4ANSA

Structure of l1196m,g1269a double mutant anaplastic lymphoma kinase in complex with crizotinib
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
309
structure length
293
Chain Sequence
NPNYCFAGKTSSISDLKEVPRKNITLIRGLGAFGEVYEGQVPLQVAVKTLPEVCSEQDELDFLMEALIISKFNHQNIVRCIGVSLQSLPRFILMELMAGGDLKSFLRETRPRPSQPSSLAMLDLLHVARDIACGCQYLEENHFIHRDIAARNCLLTCPGPGRVAKIADFGMARDIYRGGCAMLPVKWMPPEAFMEGIFTSKTDTWSFGVLLWEIFSLGYMPYPSKSNQEVLEFVTSGGRMDPPKNCPGPVYRIMTQCWQHQPEDRPNFAIILERIEYCTQDPDVINTALPIEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ALK TYROSINE KINASE RECEPTOR
publication title Structure of L1196M,G1269A Double Mutant Anaplastic Lymphoma Kinase in Complex with Crizotinib
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 96
structure length 293
sequence length 309
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2012-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4ansA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4ansA01
3DBDA 2WMVA 2XNNA 4LRMA 3OOGA 4ZXTA 5FEQA 5AAFA 5HTCA 3HV3A 4IH8A 2XK9A 5CF8A 2QQ7A 3CP9A 1GY3A 4PL4A 5L8JA 4AT5A 3MB7A 1NA7A 2BRBA 4BBFA 4JDIA 2HWPA 2ETKA 3TI1A 3IGGA 4PDYA 5ETAA 3QHWA 3KK8A 4NSTA 4BYJA 4FG8A 1BL6A 4NTTA 4E4LA 1VJYA 1YXSA 1OMWA 4L01A 4IWPA 4CLIA 3BHVA 3LFSA 4Z55A 1W0XC 3FKNA 2WEIA 2A1AB 1U5QA 3F5PA 4J53A 1O6LA 3POZA 1JWHA 1OZ1A 2V0DA 2YM7A 2YCFA 4BHZA 5HD4A 5HE2A 2YM6A 4R8QA 5I4NA 4YJUA 2WMWA 4FVRA 4RJ3A 4WD5A 1P2AA 3GXLA 4NCTA 2C5YA 3EWHA 2GHMA 4FG7A 5DH3A 3TTJA 4QMNA 4FEUA 4EJ7A 4DG2E 4G3FA 5BVDA 5IH5A 5K9IA 1WBPA 4L3JA 5CWZA 3WZUA 2UW0A 5DNRA 3A60A 2X8DA 3ZM9A 4I0SA 4X2KA 4UMTA 2ITPA 4TYJA 4CG8A 3QXPA 1IA9A 5CU2A 5TT7A 2RFNA 5DE2A 3AT2A 1Y8GA 4TYGA 4H05A 4AW1A 4XRLA 4EEVA 3ZUTA 4DFLA 4DG3E 1ERKA 5E8ZA 1YHSA 2F4JA 3UNJA 2W5BA 3TNWA 4ZSAA 1BLXA 4ERKA 5HG7A 3TV6A 4AS0A 4D2SA 4MHAA 3WZKA 3MA3A 2WKMA 5HLWA 5CQWA 3LKMA 5J95A 5CAQA 4XX9A 4DFBA 4JXFA 4O1OA 5ITAA 4ZEGA 5FXQA 2GCDA 3FI4A 3PPZA 3NDMA 4GIHA 3ZM4A 5AADA 2PZRA 4IWQA 2PE1A 2XKFA 5DOSA 4MX9A 3ACKA 2CNUA 3UODA 3IG7A 3O0GA 3HP2A 3OP5A 4GRBA 4HVHA 4EH7A 2IVUA 3TJDA 1B38A 2VO3A 5DYJA 5EI2A 4BKZA 3OCTA 4M69A 3GCPA 2CNQA 1OI9A 4RQVA 3SXFA 4EKKA 2JKOA 3PLAE 2WMSA 2PUPA 3QU0A 4KIOA 4MXZA 3W32A 3MH1A 3A7FA 3DGKA 3E3PA 3K3IA 3HA6A 4OTWA 4ANQA 3WE4A 3CIKA 3QRJA 5EK7A 1I44A 1U5RA 4IDTA 3VULA 3ZC6A 2W17A 3VWAA 5IZFA 3N51A 4G34A 2PVKA 4TWNA 2GNGA 3QTQA 3U4UA 1KUTA 2GHLA 3EQDA 4JG8A 3F3ZA 4EORA 1FPUA 1OECA 1OIYA 3DTWA 3BE9A 4O84A 4PPCA 1JVPP 2OWBA 3Q9WA 4ALWA 1GAGA 4PX6A 3KN6A 2G1TA 3AD5A 5DT3A 2AYPA 2OICA 3DKFA 3FMLA 4FZFB 4L45A 2FSTX 3MGYA 3D94A 5DT0A 5GJFA 1DAWA 3QZGA 3R71A 3MYGA 5EYCA 5GZAA 3UNKA 4ZTMA 2FSMX 4TYIA 4AGWA 4BN1A 2ITUA 2UZVA 3F82A 3MH3A 3O50A 3UQGA 2X2KA 5AM7A 4MBLA 3WF6A 5HG9A 1ZYCA 4IAKA 2WTCA 2ITZA 2UZDA 3FL4A 4NM0A 3R6XA 4JDHA 2CGVA 4QMYA 3A99A 4JG7A 3UVRA 3ZC5A 1OBGA 3W2SA 1WCCA 3RTPA 5JKGA 3TIYA 4J8MA 4V0GA 5JQ5A 4BGHA 3PVUA 4AOIA 4ZY5A 3DNDA 4Q5EA 3FKOA 3VUIA 3W55A 3OTUA 1RJBA 2BZJA 2DUVA 2WGJA 4MXYA 4AA0A 1WAKA 3DBCA 4TRLA 3W1FA 5HIDA 5BQ0A 3VS4A 4IJ9A 2R0IA 4QMMA 4O7YA 2J4ZA 4GG7A 3OWPA 4IVBA 5M4CA 1OPLA 2VX0A 2PUUA 2VGOA 3KKVA 4D2TA 4N0SA 5J79A 5HOAA 3UPZA 4AQCA 2PULA 5F9EA 4BBMA 4F1TA 2VWYA 5K4JA 3QRUA 4BI2A 3I6WA 5DEYA 3OUKA 2OXXA 4FMQA 4F9CA 3VUGA 3UTOA 2JFLA 4CRLA 3PXFA 4BDAA 2CLQA 2R3JA 4YP8A 3RVGA 2OKRA 4A4XA 3I0QA 5J7HA 2C0OA 1R78A 4JL9A 4TNBA 3G9LX 4O2PA 1Y6BA 2PVHA 2AC3A 3PVWA 4W9WA 3T9IA 5AA9A 4FV4A 4EONA 3LW0A 2UZTA 4BRXA 4XV3A 3ENHA 3L9MA 5F1ZA 3MFUA 5JGDA 4EQMA 3BBWA 2W9FB 3ROCA 3BGQA 3F5GA 4OBPA 3UO4A 3C1XA 3EN6A 3RAKA 3R8LA 4L68A 5LVMA 4X3FC 4GSBA 2QNJA 5D41A 2PVFA 5L6OA 4I21A 2BIKB 3JVSA 2CKPA 4FTTA 5L2QA 4TZRA 4AW0A 5EM8A 3DZOA 2ZYBA 2XNBA 3P78A 1J7IA 2CLXA 2OO8X 4X6RA 4AGDA 2WU7A 4HVSA 4U45A 4U79A 3CGFA 3EYGA 5E8TA 5IISA 3E8CA 5IUIA 4NKSA 4KBCA 4TY1A 4HPTE 5FLFA 3ROYA 2WQMA 4K6ZA 3VC4A 1GJOA 1YWVA 1UKIA 2XEYA 1Q8ZA 3KL8A 3ET7A 3MVMA 4M0ZA 5HTIA 5IG1A 2QURA 5CF5A 5E8SA 5LARA 1Q24A 3HL7A 1K3AA 1CKPA 2VO7A 3QFVA 2OU7A 3Q9XA 2KULA 3R9RA 4K9YA 2HIWA 3MVJA 2RSVA 3MN3A 4AACA 4IHPA 5FTQA 4Y8DA 3A7GA 4U3YA 3P9JA 3FXWA 2F7EE 3MJ2A 2J5EA 3GU8A 1U4DA 5M07A 3KRJA 3VW6A 4C3PA 1REKA 5DIAA 4D1ZA 2YJSA 5HCXA 2QLUA 4C4JA 3D7TA 2BZKB 3QD4A 3R7GA 4FT7A 1Y91A 4AE6A 1GIHA 4F6WA 4I0TA 3A4PA 1PKGA 2NPQA 3RJCA 4CTCA 4YR8A 3QF9A 1JOWB 4OLIA 2Z7RA 3LXKA 1H07A 2YWVA 2YAKA 3W2PA 4E7WA 2XIZA 2ETRA 2IW8A 3ZSIA 3W2OA 4W4XA 3ALNA 3FMNA 5CQUA 4RJ8A 3FLNC 5CT7A 3R7YA 3FC2A 3LXPA 5IA2A 4S30A 1T45A 3H10A 4FIEA 4I22A 3CLYA 4FSYA 4ONAA 1OPJA 4A9YA 1SZMA 1OITA 3ZO1A 2OF2A 5HE0A 3G15A 2XJ1A 4RVKA 1PXJA 1YKRA 2JAMA 2B4SB 1Q8WA 4R5YA 5HLNA 2W1CA 3AXWA 3TG1A 5I3RA 2XK8A 2WQBA 2ZVAA 3NNXA 4EOSA 5JGAA 1LEZA 2OSCA 2P2IA 3CY2A 4RVMA 2C3LA 4G31A 4RGJA 1X8BA 3MESA 3AC4A 3ZBXA 2I40A 3LZBA 2UUEA 4A4OA 4OTHA 4BCNA 3UP2A 1GOLA 2O64A 3NCGA 2V7AA 2ZV2A 3MIYA 2XJ2A 4JT3A 3K54A 2R5TA 2ZOQA 4E6DA 4FL2A 3FLZA 2BAJA 3WYYA 2WMRA 4E4NA 1PKDA 3MPMA 4QTAA 2PZPA 3VS3A 4EBWA 2J51A 2OFUA 4O7ZA 1W98A 5DRBA 5JFXA 5DR9A 3U55A 2VX1A 3V5PA 2QONA 2X2MA 2PZ5A 3MH0A 3QQUA 5J5TA 5M06A 2QO9A 3R30A 2ZDUA 4XLIA 5JRSA 4OT5A 4F9YA 