2UW6A

Structure of pka-pkb chimera complexed with (s)-2-(4-chloro-phenyl)- 2-(4-1h-pyrazol-4-yl)-phenyl)-ethylamine
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
337
structure length
334
Chain Sequence
SVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVMLVKHMETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLTKLEFSFKDNSNLYMVMEYAPGGEMFSHLRRIGRFEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLMIDQQGYIKVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFSEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/inhibitor
molecule keywords CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC SUBUNIT
publication title Identification of Inhibitors of Protein Kinase B Using Fragment-Based Lead Discovery
pubmed doi rcsb
source organism Bos taurus
total genus 104
structure length 334
sequence length 337
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2007-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2uw6A01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2uw6A02
3GVUA 3E3BX 3UO6A 4A4LA 3SG9A 1LPUA 5K4JA 2XKCA 4RJ5A 3ZOSA 3LQ8A 3PLAE 3TI1A 3MVMA 5FBOA 4BGQA 2XK9A 1H4LA 5I9UA 3U55A 2W9ZB 2VO0A 1BL6A 3HA6A 2FSTX 4ZSLA 5KMLA 5AUZA 3FLWA 4OTHA 3Q9WA 3QX4A 4UEUA 5GZAA 4FV7A 2RF9A 3O8TA 4CXAA 4DTBA 5A6NA 2PUUA 5IU2A 4GKIA 3PJ8A 5C4KA 3QC4A 3NUYA 2BRGA 1CKIA 3CY2A 4FEQA 4IANA 4C2WA 4AXAA 3BE2A 3SV0A 3E88A 3KRWA 1DI9A 1JWHA 2JITA 3FMKA 3UMXA 3ZO2A 3R71A 4WO5A 3G33A 4D2WA 4DLJA 4U45A 3JPVA 2G01A 4I4EA 1FVVA 5JFSA 5I3OA 2R3GA 4J95A 4FYOA 1ZAOA 3FC2A 3MWUA 4N0SA 3PSDA 4G34A 2X7GA 3DKCA 3CTHA 1GZKA 3LFFA 3AMAA 4FKTA 4PUZA 3WI6A 1WAKA 4MXAA 4K8AA 5B2KA 2X0GA 2VN9A 5H2UA 3ZC5A 1PKGA 5AR5A 4QPMA 4CZTA 3U54A 3W2QA 3G5DA 3MS9A 5DWRA 4E20A 4E6QA 3FSFA 2GU8A 3DKGA 4FKSA 2GFCA 1QPCA 3AD4A 5EHOA 5CF8A 4Q5HA 4DGLC 1ZZ2A 4JIKA 4QQ5A 4AN2A 2IZTA 4CNHA 4MYGA 1REJA 2PVRA 4ZMFA 5IQIA 4JDHA 4J1RA 4XBUA 4ZJVA 1H1QA 2GNHA 4LUEA 5IKWA 3MIAA 4FSRA 4EEVA 3W2CA 1H8FA 4KIQA 2VTJA 1V0OA 5CXZA 5HTCA 1Q61A 4XP2A 5IH5A 2E9PA 4FIGA 4FIFA 2PE2A 2QOHA 2GNJA 5BYZA 4A7CA 2YERA 3VHKA 2OJJA 3QUPA 5HE0A 3R1NA 4JQ8A 2R2PA 2RL5A 4O91A 3UO5A 2OZAB 5DN3A 4PNKA 4BCKA 1CTPE 4J97A 4BGGA 3HDMA 4Z55A 3KVWA 3QL8A 5A4LA 3FMDA 3A62A 4YLJA 3EWHA 4JRVA 3A60A 4M12A 3PXZA 1YXXA 4CQEA 3R7OA 4ERWA 4FZ7A 4FBXA 3DLSA 4IIRA 3QQFA 1JQHA 3FZ1A 1BI7A 3SG8A 4PV0A 3FI2A 1IRKA 3LM0A 1J1CA 2X6EA 3FSKA 4M8TA 4V0GA 3KFAA 1UU7A 5J8IA 5KMOA 2H96A 1SVEA 3Q4TA 3S4QA 4O7NA 5HLNA 2ETKA 2YCRA 1TQPA 4W8EA 3SW7A 3LPBA 3DAEA 4KBKA 3DJ5A 4W9XA 3NIEA 4IWQA 4AFJA 5KZ0A 4H3PA 2WMSA 4O0SA 3RMFA 4PX6A 5M4UA 4QP8A 4NJ3A 3G0EA 5T3QA 2BR1A 2PVJA 2PMOX 3D4QA 4M0ZA 1URWA 4YJUA 4EWQA 4F7NA 1H24A 5DFPA 3ERKA 1RDQE 4O0YA 3RVGA 3RPVA 2UUEA 3KMMA 3W2PA 4LOPA 4E93A 2BRBA 3ZM9A 4FL3A 5KMIA 2W1ZA 4IX3A 4G3GA 4G9CA 2J0JA 4GU9A 1Q8YA 4TKSA 5ETAA 2HXLA 1IR3A 1FPUA 2FSLX 3G9LX 5DE2A 3RBWA 3FZTA 2GNGA 4XH6A 4X3JA 4Y85A 4C61A 4YJRA 3RWPA 4AOIA 5JFWA 5JQ5A 3QZHA 3ULIA 2CNVA 3R28A 3OCSA 1W98A 2XK3A 5B7VA 4DEEA 2UZUE 3EQRA 3LKMA 2QCSA 4I93A 5HO6A 3OWLA 1WBNA 4ITIA 4NIFB 4TZRA 1Y8GA 5CU0A 3BRBA 3VBTA 5M4FA 5HTBA 3UVPA 2CKEA 2F7XE 4RFYA 4A4OA 4D1ZA 3W16A 5CAQA 3UIXA 3OC1A 4EORA 2UZLA 4PMMA 4RBLA 3DLZA 5G6VA 5KKRB 3UO4A 3C4ZA 2OWBA 2PZIA 2IVTA 2GNFA 4C37A 3WYYA 4BCMA 4USFA 1CDKA 3PA3A 3O51A 5E9EA 2FA2A 4P5ZA 4DGOA 4LUDA 4IAFA 4R3CA 4UALA 2PE0A 2WZJA 3ID6C 2J2IB 3QBNA 4U80A 1ZYCA 5HBJA 5ETIA 2J51A 2UW9A 2BALA 1F0QA 4L45A 4CMUA 4HVGA 3TUCA 4OAUC 2CKQA 3NVMB 4OTRA 2JEDA 2GSFA 3DXQA 4EHZA 1SVGA 3HP2A 4RSSA 2HCKA 3HUCA 2DS1A 5KHXA 5E1EA 3LIJA 3S3IA 2XJ1A 4FSNA 5IQFA 4TYEA 1P4OA 3EFJA 1MRUA 4O82A 3GU6A 1TQMA 2WGJA 2QD9A 3UOLA 2BKKA 4RMZA 4FTJA 5HESA 4ACDA 4AZVA 4F0GA 5J7BA 1OZ1A 3DOGA 5ANGA 5AMNA 1UNLA 3ZLYA 4EOLA 1Q41A 1FBNA 4H58A 2CJMA 2UW6A 2CMWA 4F7JA 4GIIA 3NRMA 4E3CA 4MBLA 4C57A 1ZZLA 2HXQA 5IPJA 5CX9A 3C9WA 3DU8A 5FTOA 4QOXA 4DFUA 2YA9A 4TYGA 1WBPA 5FQDC 5LVNA 3GCPA 2RFNA 3UG1A 4ZZOA 2OKRA 2PZRA 1XO2B 2BIKB 3GCVA 4QP6A 3LFQA 2OSCA 1R78A 5B0XA 2HOGA 4HGEA 3BKBA 5FXQA 1VYZA 4HVIA 2XYNA 4W9WA 4DEHA 5B2MA 5CEPA 4EHEA 2BAKA 1DAYA 4OLIA 3PJ1A 3TUBA 4HPUE 2YDJA 2XH5A 5J7HA 3CY3A 4GS6A 3LJ1A 4I41A 4QNYA 4AOTA 4FOBA 4EBWA 3CIKA 2XIKA 4L44A 3V6RA 4RVMA 2BDWA 1JKSA 3MDYA 4FT5A 4FNYA 4C33A 2X6DA 2I0YA 3FPMA 4NM7A 3DNDA 3ZSIA 1ZRZA 3TNIA 2XK8A 3QTSA 4BF2A 1XBCA 4V04A 5A4CA 3ZFYA 3KCFA 2X7OA 2ETRA 4KS7A 2JLDA 2A2AA 3F3ZA 2VUWA 4U42A 4O21A 4PTGA 4A9YA 1Q62A 3VUKA 2G2IA 4FEUA 5E8XA 2YFXA 2Y4IC 5CF6A 4H1JA 5KO1A 4TNBA 1Y6BA 4GVAA 2F7EE 4DG2E 2R3RA 5FD2A 5AP5A 4HCTA 3OW3A 1KV2A 3U8WA 4O0TA 3Q4CA 3TDWA 4I94A 4O2ZA 3AGMA 1APME 1AD5A 4PMTA 3Q60A 2XB7A 3VULA 3RNYA 4DTAA 3FYKX 1PXKA 3P5KA 1YXTA 3UTOA 4CZYB 4IE9A 3C4FA 4IEBA 4O6EA 4XRLA 2ZM1A 4U40A 4ZTNA 5FP5A 3ZTXA 5JQ8A 4NEUA 3HX4A 2ZOQA 4C59A 1MQBA 3LOKA 4O86A 5CANA 5IG1A 2W06A 2QO7A 3PXYA 5IF1A 3HMMA 3EFLA 2XUUA 1U4DA 3EQPA 3L9PA 2GFSA 3OS3A 1S9IA 4FKPA 5E8YA 1OIYA 4ZLZA 4LL0A 4IZ5A 