4ANSA

Structure of l1196m,g1269a double mutant anaplastic lymphoma kinase in complex with crizotinib
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
309
structure length
293
Chain Sequence
NPNYCFAGKTSSISDLKEVPRKNITLIRGLGAFGEVYEGQVPLQVAVKTLPEVCSEQDELDFLMEALIISKFNHQNIVRCIGVSLQSLPRFILMELMAGGDLKSFLRETRPRPSQPSSLAMLDLLHVARDIACGCQYLEENHFIHRDIAARNCLLTCPGPGRVAKIADFGMARDIYRGGCAMLPVKWMPPEAFMEGIFTSKTDTWSFGVLLWEIFSLGYMPYPSKSNQEVLEFVTSGGRMDPPKNCPGPVYRIMTQCWQHQPEDRPNFAIILERIEYCTQDPDVINTALPIEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ALK TYROSINE KINASE RECEPTOR
publication title Structure of L1196M,G1269A Double Mutant Anaplastic Lymphoma Kinase in Complex with Crizotinib
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 96
structure length 293
sequence length 309
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2012-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4ansA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4ansA01
3Q9YA 3FYKX 4RIXB 1RW8A 3OMVA 1A48A 4LUEA 4DGMA 3Q04A 2WIHA 1CMKE 5ETCA 2IW8A 3QRIA 4FKOA 3PIXA 4MD8E 1F5QA 3IO7A 4XCUA 3G51A 3QX2A 3OCGA 2IG7A 3NYNA 4UBAA 4DYMA 3U6JA 3FZRA 2WIPA 3QD0A 4EK8A 3TZ8A 5M07A 4L44A 3QTQA 2QNJA 4AT3A 2HZNA 4C4JA 3BRBA 5EH0A 2OZAB 3CPCA 1L3RE 4UMRA 4LOPA 4MXYA 5HD4A 4I5CA 3FHIA 4M8TA 4NIFA 3ZFMA 3MB6A 4EJ7A 4RFMA 3O7LD 5HIEA 4FEUA 4O22A 3MPMA 4X2KA 2XK6A 4RGJA 3MA6A 4BI1A 4ZY6A 1XKKA 4R3CA 4NKAA 1H1SA 2OK1A 3UMWA 1PMEA 2WMRA 4GH2A 4BBMA 2EU9A 3NIZA 1H08A 5DA3A 3IECA 2BFXA 5E4HA 4FTOA 3LM0A 5I5ZA 3CQWA 1XQZA 4K2RA 4M14A 5FWKK 3WF6A 4D4RA 4EKLA 3IQ7A 1VZOA 3W2PA 1P4FA 2E9PA 2VX1A 2WTCA 3CD3A 4FSWA 4BYIA 2X6EA 3QX4A 3EQRA 2JIIA 2WTKB 4X3FC 2IPXA 2CGWA 3KL8A 3QTRA 4A9YA 4CKIA 4XV9A 3GCPA 2ERZE 2UW3A 4FL3A 4NSTA 3I6UA 3O7LB 4FKIA 3D7TB 4FV8A 4GL9A 1Y8YA 4HNFA 4KBAA 3GNIB 4YJPA 5CVGA 1XH5A 2IZRA 2X2MA 2YLEA 2JFMA 4I6HA 3ZH8A 2X8EA 4DFLA 4O7RA 3LFAA 4DFNA 3WZJA 3UZPA 3SG8A 1YDSE 3QQGA 3GP0A 4PL3A 5BVWA 2EB2A 2XYNA 4HCTA 3V5JA 2Z02A 2C1BA 3TTJA 1UVRA 4E26A 5H9BA 4I0SA 4QQ5A 5BUJA 4KIKB 5M4IA 4JDIA 4IFGA 1ZMWA 4B0GA 4X6RA 3NLBA 4F65A 4CMOA 1JLUE 2R3JA 1OKWA 4QPAA 4FSUA 2YJRA 3C5IA 4MEDA 3QUPA 3ORLA 4CMTA 2ITZA 5JFVA 2C6EA 3NYVA 5HD7A 4IXPA 4BCOA 4ZSJA 3FC1X 5BUIA 3R30A 4YC6A 4UMUA 4OTRA 3ATTA 5TF9A 2RSVA 1OL1A 5FEDA 4C35A 5HCXA 4X3JA 1BI8A 4MTAA 5AUTA 3I0OA 4JOAA 1VYWA 4JDKA 1KE5A 4RIYA 5HTCA 4JQ8A 1W98A 4Z7GA 4NT4A 3D14A 4AOIA 3FLSA 2HOGA 2QODA 2W7XA 3A61A 1JKKA 1OZ1A 1Q97A 5HE2A 2BALA 2C3JA 4N57A 4LYNA 3CY3A 2ZDUA 3CXWA 3KA0A 3V6RA 4ASEA 4MWHA 4E6QA 3RZFA 2I0HA 3DK6A 4W9XA 4DEAA 4B8LA 4ZZOA 2YWVA 3D7ZA 4JIKA 4IEBA 3GVUA 4U5JA 3SXFA 2C5OA 2VNYA 3ZLYA 3HGKA 4Y72A 4CEGA 4WNKA 2VU3A 5H8EA 3O2MA 3EN7A 3EYHA 4FTTA 4QP6A 3OVVA 5HG9A 3R00A 3UE4A 3WILA 4B99A 4IM0A 4YURA 5K0XA 2PUIA 2QOKA 2LAVA 4F9WA 2C6DA 3BE2A 3PG3A 4GCJA 2OJFE 4KKEA 1APME 3NNWA 3TZ7A 4FV7A 3ZZWA 2BAKA 3W18A 1NVQA 2WHBA 4OGRA 2C5XA 3I0QA 5H2UA 5B0XA 4ENXA 4AU8A 3OT8A 5ICPA 4ZTNA 4FTJA 5I9YA 3AT4A 3VHEA 4M69B 4JG7A 1AGWA 4E5WA 4F9BA 4IW0A 1Q8UA 2IVTA 1YOLA 2VO3A 3D0EA 4DBNA 2VTIA 3FXZA 4AT5A 2XCKA 4OBQA 1MUOA 5IEYA 2WTVA 4Y95A 4YBJA 5CEIA 3UQCA 4FGBA 5CT0A 4H1JA 3A8XA 3ZUUA 5KX8A 3AGMA 3NUXA 3TNQB 4AFEA 2QVSE 4NKSA 1MRUA 5C1QB 2CNUA 4C38A 3L8XA 4U42A 4XUFA 3CJFA 5CY3A 3RGFA 1W84A 3CQUA 4CYJA 2VRXA 3TDWA 2Y0AA 4U3YA 1SVHA 3KK8A 3F5XA 3LOKA 5DT0A 4I4FA 2C5VA 3FY2A 5JFSA 5EK7A 1JVPP 5KZIA 4K1BA 2OIDA 2FSTX 3ZLXA 3KN5A 4JVGA 3FZSA 4KIKA 3BV2A 4KKGA 2JDSA 1YXTA 3QGWA 5EKNA 1V0BA 4IAFA 4P5ZA 4EK3A 4PTEA 2QHMA 3E7OA 2UVZA 2WMUA 4PL4A 4DH8A 3VS4A 5ACKA 4D4YA 5J5TA 4FV2A 3H9FA 3E8EA 4MBLA 5CAVA 5FEQA 3CEKA 4KBCA 5E8XA 1B38A 4LUDA 5ITAA 4M97A 4U97A 3G2FA 3ULZA 3IG7A 4PQNA 4TW9A 2UZDA 5KMIA 1YHSA 4RWKA 2WQMA 4HGTA 1JSVA 2PVLA 1SNXA 3RAIA 2FH9A 5JZNA 2AC5A 1ZMUA 4RG0A 3MVLA 3T3UA 1U54B 3IOPA 1NXKA 2R3PA 3AMBA 3UIBA 4IAAA 4GV1A 4KWPA 4MXCA 4FSRA 2OBJA 2XMYA 3A2CA 5HTBA 3ZTXA 5IMEA 3LPBA 3FLZA 5C8KA 3MSSA 4HYHA 3ZXZA 4I5MA 4CG8A 3ZFYA 4IACA 3DQXA 4L53A 4Q2AA 2HCKA 3FPQA 3D9VA 2CDZA 2WELA 4FOBA 2ZMCA 4UYAA 1YHWA 4NW5A 4BCMA 2B9FA 5AUZA 3TV6A 4BFMA 5CF4A 3VS6A 4F9AA 3I5NA 3VBWA 3BE9A 1M14A 5EQYA 2PUUA 2XEZA 4JBVA 3ODZX 4XP2A 4ZMFA 5FP6A 3WARA 3T9TA 3IGOA 5EQPA 3LJ1A 4CG9A 2GNGA 2P33A 3UMXA 2XIZA 2XP2A 4F70A 2NNWB 4D4VA 4E6DA 2Z2WA 5HTIA 3DB6A 2O65A 4USDA 4EEVA 2G01A 2QOBA 2WMAA 3GQIA 5AP1A 2QC6A 2XK8A 1MRYA 1PW2A 3FWQA 5K0KA 3MVMA 2VTPA 2C5YA 5CYIA 4F08A 1CSNA 4G1WA 4BDIA 3UIXA 4TKSA 3E62A 1Z5MA 2PVNA 4TYJA 3UOHA 5CF8A 5JT2A 5AP0A 3LE6A 5KMOA 5CU2A 5IKWA 4F7SA 1OGUA 4FTNA 5AP4A 3TL8A 3RZBA 4E4NA 4IDVA 2OXYA 4IZ5A 4O6LA 2IZTA 3AQVA 5LOHA 4E6AA 4HGLA 4E4MA 4XG9A 4YLKA 5J9ZA 2UW5A 5L2QA 4R8QA 5HEZA 5IA5A 4QMXA 3DFCB 3SOAA 3ZEPA 3ZYAA 3TCPA 4FIFA 4I0RA 5CU0A 2XKFA 4GKHA 3R22A 1Q24A 2F7XE 4LL5A 5KMLA 3P7AA 5HE3A 1GIHA 2R5TA 4V04A 3I7BA 5AAEA 3VJOA 2P3GX 3HP2A 1J3HA 3LCDA 5T3QA 4DCEA 5BUEA 3RAKA 2UW9A 2XNPA 3MJ2A 4LG4A 2WGJA 1WBPA 3DK3A 3E8DA 3GC0A 4IDTA 3OWKA 4RFYA 5F1ZA 4R1YA 4FICA 4YNOA 2OF2A 2JD5A 2ZMDA 3HMNA 3LFFA 4IE9A 2VWBA 4JG8A 4KB8A 3W2CA 4FSQA 3R7IA 4C61A 3IDPA 1U54A 3HV6A 3LFSA 1CKPA 