3OBGA 4DA5A 5HBHA 5I0BA 1UU8A 4FTIA 2P4IA 4JBOA 5A54A 3E63A 2OXDA 2WB8A 5AP3A 4EOLA 4BDJA 3TNPC 4L00A 4TPTA 3TUDA 3HECA 3LCOA 5IUHA 1G5SA 3ZLXA 4E73A 3AGLA 4A9UA 3EQIA 1YOLA 4IVAA 2UW7A 3ORMA 4NYEA 4HW7A 3JY0A 3DU8A 2F7XE 4IFCA 2Y4IC 1M2PA 4ARKA 2CN8A 4OUCA 3BYUA 3CD3A 2QOBA 4WNPA 5TKDA 3HGKA 3DT1A 3EIDA 3AGMA 5AR5A 4C3RA 4C4GA 4ZK5A 3MFSA 3ACJA 1UKHA 4FKIA 2ZV8A 2GQSA 4F99A 5L6PA 3Q96A 3LLAA 3VJNA 2E9NA 4TWOA 5EYDA 4YZMA 4KABA 1TQMA 2JD5A 2XMYA 3TIZA 4ANOA 4UEUA 5AMNA 2X81A 3IO7A 4U7ZA 3U87A 1A06A 3R8UA 3F61A 1Y8YA 2OFVA 4F4PA 3QWJA 1LUFA 3PZEA 3R8MA 5JSMA 4BFMA 2PHKA 3HDMA 1DI9A 3FE3A 4XCUA 5T3QA 4EUUA 1PF8A 5HHWA 4RX9A 3U51A 3BI6A 4XP0A 1OL6A 3MH2A 2IZTA 1YI3A 3EQRA 4QMXA 5CU4A 5CSHA 1G8AA 5C03A 2CMWA 4DTAA 1IR3A 2E2BA 2JKKA 3PVBA 3FAAA 4FUYA 3PY0A 3BWJA 3QLFA 3ZSGA 2XA4A 4U80A 4YO6A 1U54A 4FKWA 5AR8A 4HCUA 4GEOA 3GU5A 5KMKA 4MKCA 4FSRA 4CFVA 1LR4A 2A4LA 2WHBA 4IC8A 4IXPA 1P14A 4D4RA 5CALA 1EH4A 3DJ6A 2WMQA 3ZZWA 4LUDA 4QMWA 1URCA 2R3MA 4BICA 4K11A 4NW6A 2XJ0A 4UY9A 5AAGA 5JN2A 4LOPA 3KK9A 2HAKA 3I79A 4XBUA 5HU3A 5F95A 5EYMA 4PMPA 3PP0A 4IACA 3DK7A 2C6DA 1UVRA 2R7BA 3IS5A 3RALA 4DGLC 3KXXA 3OCSA 2PZYA 2IG7A 1OL5A 3BX5A 3H9RA 2JGZA 4YSMA 3HLLA 3E8EA 2HZNA 4K33A 3W16A 3U6JA 5L2WA 3GCQA 4RWJA 4YTIA 1E1XA 3VRZA 4R77A 2GTMA 3L8PA 4I6FA 4W8EA 2VTPA 2BALA 3FXXA 4PDSA 4YHTA 3VAPA 5LMKC 3HNGA 3HAMA 2WTWA 2IVVA 3NYXA 4XG3A 5EM7A 4J1RA 4YBJA 5F4NA 4AFJA 1OIUA 2W05A 4R3CA 4ENYA 3KXZA 2YM8A 3BRBA 3ORKA 2WD1A 2BIYA 4FV6A 4QNAA 5AX9A 3WZJA 4BIEA 2UW6A 3DK3A 3ZFXA 4CV9A 5CZHA 5HG8A 3BU3A 4FOBA 4OGRA 4WBBB 5GHVA 1PXIA 1ZY4A 1AGWA 3G6GA 4O0WA 5I9WA 4I6HA 5LMBA 2QOHA 1W82A 4KIKB 3U8WA 3LFAA 2QOIA 2C5XA 2YDJA 4IADA 2CCIA 3PJ2A 2IZUA 4Q5HA 4YJSA 4RJ6A 5FD2A 3V8SA 4IB0A 4MXAA 4XV1A 4L52A 1MRUA 4FG9A 3SW4A 3K2LA 3HZTA 3PP1A 4C35A 3HYHA 4FV2A 3R0TA 2WAJA 1XH8A 3MIAA 4FKPA 2OJ9A 2W96B 2UZNA 4FUXA 4IAAA 3BV2A 3A7HA 4ZIMA 3WYXA 4FK6A 2JITA 3GCUA 4NWMA 2VTIA 3CS9A 5HIBA 4YURA 4WOVA 4AE9A 3EL7A 3RK5A 4MNFA 4DEAA 2H96A 3DBQA 4U44A 4FBXA 3LFEA 4DG0E 3HKOA 3IPHA 1GZ8A 4RWIA 3DLSA 5A4CA 5I9VA 4R1YA 5FBNC 5KMJA 4RZWA 3QD2B 2OK1A 3DPKA 3NVMB 4L7SA 3HV7A 5J9ZA 3G9NA 4RC4A 2R3FA 4YO4A 5M09A 5FEEA 2FGIA 3R8ZA 5AX3A 1NT2A 1JSVA 2Z7SA 5EDPA 3NYOA 5HLPA 1OUKA 3D7ZA 4HYUA 1HCKA 3C5UA 4PQNA 4E8AA 3QUEA 3ORXA 5HBJA 2YN8A 4BZNA 2EXCX 3TTIA 4KSQA 4Y95A 3LQ5A 4RIYB 2J0LA 4PV0A 4BIDA 3K5VA 3TNIA 4ANNA 4FEVA 4GK3A 1F5QA 4E26A 4I4EA 3SKCA 5EG3A 1BI8A 2UW5A 2VU3A 3CGOA 2XEZA 4GVJA 3LIJA 4D58A 4E6AA 5M4UA 1FMOE 4FTUA 3TV4A 2OJGA 4FTAA 4FNYA 4QRCA 3PXZA 4C57A 4D4VA 3RCJA 5HI2A 1QMZA 4C7TA 3ZLWA 4S34A 2ITQA 4IAYA 4AU8A 1PHKA 4G5PA 4LL5A 1YI4A 5CI7A 2F9GA 2ONLC 2ZB1A 4PUZA 3QQGA 4G3DA 3QTIA 3AC1A 5EOLA 3WARA 3KU2A 3DZQA 2HZ0A 4QPSA 3V5WA 1H0VA 2J90A 2Z2WA 3JY9A 4XG7A 3BHYA 3LXLA 4Z9LA 4E6QA 1H1QA 3GEQA 4U42A 4F65A 5A4QA 1ZMVA 2O5KA 2JLDA 2XKEA 3NW6A 4JG6A 4LUEA 3PJ3A 2XK4A 2FYSA 3CPCA 1WBOA 5CU3A 5HGIA 2VTMA 1PXLA 4L6QA 2YIYA 4OTDA 4DBNA 4G3EA 5H2UA 1XH6A 4F0IA 3FBVA 3CQUA 4NM5A 4U40A 4CD0A 4F9WA 4XH6A 3C50A 3LXNA 5AUVA 2HXLA 2WZJA 4QQ5A 1RDQE 4YZNA 5EW8A 3TZ8A 3V01A 4HCTA 2R3LA 2O2UA 5FUTA 5BYLA 4CMUA 3G6HA 3ITZA 2QCSA 2Y7JA 3EYHA 3SOCA 4USFA 4MD7E 5DBXA 4DGOA 3NGAA 3PLSA 4L8MA 2VUWA 2C6OA 3ZUUA 2YCRA 2WMBA 2J6MA 4RX8A 3UC3A 4O0RA 1R39A 4FZAB 4WA9A 4AT4A 3KMUA 5IUGA 3F7ZA 4PTEA 1G3NA 2PMNX 3EN5A 3AQVA 3ZH8A 5BUJA 2ZAZA 3QTRA 2EXMA 3NUUA 3I5NA 4D2PA 3UBDA 3OF0A 5E8VA 4AW5A 2ACXA 2GFCA 3HV5A 3FXZA 1CKJA 4K8AA 5AJQA 3RHKA 1YXUA 4M97A 2BTRA 2J0IA 3ZYAA 3KB7A 3HUBA 2IO6A 3QQJA 2GS6A 4QP4A 3C4CA 3TJCA 4JQ8A 4OT6A 4QNYA 5AM6A 5IDNA 2I0EA 2VO0A 4FKJA 4C2VA 4WKQA 3QKKA 4O82A 3P0MA 3E8NA 5FP6A 2RL5A 1REJA 2XBAA 3KQ7A 3Q6UA 1H1RA 2Z8CA 4E3CA 2KTYA 4FT0A 4G3CA 3OXTA 3TEIA 1J1BA 4MNEB 4O22A 5HNIX 3HRBA 1HOWA 4JLCA 5CAOA 5CEOA 2PVLA 2EVAA 1YHWA 2VTRA 4YTCA 2VTLA 3ZZEA 1M52A 2ZM4A 3DXQA 5ICPA 1KV1A 1NY3A 3VF8A 2XIYA 4CKRA 3QUPA 3PIZA 4RJ4A 4YU2A 3C0HA 5K5XA 5HNBA 5KBRA 4F1OA 3ZRLA 3UZTA 3WILA 4AN2A 4FZ6A 3MW1A 4WHZA 3DXNA 3E7OA 3A7IA 4QO9A 5D7VA 3ZOSA 3TZ9A 4IZ5A 3E87A 4FL1A 4RBLA 3FL5A 5EDRA 3I4BA 4DH1A 3LAUA 2BROA 4YJVA 4ITJA 3SGCA 4M66A 3DB8A 4A06A 4LV5A 4I0RA 5CXHA 2ERKA 2O65A 1SVGA 1BL7A 3OZ6A 4KIKA 2V22A 3P86A 3R00A 2XCHA 2Q0NA 3FYJX 2CDZA 5IH6A 4C33A 3DAJA 3UPXA 5KX8A 2W1DA 4ZP5A 3AC3A 3VUHA 4O0UA 3TWJA 2J0JA 2J0KA 5M44A 2C6TA 4O96A 1YOMA 3Q2MA 3LHJA 3VW8A 3OVVA 3ZSHA 4CGAA 4UWBA 2B9HA 4RIXB 4JBQA 4FYOA 5DA3A 3HP5A 5DR6A 3R73A 5J9LA 1ZYLA 3DFAA 5AIKA 2ZB0A 3SRVB 3F5XA 4HVGA 5BPYA 4AT3A 2YZAA 4AZEA 2QKRA 4AA5A 2AUHA 2WOUA 5ETCA 5KMIA 4RJ7A 4J52A 4X2FA 5G6VA 3D0EA 3SDJA 2FO0A 4C02A 3C4FA 2I0YA 1MQ4A 5E8YA 3ORLA 5HICA 4I41A 4J98A 1H4LA 4V01A 3KRRA 4BC6A 5EKOA 2UW3A 5J9YA 2JBOA 4HGSA 4IB1A 4MK0A 4X0MA 3KY2A 3VUTA 2PVMA 3C0GA 3HMMA 4RPVA 2OBJA 4FV0A 4FVQA 3NNVA 2VWVA 5AV4A 2C6KA 1FQ1B 3F7WA 4L67A 3MPTA 3DAEA 4XLVA 2F7ZE 4YZ9A 4HYIA 3ZRMA 1WMKA 5AR2A 2QU6A 4E6CA 1Z57A 4IMYA 5HVKA 4GT3A 4K18A 4Y5QA 5D11A 2H9VA 3BBTB 4GMYA 4RIYA 1QPJA 3AT3A 3FZPA 3IW6A 3QRKA 1OPKA 5AV2A 2DS1A 3G0FA 3LQ3A 2X7OA 4O83A 5AUZA 1T46A 1PYXA 1Q3WA 1WBNA 3AMYA 5CNNA 5J7BA 1B39A 