3OOGA 5AV1A 4FZ6A 4OBPA 3V5WA 3DV3A 1OL5A 5DOSA 2DQ7X 3LXNA 2G2HA 4ZS0A 1WVXA 4AUAA 3CR0A 4L6QA 1QCFA 2WOTA 3O8PA 2WQOA 3E62A 2IVUA 3BGPA 4BHNA 4FV5A 3O7LB 4R3RA 5EQEA 1PHKA 4WOVA 3MN3A 4FTOA 4MAOA 5BUEA 2X9FA 3V51A 5J5SA 3N4VA 4GH2A 3QUDA 4AT5A 4IAKA 3CS9A 5CI7A 3VC4A 3ZUTA 1PKDA 4Q5EA 2Z2WA 3T8OA 3BHHA 2JIIA 1NVRA 3HL7A 3AD6A 2BZIB 3DGKA 3Q9ZA 4GK2A 2VO6A 4L01A 4XS2A 4A9SA 3OWJA 4YHJA 4AW5A 3CD8A 1VYWA 3P79A 4AA4A 2X7FA 5EDRA 1YI6A 3IKAA 3ZUUA 4FT3A 4GL9A 5LMKA 3HYHA 4MD7E 4XEYA 1P2AA 2J5FA 3KQ7A 3R21A 5C8MA 2VNYA 3SXRA 5DPVA 5JK3A 5CY3A 2OJIA 4JBOA 4HW7A 4FVRA 3V3VA 4ANQA 2W1CA 4BDEA 3PVBA 2FYSA 5DH3A 5CVHA 4I23A 5DEWA 5CALA 4IH8A 4RX9A 5CZIA 5E92A 4WUAA 3TWJA 3SOAA 2AYPA 3II5A 2BFYA 4RRVA 5FEEA 4QMOA 4QMXA 3QD0A 4GYGA 4I21A 4AA5A 2VX3A 3PPZA 4G17A 4RPVA 2V7AA 3ORPA 3PA4A 4P5QA 3TZMA 4S30A 5AUVA 2OO8X 2W4OA 5C8NA 4I0TA 4L43A 4ENYA 5I9ZA 2R64A 1PYXA 3ZDIA 3FI8A 2XIZA 4IDTA 4X2KA 1KE7A 2IPXA 5EM8A 2WIPA 4ERKA 1XR1A 3BBTB 3KA0A 3FUPA 3ZO4A 2W99B 2YDIA 1PMEA 3P4KA 3R83A 4U5JA 4ACGA 2WMXA 3D14A 4PRJA 4YURA 3BU5A 2F57A 5HG8A 5GZ9A 3HRFA 3ACKA 1H28A 3DAJA 3DJ6A 5D41A 3F66A 4ANMA 5AV4A 3DFAA 4YLLA 5AFVA 3NNXA 4FTUA 4F6UA 1XH6A 2VGPA 2WTKB 4DA5A 2C1AA 4C0TA 3EQBA 3ZSHA 4C8BA 4FTTA 4ZTMA 4FEXA 3Q9YA 3JUHA 3KXGA 4DFZE 3EN9A 3HZTA 2R5TA 4F7SA 4V0GB 2V62A 4PP9A 4WNKA 3W8QA 2YZLA 3C4WA 3BYVA 1ZOHA 1M17A 2YIQA 3I0QA 1BMKA 4HZRA 2VZ6A 3LW0A 4IVDA 5AP2A 5E91A 5FXSA 5J87A 2J9MA 3FV8A 5TE0A 1T45A 3H3CA 1Y6AA 2R4BA 3R1SA 5HICA 4QP7A 5EK7A 4NYEA 5BYYA 5EYCA 4OTWA 3VUHA 2C3LA 2QONA 5EKOA 3CLYA 4BTMA 4JG8A 2ERZE 1T46A 3ROYA 2PVYA 3KU2A 2B9FA 4D2PA 3P86A 4UYAA 4PDYA 3RI1A 3MVHA 4YUQA 4AQCA 3U9NA 5I3RA 1OM1A 4UZDA 4C4IA 3C0HA 3ATSA 5GIPE 1WBVA 2UW5A 4RVLA 3NW7A 1ATPE 4TWNA 5CI6A 3ORTA 4RG0A 4NCTC 4FG8A 3F6XA 2EB3A 4QNAA 3ODYX 2QNJA 1SVHA 4GMYA 1REKA 3UVRA 2OZOA 4PL4A 4BGHA 4WSQA 4RJ6A 4UXLA 4ACHA 1Q3WA 3KL8A 5IQBA 3E63A 4OTGA 2BVAA 1UWHA 4L46A 5IQHA 3VUGA 2Y6MA 3R8PA 4QPSA 3JR1A 4XG6A 5F9EA 2IZRA 5EM5A 2XIYA 4AZTA 1JKKA 4FVQA 3IW4A 3IONA 3BU6A 2WU7A 3KN6A 4KBAA 2VTNA 1V0BA 3POOA 4FTKA 1W8CA 4O6LA 3BLHA 4PPAA 2VTMA 2R0UA 4NU1A 1YOMA 2ITOA 3GGFA 4ACCA 4AZWA 5M51A 4E5AX 3JVRA 5IH6A 2XNBA 4GIHA 5ANEA 4BHZA 1CM8A 2V0DA 3DAKA 2R3JA 5TF9A 3DDQA 3L8SA 3ZRKA 3HDNA 3ODZX 3ZFXA 3FXWA 1P5EA 4XG2A 3MH1A 5JGBA 4YP8A 3ORKA 2HIWA 4AN3A 5GJFA 4BWKA 4QO9A 4EHGA 3NEWA 4K77A 1PXMA 3R63A 5AUXA 5JFVA 5A14A 4K0YA 3LJ2A 4LYNA 4CEGA 4NM0A 2OI4X 3V5PA 4ITJA 4CYIA 4U0IA 3D2KA 2PVHA 4IQ6A 2W5HA 3NX8A 4U3ZA 3PIYA 2A19B 4JR3A 5IEYA 2P33A 4FSQA 4FODA 3WF6A 1E1VA 2P0CA 3LCOA 4GFMA 3DTCA 4IDVA 2ITZA 4FIIA 2C3KA 2YM5A 4XLVA 2VTHA 3U51A 4EOOA 3TDVA 4NIFA 4JL9A 3M2WA 4KKHA 1FOTA 4WKQA 5AP7A 2G15A 4FE2A 2CCHA 3FL4A 1O6YA 4YPDA 3RK9A 3SHEA 1IA9A 4YTIA 4QQTA 2XJ0A 4YZ9A 5CTPA 4IBMA 5ACKA 4X6RA 4AZFA 2F2UA 3WE8A 4EOQA 3PVWA 2X2MA 4O7LA 2R0IA 3GFWA 4JJRA 3SKCA 3I1AA 3CKWA 2BTRA 3OY3A 3G6GA 3WZKA 2XNEA 4BZOA 2QI8A 4GT3A 3I5ZA 4CV9A 2QOBA 3MY5A 3ZONA 4UV0A 4J99A 4CQGA 4P7EA 4IM2A 2JGZA 4F0IA 4PY1A 3VS3A 3W55A 4MVFA 3HECA 4AGWA 3GFEA 2A0CX 4UBAA 3BHVA 3GQIA 4DAWA 2C69A 4L53A 4DITA 5CF4A 2X81A 4KA3A 4WBBB 5AP3A 2WTCA 4C3PA 3UNKA 3JS2A 4E5WA 4PDSA 2OF4A 4WRGA 3W33A 2NPQA 2X4FA 3GEQA 4C34A 4Q2AA 2YCFA 3Q5IA 3F69A 4KKGA 4HZSA 2C0OA 2PSQA 3P9JA 5HOAA 3UOHA 5GJGA 1FGKA 5J9ZA 3VBWA 4GUEA 2I0HA 5HD4A 3CPBA 3OW4A 5M56A 4PF4A 4QMPA 5E8WA 2E9OA 2R3FA 4M13A 3PXQA 5DT4A 5L2WA 2ITWA 3VUDA 3N4TA 4ITHA 1KSWA 4JDJA 4TWCA 5IH4A 3TNQB 3FEGA 3F7WA 4NT4A 4AW0A 2PMNX 5DA3A 1ND4A 3ZSGA 3TV6A 4MD9E 5K4IA 1KV1A 4MXXA 2AC5A 5AX9A 3QA8A 3H9RA 3WZJA 4X3FC 5EQYA 4YNOA 1VJYA 1J3HA 2V55A 2PU8A 4ZLOA 2FVDA 4BCHA 4DHFA 4A4XA 4F9YA 3CE3A 3G51A 4BTKA 2P4IA 3QYZA 1I09A 5AUYA 3P7AA 2X8IA 5M08A 1BUHA 2Q0BA 2PUIA 3LXLA 2CSNA 4RX8A 4WT6A 4AAAA 4M3QA 5A9UA 4GJ3A 2HZ4A 3QYWA 2Q0NA 4UN0C 5CU4A 2XK4A 2B9IA 2O65A 2YIWA 2BDJA 4K18A 3TZ9A 4F1OA 2JD5A 4WSYA 4DH5A 3OWPA 3H10A 4EH4A 4LRMA 4WBOA 4FSWA 4JBVA 1IG1A 3ELJA 3ET7A 3R00A 4C36A 4C3FA 1PRYA 4FV4A 2UV2A 2GCDA 3D0EA 4MXOA 3PSBA 5JH6A 3QTQA 4KS8A 4J8NA 4ALVA 5A4EA 1J7LA 4JAJA 2R3OA 3FQHA 3VJNA 3DK6A 5LARA 4TW9A 3EFKA 3RJCA 4P90A 4KRCA 3ZXZA 1OL6A 3PP0A 1YDTE 4X2JA 5CEQA 5I9WA 3B8QA 4RJ4A 4JDKA 5EW3A 4H39A 2P55A 4N4SA 4CRLA 2XF0A 4YTCA 5ICPA 4JDIA 3KULA 3JY0A 5HNGA 3F3WA 3V6SA 1E1XA 3HV5A 3OF0A 4U9AA 3SVVA 4FTIA 2WKMA 4MKCA 4MNFA 4BCPA 2QKRA 3W32A 3BHYA 4F99A 5HVKA 1IASA 3CP9A 2YN8A 3JVSA 2AC3A 3C7QA 4QTEA 4JT3A 1L8TA 3CTQA 4BDKA 3QQLA 2VU3A 4K9YA 4KSPA 4BIDA 4XP3A 4D2VA 3NYXA 5D10A 2EXCX 4RZVA 5AA9A 2WELA 3PUPA 1BL7A 4BCNA 5L6WL 3DB6A 4IM0A 1SZMA 5EG3A 2C3IB 3I4BA 1PW2A 2XKDA 4K11A 5DI1A 1H1SA 4FV3A 4QMTA 3WF5A 1MQ4A 4M66A 1UV5A 4WIHA 1Y91A 4YZMA 3TUDA 3VUIA 2GTMA 4I6QA 2C6KA 1UVRA 5DR6A 4D4VA 4L7SA 3LMIA 3TNPC 4M67A 5HIDA 5BVOA 4EUUA 3NMUF 4NK9A 2BRNA 3MJ1A 2WMAA 4C4JA 4EL9A 3BGQA 3VN9A 3CXWA 5HORA 2UVYA 4U3YA 3TJDA 4FV9A 5FEDA 3A7IA 2Z60A 2W1DA 4I1ZA 5A3XA 5AV2A 3EYGA 3GOPA 3W1FA 5C1QB 5C4LA 2C6LA 