3ACKA 4C4FA 3CD8A 4WRSA 3Q4TA 1JBPE 2XIYA 5CSWA 3GFEA 5LMKC 3R8ZA 3VS0A 5FM3A 4AT4A 4EK5A 5KKRC 3BLHA 3KCFA 4UEUA 3L9PA 4O27B 5I9WA 2V0DA 2F4JA 4EH2A 1ZY4A 1G8AA 3GGFA 3AGLA 3R9NA 4HNIA 3TNHA 4ACGA 4L52A 3OS3A 1M2QA 3HRBA 4EQCA 4XP0A 3OCSA 3NSZA 3RM7A 5AM6A 4DHFA 2VZ6A 1ZYSA 3OWLA 1UU8A 3LKMA 2V62A 4FSMA 2VN9A 3FSFA 2GHLA 2OFVA 2XJ2A 3ZBFA 3QU0A 2PL0A 1YDRE 3QTSA 4TWOA 4D2SA 5ANEA 4U3ZA 1XH7A 1ZRZA 3FZTA 2RKUA 4ITIA 2VTQA 3G9NA 3GU7A 2Y4IC 4U43A 3JVRA 4KRDA 1ZLTA 4X6QC 1NA7A 5EW3A 3ZBXA 3SOCA 2W9FB 2WMTA 2BDFA 4FTUA 2UZOA 4C2VA 4DINA 3MPTA 4HVGA 4FV4A 4X7QA 4KIOA 4UWYA 3HRCA 4JBQA 5CSXA 4LI5A 5L2WA 4O7WA 3K3JA 3HEGA 3ZSGA 1KE8A 4FV5A 5A14A 4DA5A 3PE1A 4PMPA 4O0TA 2B1PA 4EK6A 4OTIA 3VS1A 4BN1A 3ZO3A 2ONLC 5L2SA 2OU7A 4YZ9A 3UIUA 5J1WA 3FMNA 4AZSA 3HMOA 2REIA 5IQDA 3ZU7A 5AP7A 3R1QA 1UNHA 4O0SA 5CSVA 2PYWA 3PVUA 5CZHA 2Z7QA 5HVYA 5CEQA 1QCFA 5AR2A 3H10A 3UO4A 2R64A 2JDRA 3WF8A 4C58A 4QYHA 3R02A 3S4QA 4LMNA 4QMOA 4NEUA 3VC4A 4C3FA 4IWPA 5C27A 1AQ1A 5HX8A 2YM5A 5CWZA 5CS6A 3C7QA 3P4KA 3RPYA 3TG1A 4Z7HA 3T8OA 1ZXEA 3VF9A 2BUJA 5JEBA 4F1MA 3OD6X 3ORNA 1U5QA 5CEPA 4S2ZA 5E91A 4BWPA 3EL7A 3PRIA 4JJRA 4FZ7A 5JMSA 4TT7A 4JL9A 3EQGA 3EFJA 3PXFA 5E7RA 3FBVA 3K5VA 4RIOA 2Y9QA 4CRSA 4O7ZA 1MP8A 4X21A 2B55A 5L3AA 5DVRA 2BRBA 4G16A 1LPUA 4H39A 3T9IA 2PVMA 3TEIA 2PMNX 2RF9A 4FV9A 5IEXA 4AACA 5KO1A 1FGKA 2XYUA 4I0TA 5HHWA 3N4UA 5GIPE 4YJSA 3L8SA 3QQJA 4S30A 4BCGA 4PP9A 3BWFA 3KF4A 3PY3A 1KSWA 3LFDA 3R9DA 1CTPE 5FTOA 5FTGA 3JS2A 2YAAA 3C9WA 3IDCA 3WIKA 4ACHA 2QI8A 4FV3A 4DGNA 3QCXA 4F6WA 3IW5A 3RK7A 4CFMA 3OY1A 1GIJA 3H0YA 3HZTA 5CLPA 5GJDA 2X9FA 1WFCA 2Y8OA 3B2WA 3DOGA 1DAYA 2G9XA 4O91A 4GIHA 4I5HA 5ANGA 4O86A 3C4XA 1URCA 3R1SA 1PXPA 1XBCA 5L2IA 1BKXA 4BICA 2VWWA 1H1WA 3QCYA 4FNYA 5FDXA 2PK9A 4YJOA 1NT2A 2F7EE 3ZUTA 1FMOE 1SMHA 2OJJA 4ZXTA 4M15A 4O0WA 1XWSA 2W05A 2BDWA 4RVTA 1PHKA 4XYFA 3SKCA 4BI0A 3MY5A 2OW3A 4FG8A 2W5BA 1H1QA 5EHYA 2R3MA 3SD0A 2DWBA 2XKCA 2HWOA 4EH8A 3TUBA 4BY9E 2ITPA 5IMXA 3O17A 5BMSA 3LCSA 2GNIA 4ZOGA 1U4DA 2PUNA 5AV4A 2GMXA 2A2AA 3PIZA 3BPRA 4TNBA 1ZYDA 2GTMA 4IZYA 4Y5HA 4O84A 4EQMA 4XP3A 4OW8A 3QTIA 2UZTA 3VS3A 1DI9A 4KAOA 4U44A 4QMNA 3PWYA 3TTIA 5AUXA 3BEAA 1H00A 4HZRA 2E9VA 4L8MA 3V5QA 2PULA 3GU5A 3KN6A 1T46A 2XK7A 4L6QA 4FIEA 4I6QA 2CGUA 5CNNA 4JAIA 4P2KA 5AUUA 3C0IA 3HYHA 4IC7A 4WSQA 1H1RA 3Q5ZA 2B9JA 4J7BA 4G34A 4EWQA 4D9UA 5IQHA 3RTPA 2PZPA 4IM2A 4A9TA 2BCJA 4PNKA 1YI4A 4WHZA 1WVXA 3I81A 1WBOA 4IAYA 4BC6A 1Z9XA 4AGWA 2J4ZA 4KA3A 4TWNA 4DEEA 1PMNA 5HU3A 2JAMA 3HVCA 4UXQA 5ANDA 5I3RA 3DGKA 4ENYA 1UWJA 4QPMA 2XJ0A 4WNOA 1PMVA 3LHJA 4ZK5A 2PVRA 4UWCA 3NZ0A 4YHJA 4D28A 4MNFA 2PZRA 3CJGA 3R7YA 4C36A 3VUKA 4D2RA 1IG1A 3ID6C 3JY9A 3HP5A 3ZLSA 3HX4A 4RVKA 3MBLA 3C0GA 2UZLA 2I1MA 4DH7A 3VO3A 3UZTA 4MD9E 3PJ8A 1BI7A 5CQWA 3EQPA 1ZAOA 3SW4A 3V5TA 5CU6A 4LOOA 3KMUA 4BTKA 4QMUA 3GU4A 3UG1A 4EH5A 2UZBA 4FNZA 5FXQA 3LJ0A 4L3PA 3TKHA 3QUDA 4MCVA 2C6LA 3MI9A 3OW3A 2JEDA 4FODA 3FI3A 3PA5A 4QMQA 1RE8A 3PPJA 1YOMA 4I93A 2RFEA 4H3QA 4MVFA 4ZS0A 5FP5A 2X8IA 4F99A 4Z3VA 3W2RA 1Q62A 4BRXA 4UZDA 4F0GA 2GQGA 2VWYA 5HBEA 2OJIA 4AA4A 3O96A 1FBNA 5C8NA 3C4ZA 4UZHA 1Y57A 5E8YA 4YTFA 1OUKA 4OTGA 5D1JA 5C01A 4UB7A 2BDJA 3MYGA 3IGGA 1ERKA 2IVUA 5H8GA 4XHKB 2I0EA 1ZOHA 2PZYA 4GIIA 5DH3A 4C57A 4EZ7A 3DXPA 2C3KA 3LIJA 5ANIA 1HCKA 1TKIA 5G1XA 4EKKA 3MY0A 1URWA 4WUAA 5BVNA 3PUPA 4TPTA 4N70A 2LGCA 4YJVA 5BNJA 4I92A 4BCQA 3NVMB 3AXWA 5AR4A 4JI9A 5A54A 2BFYA 5FXSA 1B39A 2ACXA 4F0FA 1GZNA 2WU6A 5EHOA 4AE9A 3QCSA 2WB8A 1O6YA 2H9VA 3U87A 2ITUA 5LCKA 3S3IA 2CCHA 5IQBA 3HA6A 4ARKA 4L3LA 5HNBA 4LRMA 4QO9A 3KXHA 3HUCA 5C4KA 3QFVA 2YWPA 4PX6A 3UVPA 1ZWSA 2C0TA 3NNVA 2VGOA 3FJQE 5DRDA 3TIYA 4EH7A 4FGRA 3NAXA 4KS8A 5GJFA 2VD5A 2CHLA 2F2UA 1ATPE 3RHXA 4BGQA 1UU7A 2WTKC 3DY7A 1J91A 3F61A 3F3VA 4AAAA 2W4OA 4W8DA 4O81A 2HZ4A 1FMKA 1R3CA 3ODYX 4O1OA 3BYMA 4NH1A 3OHTA 3FZOA 2YM7A 3KEXA 3BGQA 4JNWA 4WO5A 4WT6A 3V6SA 5CANA 4NIFB 5L6OA 5CVHA 2J6MA 2XIXA 1ZYLA 4FEVA 4FOCA 3SA0A 3BI6A 5J95A 4K77A 2BRNA 3S00A 4W4VA 3R8MA 4AGDA 4BDJA 5M4FA 3Q9ZA 3PFQA 3U51A 3ORIA 3OTUA 3G90X 2WKMA 5HU9A 2G1TA 4R6VA 4BB4A 5F95A 5I9XA 1LEZA 1PYXA 2P2HA 5AV0A 2O5KA 5JGAA 2CKEA 3RPVA 4AW0A 1YI3A 4S33A 2YISA 1QPCA 3GT8A 1JWHA 1PKGA 1CM8A 4GT3A 4RC3A 4L46A 4TY1A 5J7BA 3TV7A 5EFQA 1PXMA 3DBQA 1PYEA 2J50A 5E92A 3W8QA 2F49A 5GINE 4W8EA 5H8BA 3R8LA 4IC8A 4PNIA 5JRSA 4O7SA 2Z7RA 1UU9A 4YZCA 2QOHA 5HG8A 4AOTA 3BU3A 2QG5A 4FVRA 4F09A 4M3QA 3WIGA 5FGKA 4ZJVA 5HNIX 5AUYA 4GK3A 4QMTA 4UWBA 1CKIA 3JY0A 3VS2A 3CCNA 5DOSA 1GZ8A 4FI1A 4PMMA 2WMSA 3QHRA 4K9YA 2ZM1A 2WQEA 5IUGA 1PRYA 3WF9A 4JR7A 5EI6A 3HV5A 2R0UA 4PP7A 4DEGA 2XA4A 4XG2A 3ELJA 4E5AX 2A0CX 2YIXA 2BZJA 4NCTC 3OT3A 3RBWA 1PXIA 5GNKA 3VULA 3CIKA 3Q2JA 5IQAA 3TJCA 4IH8A 4WUNA 3QC4A 1IRKA 4KNBA 4EBWA 2VTRA 2UZVA 3SRVB 4C4GA 5A9UA 3ORTA 3VBXA 4FMQA 1XH4A 4FT5A 5CTPA 5G6VA 3PJ1A 4RIYB 4JQEA 1E1XA 5DE2A 4BI2A 1YWRA 4YHFA 2VO0A 3MWUA 5TKDA 4D5KA 2FUMA 2WMWA 3EFKA 4A9SA 4FKQA 4MNEB 3OF0A 2JKKA 4YLJA 3FMEA 4O38A 4FKUA 3KCKA 3THBA 4DT8A 4EK4A 5IDPA 4U45A 3WBLA 3R8UA 4ASZA 3F5PA 2QOCA 5JK3A 3II5A 2XRWA 3VUGA 5CASA 2WQBA 4HYSA 