2OI4X 3P23A 2YISA 3A8WA 4FKQA 3GOKA 4BYIA 4OAVB 4EC8A 2BAKA 5CEQA 4BI1A 3QRTA 5IA0A 2NNWB 3ZCLA 4G6LA 3ZFYA 4U97A 2W5HA 4JJRA 3ODZX 4PNIA 5FBOA 1ZMWA 2JC6A 2FSOX 4P7EA 1OIQA 2PE0A 4G9CA 4USEA 2VTTA 3AMAA 5CSWA 5BYZA 4FVPA 4C61A 4DF3A 5DWRA 5A6OA 5DN3A 5E90A 4EH3A 4MF0A 1TQIA 4EUTA 3V8WA 2WQOA 1Q8TA 1AD5A 2WTKC 2X4FA 2YCQA 3O96A 4FV3A 4TWCA 3VS7A 3KF7A 3DQXA 3TNQB 3HAVA 3Q9ZA 2W7XA 3FQSA 4NIFB 4NT4A 4CT2A 3QGWA 4EHEA 2GPHA 3TT0A 1H0WA 4BDEA 4QP6A 4KBAA 4X3FB 4FTNA 3TCPA 5BVNA 2QKWB 5JQ8A 4RA4A 3PA5A 4QT1A 3TV7A 4BKYA 4CTBA 2QHMA 2UVZA 3E64A 4G9RA 2VTOA 2B1PA 2X9FA 4ZY6A 3RNIA 5HESA 1WVXA 3C4ZA 3I1AA 4R3RA 4D1XA 4A9RA 4WNOA 4BCMA 5CEKA 5D12A 3CE3A 5D1JA 2E9UA 5D9HA 3DTCA 5FDPA 1JKSA 1PMUA 4AZWA 4FT9A 5GNKA 4FT5A 5JFVA 3OT8A 2R64A 1JKTA 3LCKA 5I9YA 1S9IA 3IK3A 3L9LA 1JLUE 3GNIB 1LEWA 4QP7A 3RPSA 3Q4CA 2WMUA 3VBWA 5EI6A 4CEGA 2G01A 5CANA 4O27B 1XHAA 3O2MA 4ZSGA 4BDDA 2CGXA 4BI0A 5IQEA 4Y72A 3HRFA 3D5XA 3PYYA 4D9UA 1JSUA 4EHVA 3CKXA 3HDNA 4FR4A 4KKHA 1OM1A 5HO6A 2ZM3A 4ORKA 3A62A 3SV0A 2BKZA 3FMKA 3UQCA 2HCKA 3DDPA 3VQUA 3M2WA 3T8OA 4CXAA 3OWKA 3FV8A 3VBYA 3ZMMA 4TXCA 2BHHA 3M1SA 3EKNA 1FMKA 4BTFA 3QKMA 3OXIA 4TTHB 5C8MA 5AP1A 2DQ7X 2XM9A 3QGYA 4GFGA 4I3ZA 3W8LA 4DLJA 2XUUA 3VN9A 3LLTA 1IASA 4EJNA 3VRYA 2PVNA 4M8TA 5CVGA 2BMCA 1RE8A 3W2CA 3BU6A 2UZEA 3Q4TA 3UIUA 3LOKA 4NU1A 3OBJA 4Z16A 3O7LD 4MEDA 3CEKA 4P4CA 1BX6A 4NKAA 4YJOA 3VQHA 3VBVA 4FEWA 3DA6A 1IEPA 2GU8A 3D2KA 4IANA 4KS8A 2YZLA 4O7VA 1H27A 5B2KA 3KF4A 2VWZA 5AP5A 4ZLYA 3JUHA 4FODA 4AA4A 2YDIA 2B53A 4N6YA 4AOJA 3FQEA 2WMXA 3OC1A 4JOAA 4XBRA 5AV0A 1O6YA 2W1GA 5CI6A 5L4QA 5I9UA 4HNFA 4MD8E 5HZNA 4DH7A 4EZ3A 3KMWA 3BEGA 4LGHA 4IEBA 3PJCA 5IEVA 4PMMA 3W2QA 3P7AA 3G5DA 1W84A 5GIPE 1U59A 2QLQA 3COIA 2B7AA 4AN9A 4E5WA 3U6IA 2BRNA 3COHA 1IRKA 4EYJA 5EHOA 5FXRA 4PL3A 1GIJA 1H28A 4QMPA 4W8DA 3R22A 4RLLA 4EH2A 4AZVA 2B9IA 3JS2A 4MQ2A 1H25A 4V04A 4ZTNA 3KRWA 2XK7A 3RWPA 4FE2A 5CTPA 4FSNA 3OD6X 4M67A 4B8MA 1YDRE 4FEXA 3D83A 5DGZA 4CCBA 4C4EA 1V0PA 4LMNA 4E5BA 2W4KA 3EFKA 4IZ7A 2X8IA 3FLYA 5E1EA 5E7RA 2QG7A 3R7EA 5CLPA 3BPRA 3V3VA 3W10A 4X2NA 3G0EA 4DFNA 4CNHA 2XNOA 3NX8A 1YQJA 3ORNA 2R7IA 2I0VA 3RHXA 3UG1A 4D4YA 5IH4A 3PG1A 4DBXA 5AUXA 3LFBA 3WF9A 4FICA 3NIEA 4PY1A 2GNLA 5TE0A 4X2GA 2HY0A 3KFAA 3MY1A 3BU5A 3SRVA 2I0HA 3BKBA 5A14A 5KMMA 2W1FA 2XBJA 3S00A 5D10A 3UOHA 4BCQA 1YWNA 3KXHA 4XOYA 5HVYA 4BY9E 2WMTA 4KRCA 2C30A 3DK6A 3F3UA 3KRLA 5HEZA 4GK4A 4NM3A 4DH8A 2WPAA 5GZ9A 4PTGA 2R3KA 2Z60A 2Y4IB 4HYHA 2RFEA 4MD9E 3B8QA 3ORPA 5AV1A 5C8NA 2JDVA 2VWBA 4OTQA 5DR2A 3JVRA 4ALUA 5LQFA 2VN9A 3QA0A 4M7IA 4ACCA 5L6WL 5HIEA 3T3UA 2DYLA 2CKEA 3GENA 4N6ZA 1W83A 2R3GA 3F88A 4F7NA 2IZRA 2PSQA 1FGKA 3W33A 1XBBA 1FBNA 3VS1A 3JYAA 2W0JA 5BMSA 2FB8A 3E93A 3VJOA 3QQFA 2ZM1A 3DV3A 3EL8A 4D0WA 2IWIA 2J5FA 4BCJA 4IZAA 3DXPA 3DQWA 4IX6A 5IA5A 5C27A 3VNTA 4S33A 5E4HA 3N4VA 2E9OA 3SAYA 4C58A 2OJIA 3CPBA 4TWPA 3ZLSA 1MRVA 3JXWA 4FEQA 2YIWA 2XB7A 5CEIA 4YJQA 3ZO2A 2W06A 3FWQA 5E8XA 4CZUA 3LMIA 3HMIA 4QTEA 3LFDA 4F0GA 4CFUA 1M2QA 1Z5MA 3FPMA 2UZWE 4DH5A 2RIOA 3QCXA 2R4BA 2NRUA 1XBAA 3NS9A 2PMOX 3QCYA 5CVFA 1TQPA 3DFCB 3P7BA 2ETMA 1KV2A 4FC0A 5AFVA 4WG3A 3TKIA 3RM6A 4I5PA 4QP2A 5EW3A 5EQEA 4H1MA 4JAJA 4ASXA 2XVDA 1M17A 3RZBA 3JR1A 1KE5A 3S95A 1QL6A 4H36A 1A9UA 3FLSA 4NIFA 4P90A 4DTBA 2H6DA 3PY1A 4OBQA 4TKSA 4X3FA 4I4FA 1ZYSA 4RIWB 3UNZA 3B8RA 5IKWA 3COKA 3SG8A 1H1WA 4U9AA 4HVIA 2XRUA 3RCDA 4DGMA 3VUKA 3HUCA 2QOOA 3TXOA 4CKIA 4IB5A 2X7GA 1UA2A 2BAQA 1CMKE 2XYUA 3O8PA 4L7FA 4X2JA 4B4LA 2XM8A 4FI1A 4DAWA 4FK3A 3IDCA 4AFEA 5TR6A 3DKCA 4H3PA 1PXPA 2JKMA 4K1BA 4DEHA 4BWKA 3QTUA 3A7JA 3QTZA 2PYWA 3TDWA 3NNUA 2VRXA 1KE8A 3LPBA 3QXOA 4BBEA 4ZSLA 2B9JA 1NVSA 4K2RA 3KREA 2W99B 1KOAA 4FTQA 1ZYDA 4DE4A 5CASA 1ZOGA 4MH7A 2R0UA 3PDTA 3EZVA 3PA4A 1OL7A 4DEBA 3KMMA 1S9JA 1YXXA 3WF5A 4KIPA 4RFYA 2XNPA 3NZ0A 3SC1A 2R3QA 3S3IA 2BTSA 3BEAA 3OUNB 1L8TA 4D55A 3WIGA 4GUEA 4EHZA 2XP2A 2W1ZA 4W4YA 2QG5A 2A0CX 3IDBA 4J8NA 5JRQA 2H8HA 2IW6A 2ZMCA 4PDOA 4WRSA 1P4OA 4R7HA 2OIDA 2QI8A 1VYWA 3ULIA 4HGEA 3QTXA 2C1AA 1OBDA 4A9SA 5I9ZA 4I6BA 5AUTA 3NUAA 4XNEA 2P0CA 2R3HA 4OR5A 5CAUA 5EI8A 3CTJA 4H1JA 1H24A 3BCEA 4OW8A 3KGAA 5ACKA 5HQ0A 2JBPA 4FKRA 5IA1A 5IEXA 3FHIA 3NUPA 4O7TA 1Q41A 2VTAA 2GS7A 3ZHPC 4PMSA 3FLWA 3AC5A 5AP2A 3VBTA 2B52A 2WEVA 3NVKI 3D15A 5C01A 5FTOA 2VAGA 1P5EA 4QD6A 4YTHA 4ALVA 4ZMFA 4BF2A 5HCYA 1NW1A 1QPEA 4MXCA 4U6RA 2BUJA 4LOQA 4ZTRA 5D7AA 2X1NA 4FV8A 4OTIA 3LCSA 3NUNA 2XIKA 4C36A 5L8KA 4UBAA 4O7WA 3GU4A 5IQBA 3KCFA 4L53A 4ID7A 4JQEA 1QPCA 4JI9A 3O8TA 3OS3A 4ERWA 5TF9A 5AUYA 4O0VA 1Y57A 4G17A 4QQJA 4FV7A 3QX4A 4IB3A 4Y85A 5E1SA 5DHJA 4AF3A 3B2TA 3F2NA 4AG8A 4DC2A 1XKKA 3SXRA 2O8YA 3MPAA 5AR3A 4YLKA 3LFCA 3Q53A 2YAAA 3VF9A 4AP7A 4CRSA 1JKKA 4AZFA 3E8DA 4ZTLA 4GUBA 5ANOA 4O6LA 4D5KA 3ATSA 4FX3A 4F6SA 5A9UA 4XRJA 3EQBA 3NYNA 3PUPA 1K9AA 4UXQA 3TZ7A 4DFXE 1JAMA 4QPMA 4XJ0A 1IG1A 4QYHA 2CNVA 3IQ7A 4RG0A 5E8UA 4F7JA 2QOCA 4KBKA 4ZTSA 4PNKA 4EC9A 4F9AA 3CJFA 5K0XA 5B0XA 4RJ5A 1XH5A 4XEYA 2PU8A 4ENXA 1KE6A 1YW2A 3UE4A 4DEEA 2YCSA 4YC6A 4FIIA 4AOTA 3DDQA 3CY3A 2WQEA 4XV2A 4F1MA 3V5LA 1Z9XA 4YJTA 5C9CA 