1XHAA 5LVLA 1F3MC 3BZ3A 1GNGA 2GHMA 2J4ZA 4B8MA 4DBXA 4O22A 4Y73A 1OBGA 2C5XA 3TXOA 3NUXA 5C9CA 3GU5A 4AU8A 4O7YA 1Q99A 3LFBA 5ETFA 5HNIX 3BPRA 3QTUA 3AT2A 4HCVA 3MH0A 2WTWA 4C4GA 3SOCA 5I4NA 3VBYA 1PXJA 2X2LA 3I60A 2WTVA 4CFNA 1ZOGA 5KBRA 3BQRA 4B8LA 4G16A 2JFMA 3IDBA 4DT9A 3PPJA 3KVXA 4FKLA 4I92A 3EL8A 1W83A 3R7EA 3WIGA 3Q32A 4UWBA 3ZFMA 4B4LA 3DK7A 3WF7A 2W7XA 4BYJA 4IJPA 5IUGA 2YABA 1RE8A 1K2PA 1OI9A 4CKIA 3NDMA 4H3QA 4QRCA 2R3QA 4U8ZA 3ULZA 2ITYA 4ZMEA 3DA6A 4NTSA 2QLUA 3UGCA 3FXXA 3QAME 5IA0A 1QPEA 4QP4A 4IX6A 3MY1A 2Y6OA 1NY3A 1Z57A 3Q5ZA 1OL2A 3P08A 4GFOA 3HV7A 3C0GA 3D7TB 2BZHB 4UY9A 4ZSJA 1YI4A 5FTQA 3U87A 1OBDA 4GEOA 3QALE 3EQDA 3QD3A 1V1KA 4EH6A 2IN6A 1QL6A 3FI4A 4EK8A 2R3LA 4UMTA 1JSTA 4AW1A 4OTIA 4XG4A 2C6EA 4IHPA 3C51A 1HOWA 3GBZA 4ZZNA 5A4TA 3NYOA 2DYLA 4LOQA 5DR2A 3RZFA 4BBEA 3Q2JA 3GNIB 3OG7A 5E90A 3V8WA 5EYKA 2XP2A 3EN5A 4MXYA 2ZMCA 3VBVA 1YWVA 5EDQA 1S9JA 2GS7A 4CFXA 4CYJA 5IEVA 3ATTA 3TACA 4FSYA 3EKNA 4I24A 4JS8A 4XG9A 1DM2A 3OEZA 3CJGA 5J1WA 1OGUA 1QPDA 4WNPA 1OUYA 3H30A 2R3HA 2VTTA 4JQEA 1XH7A 1KOAA 3DZQA 2ETMA 2G2FA 2XS0A 4I3ZA 4JX3A 4RJ3A 5AUTA 2GQSA 5J95A 3TKUA 3PIXA 3PPKA 2UZEA 3D5XA 1DAWA 2I40A 1OUKA 3A7HA 4RIXA 2IZSA 4ANLA 3FPQA 4BKJA 3QQHA 2EXEA 5M44A 4PDOA 3BYMA 2PUPA 1DS5A 4HNFA 3L1SA 5D9HA 2IW8A 1U46A 2ESMA 4BZDA 3WOWA 1M52A 2WMVA 3QQJA 3LAUA 2XBAA 4GT5A 2WMWA 4PNIA 4D2RA 3L8XA 1W7HA 3OEFX 5IDPA 4O7ZA 1Y8YA 2AUHA 3WBLA 3NNUA 4UMUA 3PJ3A 4FTQA 4HNIA 3QZFA 5HE2A 4CFFA 3VS4A 3ZZEA 1TQIA 3HV6A 1OECA 4MH7A 4F9BA 3AOXA 4BCIA 3KN5A 3POZA 4FL1A 3O71A 3NS9A 2XJ2A 5EKNA 3ZLSA 3ZBFA 3FJQE 4EKLA 4DFXE 2Q83A 4B9DA 5AX3A 4K2RA 4DTKA 3ZDUA 4KBCA 4XHKB 5FLFA 3COHA 2UZNA 4C2VA 4QYYA 4D0XA 3BWJA 2XMYA 4E4XA 1LEWA 4YNEA 4Q9ZA 4FNXA 3L9NA 5IMXA 3LQ5A 2E9VA 3BELA 4ZTRA 3R7GA 2WOUA 2GS6A 5CENA 3FKOA 1WBOA 2ITTA 4DBNA 2BTSA 4G5PA 2V22A 3IGOA 3C0IA 3TKIA 3ZEWA 4JX7A 4F9AA 4BDJA 3UNJA 4EI4A 4TPTA 5KBQA 4BDBA 3P23A 5AR2A 4MK0A 1M2QA 3GUBA 2PYWA 3RKBA 2SRCA 2IVVA 5BQ0A 3T9TA 1H26A 2ITUA 2HWPA 4ANBA 4E4LA 4ZTLA 2UZWE 3RK7A 3VW6A 3RZBA 4YO6A 4RLKA 3FHIA 3IO7A 2XK7A 4RWKA 5EYMA 4FTMA 4L8MA 3V01A 1DI8A 2CLXA 4AZSA 1YXUA 2XKEA 3NLBA 3R30A 4CFVA 2BAQA 4O1PA 3VWAA 4BC6A 4CVAA 2J5EA 1ZXEA 1WBSA 4O7TA 4MD8E 4JI9A 4FKWA 4MXZA 3QC9A 4CG8A 2QOIA 2J0KA 4MCVA 4XV2A 3QU0A 4IX4A 4CCBA 5BMMA 2WFYA 4X2NA 4YO4A 3DT1A 1ZWSA 3L8VA 3PA5A 2QG7A 3AGLA 4F65A 2HYYA 2V5QA 3R1YA 4X2FA 2YM6A 1STCE 5M55A 5HZNA 4EHVA 4XOYA 3E8EA 3MFSA 2O63A 3ORZA 3R9OA 3UC4A 3UP7A 3I5NA 3VBXA 4O7VA 1U59A 2OBJA 2C1BA 2PZYA 3AC4A 3MFRA 1YOLA 4RVKA 4QD6A 5EI2A 3BE9A 5AJQA 4EZ3A 4FK3A 5GJDA 4RA5A 3DJ7A 3VS2A 3BWFA 1RJBA 2XVDA 3GENA 3PXFA 3IS5A 4QP9A 4TYHA 4CV8A 2F2CB 3DTWA 4O27B 3VRZA 2X4ZA 2JDOA 3GCSA 4BKYA 2JAVA 5CXHA 4K1BA 3KRRA 3IOKA 4EK4A 2RFEA 3D5VA 1AQ1A 4XYFA 4EOMA 4KAOA 3PDTA 1U5RA 3ORXA 2QC6A 3DS6A 3HRCA 1GJOA 4L42A 3RNIA 3IOPA 1CMKE 3HV4A 3NUPA 4FUYA 4APCA 5H3QA 3FZOA 5CEOA 4E73A 4G6LA 4JG7A 4J96A 1TKIA 3E7VA 3F5GA 3EQIA 1GZ8A 3DQWA 5JKGA 2WEVA 4EONA 3OROA 3UOKA 2BCJA 3U4UA 2OXXA 3Q4UA 4UMPA 3S0OA 3NYVA 4KINA 4AGCA 1YI3A 2B0QA 3CQEA 5CQWA 3ZO1A 3D2IA 3UVQA 1PXNA 2OF2A 2XA4A 3F5XA 3W2OA 4DEIA 3N4UA 1NVQA 2WXVA 3TTIA 2H8HA 3PLSA 3I6UA 3QFVA 4BTFA 2ZB1A 4RT7A 3KULB 2YWPA 3MVLA 2BPMA 4GRBA 4N70A 3WZDA 4USDA 4FVPA 5CEMA 2YCQA 2YISA 4M69A 5CU6A 3NUNA 4J8MA 2JFLA 2C5VA 4X2GA 5HU9A 4JNWA 4D9TA 4YZDA 2YJRA 3TM0A 3BCEA 4FG7A 4RWLA 3QGWA 3R7VA 2PL0A 3DKOA 3BV3A 3LHJA 4O81A 4BZNA 4W8DA 3VUTA 2CKPA 1WBWA 4P2KA 2JC6A 2WNTA 3Q96A 3K54A 4QMQA 5I9YA 4DN5A 5J1VA 3A61A 2EB2A 5EI8A 2C6DA 4LFIA 5CT0A 3CQWA 3RM6A 4WRSA 5AA8A 4KKEA 1VR2A 2E9UA 3VF8A 4HVDA 1OVEA 1PXPA 3BLQA 5CSHA 4AE9A 4AP7A 4O0XA 4Q9SA 2UW7A 3WILA 3AC8A 3RINA 4WG3A 4Y5QA 4C4HA 1R39A 1XQZA 3FLSA 3FZPA 4YJQA 4S34A 2RG6A 4DG0E 2HW6A 2UVXA 1KUTA 4RIYA 5AUWA 3OCTA 3NYNA 3ZHPC 4BBMA 4W4XA 2BHHA 1P4FA 4FKQA 4FTLA 3K5VA 3CC6A 3MVJA 4FIHA 4MEDA 4XMOA 5L2SA 3SLSA 3I6WA 4GG7A 1ZYDA 4M7IA 3HEGA 5AP4A 3PE1A 4ZJIA 3U6IA 4NM5A 3KF7A 4CLIA 4YHTA 5CAUA 3KREA 3KKVA 4EJ7A 4TRLA 3SXSA 5LCJA 2G1TA 4D1XA 2CNUA 1R0PA 3CGOA 4BN1A 3BU3A 4FG9A 3LFDA 1LP4A 4MQ1A 3ANQA 5HQ0A 2V7OA 1Z9XA 4FNWA 4XV1A 1Q8UA 2JKOA 2QHMA 2XNPA 4RQVA 4FV0A 4RA4A 4XX9A 3RPYA 2O8YA 4JXFA 2HK5A 4EYMA 5ETCA 3VS1A 5JEBA 3OXZA 4HYUA 5L8LA 1ZMVA 2PZ5A 3MH3A 4NW6A 2YWVA 3C4CA 5AP1A 4L3JA 4L3PA 2W05A 4BCFA 3AT4A 3F5UA 5FTGA 4EWHA 1F5QA 4JIAA 4A9RA 2VNWA 1PYEA 3FDNA 1JKLA 4QMMA 4BDGA 4FSTA 2LGCA 2O0UA 3VJOA 4QTCA 3NGAA 1OKVA 2C3JA 4QMLA 2W1EA 3CBLA 4RC2A 3QQGA 4M84A 4EKKA 3UZTA 2ZB0A 4YTHA 4N57A 2OJFE 2PVLA 4BIEA 5LMKC 3QCXA 2BRMA 4O7RA 2I0VA 4XUFA 4M0YA 5L4QA 2E9NA 4QT1A 3AT3A 4BRXA 3HMOA 3VO3A 5A4QA 4MBIA 4TYIA 2BZJA 3LZBA 4HGSA 3CEKA 5AIKA 2NP8A 2X8DA 3KXNA 4NWMA 4F63A 3S1HA 1JSVA 4HJOA 4GK4A 2VX1A 5LVPA 4G31A 4JRNA 5LMAA 1UU8A 2HWOA 4C3RA 2VTRA 2VTLA 4L67A 3HV3A 3R8LA 1JOWB 4AT4A 4YZNA 2O3PA 4FK6A 5KMMA 4TYJA 3LLAA 3WARA 4PWNA 3KGAA 4CMTA 1BKXA 1ZYJA 2OH0E 1B38A 4JG6A 5CU3A 5HG7A 