5M56A 2YITA 3P08A 3TNPC 3EMGA 4C4HA 4DTKA 1E9HA 1U46A 2V55A 2CPKE 4WNPA 5EHLA 1WZYA 4U40A 1DAWA 1RQQA 2WQOA 4O7TA 2HW7A 3PP1A 1H8FA 3LXKA 3BHYA 5AV2A 2Y6MA 3KULA 3KRLA 2VO6A 4OT5A 5IH4A 3Q3BA 3QGYA 5J7HA 4I4EA 2G15A 3B8RA 1H27A 4F0IA 4GFGA 5AWMA 4RJ7A 5HLPA 5L6PA 3QCQA 4Q9SA 4IB3A 2G2FA 4Z55A 3ERKA 3RP9A 2OG8A 1P14A 1FVTA 1BL6A 4GT5A 3D5VA 3LFNA 3R71A 2X0GA 3ANQA 3K2LA 4TWPA 3CY2A 3F2RA 3JR1A 2P55A 2JAVA 3WZKA 5DN3A 3I4BA 4YZDA 3G6HA 2WQNA 4ZAUA 2C6OA 5AV3A 4L00A 3FQEA 3OW4A 4O0RA 4MBJA 4BWKA 5L4QA 5GIOE 3BCEA 3GXLA 3MIAA 1FINA 4FKJA 5K9IA 2VTOA 2Q83A 5CI6A 1GIIA 2NO3A 3P9JA 2OSCA 3WZEA 3NMUF 4I21A 4XLIA 4FT0A 1F3MC 1ZZLA 4MX9A 3VW8A 3WI6A 5AP5A 5EI8A 4ZJJA 2AC3A 4WKQA 3OC1A 4TNDA 5LXMA 4QQJA 1JOWB 2ZOQA 2VTHA 1M7NA 2ITQA 4OTWA 2PMOX 5DMZA 2BRMA 4F64A 4PY1A 4FSYA 4FL2A 3OEFX 3SRVA 2XNOA 4F9YA 3NS9A 2XEYA 5KHXA 3QD2B 4NTSA 4QMMA 5FM2A 2X4FA 4J97A 2RL5A 2JITA 2Z60A 2ZV9A 4YUQA 4S34A 3RINA 4I22A 4EL9A 3JUHA 4YZNA 1CKJA 5HLWA 4A9RA 3MB7A 3NNXA 4MNEA 5EYKA 2NP8A 3MDYA 4FT9A 4BCNA 3TT0A 5F9EA 4R7BA 1U59A 3VJNA 2GNLA 3P1AA 4KS7A 4BCJA 3OY3A 5HIDA 5GJGA 4JDHA 4WG3A 4YJTA 2GFSA 4AZWA 3FMKA 2ZJWA 4WNMA 5CVFA 3ZUVA 3CQEA 3QKLA 2YACA 3A62A 3AC1A 3ZOSA 4BZDA 3E5AA 4A4XA 1UU3A 3KXGA 4BL1A 3MY1A 1WVWA 3SGCA 1U5RA 3Q60A 5EM7A 4I20A 5LJJA 3P23A 4XJ0A 3OBJA 4GSBA 5LVOA 3QC9A 2ITWA 5J9YA 2XRUA 3UTOA 5DPVA 3ZCLA 3HL7A 4QP9A 4UMQA 4FV0A 3NUUA 2QOLA 4D1ZA 2BKKA 4RWIA 2CKPA 3GCVA 3GBZA 3NYXA 4D5HA 3A7GA 1UKHA 4M67A 4ANSA 4YJNA 5HCYA 5KUPA 2ZB1A 4O7YA 4D2TA 1IAHA 3HLLA 4YZMA 2WO6A 3R2YA 4HPUE 4EOPA 4EC9A 4KIPA 3R01A 4IM3A 2SRCA 3MFTA 1W8CA 3WE4A 3H9OA 3KRJA 3ZFXA 2QCSA 3QRJA 5F20A 3P7BA 4ACCA 3K3IA 2R3OA 4PDSA 1QPEA 4MQ1A 2UZNA 4G5JA 5A3XA 2W1DA 1PXJA 4TXCA 3C1XA 4UMTA 3QBNA 3UC3A 1PXLA 3IDBA 3TKUA 4Z16A 2XJ1A 4RSSA 3PE2A 4L3JA 2W1IA 4E4LA 4B9DA 5TOZA 4B7TA 4GUEA 3UGCA 4UMPA 4A4LA 4J95A 2YHVA 3BBTB 3ORZA 5IISA 1M2RA 3OCBA 3OEZA 4MH7A 3R2BA 3DQWA 2I0YA 3BYOA 4LRJA 4XV3A 4DH1A 4NM0A 5EW9A 5HO6A 2HXLA 3PSDA 1O6KA 4FSTA 1J7IA 3AT2A 3MIYA 5CEOA 3ALOA 5IUHA 5E8TA 1PXKA 3E92A 4QMWA 3PYYA 4F63A 2HENA 5CXHA 5JRQA 5DT4A 3DDPA 4ZTLA 5J87A 1SM2A 3DBEA 1H01A 1W0XC 4H3PA 4HVDA 3BV3A 5JGDA 3TUCA 5IQIA 3Q53A 4JS8A 3QHWA 2PY3A 3JPVA 3UQFA 2EXCX 1OBGA 2XNNA 3W2SA 4QRCA 3U55A 5D7VA 2QKRA 2RFNA 3CTJA 1YXSA 1WBTA 4YP8A 1R1WA 5D10A 3DTCA 4IB1A 4E4XA 4M84A 1OB3A 3QD4A 3QZIA 4LRKA 3MESA 5EQEA 1DS5A 5GZAA 4K33A 3TIZA 3V8SA 4D58A 5M53A 4FT7A 4I1ZA 3AMYA 4A07A 3NUAA 5TT7A 4FKRA 5EM8A 3FPMA 2OJ9A 3FXWA 1J1BA 3Q32A 4FIJA 1GOLA 3NW7A 5BX0A 2OH4A 4B4LA 4MWIA 3LFEA 1XH9A 3Q6UA 4W9WA 5GZ9A 5CEMA 2CKQA 3DKGA 2OI4X 5CU3A 5DFPA 4FNWA 2VTNA 2FO0A 1GNGA 4NJDA 3H30A 4EZ5A 4CCUA 1OL2A 2PVYA 1H07A 4EOIA 4HVIA 5AADA 5FBNC 3RJCA 4K11A 3NRMA 3QZFA 4WOVA 5A46A 1R78A 3QUEA 4RJ4A 3L9NA 4G3DA 3ZXTA 4ASXA 4BIDA 5KMKA 1PF8A 1ZYJA 1OIYA 4UY9A 3ZC6A 3ZDUA 4ITHA 2YIQA 4J96A 3RPOA 2EXEA 2PVFA 2ETKA 3M11A 2DS1A 4ZP5A 3V3VA 5K4JA 5CZIA 3DB8A 3VUTA 4FA2A 2CN5A 3SHEA 4JT3A 4JAJA 5EDPA 4USEA 2I7QA 3ZLWA 4NUSA 3F69A 2J9MA 4WIHA 4IJPA 5CSPA 2JKOA 3BHUA 3FMLA 2XCHA 4BDAA 1H26A 1LP4A 4FSZA 3ACJA 2R7IA 3L9MA 4JX7A 5DT3A 4LL0A 4MXZA 3SDJA 5JQ5A 3DLSA 4GJ2A 5B7VA 3R28A 4OTDA 1DM2A 2NRYA 5E8SA 2IW9A 4HYIA 1CDKA 2G2HA 2VWIA 4ZIMA 4ANBA 1OL6A 2A4LA 4ASDA 2GSFA 3Q4CA 4OR5A 2JFLA 5TR6A 4P90A 4DEIA 4MD7E 1OIUA 4PV0A 5D9HA 5CALA 4YTIA 1SZMA 4R77A 1IA8A 4BZNA 3E3BX 3V8TA 4L43A 5IA3A 4ZMEA 1NVRA 5CAOA 4FTIA 4I41A 4AA5A 1T45A 1Q3WA 4ZZNA 3OXZA 1XR1A 2PZ5A 4FZ6A 3QQHA 5KE0A 2GFCA 4FZDB 3FI2A 5M09A 3D15A 4EOOA 4AXAA 4DG0E 3R9RA 4W4XA 3VVHA 1ZY5A 1Y6AA 2Y7JA 3QAME 3QRTA 3NUSA 1TQPA 3CKXA 4V01A 4PTCA 3PJ2A 5JQ8A 4NZWB 2XBJA 5IPJA 4D0WA 3VBTA 5BPYA 2P0CA 4PDOA 3CLYA 2GTNA 4EOJA 4X3FA 4XG8A 5GHVA 3QRUA 2ETMA 3FV8A 3ANRA 4QMSA 5FLFA 2C30A 3KXZA 4MQ2A 2J90A 2VNWA 5KHWA 2UW6A 1QPDA 4Y83A 5A4QA 1Y91A 3L9LA 4BTFA 4DC2A 1M7QA 5ETIA 2Y4PA 5BMMA 3FLNC 1H28A 5TE0A 3DJ6A 3R7GA 4CTCA 3TJDA 2IVVA 2WFYA 2R3IA 2J7TA 3VW6A 4BDGA 4ZLZA 3NYOA 4JR3A 3E8CA 4FX3A 3MH1A 3SX9A 3NX8A 4FEQA 3QQLA 4K8AA 3S2PA 5L8LA 3RK9A 2PPQA 2ERKA 1UKIA 2FYSA 3VIDA 1YW2A 2BHHA 3PXRA 4AZTA 1IAJA 4QP2A 3LJ2A 2BRHA 3KU2A 3POOA 3F3WA 3EZRA 5DEYA 4QPSA 4PPCA 3DBCA 4U9AA 4XV2A 4YHTA 5AR7A 5HESA 2QG7A 2UW7A 4H3BA 3QL8A 5LCJA 2XKEA 4EONA 4AGUA 5D12A 3FL5A 3ZS5A 3ZO2A 4IAIA 2C6KA 3QTXA 4E5BA 5AP3A 1HOWA 5AA9A 3PWDA 4BHNA 4FIIA 5BVOA 4JIAA 2HY0A 1UNLA 2R0IA 4K0YA 5EDRA 5JSMA 5AV1A 3SG9A 2Q0BA 2VWZA 3BLRA 4GYIA 4HYUA 3F5UA 2PU8A 1QL6A 3EQHA 3I1AA 4U79A 5M08A 2X7GA 3F7WA 4O2ZA 4OTQA 2VTMA 1YDTE 2HIWA 2J0JA 4G3CA 4OAVB 2IVSA 2YCQA 3GI3A 3D2KA 3ORXA 2CN8A 3U9NA 4C37A 3NGAA 5E1SA 3PIYA 2X9EA 4MK0A 3UO6A 4PTGA 5IF1A 3R8VA 2WTJA 3E64A 4Z9LA 2WMXA 2BMCA 3C4EA 2IZUA 4ZS4A 2UW0A 4IJ9A 5DRBA 1W83A 3KXNA 2IWIA 2X6DA 1PJKA 4OBPA 4DE4A 2R3GA 4PPBA 3LCOA 3CTHA 3SAYA 3Q2MA 4RPVA 3O23A 4FKPA 3ZMMA 2GU8A 3GOPA 2CNQA 5CENA 3DCVA 2YM3A 1KUTA 1JSTA 1A06A 2JLDA 3LFBA 4X2FA 2YCFA 2C0IA 4YNEA 5IEVA 5IA0A 3WYXA 4BGHA 2QLUA 5LQFA 4LFIA 4AN9A 5DYJA 3BWJA 4FZFB 3R7VA 3VUDA 3M1SA 4F7JA 3BQRA 3TKIA 1YQJA 1Q8WA 1REJA 2VO7A 4NW6A 4R7HA 4RJ3A 5HZNA 2OH0E 2WZJA 4U7ZA 1TQIA 