5LJJA 4HGTA 2YACA 3PE2A 4O1PA 1L3RE 3R1QA 4RRVA 2I1MA 3MTFA 4PP7A 5A4LA 2BZHB 4I24A 2VWUA 3H9FA 3I60A 3LFFA 3QUDA 4Q9SA 4ZS0A 3ZTXA 4CYIA 2E9VA 1FVRA 2ZV7A 1H1SA 2HWOA 2IVSA 2XYNA 4JX3A 3IDPA 4FL3A 1ZYJA 3NW5A 3PWDA 2HENA 2OH4A 2YIXA 3S1HA 4IFGA 4EQUA 3R8PA 3EQFA 4RVLA 4GIIA 5KE0A 3MI9A 1P4FA 4X3JA 4CSVA 4JIKA 4FZDB 3NPCA 4IWOA 2WQNA 2XH5A 4LL0A 4NW5A 5HE3A 1V0OA 3II5A 4FT3A 3EMGA 2QODA 2YEXA 1FOTA 3BV3A 3R1YA 2ITVA 1PXNA 5LWMA 2CKQA 1LPUA 5H8BA 1YWRA 2CPKE 3ZLYA 5HNGA 4AAAA 5I9XA 2P33A 4BCHA 2HZ4A 4Z7GA 2XK6A 4FF8A 3BYSA 2X6DA 3PWYA 5JZJA 4ITIA 4RWLA 2PWLA 3ERKA 4ZMEA 2ZDTA 3LJ2A 5AWMA 2I6LA 3MS9A 1VR2A 2GSFA 4GYGA 4QMSA 2C6IA 4B9DA 4NEUA 4R1VA 3GVUA 2E9PA 5EHYA 3PG3A 3W2RA 4EH4A 4S2ZA 4LMUA 4RIWA 3AOXA 5CNOA 2BCJA 3QYWA 4W4WA 3GC9A 4ITHA 3RGFA 3WF8A 3PRIA 1O9UA 1RW8A 2C69A 4RMZA 3UYTA 4EHGA 1UNHA 1Q3DA 3BHTA 4O0YA 4UZDA 4D1SA 4CCUA 1J7LA 3PY3A 3MVHA 4RVTA 2QU5A 3C13A 3C7QA 4DINA 4UMRA 1M14A 4YHFA 4A4LA 4QQTA 1STCE 3U9CA 3BQRA 1BI7A 3PPKA 3R21A 4C4HA 1H26A 4L44A 5EM6A 4RA5A 3EOCA 5AA8A 1ZZ2A 2PVYA 3D4QA 3L9PA 4NJDA 4ANLA 3RAIA 5CU0A 3LQ8A 2BFYA 5IA4A 5EQPA 5M4IA 1E1VA 3EQHA 1UU3A 5T68A 5GZ8A 3V5TA 4QTCA 1NVQA 2HELA 1AQ1A 4DCEA 3UO5A 4DT9A 4C34A 4UMPA 1J1CA 2VNYA 5ETFA 5KZIA 1MQBA 1ND4A 4EK8A 2WTDA 1WVYA 2HY81 3FC1X 3Q04A 3THBA 2UW4A 3ZXZA 2RF9A 5GINE 3PSCA 2C3KA 2XIRA 2ZV9A 4ASDA 5CXZA 4O86A 4XP3A 5TO8A 2B54A 3D9VA 2CGUA 4XG8A 4F0FA 2OJJA 2PE2A 3Q32A 1V1KA 3FY0A 2P55A 3D5UA 3MBLA 4FTLA 3TKHA 2PVRA 4Q9ZA 4CFWA 1H01A 3GP0A 4O91A 3V51A 4L9IA 5KKRC 4FV9A 4Y83A 3RNYA 2VTSA 4FTRA 4QMQA 1PRYA 5BUEA 3ATTA 1R0PA 3HMOA 3ANQA 3I7BA 2WTIA 4CMOA 2IZSA 3OCGA 3OMVA 4QMOA 4UWYA 4ZZMA 3PJ1A 1VZOA 3H4JA 1BUHA 3GCSA 3EFJA 4JR3A 5FDXA 5ANDA 3B2WA 5J5SA 3CTQA 4EOIA 3QA8A 1H1PA 1ZRZA 1CKIA 2WO6A 4FV5A 4J7BA 4DT8A 4M69B 4BTKA 1DS5A 4MQ1A 4ZAUA 3F3VA 5C8KA 3GC0A 3QWKA 3TUBA 5FWKK 5A4EA 3P4KA 3N4UA 4GYIA 3OY3A 2GNFA 3FI8A 2HZIA 3QQKA 4FKTA 4JBPA 4EK3A 5EKNA 5C26A 3S4QA 3F6XA 3V04A 3I5ZA 5JMSA 3ZFMA 3OCBA 4RSSA 5DMZA 4JR7A 3KVWA 2C4GA 3O23A 4DGGA 3H30A 4FSUA 3UIMA 3RK7A 5M4FA 4EH8A 4YC8A 4I92A 1GNGA 1WBWA 3O17A 3S0OA 4AGCA 5AUWA 5BNJA 5E9EA 5HD7A 4FIJA 3FZ1A 4G1WA 5CT0A 4QMUA 2GS2A 4EKLA 3SD0A 3R9NA 1W7HA 4U43A 3R2YA 3EB0A 2Y8OA 4RFMA 4H39A 2NO3A 1QCFA 5EQYA 3PZHA 4R7IA 5CZIA 5BVFA 2X39A 2B0QA 3QRIA 5CVHA 5I3OA 4O38A 4USDA 3RINA 3TUCA 2IPXA 5DG5A 4QMLA 4E1ZA 4YJNA 1JSTA 3C0IA 1PJKA 2JDSA 2JAVA 3R28A 5ANIA 4F70A 2G2FA 5CSXA 4AWIA 2WTKB 2V5QA 4AZSA 5DRDA 2X6EA 1HCLA 4UN0C 4DYMA 3QCQA 4IX5A 2UZBA 3DKOA 4XG6A 4GVAA 3PJ8A 4L42A 3LM5A 4ZTQA 4OTGA 4TN6A 3ULZA 4QYEA 5B2MA 4C4IA 5B2LA 3ALOA 5M56A 3DS6A 3E92A 4B99A 5L2SA 4NCTC 3FMMA 4YPDA 2F2CB 4FIFA 3R9DA 3BIZA 4FNWA 3VHKA 3QD3A 4ZS4A 3LE6A 4PPBA 4AX8A 3RAWA 4J97A 3IONA 4QOXA 4HCVA 3UMWA 4JRVA 5JH6A 4MWHA 2WELA 3QL8A 3W18A 4RWKA 4WBOA 4I94A 4B7TA 3EFLA 3CJGA 5KMLA 3IW7A 3VS0A 4WO5A 4E93A 5M57A 4FGRA 4EOPA 4FSZA 4GK2A 3PXYA 2VNWA 3G2FA 4O21A 4IC7A 5DI1A 1OKWA 3MSSA 3UDBA 3R04A 4PTCA 4NK9A 4WUNA 2JIVA 3RI1A 4CZYB 4ACDA 4N57A 3CR0A 5BVWA 2PMIA 1M7QA 4E4MA 5IA3A 5EFQA 4ANSA 3OXZA 4FTKA 4S32A 4U0IA 3EH9A 3SG9A 2WTVA 2C6LA 2BRHA 4H58A 4KB8A 4V05A 4X21A 3NMUF 3QZIA 4BZOA 3A4OX 4WG5A 2NRYA 5E8WA 5LOHA 3OY1A 4O7SA 4G5JA 3GU7A 3OWJA 3NWWA 2C0TA 4E20A 2OH0E 1GIIA 1Q61A 3FMDA 4QMVA 4QQCA 2C6EA 3MWUA 5HX6A 2ITNA 2EXEA 3LJ1A 4O6EA 3BWFA 3RPYA 5EH0A 4BGQA 4IE9A 1PY5A 4WT6A 4U41A 4EOOA 3DNEA 3BHHA 1JQHA 4J71A 4BTMA 5BX0A 3GB2A 2YA9A 3TDVA 3TNHA 4DEDA 3E3BX 4YJPA 1PMEA 2YERA 4O0SA 3SHEA 3L8SA 5HORA 1Q8UA 4M12A 1VYZA 1ZXEA 2WNTA 1PMVA 3O8UA 1XWSA 2F2UA 1XJDA 3IW8A 5CAPA 4TL0A 2GFSA 3F3TA 2IN6A 3P5KA 1PMNA 3EZRA 3F66A 4QP9A 1XH7A 2G15A 3UOLA 3D5VA 2P3GX 2FUMA 3UGCA 5J8IA 5LVPA 4D2VA 2VO6A 3OROA 4H3QA 4D0XA 5CEPA 3VS6A 4BTJA 3H0YA 4MF1A 3ZS5A 1ZY5A 4F09A 1UU9A 5IQHA 3KXGA 1WFCA 4BKJA 2Y6OA 3HV4A 1KOBA 4FNXA 2R3OA 4DH3A 1VEBA 4BZDA 3FYKX 3FMJA 2GNHA 1OL2A 4U5JA 4EOKA 3D7TB 4FKVA 4EWQA 4LI5A 4PL5A 5HCZA 2PY3A 3PXRA 5BYYA 3FZTA 4DEGA 2ITTA 3VO3A 3BZ3A 1R1WA 3G33A 4KSPA 4P5QA 5G1XA 3I81A 2QHNA 4C37A 2QC6A 1ZOEA 4ZOGA 2C3JA 3T3VA 1ZLTA 3QLGA 3ZO3A 3HX4A 3P7CA 4R7BA 4G6NA 4YNEA 3REPA 2R3RA 3CQEA 4I5CA 1YOJA 4UB7A 1BMKA 4FNZA 1Q99A 3DJ7A 3EFWA 4R6VA 3ZDIA 4ZTHA 4C8BA 1ZAOA 3MY5A 4ZY4A 4CFXA 4FTCA 4FSMA 4I5MA 3EKKA 4TYHB 1APME 3BYMA 2F57A 3BLHA 3RWQA 4FV1A 4IM0A 4IAZA 4KINA 4B6LA 3NSZA 3F3WA 4OAUC 4G6OA 3DB6A 4CFMA 5H8EA 4LQMA 3LCTA 4C59A 4ZJVA 4DFUA 3V6SA 4FA2A 5K4IA 4HZRA 3ORZA 3K5UA 3EN9A 4ACGA 4CFNA 3FQHA 3L1SA 4W9XA 1ZWSA 2ZJWA 5F94A 5LVLA 4QP1A 3BLQA 3QTWA 5AR7A 4DEIA 1XO2B 3P08A 4L3LA 3AG9A 4FSTA 5IQFA 2V62A 3O51A 4R5SA 4EOJA 1ATPE 5EW9A 2R3PA 4D28A 4DGNA 1SNUA 3BGZA 3FLQA 3LCDA 3QZFA 1MUOA 2EWAA 3WI6A 5M51A 2BKKA 5I5ZA 3MB6A 5JGBA 2RFSA 3OFMA 4EH5A 2QOLA 5HE1A 3F9NA 5JZNA 3PSBA 3QHRA 4JS8A 3Q52A 4DCAA 2BDWA 1URWA 1XH9A 2EB2A 3R7VA 1YDSE 1UU7A 2BDFA 5KHWA 2C3IB 3TZMA 5FTGA 1J3HA 5B7VA 4RC3A 2DWBA 3QC9A 4MCVA 1KE9A 3FKLA 3IECA 4U8ZA 4IAIA 3TKUA 4MNEA 1DM2A 2OG8A 2EU9A 4XS2A 4ZLOA 5CU6A 4KWPA 5AP6A 4IVDA 4X7QA 3ENMA 4K77A 3DY7A 3SLSA 3KULB 4LFIA 3NAYA 5FXSA 2JKQA 3CC6A 4GT5A 2Z7LA 5K0KA 3S2PA 