3NIZA 3O50A 1OIUA 4WA9A 5BVKA 5BNJA 4I5PA 2OFUA 4K6ZA 4EQMA 5A6OA 4ZSGA 3ORLA 1FMKA 4D9UA 2QHNA 4FZAB 4UYNA 4EH8A 4RIXB 4IMYA 4I20A 3GC8A 5L2TA 4UXQA 4NCTA 2WQNA 4QYGA 2ONLA 5HO8A 3MBLA 2HZ0A 2OG8A 5F94A 3B2WA 5HHWA 1PXOA 3T3UA 3AC1A 5TO8A 2VTIA 5GHVA 1ERKA 4II5A 3FMNA 4DE4A 3MA3A 4YLKA 1PMVA 2XCHA 1WVYA 4F1TA 5IZFA 1B6CB 5CEKA 3D7TA 4OW8A 3ALOA 3MYGA 4HCUA 4C62A 2ZDTA 5LCKA 3VS6A 4ID7A 4QMNA 4LMUA 4BTJA 4XBRA 5BUIA 2ITNA 5E1SA 3RP9A 4ZTQA 5E8SA 1GIIA 2J50A 4NFNA 5AV0A 1OPKA 2VX0A 4AGDA 4AGUA 4L7FA 1H00A 4BCOA 3MH2A 4IAYA 2YIXA 4OBOA 4EQCA 4Z16A 4CZUA 5AAGA 4KRDA 3G9NA 3TEIA 4GU6A 2I6LA 4M97A 4A07A 5IQGA 3AQVA 3P0MA 1CSNA 4R7HA 5L2QA 4J71A 4F9WA 5IA5A 4UZHA 3OP5A 4GV1A 2H9VA 3R7IA 3UOJA 2YACA 2XRUA 2Y7JA 1CKPA 3SQQA 2QVSE 5JFXA 3FMHA 4F1MA 3PXRA 3FKNA 1QMZA 2UZVA 2OXYA 1XH5A 3KC3A 4IJ9A 4YJOA 2VRXA 4FKRA 4YHFA 4G2FA 2XNOA 2JDTA 2WO6A 3V5JA 1GY3A 5E4HA 2BRHA 3F82A 4IZYA 1YHSA 4U44A 5C26A 4U41A 4ZZMA 4ASZA 2KTYA 1UKIA 2HW7A 3K3JA 4I6FA 3C5UA 4QTDA 4FTNA 2HZIA 2VO7A 3TT0A 3ZH8A 3LMGA 5HLPA 4ZY5A 4W4WA 5HCXA 5JZJA 2J0IA 4Z3VA 2NO3A 3FL5A 4O2PA 4A06A 4D1SA 3IW6A 4DCEA 3KB7A 3R8UA 2C5NA 5AUUA 3QKMA 5LVMA 4RLLA 4G3FA 1ZY4A 4CGAA 3P1AA 3PP1A 4J7BA 4ANNA 3JYAA 3NPCA 2RFDA 3R8MA 4HYHA 3SW4A 4PMSA 3EJ1A 4EOPA 4R1YA 3DNEA 4WNOA 3LFNA 3F3VA 4M68A 2ZV8A 2RIOA 3ALNA 3WIKA 3NWWA 4L3LA 4FC0A 4KD1A 5AIRA 3QKKA 2C4GA 1H25A 5AM6A 4ZOGA 2PULA 3FI3A 3R01A 3F88A 4QMZA 4C35A 1PXIA 2OJ9A 2WMTA 3AXWA 3E5AA 4FL2A 4MQ2A 4UWCA 5ANIA 2LAVA 3RCDA 3RHXA 2GHLA 2QQ7A 3ZO3A 3ZRLA 3DFCB 3QQUA 1BX6A 4I0RA 3K3IA 3TJCA 2W4KA 3MB6A 5CEIA 3Q53A 5IQDA 3I79A 4KABA 1JVPP 2BZKB 2JDRA 2CPKE 3EQFA 3TNWA 3NUUA 1PY5A 5EFQA 4D4SA 3OXIA 4I4FA 4HVHA 4JBPA 4M14A 1M7QA 4R3PA 5E8TA 3UZRA 5IA2A 1W84A 5LQFA 4C02A 3TV4A 2RGPA 5KMNA 3LFAA 3DK3A 4D28A 3ROCA 4ZSEA 4V05A 4Y95A 4TYHB 4YC6A 5CQUA 4EK3A 4RX5A 1WMKA 1XBAA 5FM2A 2W9FB 3VVHA 1UNHA 2W5AA 4LMNA 4NM3A 4XP0A 4BDAA 4FT9A 4CTBA 2WTDA 3UBDA 5L6OA 2PPQA 5FGKA 4E7WA 4F09A 4DFBA 3BBWA 3E8DA 4R5SA 4B99A 2Y4IB 4U7ZA 4LOOA 5F95A 4B7TA 4R5YA 1Z5MA 3EMGA 3VRYA 1TVOA 4ACMA 3WE4A 2C30A 3A4PA 3S2PA 1H08A 4AACA 3OUKA 2XRWA 2QKWB 1J7UA 3C13A 3QQKA 5FXRA 3ZEPA 3Q9XA 3FLQA 5EM7A 5KKRC 4IB0A 4RWJA 5EI6A 3U6HA 3F61A 3LCDA 3BEAA 4IVCA 4F6WA 4Z7GA 4X3FA 3EZRA 3KXXA 5BVWA 3GP0A 4XNEA 2VWVA 4H05A 4JVGA 1YWNA 2R3PA 5JRQA 3LCTA 4QP2A 5EYDA 1OMWA 4QMUA 3PG1A 4NH1A 2JIUA 5TT7A 1H1PA 4FV6A 4IAZA 5AP0A 2W1FA 2YM3A 5H9BA 5BVFA 5HU3A 1LEZA 2C68A 3BLRA 3H0ZA 1Q24A 3PY3A 2PTKA 4YC8A 4BDFA 2ERKA 3EYHA 3KCKA 4I0SA 4LGHA 4M69B 4ZP5A 3VUMA 4CFMA 3BIZA 4QQCA 2FH9A 4OTDA 4A9UA 4ENXA 3QLGA 5CAPA 4MXCA 3GC7A 2VTAA 4LI5A 3BYOA 3I7CA 2C5YA 3LCKA 5AR4A 5B2LA 4ORKA 2P2HA 2VWZA 3R2YA 4YGAA 4D4YA 3O2MA 3CSVA 3VS7A 1JLUE 3MESA 3NNWA 3FLYA 3P7BA 1NVSA 3AC2A 3COKA 3QD4A 1GIHA 3QX2A 4FIEA 4D0WA 4NSTA 3Q4ZA 5LWMA 4J98A 4ZXTA 5HVJA 3HVCA 3KXMA 5IISA 3OD6X 5BYLA 4KIKB 4C4EA 5FP6A 3H9FA 1SMHA 5GNKA 3UG2A 5EHYA 3IDPA 1VZOA 4G1WA 1UWJA 1WVWA 4TY1A 3O7LD 4KIPA 4O7SA 5HG9A 3RAIA 4BCJA 3Q2MA 1GOLA 3FBVA 5BX0A 5EQPA 4DG3E 1E9HA 3O8UA 3UMWA 1J91A 3DXNA 5CVFA 4CD0A 4I5MA 3LXKA 1OKWA 2CGVA 4IVBA 3PWDA 3F2AA 3DB8A 2VGOA 2XNMA 3GCQA 4RIYB 3F3UA 3OCGA 3KF4A 4FV2A 2UZBA 3PY1A 3D83A 4IC8A 4XOZA 3MPTA 3IGGA 4MBJA 2QODA 4C4FA 4M15A 3CTJA 3SRVA 4AWIA 5I0BA 4DINA 2XM8A 3UC3A 1PMUA 2UW0A 3UQFA 5IA4A 2FSOX 5J5TA 1PJKA 2R7BA 3QCSA 2PY3A 4QYHA 5F1ZA 5GINE 4R6VA 2J6MA 2YIRA 3FLNC 3MGYA 2VTPA 4RWIA 3RAHA 3UQGA 2FUMA 2HZNA 3DBFA 4I5CA 4YJSA 3V8SA 5AADA 4KSQA 1U54A 2Z7RA 2ZDUA 3AC5A 5JRSA 4I6BA 3W10A 4FV1A 2NNWB 5DHJA 4D58A 1H1RA 3C1XA 3WZUA 1URCA 4DEAA 4XLIA 5HD7A 4ASEA 3HMIA 3RALA 3KK8A 5E8ZA 4ANSA 4IWPA 2B1PA 4AF3A 3R9NA 2YM8A 2ITPA 1UU3A 3FQSA 1W82A 3OOMA 4KNBA 2C0IA 4YJNA 5FDXA 3V5TA 3VNTA 4ZK5A 3W18A 5CVGA 3SDJA 4GFGA 2XNNA 3UIMA 3ORIA 4EZ7A 4E4MA 2JKQA 3RK5A 2WQEA 5EW9A 5IQAA 5EHLA 1XH8A 3HAMA 1MRYA 4RFMA 4TNDA 3ZCLA 3SAYA 4ZIMA 5M09A 3ZM4A 3FWQA 3L9LA 4NL0A 3UYTA 3GT8A 1IAHA 2OXDA 2JKKA 4EQUA 4Z9LA 4Y46A 5CNOA 1ZYSA 4YR8A 3ENMA 4CMOA 1B39A 2VTOA 2YCSA 4EK5A 2EU9A 2OJGA 2QOLA 2YM7A 3NNVA 3GOKA 3R7UA 3UODA 3KRJA 3OHTA 4FSMA 2GDOA 5FWKK 3IQ7A 2YAAA 4BVUA 3O23A 3OCBA 4C38A 3NCGA 3TV7A 5LXMA 1M14A 3HKOA 4O38A 3R7YA 3QZIA 1KOBA 4EYJA 1GZNA 4D55A 3HMNA 2QOKA 4RIWB 5K3YA 4BBFA 1GAGA 3PXKA 3S00A 2BHEA 2Y0AA 2YDKA 4FKIA 4E26A 2PVKA 4FF8A 3FE3A 3O17A 3UE4A 1XH9A 4TN6A 4O84A 5HI2A 4BI1A 2XIXA 2QLQA 3NW6A 4IB1A 1M2RA 2HY0A 3KK9A 4G6OA 2OLCA 3MFTA 3QRTA 3M1SA 2DWBA 4TWPA 5HCYA 2B52A 1Q4LA 4U81A 4CSVA 2ZVAA 3EQCA 2PVMA 3GCUA 3NW5A 1KE6A 2OGVA 3Q6UA 4P4CA 3EN7A 3DBDA 4PL3A 5KZIA 1VEBA 4U43A 4G5JA 2HENA 3PE2A 4X7QA 4HVSA 4CKRA 1OKZA 4JR7A 1SNXA 2BILB 3AD5A 4IX5A 3UPZA 5I9XA 4MF0A 4XG3A 4S31A 4FX3A 4D4RA 4EC8A 3EOCA 3H0YA 2ZV7A 3BQCA 3G6HA 2BAJA 2YHVA 5M53A 2RG5A 4G3CA 3IG7A 3CD3A 2QG5A 1EH4A 2EXMA 2J0LA 1UKHA 4YPSA 1H27A 2WMBA 5T68A 1KE9A 3E93A 3FMMA 4UWYA 4R7BA 3W8LA 5JT2A 4FGRA 4ZTSA 4FKUA 5JZNA 3UP2A 3QRIA 3R73A 4X0MA 3P78A 