2C5NA 4QP7A 4RWJA 3A7FA 3DBFA 4OTHA 3ZONA 5AR3A 1GZKA 4C02A 2X2LA 4DGLC 3AT3A 3OWJA 1BMKA 3OXTA 3U9CA 3DXQA 4DFZE 4O2PA 2EWAA 3HV7A 3KRXA 3VUHA 4AS0A 4G6LA 3A99A 4EHVA 2B0QA 1UA2A 3PSCA 2BTRA 4U81A 2BILB 4C3RA 1OI9A 4UV0A 2WOTA 3O51A 4LGDA 3EWHA 1MQBA 4PPAA 4FTCA 1GY3A 4PDYA 3OG7A 5E8VA 3RI1A 4M68A 3KC3A 4QTEA 3WZUA 3ALNA 1RJBA 1S9IA 2PE1A 5HE0A 1F0QA 2BZHB 5AA8A 3CC6A 2OXXA 3O8UA 4A4OA 3RALA 2XK3A 2HXQA 3DKCA 2RFDA 3KXMA 4ALWA 4C0TA 3AC3A 3QQKA 2KULA 5IA4A 1ZOEA 2FSMX 3CR0A 4QOXA 4XG6A 5M44A 2XUUA 3R04A 2IJMA 1OIRA 2X81A 3C51A 4GK2A 5C9CA 3MH0A 3ZRLA 4M66A 2BIYA 4O0UA 4J71A 3QA0A 3IPHA 5HX6A 3C4FA 2YIYA 3PVBA 2VTAA 4D1XA 4G5PA 5D11A 3ZSIA 5EDQA 3L1SA 4H36A 3O8PA 1P5EA 5KMJA 4C7TA 3Q96A 3RNYA 2QOFA 2J2IB 4GW8A 3NCZA 4FVPA 1KE7A 4ZSAA 3R83A 4RT7A 4D0XA 3SVVA 3W32A 1RDQE 4GVAA 4RWLA 4UYNA 1UNGA 2HZIA 1YXUA 4YR8A 3RM6A 1PMUA 4ID7A 2CLXA 1YVJA 3UVRA 4YMJA 3PRFA 3VHKA 2ITYA 4RA5A 5IA1A 5ANOA 5AR8A 4C4IA 2YIRA 4G9RA 3EH9A 4U6RA 4V0GB 4KUJA 4HOKA 2PSQA 4YPSA 3P86A 3E93A 4GKIA 4BZOA 4EH6A 5ANKA 5LVPA 1LR4A 3LQ3A 4JQ7A 1BLXA 1OPJA 3LW0A 4W4WA 4CGAA 1UV5A 3EIDA 1YI6A 2RG5A 2X8DA 3A7HA 4UX9A 5LMAA 3D5WA 3DTWA 4PUZA 4DEHA 1Q8ZA 2OIBA 2GS2A 5HKMA 1NW1A 3SW7A 4YJQA 2UVXA 3OP5A 4V05A 2QQ7A 3DJ7A 1PXNA 4FEXA 2O64A 1JSUA 3UP7A 2O2UA 3QD3A 1PKDA 3Q52A 5HE1A 3VUIA 1G8SA 4KD1A 5FRIA 5HICA 4N6YA 5L6WL 3KGAA 3UVQA 4O7VA 4M12A 2YDKA 3H0ZA 5K5XA 4FEWA 3RMFA 2XF0A 3GOKA 2VV9A 3F6XA 4Q9ZA 1XH8A 1J1CA 4ZZMA 4JX3A 5IDNA 4F1OA 4NFMA 3FLYA 5KCVA 5EYMA 4G9CA 4APPA 4ACMA 3R1YA 4ZTHA 4QTDA 4J1RA 4XS2A 2OZOA 4M0ZA 3A60A 4WA9A 4TYHA 1OPLA 3F88A 4RX9A 4EUTA 1BL7A 2AYPA 2YDIA 4ANNA 4D1SA 2W06A 4ZTMA 4ZY4A 2EXMA 5FBOA 3MTFA 4BTJA 4FE2A 4YTCA 4AF3A 2VX0A 2ITNA 1Y6BA 2QHNA 3WOWA 2IZSA 1MQ4A 1ZOGA 2FSLX 2ZV2A 4CNHA 4H05A 5LMKA 2VTJA 4DFXE 5IA2A 3QTWA 4BCHA 2I40A 4RQKA 4E93A 1Q41A 3GEQA 3BBWA 5HORA 2DUVA 3FL4A 3P79A 2C6MA 2YCRA 3CE3A 4J99A 4YJRA 4E1ZA 3LMHA 4AE6A 4EOQA 2HW6A 2PE2A 2ITTA 2P4IA 4IFCA 4QTCA 1K3AA 3R63A 3ZHPC 2OXDA 3TDVA 4DEDA 5EG3A 3PLAE 2CMWA 4QQTA 1SNUA 2C47A 2XH5A 4TWCA 2OJGA 2ZYBA 3IW7A 4HVHA 1JKSA 3N51A 2GQRA 3NUNA 2BIKB 4L42A 3NVKI 1NY3A 5IUIA 5BYLA 4AUAA 3F2AA 1VR2A 4YZBA 2W4JA 3BIZA 3KULB 3P0MA 2V5QA 5HVJA 5L8KA 3A8WA 5AX3A 4XEYA 3LXPA 3CGOA 3DXNA 4O0YA 4QYYA 5KBQA 4DEBA 4V0GA 4O21A 3OOGA 4O0XA 4QNAA 4I6FA 4YSMA 4RVMA 4FK3A 4TTHB 2P2IA 2PHKA 1YWVA 3W33A 4AN3A 5I4NA 4XRLA 5HO8A 3RWQA 4ANQA 2CNVA 2UVYA 2W5AA 1I44A 5C26A 4NWMA 3GU6A 3AD5A 3NAYA 4S32A 3NIEA 3PPKA 4IBMA 2XNBA 3KFAA 4JLCA 5LARA 2BTSA 1WVYA 1OPKA 5CX9A 2PZIA 3FUPA 5IZFA 5DNRA 2PE0A 4QYGA 4J8MA 2ONLA 3PXZA 1WBWA 1JAMA 2HY81 2PWLA 3MFSA 4FTKA 4IB5A 2ETRA 3PG1A 1REKA 4USFA 3IKAA 3MFUA 4L01A 2BZKB 3ENMA 4ZSEA 4EYJA 3PZHA 4X2NA 3NW6A 2QO7A 5B2LA 1V0OA 5FDPA 4BCIA 2QU5A 4YLLA 4RZVA 4BIBA 1XBAA 5K3YA 3COIA 3P5KA 4IX5A 3CS9A 1Q99A 4H58A 2W5HA 1XO2B 3UG2A 4FR4A 4JRVA 4WG4A 1BYGA 4G31A 4LV8A 1ZARA 3LXNA 4QMVA 4EOMA 1YHVA 4AN2A 3NWWA 3UDBA 4IAKA 4AZEA 1M17A 5IQCA 2FSOX 4IWOA 3FZPA 3K5UA 1IASA 4UALA 4R3PA 1P2AA 1K2PA 3BKBA 5HG7A 3DFAA 3PDTA 3BU6A 3I79A 5JGBA 4RIWA 2C0OA 3U6HA 3BX5A 4M13A 4HW7A 5K4IA 3S95A 2I0VA 5E8UA 4YO6A 5AIKA 4MAOA 2YZLA 3DDQA 3F3TA 2PVKA 5EYDA 2W9ZB 3EOCA 4ONAA 5AMNA 4F7LA 1KOBA 5E90A 4DITA 4TYEA 3DZQA 4RVLA 3VUMA 3H4JA 3OZ6A 4Y8DA 3EYGA 2UW8A 1DI8A 2C6TA 4LQMA 3FY0A 1Q3DA 2XM8A 5M4CA 4DCAA 3HMIA 2BR1A 3M2WA 4ZTSA 3AC4A 5C03A 2OFUA 2W4KA 2YZAA 3I6WA 1O6LA 1OUYA 2YA9A 2ZM3A 3L8PA 3QALE 3RPRA 3UJGA 4EOKA 4RRVA 3PJ3A 4TRLA 4F9CA 1X8BA 3C13A 3WF5A 4ZTRA 4O1PA 3V5WA 5ETAA 3S1HA 5K5NA 3F7ZA 5F94A 4DTBA 2CGXA 1L8TA 5DI1A 3WZDA 4BTMA 5B2MA 4LGHA 4LV5A 3D2IA 4NU1A 2XZSA 2CJMA 5CXZA 3EQFA 1WBNA 3UBDA 3W8LA 2XNMA 3ITZA 3POZA 4R5YA 1Q61A 4FTRA 5JH6A 3UO5A 4BYJA 5C4LA 3CTQA 4D2VA 2CSNA 5DG5A 5AM7A 4C8BA 4GU9A 1Y8GA 2J51A 4YO4A 1JKTA 2EVAA 1JPAA 4R3RA 3QLFA 3FE3A 3VBVA 3PA3A 3OBGA 4KINA 2R3KA 3HMPA 1VYZA 2VTLA 4FF8A 4JXFA 2HAKA 4JBOA 1R39A 4M0YA 1YWNA 4O96A 4XBUA 3RAWA 3G0EA 1FVVA 4J52A 4A9UA 4Y5QA 2JDVA 4QNYA 2OF4A 3ETAA 3MH3A 5IH5A 4K6ZA 4CT2A 3OFMA 3ORKA 3P7CA 4RA4A 4AOJA 3D4QA 4G17A 4XRJA 3IOKA 1S9JA 2A19B 3H3CA 3KRRA 3BGPA 4JG6A 4ZLOA 5AUVA 2DYLA 4C2WA 5I9ZA 3F3ZA 2VWVA 2Y6OA 3F9NA 1PY5A 3OUKA 2IO6A 4CQGA 2FVDA 1LEWA 3WF7A 2GHGA 4FBXA 4E6CA 3ZO4A 1LUFA 2YN8A 3ORPA 1SVEA 2ITXA 3E8NA 4WD5A 3DJ5A 3MGYA 4KSQA 4QMZA 4R1VA 4XV1A 2VTSA 5CU4A 1OBDA 2GPHA 2ZV8A 3KKVA 5ANJA 4DGGA 3F3UA 4CKJA 4J98A 4BCFA 3PVWA 4KIQA 4R7IA 2B9HA 2VAGA 2R3HA 3FYJX 4ALVA 2QU6A 3NPCA 3RPSA 5AP6A 3C4CA 4DH5A 5E8ZA 4CFWA 5T6KA 5FTQA 4MBIA 4XLVA 3HUBA 5JKGA 4GS6A 5LMBA 1FOTA 3P78A 2OO8X 3PTGA 2OGVA 3U4UA 3FEGA 1Q4LA 3FHRA 5IG1A 3DV3A 2BVAA 3VNTA 4AFJA 4FTLA 2DQ7X 4D4SA 3UPZA 1P4OA 4TN6A 4RX8A 3IW6A 4RJ5A 1ZYCA 4EWHA 5JN2A 4FTMA 4RIXA 4I3ZA 4N0SA 1OIQA 4J8NA 1Q8TA 4EOLA 4IX4A 3V5PA 4NFNA 4CV9A 5D41A 5BVDA 3BHTA 3TWJA 2F9GA 5CSHA 4Y85A 3MTLA 4XH6A 1XHAA 4G6NA 3BGZA 4ERKA 2QLQA 4DLIA 4FC0A 1W82A 4XG4A 4BKJA 2W1FA 3PY0A 4I5PA 4CLIA 2CGVA 3FKNA 3H9RA 2OZAA 5IQGA 5EOLA 2Z8CA 3AMAA 4CXAA 5J5SA 1BUHA 1STCE 3QQFA 4L7FA 3PPZA 4L68A 4XX9A 1WBSA 5BQ0A 4B8MA 3KMWA 1BX6A 3BYSA 4ANMA 3IW8A 4QMYA 