3FZOA 4EK4A 3SA0A 2QOKA 1FVTA 4AN3A 5HU9A 4HGLA 4IBMA 4XP2A 3AD6A 3TN8A 5LWNA 4UX9A 5H3QA 2PPQA 2OJFE 4NTSA 2PL0A 4F6UA 2J0MB 4OBOA 5EDQA 4YMJA 2J7TA 2A27A 2B9FA 1UNGA 4AGUA 2QR8A 4IW0A 5KMNA 2PMLX 2QVSE 2W1IA 4DFZE 4O0TA 3VBQA 4DHFA 5AEPA 2W9ZB 2YLEA 4NFMA 5GIOE 3OW4A 4J99A 4RIOA 4IAFA 3R9OA 3TM0A 4FOCA 1OUYA 2BRGA 2VD5A 4FTJA 3VUDA 4AZTA 2WIPA 5ANKA 3L8XA 4ACMA 1M2RA 3BQCA 3HA8A 3KCKA 4I20A 3PRFA 4PRJA 4BDKA 2VX3A 4XOZA 2VZ6A 5JFSA 3GI3A 2X0GA 3FSKA 4GS6A 1H8FA 3GBZA 2C47A 2FH9A 3BELA 4KD1A 1U54B 3GC8A 2VTQA 3NEWA 4RIXA 4DFYA 5KO1A 2V7OA 4YLLA 4DLIA 1OKYA 3ZEPA 4OTPA 4FKGA 5EYKA 3WIKA 4I93A 3JPVA 1YHVA 2CJMA 4I5HA 5AP4A 5J87A 3R7OA 1J91A 5AIRA 5IQGA 3UC4A 4WSQA 2UZUE 3VS5A 2GHGA 4CMTA 4XV9A 2YIRA 3Q9YA 2PTKA 2W4JA 3Q5IA 2Y6MA 5LMAA 4QP3A 3D2IA 3COMA 3UOJA 2RGPA 4F7SA 4FYNA 1PXOA 4IIRA 4JIAA 3P79A 4BL1A 5AAEA 1IA8A 4O7NA 2WTJA 4HVDA 4FKSA 3QQHA 4PMTA 1A48A 5FEDA 4NL0A 2BR1A 4GJ2A 2CCHA 3FPQA 4EWHA 1R3CA 3U54A 4KRDA 3VBXA 3T9TA 2UW8A 3IGOA 4WRGA 1G8SA 3RPVA 5FQDC 3KC3A 2OIQA 3R2BA 3N4TA 2CHLA 2OF4A 4CZTA 4GCJA 5CAVA 3R01A 4GFOA 2ZMDA 3N9XA 5H9BA 2GNIA 3C4WA 4NUSA 5KUPA 3ANRA 4MBJA 4EBVA 3HVCA 3Q4UA 5KZ0A 5DFPA 3RZFA 4IWDA 2Q83A 2X8EA 2O3PA 4FTOA 4M0YA 4CQEA 3K3JA 2BFXA 3KN5A 5IQIA 4M3QA 3EQGA 3OT3A 2OXYA 4R78A 3M11A 2QO2A 4GJ3A 4C62A 3RP9A 4BDCA 1YVJA 1Q8YA 4JAIA 2YDKA 4MXOA 3UYSA 4HYSA 2BZIB 5ANJA 2WU6A 4FGBA 4BCGA 1ZMUA 4JDKA 3GGFA 3I7CA 4CQGA 2YLFA 1JBPE 3IOKA 3L9NA 5A6NA 2OGVA 4FSQA 3WE8A 2VTHA 4GFMA 4IQ6A 3UVQA 4IDVA 3U6HA 2QOQA 3BHUA 1Q62A 2JIIA 2UV2A 3FI3A 3R7UA 2W5AA 3OHTA 4RX5A 5LXMA 3UVPA 3HMNA 3UP7A 4Z7HA 4KAOA 3LM0A 4ZJJA 4CFFA 3SW7A 3NIZA 4QYGA 2B55A 4TYHA 3ZEWA 1IAJA 4DTKA 4CT1A 4YBKA 1Q4LA 3GOPA 4WNKA 3LVPA 3CQWA 1OKVA 4D4SA 4YTFA 4YSJA 5KCVA 5KHXA 4UWCA 5DVRA 4BWPA 1PXMA 2OW3A 3R63A 4GG5A 3RM7A 3UZRA 2XF0A 3FI2A 4FIGA 4C38A 4Y73A 3FY2A 1NVRA 2Q0BA 5EHLA 3V6RA 2Y4PA 4YNOA 4NZWB 3H3CA 3DBFA 3ZXTA 4RFZA 2AC5A 5HO7A 2R3NA 1CM8A 2BDJA 5M55A 3RBWA 4CLJA 3R1SA 4IX3A 4EH9A 5LVOA 3UG2A 5M53A 2GDOA 4D2RA 3CSVA 4M13A 5A3XA 2XKDA 4NFNA 2C5VA 3HRCA 4F7LA 4WNMA 3VIDA 5HTBA 5CYIA 2X9EA 4FKUA 4F64A 1Y6AA 2WFYA 5HVJA 4O2ZA 5CF6A 4LGGA 2EUFB 4WSYA 2VTNA 2RFDA 1Q97A 4JRNA 4WG4A 2FSLX 5K5NA 3QQLA 4YHJA 1PXKA 3LMGA 3C9WA 1XH4A 3NNWA 3NW7A 1F0QA 2O0UA 4M68A 3R7IA 3GQIA 4P5ZA 5JEBA 3DLZA 1KSWA 2BVAA 1M7NA 3WF7A 4L43A 3EHAA 4CVAA 1JKLA 3AT4A 2C68A 4Y5HA 3UIXA 2X7FA 4F9BA 4LRKA 3QTSA 2BILB 3HEGA 3VHEA 2VWIA 3KULA 3FZRA 4CV8A 2UZLA 2RG6A 3F5UA 4O81A 2VV9A 2HOGA 2R9SA 4ZSJA 2PZIA 4JVGA 4I1ZA 4IX4A 2I7QA 3GCVA 5M08A 3C51A 2XZSA 3E5AA 2W1HA 3BE2A 4MAOA 1LP4A 2NP8A 2R3IA 3WZDA 3FDNA 4YLJA 5C1QB 2PUNA 4YC3A 5BVEA 3OWLA 4BIBA 3WOWA 2GNJA 1OGUA 3IOPA 1XQZA 3ETAA 3QCSA 1OKZA 3GFEA 4LV8A 4ZZNA 5JFWA 2WOTA 2OZAB 3FUPA 4UMUA 4W4VA 5CSPA 5AP7A 4RQKA 4KNBA 2XS0A 2SRCA 3QD0A 5J1WA 5KMOA 2YIQA 1NXKA 2QO7A 1E9HA 3UIBA 4O7LA 3M42A 3FMHA 1DI8A 3PPJA 4TYEA 3QX2A 4IZYA 5FG8A 5IDPA 1JPAA 1QPDA 4HOKA 4NM7A 1RQQA 4YZBA 4UV0A 3A8XA 3ZDUA 3OG7A 3Q4ZA 3LMHA 4A7CA 1SMHA 4HJOA 4UZHA 5BMMA 3EN7A 3VS2A 4A07A 4U3ZA 5IU2A 4EQCA 3MV5A 1H00A 2C1BA 3F2RA 5HO8A 1MP8A 4RZVA 4LG4A 2XRWA 3E62A 1SYKA 4O7RA 3DOGA 2ERZE 3R1NA 2YM3A 4EZ7A 2YWPA 3PA3A 1UWHA 2REIA 4KKGA 1K2PA 2HXQA 3DCVA 3QBNA 4I6QA 4J96A 1YRPA 2YJRA 5CENA 4C3FA 4DITA 2C5OA 5KKRB 4HNIA 4ASEA 1OVEA 4EOMA 4QTBA 3AC2A 3I6UA 4P2KA 4Q2AA 5HKMA 5CY3A 3C4EA 2H34A 3Q6WA 2W4OA 2ITWA 3MY0A 4LGDA 2ESMA 4QYFA 1O6KA 2YITA 4YZDA 1V0BA 2R2PA 5JT2A 4EOQA 3BGPA 5IPJA 3POOA 4PDPA 2YABA 3QC4A 4BDFA 5FRIA 2RKUA 3UO6A 4U81A 3RMFA 5IQCA 1YI6A 1CSNA 3C4XA 4S31A 3KXMA 1XR1A 5GJGA 4F08A 1YDTE 4GL9A 4PWNA 3NLBA 3DJ5A 4RC2A 3V8TA 3BLRA 4MXXA 4M84A 5F20A 3NRMA 3VUMA 1GZOA 4FKLA 4YGAA 4N70A 5ETIA 4IVCA 4TNDA 4EH6A 3IW5A 3FSFA 4UYNA 1CDKA 5A46A 5BUIA 1DAYA 5BVKA 2FA2A 3E7VA 5IF1A 3C5IA 3DAKA 3PXKA 4B0GA 4L3PA 2CGWA 3RKBA 4C2WA 4HPUE 3I0OA 4M15A 3QALE 5C4LA 5ACBC 3U4WA 3PE1A 4GT4A 3RPRA 3V5QA 3QYZA 3Q60A 4XUFA 3EJ1A 4KIQA 5A4TA 5CF4A 4YPSA 1W8CA 4TW9A 4CG9A 2JEDA 3CKWA 4KS7A 2UW9A 3TACA 4QPAA 4N4SA 1U46A 3DKGA 3IKAA 4FKOA 1WBSA 4II5A 3QZHA 3GFWA 5KBQA 3O7LB 3SX9A 3E88A 4WUAA 3Q3BA 1TVOA 3VVHA 2UZOA 3HV6A 4J95A 3KEXA 3ZONA 4ANBA 5HX8A 1FVVA 4TT7A 3G51A 1BKXA 1IAHA 4QP8A 3SVVA 1UNLA 4YZCA 3LJ0A 3PTGA 5ANGA 4BDHA 2LGCA 3ZRKA 4GV1A 4E5AX 3G90X 1SNXA 5L8LA 5HBEA 4XG2A 5LMKA 3ZUVA 4QTDA 4BCFA 4BDBA 2C5NA 2ITOA 3CD8A 3NUSA 3O71A 2OIBA 1FINA 4G2FA 5BVOA 4D5HA 3R8VA 5GJDA 3UQFA 2XCKA 3CBLA 5CX9A 2XNGA 5FM2A 4BCPA 4OTFA 1SVEA 3WZEA 4FTMA 5EOBA 4RX7A 2QD9A 4O0XA 5AR4A 2XIXA 3RPOA 3UJGA 4LOOA 2F49A 4ACHA 5KNJA 1JNKA 1GZKA 1SVHA 4BGGA 1H08A 2JDTA 3ELJA 5E92A 4JQ7A 4YJRA 4EL9A 3DBEA 3OW3A 4C4FA 3U9NA 4I23A 4JNWA 3MDYA 4BCOA 3NUXA 4BVUA 3ZBFA 4ZZOA 4UMQA 1TKIA 4EZ5A 5LVNA 5FP5A 3RK9A 3MJ1A 4B8LA 3AD4A 2LAVA 2VWWA 3PIXA 2PVJA 4L46A 3CTHA 2BPMA 3GC7A 3KVXA 1MRYA 1I09A 2C6MA 4QYYA 5DEWA 4KUJA 3MTLA 4UYAA 3GUBA 2JIUA 3ID6C 2WIHA 4CKJA 4FSWA 1ZARA 3KXNA 5DLSA 2XK3A 4BDIA 3A61A 2OZOA 5AV3A 2FVDA 3H0ZA 3MA6A 4LYNA 2EB3A 4GH2A 3SOAA 5ANEA 4K0YA 2JFMA 3D5WA 2XNEA 4BDGA 2YFXA 2QR7A 4PF4A 4GKIA 5CSVA 4QMZA 3R83A 2P2HA 5LCKA 2HW6A 