2A27A 3MPMA 2W17A 4MWIA 5DEYA 2ZM4A 3ORMA 1PF8A 4H1MA 4F08A 2W96B 4JQ7A 3BYUA 3ZYAA 1YDSE 1YWRA 3O96A 5BUJA 3ITZA 2PMLX 4CKJA 2NRYA 4IFGA 5DG5A 2EUFB 3H4JA 1BLXA 3D15A 3GXLA 2F7ZE 2ZYBA 3EB0A 5HVYA 5C01A 2NRUA 3R9HA 3SD0A 3VHEA 5BMSA 3ACJA 3ORNA 2WTKC 1W0XC 3ENHA 5C27A 4OTFA 4PP7A 3EZVA 5IQEA 5DT3A 4IB5A 3PYYA 4GUBA 3Q52A 5A54A 2F49A 2B9HA 3EQHA 5ITAA 1YVJA 3PY0A 1UNGA 4RJ8A 4S2ZA 3MTFA 5IA1A 3HA8A 3QD2B 1OB3A 1WFCA 3QTWA 1Q8TA 1OPLA 2PWLA 2B4SB 3OTUA 5LWNA 3ZXTA 4Y83A 5KMJA 1UA2A 2JIVA 4LGDA 4UB7A 3G2FA 4ALUA 1OL7A 3PFQA 3MFUA 3O0GA 4PDPA 4PTEA 3V04A 3CCNA 4TT7A 4AE6A 2OIQA 3EL7A 1JKTA 1M7NA 3RM7A 2DUVA 3QCYA 2GPHA 1OIQA 2IZUA 1HCLA 2A1AB 4FICA 3JY9A 4OGRA 2GNIA 4PPCA 4ARKA 2R3KA 5HGIA 4DGNA 4QTAA 3NUAA 5G1XA 1SNUA 3TKHA 2WEIA 1Q3DA 2WHBA 4OBQA 2C6TA 2RSVA 4PL5A 5J9YA 3MW1A 2RKUA 5CNNA 4RGJA 3F3TA 1ZMWA 3D94A 1YXVA 3A7FA 3HNGA 1HCKA 2VWXA 5H8EA 5C03A 4BCQA 4F6SA 3HLLA 4ZLYA 3U6JA 1I44A 5DGZA 5L3AA 1OKYA 3FQEA 4AA0A 2IG7A 5D11A 2HY81 4FYNA 2PUNA 3TIZA 4OAVB 2WMUA 3QZGA 2XM9A 2QOQA 4XG7A 4DEDA 3R02A 4BDDA 4CTCA 3MV5A 4BWPA 2X2KA 3RAWA 3ZZWA 3E8CA 4ZAUA 5M4CA 3EH9A 4EOSA 2HAKA 3CGFA 4ALWA 3LFSA 1M2PA 4XG8A 3HRBA 4GYIA 1LUFA 4PQNA 5JGDA 2WAJA 3OVVA 3OT3A 1BI8A 4YSMA 3ZRMA 4DGMA 4W4YA 5H8GA 4OTPA 3VIDA 2YZAA 4ANOA 2QO9A 5LVOA 1SYKA 4FGBA 4FNZA 1O6KA 2ITXA 5L8KA 2JBOA 3QA0A 5DYJA 2CN5A 4X3FB 3F5PA 3OZ6A 5E8UA 4BWXA 4JAIA 4U6RA 4ASDA 2C5OA 5DIAA 4CCUA 2YLEA 3ZS5A 3PJ2A 4I22A 5IQCA 3CQUA 4FIJA 4EJNA 2R3IA 3DCVA 4NUSA 3ZLWA 4E4NA 4Z7HA 2J0MB 5CZHA 2W4JA 4B6LA 5EOBA 5CAVA 2X1NA 2Z8CA 3VQHA 4IAIA 4TWOA 1YXSA 4IADA 2YJSA 2IWIA 3LFCA 3MPAA 4AS0A 4MHAA 5DBXA 4F7LA 2BROA 4C58A 4E8AA 3NAXA 3E3PA 2X39A 4NZWB 3H9OA 3R22A 1G8AA 4CLJA 4N6ZA 4QP1A 3A99A 3NAYA 4IFCA 4EUTA 2QU5A 3L9MA 3PTGA 4XV3A 5E8VA 4F64A 5HIEA 4QTBA 4DCAA 3BV2A 3AMBA 2XEZA 3LCSA 2Z02A 3NR9A 3OBJA 3BI6A 3C4XA 2GMXA 2WQBA 5JGAA 2CNQA 2C6MA 3SA0A 3D9VA 4IWDA 1UU9A 5M57A 4KIOA 2UVZA 2VWBA 3R0TA 5KX8A 2PVFA 4ZY6A 3A4OX 4FKOA 3S95A 2WIHA 2VAGA 4IZAA 5CASA 2YAKA 1V0PA 4AT3A 2IO6A 4Y5HA 2WD1A 3T9IA 4R7IA 3FXZA 4FEWA 2QR7A 3R1QA 5LJJA 2YLFA 2IVSA 4BIBA 2B9JA 3CJFA 2F4JA 5T6KA 4FT7A 3RTPA 2CGUA 5KCVA 2UW3A 1KE5A 2REIA 4MNEB 1Q8WA 3SRVB 2JDVA 3OFMA 5IEXA 5CS6A 5AR7A 5M06A 2CHLA 4IW0A 4DEBA 5DNRA 3K5UA 4RQKA 3FZSA 3CPCA 4DT8A 5ANOA 4MTAA 4MX9A 5K5NA 1ZMUA 4LV5A 4AOJA 3UYSA 2XK6A 5FBNC 5ANJA 2GS2A 5GIOE 1XWSA 3BHTA 3TZ7A 2CN8A 3SGCA 3IDCA 2P2IA 1X8BA 1BYGA 5KNJA 4EH9A 4L68A 5D12A 4FSZA 2FO0A 4GCJA 3ZMMA 2OIDA 4ZTHA 5EOLA 4UX9A 1U54B 3QRKA 2XKFA 4F70A 2HELA 3QXOA 2XEYA 3MA6A 4L9IA 5BVEA 4BY9E 4ASXA 3C4EA 3E92A 3R2BA 4L00A 5KMKA 4LV8A 4KIKA 3FY0A 5CU2A 3VW8A 1RW8A 4EOIA 1QPJA 2OH4A 4BI0A 3UIBA 4QMSA 2VWYA 4BICA 4GJ2A 3OT8A 2ZJWA 4LM5A 4HYIA 5J9LA 3R6XA 3FZRA 4JOAA 3B8RA 3R04A 5D7AA 4QP3A 5LOHA 5F20A 2XYUA 2C6IA 3ETAA 3QKLA 2UZDA 5CLPA 3SXFA 5DR9A 4RVTA 5DT0A 4WHZA 3VAPA 4YMJA 3EFWA 3FY2A 4BDIA 3OMVA 3UZPA 4HYSA 4E6AA 5HO7A 5KHWA 3FYJX 3TZ8A 4RC4A 1Y57A 2GTNA 4BCGA 3TIYA 2Z7LA 2WTIA 4WUNA 3K2LA 3NSZA 3T3VA 3G15A 4DH1A 1WCCA 3LMHA 5HX8A 3LQ3A 5JSMA 4HPTE 2PHKA 4WD5A 3WF8A 4W4VA 3V5QA 2XCKA 2Y4PA 2PZPA 1IAJA 2UZOA 3A7GA 5HNBA 4DH8A 2BDFA 4IZ7A 3PVGA 4O0WA 4FA2A 4LG4A 3DY7A 4YBJA 4BL1A 2PK9A 4AFEA 2VV9A 2RFSA 3QCQA 3EN4A 4GVJA 3TCPA 5HBEA 4EBVA 5AWMA 3GB2A 4ZS4A 3NVKI 5HCZA 4H3BA 3FHRA 2WQMA 5D1JA 1XKKA 4LQMA 2Y8OA 3GU8A 3NUSA 2B55A 2JDSA 4DYMA 1Q97A 4USEA 1J1BA 1H07A 3MY0A 4TXCA 3TN8A 3WYXA 3HAVA 1A9UA 4QMWA 4E6DA 2ITQA 4DFYA 4DFNA 3COIA 4G3DA 3KY2A 3FMLA 3E64A 4PMPA 5JMSA 4AG8A 4YJTA 4TTHB 2B53A 4QQJA 4FMQA 2UW4A 1OPJA 2UZTA 3C5IA 1YRPA 5CSXA 5BVDA 1PXLA 1IA8A 4MWHA 4O96A 3QHRA 1OIRA 3A2CA 1ZOEA 5AV3A 5I9VA 2YITA 4ZJJA 3R9RA 3KMWA 3UIUA 2WPAA 4X6QC 4IXPA 1JNKA 3RAKA 2IJMA 1YHVA 3L8PA 4RZWA 5EW8A 5FG8A 4APPA 3E7OA 1YHWA 3QTXA 3DKFA 3FAAA 3REPA 4HOKA 2IW9A 5IUHA 2CGXA 4EOJA 1GIJA 2JAMA 3ZUVA 1AGWA 4B0GA 5C8KA 5L6PA 2GQGA 1YQJA 3ZC6A 5FM3A 3MTLA 2B54A 4DEGA 3I0OA 4CRSA 3THBA 2C0TA 3U9CA 4L52A 3DDPA 4IM3A 1K9AA 3KXZA 4EOKA 4FTAA 5IUIA 4FOCA 1R1WA 2WMQA 4YBKA 5H8BA 5HEZA 3JXWA 4PPBA 4EZ5A 3DQXA 4RIWA 1CKJA 3HP5A 2B7AA 3F2NA 4OT5A 1MRVA 3GI3A 3DPKA 3OTVA 2VTQA 1RQQA 3TNHA 2VO3A 2FGIA 2X8EA 3Q3BA 4YZCA 3NCZA 4ONAA 3ZBXA 4O7WA 4NKSA 3RPSA 2XIRA 3LXPA 3EKKA 4EH5A 4YJPA 3DXPA 2OIBA 4DF3A 3FC1X 2I0EA 3MJ2A 3OUNB 3PIZA 3BYSA 2CGWA 4FT0A 3D5UA 4DLIA 1FINA 4CFWA 3PRFA 3HUBA 4LRJA 3VQUA 4YTFA 3OXTA 2FB8A 2GQRA 1H1WA 3FKLA 5FRIA 3AMYA 3PVUA 3OWKA 2X9EA 2VWWA 2CLQA 2XZSA 3IW5A 2R3NA 4J53A 3EQGA 5FUTA 2EVAA 2Z7QA 3A8XA 3Q6WA 3M11A 4BDCA 4O83A 3ZLXA 1H0WA 3LE6A 3BGZA 3GQLA 1YW2A 3FMJA 1H0VA 1FGIA 2VTSA 4CG9A 2VWUA 3WF9A 2R3MA 5AM7A 3E8NA 3IPHA 4X21A 3MIYA 2ONLC 2OZAA 1MUOA 2GHGA 5DLSA 4OR5A 2R9SA 2WU6A 4KB8A 4QYEA 3I81A 5K0KA 2G9XA 4TL0A 3G0FA 3FMEA 1R3CA 3ANRA 2QOFA 3QWKA 4FI1A 4AX8A 4EH7A 1O9UA 3HMPA 3QTIA 3P7CA 3VS5A 4FTRA 3PZEA 5DRBA 1MP8A 4FTCA 2BFXA 5DVRA 5DMZA 3GU4A 3UJGA 1ZARA 1U5QA 4XCUA 4NKAA 4BDHA 5LMBA 5AR8A 3QRJA 