3PZEA 3UP2A 2YAKA 1Q5KA 2JKMA 4OAUC 2R9SA 2X7FA 3GB2A 3NCGA 4FT3A 4U41A 3RHKA 2CKOA 3QRKA 3QXPA 3B2TA 4WRGA 4EYMA 4ZLYA 2ZV7A 3BYVA 2JGZA 3BLQA 4GG5A 3KVWA 1R0EA 4NK9A 1QMZA 2YM8A 3PLSA 4FG7A 3KRWA 4I94A 3A4PA 3E3PA 1TVOA 4CLJA 3W2OA 2B53A 3Q4ZA 1YXVA 3DKOA 5KNJA 5A4CA 2RGPA 5FUTA 3NW5A 2H8HA 4U8ZA 2E9NA 3BEGA 2YLFA 1YKRA 4D55A 4IVDA 3D7TA 3GCUA 2GNHA 3OXIA 3ZRKA 3HV4A 4RX7A 2FGIA 4EHGA 5DHJA 1JNKA 3FSKA 4CZYB 4IZAA 4AW2A 2PVHA 2WMVA 4FZAB 4OTPA 4QD6A 5EOBA 5L2TA 2W1CA 2AUHA 3DBDA 5EM6A 4CZUA 3AD6A 5I9UA 5CNOA 3MJ1A 2YFXA 3OOMA 3EN9A 3QTUA 3QYWA 4FVQA 5E9EA 2R3QA 3LXLA 2R2PA 1YRPA 4BDBA 3HECA 4GT4A 2XK4A 3FKOA 2XIRA 4WG5A 3AD4A 3QZHA 2W1HA 2Q0NA 4GVJA 3RKBA 3FMDA 4X2GA 3VRZA 2HELA 3EQBA 4FNXA 3MH2A 3COHA 3D94A 1E1VA 4F4PA 3GFWA 4BDCA 4YU2A 2J0MB 3DS6A 5DIAA 3M42A 5AAGA 1IA9A 4X3FB 2ITOA 2NPQA 5J79A 3TZMA 3DLZA 1KWPA 4JRNA 3NR9A 4U80A 1G3NA 5KMNA 3HAMA 3OROA 3QLGA 2IN6A 4CT1A 5AP2A 4BBFA 2X2KA 2YCSA 2XKDA 3GCQA 3BU5A 4BVUA 4EHEA 3FMJA 4JBPA 2HZ0A 4L7SA 4RX5A 3HMMA 4FV6A 3BELA 5T68A 3N4TA 2VWXA 4C34A 3G9LX 4O7LA 4HJOA 5L8JA 3AC5A 4HGSA 5M4UA 5EM5A 3S0OA 3QYZA 3NUPA 5HO7A 4DF3A 2R3LA 2BAQA 2XBAA 2WTDA 1JQHA 3DNDA 2C3IB 3B8QA 2XNGA 3C0HA 3EN6A 3MA3A 4GK4A 4YSJA 4NCTA 2E2BA 2YERA 3DZOA 4IWDA 2YDJA 3ZZEA 4GMYA 4C33A 4TL0A 2XNEA 3SXRA 3E88A 4BDFA 1OECA 3QWJA 3FXXA 4RLKA 3QZGA 4I24A 2WEIA 4A06A 2GQSA 1G5SA 1TQMA 3EFWA 4FKGA 4YGAA 3LFQA 3HAVA 4RC2A 3GENA 2R4BA 4QT1A 2R3FA 4CD0A 4EQUA 4X2JA 4AZFA 3VBYA 3I60A 4M69A 3JXWA 2XIKA 4J53A 4CVAA 4KKHA 5JZJA 4O83A 3BHVA 3EN4A 3DA6A 5HIBA 2ZVAA 4RQVA 4O0VA 2BAJA 4L9IA 1VEBA 1OL7A 3MFRA 2OKRA 4BHZA 5HQ0A 2HYYA 3VWAA 4QMPA 3FC2A 2IW6A 2I6LA 4MXOA 5HCZA 4EH3A 3JYAA 3MS9A 1OITA 4FIHA 5HBHA 5J8IA 4ZTQA 3EHAA 4XMOA 4MXXA 2W0JA 3QKKA 1H25A 3KMMA 1Q8YA 2VTTA 3R21A 4JDJA 2QKWB 3AG9A 3IW4A 4C59A 4CV8A 2EB3A 4EJNA 4RFZA 4ACDA 3EQDA 3LLAA 2JKQA 3Q9WA 3QKMA 3LMGA 1FGIA 2BPMA 5C8MA 3AC8A 4IMYA 4NM3A 3ZDIA 4BCKA 4ANLA 5E1EA 4G3GA 4K18A 3LFCA 2VWUA 1KE6A 2PVJA 4AW1A 4CFXA 4R78A 4APCA 2XB7A 4IHPA 3C50A 3DKFA 4PDPA 3ZEWA 4LM5A 4PRJA 4TYGA 3Q5IA 5M06A 4HCVA 4YBKA 3G5DA 3ZC5A 2R7BA 4BKZA 1ZZ2A 3VQHA 4EOSA 2C69A 2VGPA 3R0TA 2QONA 3MV5A 4IANA 4DGOA 3AC2A 2OICA 4XNEA 3VF8A 5BVKA 3E7VA 3A4OX 3PJCA 3KK9A 5DR6A 2B9IA 2J5EA 1H1PA 5FG8A 5A6NA 5KMMA 4G3EA 2UZWE 3U4WA 5DR9A 3U8WA 4W4YA 4BBEA 3G6GA 1KV2A 4C62A 5EYCA 4A7CA 3W1FA 4BDKA 1OKYA 2RFSA 3MVHA 4PMTA 4HGEA 3V01A 4ANOA 3CP9A 4P4CA 3UC4A 3Q4UA 5HG5A 2H6DA 5IH6A 2BKZA 3BHHA 3DAEA 2W1GA 4F6SA 3LQ8A 3HA8A 3TACA 5KBRA 2WTWA 1IR3A 3F82A 3JVSA 1V0PA 4FUXA 2J0IA 4IX3A 2WNTA 3BYUA 5AX9A 2BHEA 3R73A 3LQ5A 4B6LA 4GFMA 4UN0C 2V22A 4QYFA 5H3QA 3TV4A 1MRVA 5D7AA 3REPA 1OM1A 2B7AA 2YJSA 3GC8A 4G3FA 5CQUA 3UYSA 4AWIA 2FA2A 3PP0A 3G0FA 3L8VA 4OT6A 4AG8A 2E9OA 4GFOA 3FMHA 4MYGA 3ZM4A 2XVDA 4QP4A 5CI7A 5M55A 4L67A 4RLLA 4YC3A 5AIRA 3ZSHA 4BF2A 3RWPA 4DFYA 2B4SB 5AAFA 2X39A 2O3PA 4IVBA 4L45A 2CCIA 2PTKA 3EZVA 5LVMA 2QOQA 5AEPA 2YABA 4CMUA 3MVJA 5CF6A 4DBXA 2E9UA 3G15A 4AGCA 4OLIA 3HV3A 3E63A 3ORMA 4FTAA 3DAJA 2A27A 3D83A 5EKOA 3EQIA 3QWKA 3UQGA 3VS5A 5A4TA 2CLQA 3COMA 2WAJA 2WEVA 2Z7LA 2JIVA 3W2QA 3O71A 4RJ6A 3EN5A 4R5SA 5DWRA 3GU8A 4Q5EA 4RMZA 2BRGA 5AFVA 2W96B 3KXXA 1KV1A 3FZ1A 4I6BA 4TYIA 4U0IA 2R3NA 3I7CA 4IADA 4KBKA 4EUUA 3UNKA 3ZM9A 4E8AA 4PF4A 3KREA 4G6OA 2ESMA 4AZVA 1WMKA 1YOJA 3DPKA 4NYEA 2C4GA 3SQQA 4ERWA 4AQCA 1I09A 4E73A 4O82A 3D5UA 4LMUA 4IVCA 4XOZA 5IQEA 1PXOA 3ZRMA 4CTBA 4IB0A 3IK3A 5HGIA 3LMIA 5IU2A 4FYNA 4FUYA 4MF1A 3W10A 2YEXA 4ZJIA 3WYYA 3DK7A 3FQSA 3F5GA 4CFFA 2ZDTA 2QURA 3V04A 4RJ8A 2VX3A 3BZ3A 1ZMVA 1NVSA 5DLSA 5HOAA 4E20A 5CEKA 5M57A 5KZ0A 4DLJA 3KQ7A 4DTAA 3CKWA 2PUPA 2QR8A 4FTQA 3OCTA 4LGGA 1A9UA 5FQDC 5AR5A 2BROA 2J0KA 2WD1A 1OVEA 1FQ1B 1HCLA 4I23A 4QP3A 3TXOA 2V7OA 3IS5A 3OWPA 4IIRA 3CGFA 3NDMA 4CFNA 3QF9A 2QO9A 3HRFA 2C6IA 3GC7A 3SV0A 3PY1A 3U6IA 3D5XA 2PMLX 5ACBC 4EORA 1YXXA 2ZM4A 1J7LA 5AUWA 2OIQA 5J9LA 3KB7A 3C4WA 4FSNA 5CAUA 3GC9A 3N9XA 3RAHA 4D2WA 3UOJA 4X0MA 4EHZA 2XK9A 3VQUA 4EBVA 3LCTA 2YM4A 4GYGA 4O6EA 4DT9A 1XBBA 3O50A 1OKVA 4RZWA 3C5UA 5I9VA 4TYHB 3Q9XA 4NTTA 4FG9A 3VAPA 2XM9A 2WXVA 1XJDA 4KABA 1R0PA 4P7EA 4WBOA 1XH6A 2A1AB 3FDNA 2GNJA 2PMIA 4N6ZA 5FD2A 3VRYA 4S31A 5LVLA 4BCPA 3VN9A 3EKKA 4FIGA 3VS7A 2JBPA 4FL1A 3WE8A 1GZOA 1ND4A 4CRLA 3QA8A 3IONA 4IX6A 3V51A 5KKRB 1UWHA 5HI2A 3ATSA 3ROCA 1WCCA 2C1AA 4BWXA 3DNEA 3QTZA 5GZ8A 3DAKA 4EH4A 3U54A 4UXLA 2RG6A 3KF7A 4BIEA 1OKZA 2JDTA 2R3RA 4OBOA 4LOQA 4QMLA 3UNJA 4ZY5A 2X1NA 2WU7A 4WBBB 5B2KA 3ROYA 2QO2A 3HDNA 5LWNA 2OLCA 4XG7A 4DG2E 3MN3A 2X4ZA 4IVAA 5HVKA 3R7UA 2GS7A 4GRBA 4WSYA 4GUBA 2Z7SA 4GG7A 2NRUA 4YJUA 4RBLA 1H0VA 3Q6WA 5CT7A 3NNUA 3R9OA 4QTAA 3UIMA 3N4VA 2WPAA 4QYEA 4XG3A 4AX8A 3EQCA 4E3CA 2W1ZA 4ZEGA 2Y4IB 2O8YA 3FKLA 4DN5A 5TO8A 1M2PA 5BVEA 3UOLA 4PL5A 3E87A 2F2CB 2GCDA 4M7IA 2JDOA 3G33A 3GQLA 4TZRA 4NM7A 3R8PA 5LVNA 3CBLA 4EI4A 4P5QA 3W55A 4GJ3A 4XBRA 5F4NA 1KE9A 4CFUA 2F57A 5CF5A 2YM6A 3QQUA 1WAKA 4G2FA 3R9HA 4FKLA 2C3LA 5LWMA 5HNGA 4QQCA 3UNZA 3FAAA 5DGZA 4BKYA 3DU8A 4Y46A 3FQHA 4PWNA 1FPUA 4HZSA 2O0UA 4XOYA 5JFXA 5I3OA 4GEOA 1JKLA 2W17A 2B52A 4Y73A 5EW8A 