4FZ7A 5DPVA 4D2WA 4G3GA 4EI4A 1KWPA 2XKCA 3CXWA 2X2LA 3WBLA 2G2HA 2UVXA 2Y0AA 4R3PA 4MYGA 5LCJA 2CKOA 4BWXA 1WBTA 4CYJA 3P1AA 3RAHA 2J9MA 1OL1A 4MTAA 4Y46A 2BHEA 5L2TA 3CCNA 5CS6A 4JBVA 4NJ3A 5E91A 3ORTA 1CTPE 3GU6A 2PK9A 3UZPA 5J1VA 3NYVA 4ZLZA 4OTRA 3EQCA 3AC8A 3R9HA 2UVYA 2OLCA 4APPA 4AW2A 3OEZA 3PFQA 2Z02A 2OZAA 5IQAA 4HZSA 4FIHA 1WVWA 2O63A 3KRXA 3TL8A 5CEMA 4NH1A 4YUQA 1F3MC 4XG4A 3Q5ZA 2BRMA 5EM5A 4BB4A 4D9TA 4EK6A 3AMBA 3BYOA 2VGPA 4BCKA 3QKLA 1WZYA 4DN5A 2PUIA 3LFQA 4GU9A 1KE7A 5HG5A 2V55A 4A9TA 4E4XA 2JDRA 4MBIA 1B6CB 2VWXA 2X4ZA 4QMTA 5IMXA 2IVTA 3PSDA 5AUUA 3PXQA 2G2IA 2ONLA 3A2CA 2WXVA 1PYEA 1YXVA 2A2AA 4UXLA 1UWJA 1OB3A 3FEGA 4IM3A 2HW7A 2GQRA 4EK5A 3OOMA 2A19B 3F2AA 4V0GB 4XMOA 4Z3VA 5H8GA 3D14A 3NAXA 4UALA 5TOZA 3FMEA 4H3BA 2YHVA 1FGIA 5K3YA 3V5JA 2G9XA 2GTNA 1XBCA 2WMAA 4IM2A 5FGKA 3EN4A 3R02A 2XNMA 4GU6A 4BR3A 3PVGA 3OEFX 2RG5A 3FZSA 5IQDA 4PP9A 2Y9QA 5JK3A 3UOKA 5L3AA 3FHRA 4JX7A 2W1EA 2GQGA 2C0IA 2VTJA 3BYVA 3IW4A 4KA3A 3UMXA 4XG9A 3ZU7A 3SXSA 4XHKB 4KKEA 4ZSEA 4JDJA 3PIYA 2Z7QA 4ANMA 2GMXA 2QOFA 3GT8A 5C4KA 3MFTA 1ZZLA 4AUAA 1OIRA 2YM5A 5AP0A 4EYMA 5T6KA 3HMPA 5IEYA 3NR9A 2CSNA 4RT7A 3L8VA 1R0EA 4IJPA 2HK5A 3ZO4A 4BHNA 1J7UA 2YM4A 4MWIA 4XYFA 1SM2A 3OTVA 3EQPA 3KA0A 4RLKA 4AXAA 4WIHA 3QAME 4APCA 2ITYA 3ODYX 1ZOHA 3F69A 2IW9A 2JDOA 1YXTA 1WBVA 4LM5A 3Q2JA 1UV5A 4LRJA 4PPAA 3GQLA 3LFNA 5FM3A 4X6QC 2J50A 4ASZA 5L2IA 3MVLA 1BYGA 1GZNA 1PW2A 3H9OA 3MFRA 2HYYA 3NCZA 1Q5KA 2ITXA 3SQQA 3FJQE 2J2IB 3NUYA 4ZJIA 3W8QA 4C0TA 4MVFA 4BCIA 4G16A 5IMEA 2IJMA 4GW8A 4GKHA 4M14A 3ORIA 2CN5A 4F63A 5DT4A
chains in the Genus database with same CATH superfamily
3DBDA 2WMVA 2XNNA 4LRMA 3OOGA 4ZXTA 5FEQA 5AAFA 2X0QA 5HTCA 3HV3A 4IH8A 2XK9A 5CF8A 2QQ7A 3CP9A 1GY3A 4PL4A 5L8JA 4AT5A 3MB7A 1NA7A 2BRBA 4BBFA 4JDIA 2HWPA 2ETKA 3TI1A 3IGGA 4PDYA 5ETAA 3QHWA 3KK8A 4NSTA 4BYJA 4FG8A 1BL6A 4NTTA 4E4LA 1VJYA 1YXSA 1OMWA 4L01A 4IWPA 4CLIA 3BHVA 3LFSA 4Z55A 1W0XC 3FKNA 2WEIA 2A1AB 1U5QA 3F5PA 4J53A 1O6LA 4DDGA 3POZA 1JWHA 1OZ1A 2V0DA 2YM7A 2YCFA 4BHZA 5HD4A 5HE2A 2YM6A 4R8QA 5I4NA 4YJUA 2WMWA 4FVRA 4RJ3A 4WD5A 1P2AA 3GXLA 4NCTA 2C5YA 3EWHA 2GHMA 4FG7A 5DH3A 3TTJA 4QMNA 4FEUA 4EJ7A 4DG2E 4G3FA 5BVDA 5IH5A 5K9IA 1WBPA 4AXCA 4L3JA 5CWZA 3WZUA 2UW0A 5DNRA 3A60A 2X8DA 3ZM9A 4I0SA 4X2KA 4UMTA 2ITPA 4TYJA 4CG8A 3QXPA 1IA9A 5CU2A 5TT7A 2RFNA 5DE2A 3AT2A 1Y8GA 4TYGA 4H05A 4AW1A 4XRLA 4EEVA 3ZUTA 4DFLA 4DG3E 1ERKA 5E8ZA 1YHSA 2F4JA 3UNJA 2W5BA 3TNWA 4ZSAA 1BLXA 4ERKA 1TZDA 5HG7A 3TV6A 4AS0A 4D2SA 4MHAA 3WZKA 3MA3A 2WKMA 5HLWA 5CQWA 3LKMA 5J95A 5CAQA 4XX9A 4DFBA 4JXFA 4O1OA 5ITAA 4ZEGA 5FXQA 2GCDA 3FI4A 3PPZA 3NDMA 4GIHA 3ZM4A 5AADA 2PZRA 4IWQA 2PE1A 2XKFA 5DOSA 4MX9A 3ACKA 2CNUA 3UODA 3IG7A 3O0GA 3HP2A 3OP5A 4GRBA 4HVHA 4EH7A 2IVUA 3TJDA 1B38A 2VO3A 5DYJA 5EI2A 4BKZA 3OCTA 4M69A 3GCPA 2CNQA 4O4CA 1OI9A 4RQVA 3SXFA 4EKKA 2JKOA 3PLAE 2WMSA 2PUPA 3QU0A 4KIOA 4MXZA 3W32A 3MH1A 3A7FA 3DGKA 3E3PA 3K3IA 3HA6A 4OTWA 4ANQA 3WE4A 3CIKA 3QRJA 5EK7A 1I44A 1U5RA 4IDTA 3VULA 3ZC6A 2W17A 3VWAA 5IZFA 3N51A 4G34A 2PVKA 4TWNA 2GNGA 3QTQA 3U4UA 1KUTA 2GHLA 3EQDA 4JG8A 3F3ZA 4EORA 1FPUA 1OECA 1OIYA 3DTWA 3BE9A 4O84A 4PPCA 1JVPP 2OWBA 3Q9WA 4ALWA 1GAGA 4PX6A 3KN6A 2G1TA 3AD5A 5DT3A 2AYPA 2OICA 3DKFA 3FMLA 4FZFB 4L45A 2FSTX 3MGYA 3D94A 5DT0A 5GJFA 1DAWA 3QZGA 3R71A 3MYGA 5EYCA 5GZAA 3UNKA 4ZTMA 2FSMX 4TYIA 4AGWA 4BN1A 2ITUA 2UZVA 3F82A 3MH3A 3O50A 3UQGA 2X2KA 5AM7A 4MBLA 3WF6A 5HG9A 1ZYCA 4IAKA 2WTCA 2ITZA 2UZDA 3FL4A 4NM0A 3R6XA 4JDHA 2CGVA 4QMYA 3A99A 4JG7A 3UVRA 3ZC5A 1OBGA 3W2SA 1WCCA 3RTPA 5JKGA 3TIYA 4J8MA 4V0GA 5JQ5A 4BGHA 3PVUA 4AOIA 4ZY5A 3DNDA 4Q5EA 3FKOA 3VUIA 3W55A 3OTUA 1RJBA 2BZJA 2DUVA 2WGJA 4MXYA 4AA0A 4I6LA 1WAKA 3DBCA 4TRLA 3W1FA 5HIDA 5BQ0A 3VS4A 4IJ9A 2R0IA 4QMMA 4O7YA 2J4ZA 4GG7A 3OWPA 4IVBA 5M4CA 1OPLA 2VX0A 2PUUA 2VGOA 3KKVA 4D2TA 4N0SA 5J79A 5HOAA 3UPZA 4AQCA 2PULA 3VONA 5F9EA 4BBMA 4F1TA 2VWYA 5K4JA 3QRUA 4BI2A 3I6WA 5DEYA 3OUKA 2OXXA 4FMQA 4F9CA 4O4FA 4AXEA 3VUGA 3UTOA 2JFLA 4CRLA 3PXFA 4BDAA 2CLQA 2R3JA 4YP8A 3RVGA 2OKRA 4A4XA 3I0QA 5J7HA 2C0OA 1R78A 4JL9A 4TNBA 4DHJA 3G9LX 2IEWA 4O2PA 1Y6BA 2PVHA 2AC3A 3PVWA 4W9WA 3T9IA 5AA9A 4FV4A 4EONA 3LW0A 2UZTA 4BRXA 4XV3A 3ENHA 3L9MA 5F1ZA 3MFUA 5JGDA 4EQMA 3BBWA 2W9FB 3ROCA 3BGQA 3F5GA 4OBPA 3UO4A 3C1XA 3EN6A 3RAKA 3R8LA 4L68A 5LVMA 4X3FC 4GSBA 2QNJA 5D41A 2PVFA 5L6OA 4I21A 2BIKB 3JVSA 2CKPA 4FTTA 5L2QA 4TZRA 4AW0A 5EM8A 3DZOA 2ZYBA 2XNBA 3P78A 1J7IA 2CLXA 2OO8X 4X6RA 4AGDA 2WU7A 4HVSA 4U45A 4U79A 3CGFA 3EYGA 5E8TA 5IISA 3E8CA 5IUIA 4NKSA 4KBCA 4TY1A 4HPTE 5FLFA 3ROYA 2WQMA 4K6ZA 3VC4A 1GJOA 1YWVA 1UKIA 2XEYA 1Q8ZA 3KL8A 3ET7A 3MVMA 4M0ZA 5HTIA 5IG1A 2QURA 5CF5A 5E8SA 5LARA 1Q24A 3HL7A 1K3AA 1CKPA 2VO7A 3QFVA 2OU7A 3Q9XA 2KULA 3R9RA 4K9YA 2HIWA 3MVJA 2RSVA 3MN3A 4AACA 4IHPA 5FTQA 4Y8DA 3A7GA 4U3YA 3P9JA 3FXWA 2F7EE 3MJ2A 2J5EA 3GU8A 1U4DA 5M07A 3KRJA 3VW6A 4C3PA 1REKA 5DIAA 4D1ZA 2YJSA 5HCXA 2QLUA 4C4JA 3D7TA 2BZKB 3QD4A 3R7GA 4FT7A 1Y91A 4AE6A 1GIHA 4F6WA 4I0TA 3A4PA 1PKGA 2NPQA 3RJCA 4CTCA 4YR8A 3QF9A 1JOWB 4OLIA 2Z7RA 3LXKA 1H07A 2XAMA 2YAKA 2YWVA 3W2PA 4E7WA 2XIZA 