2UW8A 3LFEA 3GC9A 3TTJA 4UMQA 4S33A 5D7VA 4O0RA 4FV8A 5HKMA 1GZOA 2PE1A 3FLZA 3F7ZA 3OY1A 4F4PA 5A46A 5AAEA 5HX6A 5HBHA 5L8JA 1JAMA 4IAAA 2W1IA 3DBCA 4DGGA 3VS0A 3QTRA 3QLFA 4O0VA 5CSPA 1SM2A 5EDPA 3EN6A 3KEXA 2YM4A 4D5HA 5CAOA 4GK3A 2YEXA 3MB7A 3PZHA 3IW7A 4IACA 1KE8A 4FKVA 4V01A 5HE3A 3UNZA 2XBJA 4HGTA 4AZEA 4D2SA 5HLWA 2VWIA 5J79A 3BX5A 5M4IA 3RHKA 4QMVA 4BKZA 4G9RA 5ACBC 1LR4A 4Y8DA 5EH0A 3MSSA 4R8QA 3DBQA 2PMIA 3QUEA 4QMYA 3TG1A 4DC2A 4WG5A 4E5BA 5GZ8A 2XNGA 5K0XA 1IEPA 1JBPE 2JBPA 3G90X 3KMUA 5CT7A 3UDBA 2JKMA 2PVNA 3F2RA 2QU6A 3QF9A 1JPAA 3D7ZA 3N9XA 4R77A 3OBGA 4ZEGA 4XV9A 3PRIA 3KXHA 4F0FA 4KUJA 4J52A 5CYIA 2OICA 5IDNA 4NW5A 3SX9A 4GT4A 5AP6A 4EH3A 1NW1A 3A8WA 2J7TA 5AR3A 4E1ZA 3DZOA 4FKJA 4S32A 3UPXA 2OFVA 2ACXA 5KE0A 5IA3A 1XH4A 4IB3A 2FSMX 3PWYA 4YZBA 5K5XA 4YC3A 5ANDA 3KRLA 3UQCA 1O6LA 5EM6A 4O0UA 2BIYA 3VF9A 3QTZA 3EHAA 4Y72A 4FR4A 3RWQA 4QPAA 4F9CA 2BUJA 2CCIA 4FZDB 3WZEA 5BPYA 4R1VA 2P3GX 1FVRA 2F9GA 5CSWA 2H34A 3BHUA 1A48A 3F9NA 2ZV2A 3A7JA 2ZAZA 4AN9A 3R8VA 1G8SA 4EC9A 4LRKA 3PSCA 5FEQA 1G3NA 5CSVA 2Z7SA 2QOOA 2W0JA 2C47A 1NT2A 3IW8A 3V5LA 3AC3A 2I1MA 2VD5A 1FQ1B 4IVAA 3MI9A 4ZSAA 2E2BA 4FUXA 3PG3A 2QR8A 4JBQA 3QWJA 4G3EA 4YSJA 4UMRA 5M07A 1XBBA 3GC0A 1XJDA 3QRUA 3RPOA 4C7TA 4EK6A 5HIBA 2WTJA 4ZY4A 4GSBA 5BVNA 5DRDA 5L2IA 1WBTA 3R9DA 5CWZA 1OL1A 2KULA 3B2TA 2H6DA 5E7RA 4D2TA 2Y9QA 4DFLA 5IMEA 3IECA 3D5WA 5FDPA 5CF5A 4FSUA 4PTCA 3TL8A 4O1OA 4IC7A 4WG4A 4BR3A 4I6HA 1Q5KA 3AG9A 5HG5A 4AW2A 4GG5A 1OITA 5TKDA 2EWAA 2WB8A 2CKOA 4G6NA 2ZM3A 3W2SA 3EIDA 1L3RE 4OUCA 4BI2A 2QOCA 4NFMA 1R0EA 4RJ7A 5TR6A 3V8TA 4DH3A 2W1HA 4I5HA 3U4WA 3LM5A 1WZYA 4N6YA 1Q8ZA 4RC3A 5HTIA 4U79A 4RFZA 2IW6A 4YJVA 2I7QA 3LJ0A 3LVPA 3PJCA 4RIOA 3LLTA 2W5BA 4YU2A 4EH2A 3N51A 4FZFB 3RPRA 1K3AA 1PMNA 3M42A 4NJDA 4CFUA 1J7IA 3Q04A 2BMCA 3QHWA 4BFMA 4K33A 5KUPA 1P14A 4D5KA 1YOJA 2ZMDA 3R8ZA 2OK1A 5HE1A 3COMA 1NXKA 2C6OA 1G5SA 3I7BA 3ZU7A 2O2UA 3CKXA 3GU7A 3IK3A 3RGFA 4IWOA 1FMOE 4OTQA 4BB4A 3BEGA 2BKZA 4NTTA 4KWPA 5I5ZA 5AEPA 2ITVA 1YDRE 4MNEA 4LL5A 4DH7A 4HGLA 3QGYA 4BYIA 2A4LA 1A06A 1JSUA 4JLCA 3VBQA 4FKGA 3SC1A 1ZY5A 4U97A 1FVTA 2CDZA 4CT2A 4E6CA 2GNLA 2O64A 3E87A 2J90A 1NA7A 4CT1A 4GKHA 5K9IA 5TOZA 4R78A 3DBEA 4A9TA 3KRXA 5AAFA 3QXPA 5F4NA 4OT6A 3C50A 4FEVA 4RX7A 2R7IA 1ZYLA 3HGKA 1ZLTA 4XRJA 5ANKA 3RCJA 1H01A 2ZV9A 3W2RA 4WNMA 4QYFA 2O5KA 2OW3A 3NZ0A 1KWPA 5JN2A 2QO2A 2QURA 4LGGA 4H36A 4MF1A 2W1GA 4XJ0A 1YKRA 4GW8A 2OU7A 2WMRA 2YIYA
chains in the Genus database with same CATH superfamily
3GVUA 3E3BX 3UO6A 4A4LA 3SG9A 1LPUA 5K4JA 2XKCA 4RJ5A 3ZOSA 3LQ8A 3PLAE 3TI1A 3MVMA 5FBOA 4BGQA 2XK9A 1H4LA 5I9UA 3U55A 2W9ZB 2VO0A 1BL6A 3HA6A 2FSTX 4ZSLA 5KMLA 5AUZA 3FLWA 4OTHA 3Q9WA 3QX4A 4UEUA 5GZAA 4FV7A 2RF9A 3O8TA 4CXAA 4DTBA 5A6NA 2PUUA 5IU2A 4GKIA 3PJ8A 5C4KA 3QC4A 3NUYA 2BRGA 1CKIA 3CY2A 4FEQA 4IANA 4C2WA 4AXAA 3BE2A 3SV0A 3E88A 3KRWA 1DI9A 1JWHA 2JITA 3FMKA 3UMXA 3ZO2A 3R71A 4WO5A 3G33A 4D2WA 4DLJA 4U45A 3JPVA 2G01A 4I4EA 1FVVA 5JFSA 5I3OA 2R3GA 4J95A 4FYOA 1ZAOA 3FC2A 3MWUA 4N0SA 3PSDA 4G34A 2X7GA 3DKCA 3CTHA 1GZKA 3LFFA 3AMAA 4FKTA 4PUZA 3WI6A 1WAKA 4MXAA 4K8AA 5B2KA 2X0GA 2VN9A 5H2UA 3ZC5A 1PKGA 5AR5A 4QPMA 4CZTA 3U54A 3W2QA 3G5DA 3MS9A 5DWRA 4E20A 4E6QA 3FSFA 2GU8A 3DKGA 4FKSA 2GFCA 1QPCA 3AD4A 5EHOA 5CF8A 4Q5HA 4DGLC 1ZZ2A 4JIKA 4QQ5A 4AN2A 2IZTA 4CNHA 1TFFA 4MYGA 1REJA 2PVRA 4ZMFA 5IQIA 4JDHA 4J1RA 4XBUA 4ZJVA 1H1QA 2GNHA 4LUEA 5IKWA 3MIAA 4FSRA 4EEVA 3W2CA 1H8FA 4KIQA 2VTJA 1V0OA 5CXZA 5HTCA 1Q61A 4XP2A 5IH5A 2E9PA 4FIGA 4FIFA 2PE2A 2QOHA 2GNJA 5BYZA 4A7CA 2YERA 3VHKA 2OJJA 3QUPA 5HE0A 3R1NA 4JQ8A 2R2PA 2RL5A 4O91A 3P5JC 3UO5A 2OZAB 5DN3A 4PNKA 4BCKA 1CTPE 4J97A 4BGGA 3HDMA 4Z55A 3KVWA 3QL8A 5A4LA 3FMDA 3A62A 4YLJA 3EWHA 4JRVA 3A60A 4M12A 3PXZA 4O4EA 1YXXA 4CQEA 3R7OA 4ERWA 4FZ7A 4FBXA 3DLSA 4IIRA 3QQFA 1JQHA 3FZ1A 1BI7A 3SG8A 4PV0A 3FI2A 1IRKA 3LM0A 1J1CA 2X6EA 3FSKA 4M8TA 4V0GA 3KFAA 1UU7A 5J8IA 5KMOA 2H96A 1SVEA 3Q4TA 3S4QA 4O7NA 5HLNA 2ETKA 2YCRA 1TQPA 4W8EA 3SW7A 3LPBA 4AXCA 3DAEA 4KBKA 3DJ5A 4W9XA 3NIEA 4IWQA 4AFJA 5KZ0A 4H3PA 2WMSA 4O0SA 3RMFA 4PX6A 5M4UA 4QP8A 4NJ3A 3G0EA 5T3QA 2BR1A 2PVJA 2PMOX 3D4QA 4M0ZA 1URWA 4YJUA 4EWQA 4F7NA 1H24A 5DFPA 3ERKA 1RDQE 4O0YA 3RVGA 3RPVA 2UUEA 3KMMA 3W2PA 4LOPA 4E93A 2BRBA 3ZM9A 4FL3A 5KMIA 2W1ZA 4IX3A 4G3GA 4G9CA 2J0JA 4GU9A 1Q8YA 4TKSA 5ETAA 2HXLA 1IR3A 1FPUA 2FSLX 3G9LX 5DE2A 3RBWA 3FZTA 2GNGA 4XH6A 4X3JA 4Y85A 4C61A 4YJRA 3RWPA 4AOIA 5JFWA 5JQ5A 3QZHA 3ULIA 2CNVA 3R28A 3OCSA 1W98A 2XK3A 5B7VA 4DEEA 2UZUE 3EQRA 3LKMA 2QCSA 4I93A 5HO6A 3OWLA 1WBNA 4ITIA 4NIFB 4TZRA 1Y8GA 5CU0A 3BRBA 3VBTA 5M4FA 5HTBA 3UVPA 2CKEA 2F7XE 4RFYA 4A4OA 4D1ZA 3W16A 5CAQA 3UIXA 3OC1A 4EORA 2UZLA 4PMMA 4RBLA 3DLZA 5G6VA 5KKRB 3UO4A 3C4ZA 2OWBA 2PZIA 2IVTA 2GNFA 4C37A 3WYYA 4BCMA 4USFA 1CDKA 3PA3A 3O51A 5E9EA 2FA2A 4P5ZA 4DGOA 4LUDA 4IAFA 4R3CA 4UALA 2PE0A 2WZJA 3ID6C 2J2IB 3QBNA 4U80A 1ZYCA 5HBJA 5ETIA 2J51A 2UW9A 2BALA 1F0QA 4L45A 