5A4EA 3HKOA 3GCSA 1V1KA 3I5ZA 3LCKA 5J1VA 3HDMA 3AOXA 3R1NA 3W16A 1O9UA 5A4LA 3NUYA 3MPAA 3LZBA 4CFVA 4D9TA 4YPDA 3EJ1A 3A7JA 2JC6A 4E7WA 2WOUA 4ZSLA 4DFBA 4H1MA 4HCUA 3ET7A 1KOAA 3BQCA 3O8TA 2BZIB 1B6CB 2UV2A 4FKTA 4OTFA 4BR3A 4RIWB 4EC8A 3OUNB 4KRCA 3RCJA 2WMBA 4FK6A 4Q5HA 2GNFA 2G2IA 2YIWA 3CPBA 4F7NA 2QD9A 1H4LA 2B54A 5CAPA 3VBQA 4QTBA 3TUDA 2J5FA 4AA0A 1GJOA 4CSVA 3T3VA 5I0BA 3QXOA 5FEEA 4HVSA 4KSPA 2GS6A 3FLWA 5A6OA 3R6XA 2V7AA 4FYOA 3PSBA 4II5A 3LAUA 4IAZA 4FKSA 3GUBA 3NEWA 1J7UA 3SC1A 2J0LA 5AJQA 3O0GA 3PXKA 2O63A 3R7OA 2EUFB 4CCBA 2XS0A 3TZ9A 2JIUA 4NM5A 3RNIA 3UPXA 1W7HA 1M52A 5DBXA 3LLTA 2QOOA 4BDEA 4MF0A 5CAQA 2F7ZE 3UYTA 3FI4A 3COKA 4CZTA 4RC4A 5M51A 4DAWA 2WTIA 4ITJA 4D2PA 3FI8A 3TI1A 2QR7A 2UUEA 2ITVA 3PVGA 3PXQA 3ULIA 1QPJA 4YTHA 4GU6A 1H24A 4DH3A 4OUCA 3MW1A 4FKVA 5DR2A 3A7IA 2H34A 5BYYA 1K9AA 3RVGA 2JBOA 4HPTE 3EFLA 3V5LA 2W1EA 4ZSGA 5DEWA 4DFUA 2ZB0A 4BDHA 3ENHA 3UZRA 4IWQA 4IZ7A 2HWPA 4CQEA 3EL8A 1OL5A 4BGGA 3LM5A 2VUWA 1WBVA 4EZ3A 3EKNA 3K54A 3TM0A 4N4SA 1OMWA 2UZUE 1SYKA 3UOKA 4NL0A 1Z57A 1AD5A 4EH9A 3UODA 3PA4A 3FMMA 4MHAA 3R7EA 4NJ3A 3HNGA 5ETFA 3EB0A 4MKCA 3F66A 5JFWA 3ZO1A 1IEPA 2QOIA 4CYIA 2UZEA 2RIOA 5BVFA 3CSVA 4C3PA 5HLNA 3RCDA 4AP7A 5HBJA 2ZAZA 2GHMA 3KY2A 4IQ6A 3F2NA 2GDOA 4ALUA 3KVXA 2HK5A 3RK5A 3TNIA 2KTYA 3PXYA 4DG3E 5EI2A 4BDDA 2X7OA 4FKWA 4FV1A 4CKRA 5BYZA 4QP8A 2W99B 1FVRA 3LVPA 3DT1A 3SLSA 1SVGA 2C68A 3TN8A 1EH4A 4F1TA 4F6UA 5FXRA 2UW4A 4MXAA 4QP1A 2OWBA 3SXSA 1VJYA 4AW5A 3FLQA 4PMSA 5IQFA 2FB8A 3V8WA 2WMQA 2H96A 4O7NA 5E8WA 4C4EA 4ORKA 1H0WA 4YC8A 3TNWA 1GAGA 3OTVA
chains in the Genus database with same CATH superfamily
3Q9YA 3FYKX 4RIXB 1RW8A 3OMVA 1A48A 4LUEA 4DGMA 3Q04A 2WIHA 1CMKE 5ETCA 2IW8A 3QRIA 4FKOA 3PIXA 4MD8E 1F5QA 3IO7A 4XCUA 3G51A 3QX2A 3OCGA 2IG7A 3NYNA 4UBAA 4DYMA 3U6JA 3FZRA 2WIPA 3QD0A 4EK8A 3TZ8A 5M07A 4L44A 3QTQA 2QNJA 4AT3A 2HZNA 4C4JA 3BRBA 5EH0A 2OZAB 3CPCA 1L3RE 4UMRA 4LOPA 4MXYA 5HD4A 4I5CA 3FHIA 4M8TA 4NIFA 3ZFMA 3MB6A 4EJ7A 4RFMA 3O7LD 5HIEA 4FEUA 4O22A 3MPMA 4X2KA 2XK6A 4RGJA 3MA6A 4BI1A 4ZY6A 1XKKA 4R3CA 4NKAA 1H1SA 2OK1A 3UMWA 1PMEA 2WMRA 4GH2A 4BBMA 2EU9A 3NIZA 1H08A 5DA3A 3IECA 2BFXA 5E4HA 4FTOA 3LM0A 2IF8A 5I5ZA 3CQWA 1XQZA 4K2RA 4M14A 5FWKK 3WF6A 4D4RA 4EKLA 3IQ7A 1VZOA 3W2PA 1P4FA 2E9PA 2VX1A 2WTCA 3CD3A 4FSWA 4BYIA 2X6EA 3QX4A 3EQRA 2JIIA 2WTKB 4X3FC 2IPXA 2CGWA 3KL8A 3QTRA 4A9YA 4CKIA 4XV9A 3GCPA 2ERZE 2UW3A 4FL3A 4NSTA 3I6UA 3O7LB 4FKIA 3D7TB 4FV8A 4GL9A 1Y8YA 4HNFA 4KBAA 3GNIB 4YJPA 5CVGA 1XH5A 2IZRA 2X2MA 2YLEA 2JFMA 4I6HA 3ZH8A 2X8EA 4DFLA 4O7RA 3LFAA 4DFNA 3WZJA 3UZPA 3SG8A 1YDSE 3QQGA 3GP0A 4PL3A 5BVWA 2EB2A 2XYNA 4HCTA 3V5JA 2Z02A 2C1BA 3TTJA 1UVRA 4E26A 5H9BA 4I0SA 4QQ5A 5BUJA 4KIKB 5M4IA 4JDIA 4IFGA 1ZMWA 4B0GA 4X6RA 3NLBA 4F65A 4CMOA 1JLUE 2R3JA 1OKWA 4QPAA 4FSUA 2YJRA 3C5IA 4MEDA 3QUPA 3ORLA 4CMTA 2ITZA 5JFVA 2C6EA 3NYVA 5HD7A 4IXPA 4BCOA 4ZSJA 3FC1X 5BUIA 3R30A 4YC6A 4UMUA 4OTRA 3ATTA 5TF9A 2RSVA 1OL1A 5FEDA 4C35A 5HCXA 4X3JA 1BI8A 4MTAA 5AUTA 3I0OA 4JOAA 1VYWA 4JDKA 1KE5A 4RIYA 5HTCA 4JQ8A 1W98A 4Z7GA 4NT4A 3D14A 4AOIA 3FLSA 2HOGA 2QODA 2W7XA 3A61A 1JKKA 1OZ1A 1Q97A 5HE2A 2BALA 2C3JA 4N57A 4LYNA 3CY3A 2ZDUA 3CXWA 3KA0A 3V6RA 4ASEA 4MWHA 4E6QA 3RZFA 2I0HA 3DK6A 4W9XA 4DEAA 4B8LA 4ZZOA 2YWVA 3D7ZA 4JIKA 4IEBA 3GVUA 4U5JA 3SXFA 2C5OA 2VNYA 3ZLYA 3HGKA 4Y72A 4CEGA 4WNKA 2VU3A 5H8EA 3O2MA 3EN7A 3EYHA 4FTTA 4QP6A 3OVVA 5HG9A 3R00A 3UE4A 3WILA 4B99A 4IM0A 4YURA 5K0XA 2PUIA 4MUQA 2QOKA 3AKKA 2LAVA 4F9WA 2C6DA 3BE2A 3PG3A 4GCJA 2OJFE 4KKEA 1APME 3NNWA 3TZ7A 4FV7A 3ZZWA 2AEGA 2BAKA 3W18A 1NVQA 2WHBA 4OGRA 2C5XA 3I0QA 5H2UA 5B0XA 4ENXA 4AU8A 3OT8A 5ICPA 4ZTNA 4FTJA 5I9YA 3AT4A 3VHEA 4M69B 4JG7A 1AGWA 4E5WA 4F9BA 4IW0A 1Q8UA 2IVTA 1YOLA 2VO3A 3D0EA 4DBNA 2VTIA 3FXZA 4AT5A 2XCKA 4OBQA 1MUOA 5IEYA 2WTVA 4Y95A 4YBJA 5CEIA 3UQCA 4FGBA 5CT0A 4H1JA 3A8XA 3ZUUA 5KX8A 3AGMA 3NUXA 3TNQB 4AFEA 2QVSE 4NKSA 1MRUA 5C1QB 2CNUA 4C38A 3L8XA 4U42A 4XUFA 3CJFA 5CY3A 3RGFA 1W84A 3CQUA 4CYJA 2VRXA 3TDWA 2Y0AA 4U3YA 1SVHA 3KK8A 3F5XA 3LOKA 5DT0A 4I4FA 2C5VA 3FY2A 5JFSA 5EK7A 1JVPP 5KZIA 4K1BA 2OIDA 2FSTX 3ZLXA 3KN5A 4JVGA 3FZSA 4KIKA 3BV2A 4KKGA 2JDSA 1YXTA 3QGWA 5EKNA 1V0BA 4IAFA 4P5ZA 4EK3A 4PTEA 2QHMA 3E7OA 2UVZA 2WMUA 4PL4A 4DH8A 3VS4A 5ACKA 4D4YA 5J5TA 4FV2A 3H9FA 3E8EA 4MBLA 5CAVA 5FEQA 3CEKA 4KBCA 5E8XA 1B38A 4LUDA 5ITAA 4M97A 4U97A 3G2FA 3ULZA 3IG7A 4PQNA 4TW9A 2UZDA 5KMIA 1YHSA 4RWKA 2WQMA 4HGTA 1JSVA 2PVLA 1SNXA 3RAIA 2FH9A 5JZNA 2AC5A 1ZMUA 4RG0A 3MVLA 3T3UA 1U54B 3IOPA 1NXKA 2R3PA 3AMBA 3UIBA 4IAAA 4GV1A 4KWPA 4MXCA 4FSRA 2OBJA 2XMYA 3A2CA 5HTBA 3ZTXA 5IMEA 3LPBA 3FLZA 5C8KA 3MSSA 4HYHA 3ZXZA 4I5MA 4CG8A 3ZFYA 4IACA 3DQXA 4L53A 4Q2AA 2HCKA 3FPQA 3D9VA 2CDZA 2WELA 4FOBA 2ZMCA 4UYAA 1YHWA 4NW5A 4BCMA 2B9FA 5AUZA 3TV6A 4BFMA 5CF4A 3VS6A 4F9AA 3I5NA 3VBWA 3BE9A 1M14A 5EQYA 2PUUA 2XEZA 4JBVA 3ODZX 4XP2A 4ZMFA 5FP6A 3WARA 3T9TA 3IGOA 5EQPA 3W0SA 3LJ1A 4CG9A 2GNGA 2P33A 3UMXA 2XIZA 2XP2A 4F70A 2NNWB 4D4VA 4E6DA 2Z2WA 5HTIA 3DB6A 2O65A 4USDA 4EEVA 2G01A 2QOBA 2WMAA 3GQIA 5AP1A 2QC6A 2XK8A 1MRYA 1PW2A 3FWQA 5K0KA 3MVMA 2VTPA 2C5YA 