2ETRA 2IW8A 3ZSIA 3W2OA 4W4XA 3ALNA 3FMNA 5CQUA 4RJ8A 3PFYA 3FLNC 5CT7A 3R7YA 3FC2A 3LXPA 5IA2A 4S30A 1T45A 3H10A 4FIEA 4I22A 3CLYA 4FSYA 4ONAA 1OPJA 1TFFA 4A9YA 1SZMA 1OITA 3ZO1A 2OF2A 5HE0A 3G15A 2XJ1A 4RVKA 1PXJA 1YKRA 2JAMA 2B4SB 1Q8WA 4R5YA 5HLNA 2W1CA 3AXWA 3TG1A 5I3RA 2XK8A 2WQBA 2ZVAA 3NNXA 4EOSA 5JGAA 1LEZA 2OSCA 2P2IA 3CY2A 4RVMA 2C3LA 4G31A 4RGJA 1X8BA 3MESA 3AC4A 3ZBXA 2I40A 3LZBA 2UUEA 4A4OA 4OTHA 4BCNA 3UP2A 1GOLA 2O64A 3NCGA 2V7AA 2ZV2A 3MIYA 2XJ2A 4JT3A 3K54A 2R5TA 2ZOQA 4E6DA 4FL2A 3FLZA 2BAJA 3WYYA 2WMRA 4E4NA 1PKDA 3MPMA 4QTAA 2PZPA 3VS3A 4EBWA 2J51A 2OFUA 4O7ZA 1W98A 5DRBA 5JFXA 5DR9A 3U55A 2VX1A 3V5PA 2QONA 2X2MA 2PZ5A 3MH0A 3QQUA 5J5TA 5M06A 2QO9A 3R30A 3AKJA 2ZDUA 4XLIA 5JRSA 4OT5A 4F9YA 3OBGA 4DA5A 5HBHA 5I0BA 1UU8A 4FTIA 2P4IA 4JBOA 5A54A 3E63A 2OXDA 2WB8A 5AP3A 4EOLA 4BDJA 3TNPC 4L00A 4TPTA 3TUDA 3HECA 3LCOA 5IUHA 2NYAA 1G5SA 3ZLXA 4E73A 3AGLA 4A9UA 3EQIA 1YOLA 4IVAA 2UW7A 3ORMA 4NYEA 4HW7A 3JY0A 3DU8A 2F7XE 4IFCA 2Y4IC 1M2PA 4ARKA 2CN8A 4OUCA 3BYUA 3CD3A 2QOBA 4WNPA 5TKDA 3HGKA 3DT1A 3EIDA 3AGMA 5AR5A 4C3RA 4C4GA 4ZK5A 3MFSA 3ACJA 1UKHA 4FKIA 2ZV8A 2GQSA 4F99A 5L6PA 3Q96A 3LLAA 3VJNA 2E9NA 4TWOA 5EYDA 4YZMA 4KABA 1TQMA 2JD5A 2XMYA 3TIZA 4ANOA 4UEUA 3TYKA 5AMNA 2X81A 3IO7A 4U7ZA 3U87A 1A06A 3R8UA 3F61A 1Y8YA 2OFVA 4F4PA 3QWJA 1LUFA 3PZEA 3R8MA 5JSMA 4BFMA 2PHKA 3HDMA 1DI9A 3FE3A 4XCUA 5T3QA 4EUUA 3AKKA 1PF8A 5HHWA 4RX9A 3U51A 3BI6A 4XP0A 1OL6A 3MH2A 2IZTA 1YI3A 3EQRA 4QMXA 5CU4A 5CSHA 1G8AA 5C03A 2CMWA 4DTAA 1IR3A 2E2BA 2JKKA 3PVBA 3FAAA 4FUYA 3PY0A 3BWJA 3QLFA 3ZSGA 2XA4A 4U80A 4YO6A 1U54A 4FKWA 5AR8A 4HCUA 4GEOA 3GU5A 5KMKA 4MKCA 4FSRA 4CFVA 1LR4A 2A4LA 2WHBA 4IC8A 4IXPA 1P14A 4D4RA 5CALA 1EH4A 3DJ6A 2WMQA 3ZZWA 4LUDA 4QMWA 1URCA 2R3MA 4BICA 4K11A 4NW6A 2XJ0A 4UY9A 5AAGA 5JN2A 4LOPA 3KK9A 2HAKA 3I79A 4XBUA 5HU3A 5F95A 5EYMA 4PMPA 3PP0A 4IACA 3DK7A 2C6DA 1UVRA 2R7BA 3IS5A 3RALA 4DGLC 3KXXA 3OCSA 2PZYA 2IG7A 1OL5A 3BX5A 3H9RA 2JGZA 4YSMA 3HLLA 3E8EA 2HZNA 4K33A 3W16A 3U6JA 5L2WA 3GCQA 4RWJA 4YTIA 1E1XA 3VRZA 4R77A 2GTMA 3L8PA 4I6FA 4W8EA 2VTPA 2BALA 3FXXA 4PDSA 4YHTA 3VAPA 5LMKC 3HNGA 3HAMA 2WTWA 2IVVA 3KIOC 3W0SA 3NYXA 4XG3A 5EM7A 4J1RA 4YBJA 5F4NA 4AFJA 1OIUA 2W05A 4R3CA 4ENYA 3KXZA 2YM8A 3BRBA 3ORKA 2WD1A 2BIYA 4FV6A 4QNAA 5AX9A 3WZJA 4BIEA 2UW6A 3DK3A 3ZFXA 4CV9A 5CZHA 5HG8A 3BU3A 4FOBA 4OGRA 4WBBB 5GHVA 1PXIA 1ZY4A 1AGWA 3G6GA 4O0WA 5I9WA 4I6HA 5LMBA 2QOHA 1W82A 4KIKB 3U8WA 3LFAA 2QOIA 2C5XA 2YDJA 4IADA 2CCIA 3PJ2A 2IZUA 4FRFA 4Q5HA 4RJ6A 4YJSA 5FD2A 3V8SA 4IB0A 4QDEA 4MXAA 4XV1A 4L52A 1MRUA 4FG9A 3SW4A 3K2LA 3HZTA 3PP1A 4C35A 3HYHA 4FV2A 3R0TA 2WAJA 1XH8A 3MIAA 4FKPA 2OJ9A 2W96B 2UZNA 4FUXA 4IAAA 3BV2A 3A7HA 4ZIMA 3WYXA 4FK6A 2JITA 3GCUA 4NWMA 2VTIA 3CS9A 5HIBA 4YURA 4WOVA 4AE9A 3EL7A 3RK5A 4MNFA 4DEAA 2H96A 3DBQA 4U44A 4FBXA 3LFEA 4DG0E 3HKOA 3IPHA 1GZ8A 4RWIA 3DLSA 5A4CA 5I9VA 4R1YA 5FBNC 5KMJA 4RZWA 3QD2B 2OK1A 3DPKA 3NVMB 4L7SA 3HV7A 5J9ZA 3G9NA 4RC4A 2R3FA 4YO4A 5M09A 5FEEA 2FGIA 3R8ZA 5AX3A 1NT2A 1JSVA 2Z7SA 5EDPA 3NYOA 5HLPA 1OUKA 3D7ZA 4HYUA 1HCKA 3C5UA 4PQNA 4E8AA 3QUEA 3ORXA 5HBJA 2YN8A 4BZNA 2EXCX 3TTIA 4KSQA 4Y95A 3LQ5A 4RIYB 2J0LA 4FJVA 4PV0A 4BIDA 3K5VA 3TNIA 4ANNA 4FEVA 4GK3A 1F5QA 4E26A 4I4EA 3SKCA 5EG3A 1BI8A 2UW5A 3BL7A 2VU3A 3CGOA 2XEZA 4GVJA 3LIJA 4D58A 4E6AA 5M4UA 1FMOE 4FTUA 3TV4A 2OJGA 4FTAA 4FNYA 4QRCA 1G8JA 3PXZA 4C57A 4D4VA 3RCJA 5HI2A 1QMZA 4C7TA 3ZLWA 4S34A 2ITQA 4IAYA 4AU8A 1PHKA 4G5PA 4LL5A 1YI4A 5CI7A 2F9GA 2ONLC 2ZB1A 4PUZA 2X0PA 3QQGA 4G3DA 3QTIA 3AC1A 5EOLA 3WARA 3KU2A 3DZQA 2HZ0A 4QPSA 3V5WA 1H0VA 2J90A 2Z2WA 3JY9A 4XG7A 3BHYA 3LXLA 4Z9LA 4E6QA 1H1QA 3GEQA 4U42A 4F65A 5A4QA 1ZMVA 2O5KA 2JLDA 2XKEA 3NW6A 4JG6A 4LUEA 3PJ3A 2XK4A 2FYSA 3CPCA 1WBOA 5CU3A 5HGIA 2VTMA 1PXLA 4L6QA 2YIYA 4OTDA 4DBNA 4G3EA 5H2UA 1XH6A 4F0IA 3FBVA 3CQUA 4NM5A 4U40A 4CD0A 4F9WA 4XH6A 1XMLA 3C50A 3LXNA 5AUVA 2HXLA 2WZJA 4QQ5A 1RDQE 4YZNA 5EW8A 3TZ8A 3V01A 4HCTA 2R3LA 2O2UA 5FUTA 5BYLA 4CMUA 3G6HA 3ITZA 2QCSA 2Y7JA 3EYHA 3SOCA 4USFA 4MD7E 5DBXA 4DGOA 3NGAA 3PLSA 4L8MA 2VUWA 2C6OA 3ZUUA 2YCRA 2WMBA 2J6MA 4RX8A 3UC3A 4O0RA 1R39A 4FZAB 4WA9A 4AT4A 3KMUA 5IUGA 3F7ZA 4PTEA 1G3NA 2PMNX 3EN5A 3AQVA 3ZH8A 5BUJA 2ZAZA 3QTRA 2EXMA 3NUUA 3I5NA 4D2PA 3UBDA 3OF0A 5E8VA 4AW5A 2ACXA 4DHIB 2GFCA 3HV5A 3FXZA 1CKJA 4K8AA 5AJQA 3RHKA 1YXUA 4M97A 2BTRA 2J0IA 3ZYAA 3KB7A 3HUBA 2IO6A 3QQJA 2GS6A 4QP4A 3C4CA 3TJCA 4JQ8A 4OT6A 4QNYA 5AM6A 5IDNA 2I0EA 2VO0A 4FKJA 4C2VA 4WKQA 3QKKA 4O82A 3P0MA 3E8NA 5FP6A 2RL5A 1REJA 2XBAA 3KQ7A 3Q6UA 1H1RA 2Z8CA 4E3CA 2KTYA 4FT0A 4G3CA 3OXTA 3TEIA 1J1BA 4MNEB 4O22A 5HNIX 3HRBA 1HOWA 4JLCA 5CAOA 5CEOA 2PVLA 2EVAA 1YHWA 2VTRA 4YTCA 2VTLA 3ZZEA 1M52A 2ZM4A 3DXQA 5ICPA 1KV1A 1NY3A 3VF8A 2XIYA 4CKRA 3QUPA 3PIZA 4RJ4A 4YU2A 3C0HA 5K5XA 5HNBA 5KBRA 4F1OA 3ZRLA 3UZTA 3WILA 4AN2A 4FZ6A 3MW1A 4WHZA 3DXNA 3E7OA 3A7IA 4QO9A 5D7VA 3ZOSA 4QDVA 3TZ9A 4IZ5A 3E87A 4FL1A 4RBLA 3FL5A 5EDRA 3I4BA 4DH1A 3LAUA 2BROA 4YJVA 4ITJA 3SGCA 4M66A 3DB8A 4A06A 4LV5A 4I0RA 5CXHA 2ERKA 2O65A 1SVGA 1BL7A 3OZ6A 4KIKA 2V22A 3P86A 3R00A 2XCHA 2Q0NA 3FYJX 2CDZA 5IH6A 4C33A 3DAJA 