4CMUA 4HVGA 3TUCA 2IF8A 4OAUC 2CKQA 4OTRA 2JEDA 3NVMB 2GSFA 3DXQA 4EHZA 1SVGA 3HP2A 4RSSA 2HCKA 3HUCA 2DS1A 5KHXA 5E1EA 3LIJA 3S3IA 2XJ1A 4FSNA 5IQFA 4TYEA 1P4OA 3EFJA 1MRUA 4O82A 3GU6A 1TQMA 2WGJA 2QD9A 3UOLA 2BKKA 4RMZA 4FTJA 5HESA 4ACDA 4AZVA 4F0GA 5J7BA 1OZ1A 3DOGA 5ANGA 5AMNA 1UNLA 3ZLYA 4EOLA 1Q41A 1FBNA 4H58A 2CJMA 2UW6A 2CMWA 4F7JA 4GIIA 3NRMA 4E3CA 4MBLA 4C57A 1ZZLA 2HXQA 5IPJA 5CX9A 3C9WA 3DU8A 5FTOA 4QOXA 4DFUA 2YA9A 4TYGA 1WBPA 5FQDC 5LVNA 1W2DA 3GCPA 2RFNA 3UG1A 4ZZOA 3UDSA 2OKRA 2PZRA 1XO2B 2BIKB 3GCVA 4QP6A 3LFQA 2OSCA 1R78A 5B0XA 2HOGA 4HGEA 3BKBA 5FXQA 1VYZA 4HVIA 2XYNA 4W9WA 4DEHA 5B2MA 5CEPA 4EHEA 2BAKA 1DAYA 3PFYA 4OLIA 3PJ1A 3TUBA 4HPUE 2YDJA 2XH5A 5J7HA 2IEWA 3CY3A 4GS6A 3LJ1A 4I41A 4QNYA 4AOTA 4FOBA 4EBWA 3CIKA 2XIKA 4L44A 3V6RA 4RVMA 2BDWA 1JKSA 3MDYA 4FT5A 4FNYA 4C33A 2X6DA 2I0YA 3FPMA 4NM7A 3DNDA 3ZSIA 1ZRZA 3TNIA 2XK8A 3QTSA 4BF2A 1XBCA 4V04A 5A4CA 3ZFYA 3KCFA 2X7OA 2ETRA 4KS7A 2JLDA 2A2AA 3F3ZA 2VUWA 4U42A 4O21A 4PTGA 4A9YA 3ML1A 1Q62A 3VUKA 2G2IA 4FEUA 5E8XA 4DHZA 2YFXA 2Y4IC 5CF6A 4H1JA 5KO1A 4TNBA 1Y6BA 4GVAA 2F7EE 4DG2E 2R3RA 5FD2A 5AP5A 4HCTA 3OW3A 1KV2A 3U8WA 4O0TA 3Q4CA 3TDWA 4I94A 4O2ZA 3AGMA 1APME 1AD5A 4PMTA 3Q60A 2XB7A 3VULA 3RNYA 4DTAA 3FYKX 1PXKA 3P5KA 1YXTA 3UTOA 4CZYB 4IE9A 4O4CA 3C4FA 4IEBA 4O6EA 4XRLA 2ZM1A 4U40A 4ZTNA 5FP5A 3ZTXA 5JQ8A 4NEUA 3HX4A 2ZOQA 4C59A 1MQBA 3LOKA 4O86A 5CANA 5IG1A 2W06A 2QO7A 3PXYA 5IF1A 3HMMA 3EFLA 2XUUA 1U4DA 3EQPA 3L9PA 2GFSA 3OS3A 1S9IA 4FKPA 5E8YA 1OIYA 4ZLZA 4LL0A 4IZ5A 3OOGA 5AV1A 4FZ6A 4OBPA 3V5WA 3DV3A 1OL5A 5DOSA 2DQ7X 3LXNA 2G2HA 4ZS0A 1WVXA 4AUAA 3CR0A 4L6QA 1QCFA 2WOTA 3O8PA 2WQOA 3E62A 4AQKA 2IVUA 3BGPA 4BHNA 4FV5A 3O7LB 4R3RA 5EQEA 1PHKA 4WOVA 3MN3A 4FTOA 4MAOA 5BUEA 2X9FA 3V51A 5J5SA 3N4VA 4GH2A 3QUDA 4AT5A 4IAKA 3CS9A 5CI7A 3VC4A 3ZUTA 1PKDA 4Q5EA 2Z2WA 3T8OA 3BHHA 2JIIA 1NVRA 3HL7A 3AD6A 2BZIB 3DGKA 3Q9ZA 4GK2A 2VO6A 4L01A 4XS2A 4A9SA 3OWJA 4YHJA 4AW5A 3CD8A 1VYWA 3P79A 4AA4A 2X7FA 5EDRA 1YI6A 3IKAA 3ZUUA 4FT3A 4GL9A 5LMKA 3HYHA 4MD7E 4XEYA 1P2AA 2J5FA 3KQ7A 3R21A 5C8MA 2VNYA 3SXRA 5DPVA 5JK3A 5CY3A 2OJIA 4JBOA 4HW7A 4FVRA 3V3VA 4ANQA 2W1CA 4BDEA 3PVBA 2FYSA 5DH3A 5CVHA 4I23A 5DEWA 5CALA 4IH8A 4RX9A 3NFFB 5CZIA 5E92A 4WUAA 3TWJA 3SOAA 2AYPA 3II5A 3AKLA 2BFYA 4RRVA 5FEEA 4QMOA 4QMXA 3QD0A 4GYGA 4I21A 4AA5A 2VX3A 3PPZA 4G17A 4RPVA 2V7AA 3ORPA 3PA4A 4P5QA 3TZMA 4S30A 5AUVA 2OO8X 2W4OA 5C8NA 4I0TA 4L43A 4ENYA 5I9ZA 2R64A 1PYXA 3ZDIA 3FI8A 2XIZA 4IDTA 4X2KA 1KE7A 2IPXA 5EM8A 2WIPA 4ERKA 1XR1A 3BBTB 3KA0A 3FUPA 3ZO4A 2W99B 2YDIA 1PMEA 3P4KA 3R83A 4U5JA 4ACGA 2WMXA 3D14A 4PRJA 4YURA 3BU5A 1W2CA 2F57A 5GZ9A 5HG8A 3HRFA 3ACKA 1H28A 3DAJA 3DJ6A 5D41A 3F66A 4ANMA 5AV4A 3DFAA 4YLLA 5AFVA 3NNXA 4FTUA 4F6UA 1XH6A 2VGPA 2WTKB 4DA5A 2C1AA 4C0TA 2XAOA 3EQBA 3ZSHA 4C8BA 4FTTA 4ZTMA 4FEXA 3Q9YA 3JUHA 3KXGA 4DFZE 3EN9A 3HZTA 2R5TA 4F7SA 4LV7A 4V0GB 2V62A 4PP9A 4WNKA 3W8QA 2YZLA 3C4WA 3BYVA 1ZOHA 1M17A 2YIQA 3I0QA 1BMKA 4HZRA 2VZ6A 3LW0A 4IVDA 5AP2A 5E91A 5FXSA 5J87A 2J9MA 3FV8A 5TE0A 1T45A 3H3CA 1Y6AA 2R4BA 3R1SA 5HICA 4QP7A 5EK7A 4NYEA 5BYYA 5EYCA 4OTWA 3VUHA 2C3LA 2QONA 5EKOA 3CLYA 4BTMA 4JG8A 2ERZE 1T46A 3ROYA 2PVYA 3KU2A 2B9FA 4D2PA 3P86A 4UYAA 4PDYA 3RI1A 3MVHA 4YUQA 4AQCA 3U9NA 5I3RA 1OM1A 4UZDA 4C4IA 3C0HA 3ATSA 5GIPE 1WBVA 2UW5A 4RVLA 3NW7A 1ATPE 4TWNA 5CI6A 3ORTA 4RG0A 4NCTC 4FG8A 3F6XA 2EB3A 4QNAA 3ODYX 2QNJA 1SVHA 4GMYA 5BV3A 1REKA 3UVRA 2OZOA 4PL4A 4BGHA 4WSQA 4RJ6A 4UXLA 4ACHA 1Q3WA 3KL8A 5IQBA 3E63A 4OTGA 2BVAA 1UWHA 4L46A 5IQHA 3VUGA 2Y6MA 3R8PA 4QPSA 3JR1A 4XG6A 5F9EA 2IZRA 5EM5A 2XIYA 4AZTA 1JKKA 4FVQA 3IW4A 3IONA 3BU6A 2WU7A 3KN6A 4KBAA 2VTNA 1V0BA 3POOA 4FTKA 1W8CA 4O6LA 3BLHA 4PPAA 2VTMA 2R0UA 4NU1A 1YOMA 2ITOA 3GGFA 4ACCA 4AZWA 5M51A 4E5AX 3JVRA 5IH6A 2XNBA 4GIHA 5ANEA 4BHZA 1CM8A 2V0DA 3DAKA 2R3JA 5TF9A 3DDQA 3L8SA 3ZRKA 3HDNA 3ODZX 3ZFXA 3FXWA 1P5EA 4XG2A 3MH1A 5JGBA 4YP8A 3ORKA 2HIWA 4AN3A 5GJFA 4BWKA 4QO9A 4EHGA 3NEWA 4K77A 1PXMA 3R63A 5AUXA 5JFVA 5A14A 4K0YA 3LJ2A 4LYNA 4CEGA 4NM0A 2OI4X 3V5PA 4ITJA 4CYIA 4U0IA 3D2KA 2PVHA 4IQ6A 2W5HA 3NX8A 4U3ZA 3PIYA 2A19B 4JR3A 5IEYA 2P33A 4FSQA 2XANA 4FODA 3WF6A 1E1VA 2P0CA 3LCOA 4GFMA 3DTCA 4IDVA 4EHVA 2ITZA 4FIIA 2C3KA 2YM5A 4XLVA 2VTHA 3U51A 4EOOA 3TDVA 4NIFA 2NYAA 4JL9A 3M2WA 4KKHA 1FOTA 4WKQA 5AP7A 2G15A 4FE2A 2CCHA 3FL4A 1O6YA 4YPDA 3RK9A 3SHEA 1IA9A 4YTIA 4QQTA 2XJ0A 4YZ9A 5CTPA 4IBMA 5ACKA 4X6RA 4AZFA 2F2UA 3WE8A 4EOQA 3PVWA 2X2MA 4O7LA 2R0IA 3GFWA 4JJRA 3SKCA 3I1AA 3CKWA 2BTRA 3OY3A 3UDZA 4BJJB 3G6GA 3WZKA 2XNEA 4BZOA 2QI8A 4GT3A 3I5ZA 4O4BB 2QOBA 4CV9A 3MY5A 3ZONA 4UV0A 4J99A 4CQGA 4P7EA 4IM2A 4DDIA 2JGZA 4F0IA 4PY1A 3VS3A 3W55A 4MVFA 3HECA 4AGWA 3GFEA 2A0CX 4UBAA 3BHVA 3GQIA 4DAWA 2C69A 4L53A 4DITA 5CF4A 2X81A 4KA3A 4WBBB 5AP3A 2WTCA 4C3PA 3UNKA 2X0QA 3JS2A 4E5WA 4PDSA 2OF4A 4WRGA 3W33A 2NPQA 2X4FA 3GEQA 4C34A 4Q2AA 2YCFA 3Q5IA 3F69A 4KKGA 4HZSA 2C0OA 2PSQA 3P9JA 5HOAA 3UOHA 5GJGA 1FGKA 5J9ZA 