5CYIA 4F08A 1CSNA 4G1WA 4BDIA 3UIXA 4TKSA 3W0OA 3E62A 1Z5MA 2PVNA 4TYJA 3UOHA 5CF8A 4QDVA 5JT2A 5AP0A 3LE6A 5KMOA 5CU2A 5IKWA 4F7SA 1OGUA 4FTNA 5AP4A 3TL8A 3RZBA 4E4NA 4IDVA 2OXYA 4IZ5A 4O6LA 2IZTA 3AQVA 5LOHA 4E6AA 4HGLA 4E4MA 4XG9A 4YLKA 5J9ZA 2UW5A 5L2QA 4R8QA 5HEZA 5IA5A 4QMXA 3DFCB 3SOAA 3ZEPA 3ZYAA 3TCPA 4FIFA 4I0RA 5CU0A 2XKFA 4GKHA 3R22A 1Q24A 2F7XE 4LL5A 5KMLA 3P7AA 5HE3A 1GIHA 2R5TA 4V04A 3I7BA 5AAEA 3VJOA 2P3GX 3HP2A 1J3HA 3LCDA 5T3QA 4DCEA 5BUEA 3RAKA 2UW9A 2XNPA 3MJ2A 4LG4A 2WGJA 1WBPA 3DK3A 3E8DA 3GC0A 4IDTA 3OWKA 4RFYA 5F1ZA 4R1YA 4FICA 4YNOA 2OF2A 2JD5A 2ZMDA 3HMNA 3LFFA 4IE9A 4LV7A 2VWBA 4JG8A 1XMLA 4KB8A 3W2CA 4FSQA 3R7IA 4C61A 3IDPA 1U54A 3HV6A 3LFSA 1CKPA 3ACKA 4C4FA 3CD8A 4QDEA 4WRSA 3Q4TA 1JBPE 2XIYA 5CSWA 3GFEA 5LMKC 3R8ZA 3VS0A 5FM3A 4AT4A 4EK5A 5KKRC 3BLHA 3KCFA 4UEUA 3L9PA 4O27B 5I9WA 2V0DA 2F4JA 4EH2A 1ZY4A 1G8AA 3GGFA 3AGLA 3R9NA 4HNIA 3TNHA 4ACGA 4L52A 3OS3A 1M2QA 3HRBA 4EQCA 4QEBA 4XP0A 3OCSA 3NSZA 3RM7A 5AM6A 4DHFA 2VZ6A 1ZYSA 3OWLA 1UU8A 3LKMA 2V62A 4FSMA 2VN9A 3FSFA 2GHLA 2OFVA 2XJ2A 3ZBFA 3QU0A 1OGYA 2PL0A 1YDRE 3QTSA 4TWOA 4D2SA 5ANEA 4U3ZA 1XH7A 1ZRZA 3FZTA 2RKUA 4ITIA 2VTQA 3G9NA 3GU7A 2Y4IC 4U43A 3JVRA 4KRDA 1ZLTA 4X6QC 1NA7A 5EW3A 3ZBXA 3SOCA 2W9FB 2WMTA 2BDFA 4FTUA 2UZOA 4C2VA 4DINA 3MPTA 4HVGA 4FV4A 4X7QA 4KIOA 4UWYA 3HRCA 4JBQA 5CSXA 4LI5A 5L2WA 4O7WA 3K3JA 3HEGA 3ZSGA 1KE8A 4FV5A 5A14A 4DA5A 3PE1A 4PMPA 4O0TA 2B1PA 4EK6A 4OTIA 3VS1A 4BN1A 3ZO3A 2ONLC 5L2SA 2OU7A 4YZ9A 3UIUA 5J1WA 3FMNA 4AZSA 3HMOA 2REIA 5IQDA 3ZU7A 5AP7A 3R1QA 1UNHA 4O0SA 5CSVA 2PYWA 3PVUA 5CZHA 2Z7QA 5HVYA 5CEQA 1QCFA 5AR2A 3H10A 3UO4A 2R64A 2JDRA 3WF8A 4C58A 4QYHA 3R02A 3S4QA 4LMNA 4QMOA 4NEUA 3VC4A 3NFGB 4C3FA 4IWPA 5C27A 1AQ1A 5HX8A 2YM5A 5CWZA 5CS6A 3C7QA 3P4KA 3RPYA 3TG1A 4Z7HA 3T8OA 1ZXEA 3VF9A 2BUJA 5JEBA 4F1MA 3OD6X 3ORNA 1U5QA 5CEPA 4S2ZA 5E91A 4BWPA 3EL7A 3PRIA 4JJRA 4FZ7A 5JMSA 4TT7A 4JL9A 3EQGA 3EFJA 3PXFA 5E7RA 3FBVA 3K5VA 4RIOA 2Y9QA 4CRSA 4O7ZA 1MP8A 4X21A 2B55A 5L3AA 5DVRA 2BRBA 4G16A 1LPUA 4H39A 4DDGA 3T9IA 2PVMA 3TEIA 2PMNX 2RF9A 4FV9A 5IEXA 4AACA 5KO1A 1FGKA 2XYUA 4I0TA 5HHWA 3N4UA 4F78A 5GIPE 4YJSA 3L8SA 3QQJA 4S30A 4AXDA 4BCGA 4PP9A 3BWFA 3KF4A 3PY3A 1KSWA 3LFDA 3R9DA 1CTPE 5FTOA 5FTGA 3JS2A 2YAAA 3C9WA 3IDCA 3WIKA 4ACHA 2QI8A 4FV3A 4DGNA 3QCXA 4F6WA 3IW5A 3RK7A 4CFMA 3OY1A 1GIJA 3H0YA 3HZTA 5CLPA 5GJDA 2X9FA 1WFCA 2Y8OA 3B2WA 3DOGA 1DAYA 2G9XA 4O91A 4GIHA 4I5HA 5ANGA 4O86A 3C4XA 1URCA 3R1SA 1PXPA 1XBCA 5L2IA 1BKXA 4BICA 2VWWA 1H1WA 3QCYA 4FNYA 5FDXA 4JMQA 2PK9A 4YJOA 1NT2A 2F7EE 3ZUTA 1FMOE 1SMHA 2OJJA 4ZXTA 4M15A 4O0WA 1XWSA 2W05A 2BDWA 4RVTA 1PHKA 4XYFA 3SKCA 4BI0A 3MY5A 2OW3A 4FG8A 2W5BA 1H1QA 5EHYA 2R3MA 3SD0A 2DWBA 2XKCA 2HWOA 4EH8A 3TUBA 4BY9E 2ITPA 5IMXA 3O17A 5BMSA 3LCSA 2GNIA 4ZOGA 1U4DA 2PUNA 5AV4A 2GMXA 2A2AA 3PIZA 3BPRA 4TNBA 1ZYDA 2GTMA 4IZYA 4Y5HA 4O84A 4EQMA 4XP3A 4OW8A 3QTIA 2UZTA 3VS3A 1DI9A 4KAOA 4U44A 4QMNA 3PWYA 3TTIA 5AUXA 3BEAA 1H00A 4HZRA 2E9VA 4L8MA 3V5QA 2PULA 3GU5A 3KN6A 1T46A 2XK7A 4FRFA 4L6QA 4FIEA 4I6QA 2CGUA 5CNNA 4JAIA 4P2KA 5AUUA 3C0IA 3HYHA 4IC7A 4WSQA 1H1RA 3Q5ZA 2B9JA 4J7BA 4G34A 4EWQA 4D9UA 5IQHA 3RTPA 2PZPA 4IM2A 4A9TA 2BCJA 4PNKA 1YI4A 4WHZA 1WVXA 3I81A 1WBOA 4IAYA 4BC6A 1Z9XA 4AGWA 2J4ZA 4KA3A 4TWNA 4DEEA 1PMNA 5HU3A 2JAMA 3HVCA 4UXQA 5ANDA 5I3RA 3DGKA 4ENYA 1UWJA 4QPMA 2XJ0A 4WNOA 1PMVA 3LHJA 4ZK5A 2PVRA 4UWCA 3NZ0A 4YHJA 4D28A 4MNFA 2PZRA 3CJGA 3R7YA 4C36A 3VUKA 4D2RA 1IG1A 3ID6C 3JY9A 3HP5A 3ZLSA 3HX4A 4RVKA 3MBLA 3C0GA 2UZLA 2I1MA 4DH7A 3VO3A 3UZTA 4MD9E 3PJ8A 1BI7A 5CQWA 3EQPA 1ZAOA 3SW4A 3V5TA 5CU6A 4LOOA 3KMUA 4BTKA 4QMUA 3GU4A 3UG1A 4EH5A 2UZBA 4FNZA 5FXQA 3LJ0A 4L3PA 3TKHA 3QUDA 4MCVA 2C6LA 3MI9A 3PUFC 3OW3A 2JEDA 4FODA 3FI3A 3PA5A 4QMQA 1RE8A 3PPJA 1YOMA 4I93A 2RFEA 4H3QA 4MVFA 4ZS0A 5FP5A 2X8IA 4F99A 3BL9A 4Z3VA 3W2RA 1Q62A 4BRXA 4UZDA 4F0GA 2GQGA 2VWYA 5HBEA 2OJIA 4AA4A 3O96A 1FBNA 5C8NA 3C4ZA 4UZHA 1Y57A 5E8YA 4YTFA 1OUKA 4OTGA 5D1JA 5C01A 4UB7A 2BDJA 3MYGA 3IGGA 1ERKA 2IVUA 5H8GA 4XHKB 2I0EA 1ZOHA 2PZYA 4GIIA 5DH3A 4C57A 4EZ7A 3DXPA 2C3KA 3LIJA 5ANIA 1HCKA 1TKIA 5G1XA 4EKKA 3MY0A 1URWA 4WUAA 5BVNA 3PUPA 4TPTA 4N70A 2LGCA 4YJVA 5BNJA 4I92A 4BCQA 3NVMB 3AXWA 5AR4A 4JI9A 5A54A 2BFYA 5FXSA 1B39A 2ACXA 4F0FA 1GZNA 2WU6A 5EHOA 4AE9A 3QCSA 2WB8A 1O6YA 2H9VA 3U87A 2ITUA 5LCKA 4O4EA 2CCHA 3S3IA 5IQBA 3HA6A 4ARKA 4L3LA 5HNBA 4LRMA 4QO9A 3KXHA 3HUCA 5C4KA 3QFVA 2YWPA 4PX6A 3UVPA 1ZWSA 2C0TA 3NNVA 2VGOA 3FJQE 5DRDA 3TIYA 4EH7A 4FGRA 3NAXA 4KS8A 5GJFA 2VD5A 2CHLA 2F2UA 1ATPE 3RHXA 4BGQA 1UU7A 3NFFB 2WTKC 3DY7A 1J91A 3F61A 3F3VA 4AAAA 2W4OA 4W8DA 4O81A 2HZ4A 1FMKA 1R3CA 3ODYX 4O1OA 3BYMA 4NH1A 3OHTA 3FZOA 2YM7A 3KEXA 3BGQA 4JNWA 4WO5A 4WT6A 3V6SA 5CANA 4NIFB 5L6OA 5CVHA 2J6MA 2XIXA 1ZYLA 4FEVA 4FOCA 3SA0A 3BI6A 5J95A 4K77A 2BRNA 3S00A 4W4VA 3R8MA 4AGDA 4BDJA 5M4FA 3Q9ZA 3PFQA 3U51A 3ORIA 3OTUA 3G90X 2WKMA 5HU9A 2G1TA 4R6VA 4BB4A 5F95A 5I9XA 1LEZA 1PYXA 2P2HA 5AV0A 2O5KA 5JGAA 2CKEA 3RPVA 4AW0A 1YI3A 4S33A 2YISA 1QPCA 3GT8A 1JWHA 1PKGA 1CM8A 4GT3A 4RC3A 4L46A 4TY1A 5J7BA 3TV7A 5EFQA 1PXMA 3DBQA 1PYEA 2J50A 5E92A 3W8QA 