3UPXA 5KX8A 2W1DA 4ZP5A 3AC3A 3VUHA 4O0UA 3TWJA 2J0JA 2J0KA 5M44A 2C6TA 4O96A 1YOMA 3Q2MA 3LHJA 3VW8A 3OVVA 3ZSHA 4CGAA 4UWBA 2B9HA 4RIXB 4JBQA 4FYOA 5DA3A 3HP5A 5DR6A 3R73A 5J9LA 1ZYLA 3DFAA 5AIKA 2ZB0A 3SRVB 3F5XA 4HVGA 5BPYA 4AT3A 2YZAA 4AZEA 2QKRA 4AA5A 3W0RA 2AUHA 2WOUA 5ETCA 5KMIA 4RJ7A 4J52A 4X2FA 5G6VA 3D0EA 3SDJA 2FO0A 4C02A 3C4FA 2I0YA 1MQ4A 5E8YA 3ORLA 5HICA 4I41A 4J98A 1H4LA 4V01A 3KRRA 4BC6A 5EKOA 2UW3A 5J9YA 2JBOA 4HGSA 4IB1A 4MK0A 4X0MA 3KY2A 3VUTA 2PVMA 3C0GA 3HMMA 4RPVA 2OBJA 4FV0A 4FVQA 3NNVA 2VWVA 5AV4A 2C6KA 1FQ1B 3F7WA 4L67A 3MPTA 3DAEA 4XLVA 2F7ZE 4YZ9A 4HYIA 3ZRMA 1WMKA 5AR2A 2QU6A 4E6CA 1Z57A 4IMYA 5HVKA 4GT3A 4K18A 4Y5QA 5D11A 2H9VA 3BBTB 4GMYA 4RIYA 1QPJA 3AT3A 3FZPA 3IW6A 3QRKA 1OPKA 5AV2A 2DS1A 3G0FA 3LQ3A 2X7OA 4O83A 5AUZA 1T46A 1PYXA 1Q3WA 1WBNA 3AMYA 5CNNA 5J7BA 3UDSA 1B39A 2OI4X 3P23A 2YISA 3A8WA 4FKQA 3GOKA 4BYIA 4OAVB 4QEBA 4EC8A 2BAKA 5CEQA 4BI1A 3QRTA 5IA0A 2NNWB 3ZCLA 4G6LA 3ZFYA 4U97A 2W5HA 4JJRA 3ODZX 4PNIA 5FBOA 1ZMWA 2JC6A 2FSOX 4P7EA 1OIQA 2PE0A 4G9CA 4USEA 2VTTA 3AMAA 5CSWA 5BYZA 4FVPA 4C61A 4DF3A 5DWRA 5A6OA 5DN3A 5E90A 4EH3A 4MF0A 1TQIA 4EUTA 3V8WA 2WQOA 1Q8TA 1AD5A 2WTKC 2X4FA 2YCQA 3O96A 4FV3A 4TWCA 3VS7A 3KF7A 3DQXA 3TNQB 3HAVA 3Q9ZA 2W7XA 3FQSA 4NIFB 4NT4A 4CT2A 3QGWA 4EHEA 2GPHA 3TT0A 1H0WA 4BDEA 4QP6A 4KBAA 4X3FB 4FTNA 3TCPA 5BVNA 2QKWB 5JQ8A 4RA4A 3PA5A 4QT1A 3TV7A 4BKYA 4CTBA 2QHMA 2UVZA 3E64A 4G9RA 2VTOA 2B1PA 2X9FA 4ZY6A 3RNIA 5HESA 1WVXA 3C4ZA 3I1AA 4R3RA 4D1XA 4A9RA 4WNOA 4BCMA 5CEKA 5D12A 3CE3A 5D1JA 2E9UA 5D9HA 3DTCA 5FDPA 1JKSA 1PMUA 4AZWA 4FT9A 5GNKA 4FT5A 5JFVA 3OT8A 2R64A 1JKTA 3LCKA 5I9YA 1S9IA 3IK3A 3L9LA 1JLUE 3GNIB 1LEWA 4QP7A 3RPSA 3Q4CA 2WMUA 3VBWA 5EI6A 4CEGA 2G01A 5CANA 4O27B 1XHAA 3O2MA 4ZSGA 4BDDA 2CGXA 4BI0A 5IQEA 4Y72A 3HRFA 3D5XA 3PYYA 4D9UA 1JSUA 4EHVA 3CKXA 3HDNA 4FR4A 4KKHA 1OM1A 5HO6A 2ZM3A 4ORKA 3A62A 3SV0A 2BKZA 3FMKA 3UQCA 2HCKA 3DDPA 3VQUA 3M2WA 3T8OA 4CXAA 3OWKA 3FV8A 3VBYA 3ZMMA 4TXCA 2BHHA 3M1SA 3EKNA 1FMKA 4BTFA 3QKMA 3OXIA 4TTHB 5C8MA 5AP1A 2DQ7X 2XM9A 3QGYA 4GFGA 4I3ZA 3W8LA 4DLJA 2XUUA 3VN9A 3LLTA 1IASA 4EJNA 3VRYA 2PVNA 4M8TA 5CVGA 2BMCA 1RE8A 3W2CA 3BU6A 2UZEA 3Q4TA 3UIUA 3LOKA 4NU1A 3OBJA 4Z16A 3O7LD 4MEDA 3CEKA 4P4CA 1BX6A 4NKAA 4YJOA 3VQHA 3VBVA 4FEWA 3DA6A 1IEPA 2GU8A 3D2KA 4IANA 4KS8A 2YZLA 4O7VA 1H27A 5B2KA 3KF4A 2VWZA 5AP5A 4ZLYA 3JUHA 4FODA 4AA4A 2YDIA 2B53A 4N6YA 4AOJA 3FQEA 2WMXA 3OC1A 4JOAA 4XBRA 5AV0A 1O6YA 2W1GA 5CI6A 4F78A 5L4QA 5I9UA 4HNFA 4MD8E 5HZNA 4DH7A 4EZ3A 3KMWA 3BEGA 4LGHA 4IEBA 3PJCA 5IEVA 4PMMA 3W2QA 3P7AA 3G5DA 1W84A 5GIPE 1U59A 2QLQA 3COIA 2B7AA 4AN9A 4E5WA 3U6IA 2BRNA 3COHA 1IRKA 4EYJA 5EHOA 5FXRA 4PL3A 1GIJA 1H28A 4QMPA 4W8DA 3R22A 4RLLA 4EH2A 4AZVA 2B9IA 3JS2A 4MQ2A 1H25A 4V04A 4ZTNA 3KRWA 2XK7A 3RWPA 4FE2A 5CTPA 3NFGB 4FSNA 3OD6X 4M67A 4B8MA 1YDRE 4FEXA 3D83A 5DGZA 4CCBA 4C4EA 1V0PA 4LMNA 4E5BA 2W4KA 3EFKA 4IZ7A 2X8IA 3FLYA 5E1EA 5E7RA 2QG7A 4JMQA 3R7EA 5CLPA 3BPRA 3V3VA 3W10A 4X2NA 3G0EA 4DFNA 4CNHA 2XNOA 3NX8A 1YQJA 3ORNA 2R7IA 2I0VA 3RHXA 3UG1A 4D4YA 5IH4A 3PG1A 4DBXA 5AUXA 3LFBA 3WF9A 4FICA 3NIEA 4PY1A 2GNLA 5TE0A 4X2GA 2HY0A 3KFAA 3MY1A 3BU5A 3SRVA 2I0HA 3BKBA 5A14A 5KMMA 2W1FA 2XBJA 3S00A 5D10A 3UOHA 4BCQA 1YWNA 3KXHA 4XOYA 5HVYA 4BY9E 2WMTA 4KRCA 2C30A 3DK6A 3F3UA 3KRLA 5HEZA 4GK4A 4NM3A 4DH8A 2XALA 2WPAA 5GZ9A 4PTGA 2R3KA 2Z60A 2Y4IB 4HYHA 2RFEA 4MD9E 3B8QA 3ORPA 5AV1A 5C8NA 2JDVA 2VWBA 4OTQA 5DR2A 3JVRA 4ALUA 5LQFA 2VN9A 3UDTA 3QA0A 4M7IA 4ACCA 5L6WL 5HIEA 3T3UA 2DYLA 1W2DA 2CKEA 3GENA 4N6ZA 1W83A 2R3GA 3F88A 4F7NA 2IZRA 2PSQA 1FGKA 3W33A 1XBBA 1FBNA 3VS1A 3JYAA 2W0JA 5BMSA 2FB8A 3E93A 3VJOA 3QQFA 2ZM1A 3DV3A 3EL8A 4D0WA 2IWIA 2J5FA 4BCJA 4IZAA 3DXPA 3DQWA 4IX6A 5IA5A 5C27A 3VNTA 4S33A 5E4HA 3N4VA 2E9OA 3SAYA 4C58A 2OJIA 3CPBA 4TWPA 3ZLSA 1MRVA 3JXWA 4FEQA 2YIWA 2XB7A 5CEIA 4YJQA 3ZO2A 4AQKA 2W06A 3FWQA 5E8XA 4CZUA 3LMIA 3HMIA 4QTEA 3LFDA 4F0GA 4CFUA 1M2QA 1Z5MA 3FPMA 2UZWE 4DH5A 2RIOA 3QCXA 2R4BA 2NRUA 1XBAA 3NS9A 2PMOX 3QCYA 5CVFA 1TQPA 3DFCB 3P7BA 2ETMA 1KV2A 4FC0A 5AFVA 4WG3A 3TKIA 3RM6A 4I5PA 4QP2A 5EW3A 5EQEA 4H1MA 4JAJA 4ASXA 2XVDA 1M17A 3RZBA 3JR1A 1KE5A 3S95A 1QL6A 4H36A 1A9UA 3FLSA 4NIFA 1ST0A 4P90A 4DTBA 2H6DA 3PY1A 4OBQA 4TKSA 4X3FA 4I4FA 1ZYSA 4RIWB 3UNZA 3B8RA 5IKWA 3COKA 3SG8A 1H1WA 4U9AA 4HVIA 2XRUA 3RCDA 4DGMA 3VUKA 3HUCA 2QOOA 3TXOA 4CKIA 4IB5A 2X7GA 1UA2A 2BAQA 1CMKE 2XYUA 3O8PA 4L7FA 4X2JA 4B4LA 2XM8A 4FI1A 4DAWA 3W0OA 4FK3A 3IDCA 4AFEA 5TR6A 3DKCA 4H3PA 1PXPA 2JKMA 4K1BA 4DEHA 4BWKA 3QTUA 3A7JA 3QTZA 2PYWA 3TDWA 3NNUA 2VRXA 1KE8A 3LPBA 3QXOA 4BBEA 4ZSLA 2B9JA 1NVSA 4K2RA 3KREA 2W99B 1KOAA 4FTQA 1ZYDA 4DE4A 5CASA 1ZOGA 4MH7A 2R0UA 3PDTA 3EZVA 3PA4A 1OL7A 4DEBA 3KMMA 1S9JA 1YXXA 3WF5A 4KIPA 4RFYA 2XNPA 3NZ0A 3SC1A 2R3QA 3S3IA 2BTSA 3BEAA 3OUNB 1L8TA 4D55A 4DDIA 3WIGA 4GUEA 4EHZA 2XP2A 2W1ZA 4W4YA 4DHZA 2QG5A 2A0CX 3IDBA 4J8NA 5JRQA 2H8HA 2IW6A 2ZMCA 4PDOA 4WRSA 1P4OA 4R7HA 2OIDA 2QI8A 1VYWA 3ULIA 4HGEA 3QTXA 2C1AA 1OBDA 4A9SA 5I9ZA 4I6BA 5AUTA 3NUAA 4XNEA 2P0CA 2R3HA 4OR5A 5CAUA 5EI8A 3CTJA 4H1JA 2A98A 1H24A 3BCEA 4OW8A 3KGAA 5ACKA 5HQ0A 2JBP