2F49A 5GINE 4W8EA 5H8BA 3R8LA 4IC8A 4PNIA 5JRSA 4O7SA 2Z7RA 1UU9A 4YZCA 2QOHA 5HG8A 4AOTA 3BU3A 2QG5A 4FVRA 4F09A 4M3QA 3WIGA 5FGKA 4ZJVA 5HNIX 5AUYA 4GK3A 4QMTA 4UWBA 1CKIA 3JY0A 3VS2A 3CCNA 5DOSA 1GZ8A 4FI1A 4PMMA 2WMSA 3QHRA 4K9YA 2ZM1A 2WQEA 5IUGA 1PRYA 3WF9A 2A98A 4JR7A 5EI6A 3HV5A 2R0UA 4PP7A 4DEGA 2XA4A 4XG2A 3ELJA 4E5AX 2A0CX 2YIXA 2BZJA 4NCTC 3OT3A 3RBWA 1PXIA 5GNKA 3VULA 3CIKA 3Q2JA 5IQAA 3TJCA 4IH8A 4WUNA 3QC4A 1IRKA 4KNBA 4EBWA 2VTRA 2UZVA 3SRVB 4C4GA 5A9UA 3ORTA 3VBXA 4FMQA 1XH4A 4FT5A 5CTPA 5G6VA 3PJ1A 4RIYB 4JQEA 4AAYA 1E1XA 5DE2A 4BI2A 1YWRA 4YHFA 2VO0A 3MWUA 5TKDA 4D5KA 2FUMA 2WMWA 3EFKA 4A9SA 4FKQA 4MNEB 3OF0A 2JKKA 4YLJA 3FMEA 4O38A 4FKUA 3KCKA 3THBA 4DT8A 4EK4A 5IDPA 4U45A 3WBLA 3R8UA 4ASZA 3F5PA 2QOCA 5BV3A 5JK3A 3II5A 2XRWA 3VUGA 5CASA 2WQBA 4HYSA 5M56A 2YITA 3P08A 3TNPC 3EMGA 4C4HA 4DTKA 1E9HA 1U46A 2V55A 2CPKE 4WNPA 5EHLA 1WZYA 4U40A 1DAWA 1RQQA 2WQOA 4O7TA 2HW7A 3PP1A 1H8FA 3LXKA 3BHYA 5AV2A 2Y6MA 3KULA 3KRLA 2VO6A 4OT5A 5IH4A 3Q3BA 3QGYA 5J7HA 4I4EA 2G15A 3B8RA 1H27A 4F0IA 4GFGA 5AWMA 4RJ7A 5HLPA 5L6PA 3QCQA 4Q9SA 4IB3A 2G2FA 4Z55A 3ERKA 3RP9A 2OG8A 1P14A 1FVTA 1BL6A 4GT5A 3D5VA 3LFNA 3R71A 2X0GA 3ANQA 3K2LA 4TWPA 3CY2A 3F2RA 3JR1A 2P55A 2JAVA 3WZKA 5DN3A 3I4BA 4YZDA 3G6HA 2WQNA 4ZAUA 2C6OA 5AV3A 4L00A 3FQEA 3OW4A 4O0RA 4MBJA 4BWKA 5L4QA 5GIOE 3BCEA 3GXLA 3MIAA 1FINA 4FKJA 5K9IA 2VTOA 2Q83A 5CI6A 1GIIA 2NO3A 3P9JA 2OSCA 3WZEA 3NMUF 3TMOA 4I21A 4XLIA 4FT0A 1F3MC 1ZZLA 4MX9A 3VW8A 3WI6A 5AP5A 5EI8A 4ZJJA 2AC3A 4WKQA 3OC1A 4TNDA 5LXMA 4QQJA 1JOWB 2ZOQA 2VTHA 3P5JC 1M7NA 2ITQA 4OTWA 2PMOX 5DMZA 2BRMA 4F64A 4PY1A 4FSYA 4FL2A 3OEFX 3SRVA 2XNOA 4F9YA 3NS9A 2XEYA 5KHXA 3QD2B 4NTSA 4QMMA 5FM2A 4DHJA 2X4FA 4J97A 2RL5A 2JITA 2Z60A 2ZV9A 4YUQA 4S34A 3RINA 4I22A 4EL9A 3JUHA 4YZNA 1CKJA 5HLWA 4A9RA 3MB7A 3NNXA 4MNEA 5EYKA 2NP8A 3MDYA 4FT9A 4BCNA 3TT0A 5F9EA 4R7BA 1U59A 3VJNA 2GNLA 3P1AA 4KS7A 4BCJA 3UDZA 3OY3A 5HIDA 5GJGA 4JDHA 4WG3A 4YJTA 2GFSA 4AZWA 3FMKA 2ZJWA 4WNMA 5CVFA 3ZUVA 3CQEA 3QKLA 2YACA 3A62A 3AC1A 3ZOSA 4BZDA 3E5AA 4A4XA 1UU3A 3KXGA 4BL1A 3MY1A 1WVWA 3SGCA 1U5RA 3Q60A 5EM7A 4I20A 5LJJA 3P23A 4XJ0A 3OBJA 4GSBA 5LVOA 3QC9A 2ITWA 5J9YA 2XRUA 3UTOA 5DPVA 3ZCLA 3HL7A 4QP9A 4UMQA 3KIOC 4FV0A 3NUUA 3VONA 2QOLA 4D1ZA 2BKKA 4RWIA 3W0RA 2CKPA 3GCVA 3GBZA 3NYXA 4D5HA 3A7GA 1UKHA 4M67A 4ANSA 4YJNA 5HCYA 5KUPA 2ZB1A 4O7YA 4D2TA 1IAHA 3HLLA 4YZMA 2WO6A 3R2YA 4HPUE 4EOPA 4EC9A 4KIPA 3R01A 4IM3A 2SRCA 3MFTA 1W8CA 3WE4A 3H9OA 3KRJA 3ZFXA 2QCSA 3QRJA 5F20A 3P7BA 4ACCA 3K3IA 2R3OA 4PDSA 1QPEA 4MQ1A 2UZNA 4G5JA 5A3XA 2W1DA 1PXJA 4TXCA 3C1XA 4UMTA 3QBNA 3UC3A 1PXLA 3IDBA 3TKUA 4Z16A 2XJ1A 4RSSA 3PE2A 4L3JA 2W1IA 4E4LA 4B9DA 5TOZA 4B7TA 4GUEA 3UGCA 4UMPA 4A4LA 4J95A 2YHVA 3BBTB 3ORZA 5IISA 1M2RA 3OCBA 3OEZA 4MH7A 3R2BA 3DQWA 2I0YA 3BYOA 4LRJA 4XV3A 4DH1A 4NM0A 5EW9A 5HO6A 2HXLA 3PSDA 1O6KA 4FSTA 1J7IA 3AT2A 3MIYA 5CEOA 3ALOA 5IUHA 5E8TA 1PXKA 3E92A 4QMWA 3PYYA 4F63A 2HENA 5CXHA 5JRQA 5DT4A 3DDPA 4ZTLA 5J87A 1SM2A 3DBEA 1H01A 1W0XC 4H3PA 4HVDA 3BV3A 5JGDA 3TUCA 5IQIA 3O5AA 3Q53A 4JS8A 3QHWA 2PY3A 3JPVA 3UQFA 2EXCX 1OBGA 2XNNA 3W2SA 4QRCA 3U55A 5D7VA 2QKRA 2RFNA 3CTJA 1YXSA 1WBTA 4YP8A 1R1WA 5D10A 3DTCA 4IB1A 4E4XA 4M84A 1OB3A 3QD4A 3QZIA 4LRKA 3MESA 5EQEA 3W0PA 1DS5A 5GZAA 4K33A 3TIZA 3V8SA 4D58A 5M53A 4FT7A 4I1ZA 3AMYA 4A07A 3NUAA 5TT7A 4FKRA 5EM8A 3FPMA 2OJ9A 3FXWA 1J1BA 3Q32A 4FIJA 1GOLA 3NW7A 5BX0A 2OH4A 4B4LA 4MWIA 3LFEA 3W0NA 1XH9A 3Q6UA 4W9WA 5GZ9A 5CEMA 2CKQA 3DKGA 2OI4X 5CU3A 5DFPA 4FNWA 2VTNA 2FO0A 1GNGA 4NJDA 3H30A 4EZ5A 4CCUA 1OL2A 2PVYA 1H07A 4EOIA 4HVIA 5AADA 5FBNC 3RJCA 4K11A 3NRMA 2X0PA 3QZFA 4WOVA 1R78A 5A46A 3QUEA 4RJ4A 3L9NA 4G3DA 3ZXTA 4ASXA 4BIDA 5KMKA 1PF8A 1ZYJA 1OIYA 4UY9A 3ZC6A 4AXFA 3ZDUA 4ITHA 2YIQA 4J96A 3RPOA 2EXEA 2PVFA 4FJVA 2ETKA 3M11A 2DS1A 4ZP5A 3V3VA 5K4JA 3TYKA 3PFYA 5CZIA 3DB8A 3VUTA 4BJJA 4FA2A 2CN5A 3SHEA 4JT3A 4JAJA 5EDPA 4USEA 2I7QA 3ZLWA 4NUSA 3F69A 2J9MA 4WIHA 4IJPA 5CSPA 2JKOA 3BHUA 3FMLA 2XCHA 4BDAA 1H26A 1LP4A 4FSZA 3ACJA 2R7IA 3L9MA 4JX7A 5DT3A 4LL0A 4MXZA 3SDJA 5JQ5A 4O4BB 3DLSA 4GJ2A 5B7VA 3R28A 4OTDA 1DM2A 2NRYA 5E8SA 2IW9A 4HYIA 1CDKA 2G2HA 2VWIA 4ZIMA 4ANBA 1OL6A 2A4LA 4ASDA 2GSFA 3Q4CA 4OR5A 2JFLA 5TR6A 4P90A 4DEIA 4MD7E 1OIUA 4PV0A 5D9HA 5CALA 4YTIA 1SZMA 4R77A 1IA8A 4BZNA 3E3BX 3V8TA 4L43A 5IA3A 4ZMEA 1NVRA 5CAOA 4FTIA 4I41A 4AA5A 1T45A 1Q3WA 4ZZNA 3OXZA 1XR1A 2PZ5A 4FZ6A 3QQHA 5KE0A 2GFCA 4FZDB 3FI2A 5M09A 3D15A 1W2FA 4EOOA 4AXAA 4DG0E 3R9RA 4W4XA 3VVHA 1ZY5A 1Y6AA 2Y7JA 3QAME 3QRTA 3NUSA 1TQPA 3CKXA 4V01A 4PTCA 3PJ2A 5JQ8A 3AKLA 4NZWB 2XBJA 5IPJA 4D0WA 3VBTA 5BPYA 2P0CA 4PDOA 3CLYA 2GTNA 4EOJA 4X3FA 4XG8A 5GHVA 3QRUA 2ETMA 3FV8A 3ANRA 4QMSA 5FLFA 2C30A 3KXZA 4MQ2A 2J90A 2VNWA 5KHWA 2UW6A 1QPDA 4Y83A 5A4QA 1Y91A 3L9LA 4BTFA 4DC2A 1M7QA 5ETIA 2Y4PA 5BMMA 3FLNC 1H28A 5TE0A 3DJ6A 3R7GA 4CTCA 3TJDA 2IVVA 2WFYA 3W0QA 2R3IA 2J7TA 3VW6A 4BDGA 4ZLZA 3NYOA 4JR3A 3E8CA 4FX3A 3MH1A 3SX9A 3NX8A 4DHIB 4FEQA 3QQLA 4K8AA 3S2PA 5L8LA 3RK9A 2PPQA 2ERKA 1UKIA 2FYSA 3VIDA 1YW2A 2BHHA 3PXRA 4AZTA 1IAJA 4QP2A 3LJ2A 2BRHA 3KU2A 3POOA 3F3WA 3EZRA 5DEYA 4QPS