3VBWA 4GUEA 2I0HA 5HD4A 3CPBA 3OW4A 5M56A 1G8KA 4PF4A 4QMPA 5E8WA 2E9OA 2R3FA 4M13A 3PXQA 5DT4A 5L2WA 2ITWA 3VUDA 3N4TA 4ITHA 1KSWA 4JDJA 4TWCA 5IH4A 3TNQB 3FEGA 3F7WA 4NT4A 4AW0A 2PMNX 5DA3A 1ND4A 3ZSGA 3TV6A 4MD9E 5K4IA 1KV1A 4MXXA 2AC5A 5AX9A 3QA8A 3H9RA 3WZJA 4X3FC 5EQYA 2ZFYA 4YNOA 1VJYA 1J3HA 2V55A 2PU8A 4ZLOA 2FVDA 4BCHA 4DHFA 4A4XA 4F9YA 3CE3A 3G51A 4BTKA 2P4IA 3QYZA 1I09A 5AUYA 3P7AA 2X8IA 5M08A 1BUHA 2Q0BA 2PUIA 3LXLA 2CSNA 4RX8A 4WT6A 4AAAA 4M3QA 5A9UA 4GJ3A 2HZ4A 3QYWA 2Q0NA 4UN0C 5CU4A 2XK4A 2B9IA 2O65A 2YIWA 2BDJA 4K18A 3TZ9A 4F1OA 2JD5A 4WSYA 4DH5A 3OWPA 3H10A 4EH4A 4LRMA 4WBOA 4FSWA 4JBVA 4MUQA 1IG1A 3ELJA 3ET7A 3R00A 4C36A 4C3FA 1PRYA 4FV4A 2UV2A 2GCDA 3D0EA 4MXOA 3PSBA 5JH6A 3QTQA 4KS8A 4J8NA 4ALVA 5A4EA 1J7LA 4JAJA 2R3OA 3FQHA 3VJNA 3DK6A 5LARA 4TW9A 3EFKA 3RJCA 4P90A 4KRCA 3ZXZA 1OL6A 3PP0A 1YDTE 4X2JA 5CEQA 5I9WA 3B8QA 4RJ4A 4JDKA 5EW3A 4H39A 2P55A 4N4SA 4CRLA 2XF0A 4YTCA 5ICPA 4JDIA 3KULA 3JY0A 5HNGA 3F3WA 3V6SA 1E1XA 3HV5A 3OF0A 4U9AA 3SVVA 4FTIA 2WKMA 4MKCA 4MNFA 4BCPA 2QKRA 3W32A 3BHYA 4F99A 5HVKA 1IASA 3CP9A 2YN8A 3JVSA 2AC3A 3C7QA 4QTEA 4JT3A 1L8TA 3CTQA 4BDKA 3QQLA 2VU3A 4K9YA 4KSPA 4BIDA 4XP3A 4D2VA 3NYXA 5D10A 2EXCX 4RZVA 5AA9A 2WELA 3PUPA 1BL7A 4BCNA 5L6WL 3DB6A 4IM0A 1SZMA 5EG3A 2C3IB 3I4BA 1PW2A 2XKDA 4K11A 5DI1A 4QDVA 1H1SA 4FV3A 4QMTA 3WF5A 1MQ4A 4M66A 1UV5A 4WIHA 1Y91A 4YZMA 3TUDA 3VUIA 2GTMA 4I6QA 2C6KA 1UVRA 5DR6A 4D4VA 4L7SA 3LMIA 3TNPC 4M67A 5HIDA 5BVOA 4EUUA 3NMUF 4NK9A 2BRNA 3MJ1A 2WMAA 4C4JA 4EL9A 3BGQA 3VN9A 3CXWA 5HORA 2UVYA 4U3YA 3TJDA 4FV9A 5FEDA 3A7IA 2Z60A 2W1DA 4I1ZA 5A3XA 5AV2A 3EYGA 3GOPA 3W1FA 5C1QB 5C4LA 2C6LA 1XHAA 5LVLA 1F3MC 3BZ3A 1GNGA 2GHMA 2J4ZA 4B8MA 4DBXA 4O22A 4Y73A 1OBGA 2C5XA 3TXOA 3NUXA 5C9CA 3GU5A 4AU8A 4O7YA 1Q99A 3LFBA 5ETFA 5HNIX 3BPRA 3QTUA 3AT2A 4HCVA 3MH0A 2WTWA 4C4GA 3SOCA 5I4NA 3VBYA 1PXJA 2X2LA 3I60A 2WTVA 4CFNA 1ZOGA 5KBRA 3BQRA 4B8LA 4G16A 2JFMA 3IDBA 4DT9A 3PPJA 3KVXA 4FKLA 4I92A 3EL8A 1W83A 3R7EA 3WIGA 3Q32A 4UWBA 3ZFMA 4B4LA 3DK7A 3WF7A 2W7XA 4BYJA 4IJPA 5IUGA 2YABA 1RE8A 1K2PA 1OI9A 4CKIA 3NDMA 4H3QA 4QRCA 2R3QA 4U8ZA 3ULZA 2ITYA 1ST0A 4ZMEA 3DA6A 4NTSA 2QLUA 3UGCA 3FXXA 3QAME 5IA0A 1QPEA 4QP4A 4IX6A 3MY1A 2Y6OA 1NY3A 1Z57A 3Q5ZA 1OL2A 3P08A 4GFOA 3HV7A 3C0GA 3D7TB 2BZHB 4UY9A 4ZSJA 1YI4A 5FTQA 3U87A 1OBDA 4GEOA 2A98A 3QALE 3EQDA 3QD3A 1V1KA 4EH6A 2IN6A 1QL6A 3FI4A 4EK8A 2R3LA 4UMTA 1JSTA 4AW1A 4OTIA 4XG4A 2C6EA 4IHPA 3C51A 1HOWA 3GBZA 4ZZNA 5A4TA 3NYOA 2DYLA 4LOQA 5DR2A 3RZFA 4BBEA 3Q2JA 3GNIB 3OG7A 5E90A 3V8WA 5EYKA 2XP2A 3EN5A 4MXYA 2ZMCA 3VBVA 1YWVA 5EDQA 1S9JA 2GS7A 4CFXA 4CYJA 5IEVA 3NFGB 3ATTA 3TACA 4FSYA 3EKNA 4I24A 4JS8A 4XG9A 1DM2A 3OEZA 3CJGA 5J1WA 1OGUA 1QPDA 4WNPA 1OUYA 3H30A 2R3HA 2VTTA 4JQEA 1XH7A 1KOAA 3DZQA 2ETMA 2G2FA 2XS0A 4I3ZA 4JX3A 4RJ3A 5AUTA 2GQSA 5J95A 3TKUA 3PIXA 3PPKA 2UZEA 3D5XA 1DAWA 2I40A 1OUKA 3A7HA 4RIXA 2IZSA 4ANLA 3FPQA 4BKJA 3QQHA 2EXEA 5M44A 4PDOA 3BYMA 2PUPA 1DS5A 4HNFA 3L1SA 5D9HA 2IW8A 1U46A 2ESMA 4BZDA 3WOWA 1M52A 2WMVA 3QQJA 3LAUA 2XBAA 4GT5A 2WMWA 4PNIA 4D2RA 3L8XA 1W7HA 3OEFX 5IDPA 4O7ZA 1Y8YA 2AUHA 3WBLA 3NNUA 4UMUA 3PJ3A 4FTQA 4HNIA 3QZFA 5HE2A 4CFFA 3VS4A 3ZZEA 1TQIA 3HV6A 1OECA 4MH7A 4F9BA 3AOXA 4BCIA 3KN5A 3POZA 4FL1A 3O71A 3NS9A 2XJ2A 5EKNA 3ZLSA 3ZBFA 3FJQE 4EKLA 4DFXE 2Q83A 4B9DA 5AX3A 4K2RA 4DTKA 3ZDUA 4KBCA 4XHKB 5FLFA 3COHA 2UZNA 4C2VA 4QYYA 4D0XA 3BWJA 2XMYA 4E4XA 1LEWA 4YNEA 4Q9ZA 4FNXA 3L9NA 5IMXA 3LQ5A 2E9VA 3BELA 4ZTRA 3R7GA 2WOUA 2GS6A 5CENA 3FKOA 1WBOA 2ITTA 4DBNA 2BTSA 4G5PA 2V22A 3IGOA 3C0IA 3TKIA 3ZEWA 4JMQA 4JX7A 4F9AA 4BDJA 3UNJA 4EI4A 4TPTA 5KBQA 4BDBA 3P23A 5AR2A 4MK0A 1M2QA 3GUBA 2PYWA 4LDTA 3RKBA 2SRCA 2IVVA 5BQ0A 3T9TA 1H26A 2ITUA 2HWPA 4ANBA 4E4LA 4ZTLA 2UZWE 3RK7A 3VW6A 3RZBA 4YO6A 4RLKA 3FHIA 3IO7A 2XK7A 4RWKA 5EYMA 4FTMA 4L8MA 3V01A 1DI8A 2CLXA 4AZSA 1YXUA 2XKEA 3NLBA 3R30A 4CFVA 2BAQA 4O1PA 3VWAA 4BC6A 4CVAA 2J5EA 1ZXEA 1WBSA 3KIOC 4O7TA 4MD8E 4JI9A 4FKWA 4MXZA 3QC9A 4CG8A 2QOIA 2J0KA 4MCVA 4XV2A 3QU0A 4IX4A 4CCBA 5BMMA 2WFYA 4X2NA 4YO4A 3DT1A 1ZWSA 3L8VA 3PA5A 2QG7A 3AGLA 4F65A 2HYYA 2V5QA 3R1YA 4QDEA 4X2FA 2YM6A 1STCE 5M55A 5HZNA 4BJJA 4O4DA 4XOYA 3E8EA 3MFSA 2O63A 3ORZA 3R9OA 3UC4A 3UP7A 3I5NA 3VBXA 4O7VA 1U59A 2OBJA 2C1BA 2PZYA 3AC4A 3MFRA 1YOLA 4RVKA 4QD6A 5EI2A 3BE9A 5AJQA 4EZ3A 4FK3A 5GJDA 4RA5A 3DJ7A 3VS2A 3BWFA 1RJBA 2XVDA 3GENA 3PXFA 3IS5A 4QP9A 4TYHA 4CV8A 2F2CB 3DTWA 4O27B 3VRZA 2X4ZA 2JDOA 3GCSA 4BKYA 2JAVA 5CXHA 4K1BA 3KRRA 3IOKA 4EK4A 2RFEA 3D5VA 1AQ1A 4XYFA 4EOMA 4DHJA 4KAOA 3PDTA 1U5RA 3ORXA 2QC6A 3DS6A 3HRCA 1GJOA 4L42A 4AXDA 3RNIA 3IOPA 1CMKE 3HV4A 3NUPA 4FUYA 4APCA 5H3QA 3FZOA 5CEOA 4E73A 4G6LA 4JG7A 4J96A 1TKIA 3E7VA 3F5GA 3EQIA 1GZ8A 3DQWA 5JKGA 2WEVA 4EONA 3OROA 3UOKA 2BCJA 3U4UA 2OXXA 3Q4UA 4UMPA 3S0OA 3NYVA 4KINA 4AGCA 1YI3A 2B0QA 3CQEA 5CQWA 3ZO1A 3D2IA 3UVQA 1PXNA 2OF2A 2XA4A 3F5XA 3W2OA 4DEIA 3N4UA 3W0OA 1NVQA 2WXVA 3TTIA 2H8HA 3PLSA 3I6UA 3QFVA 4BTFA 2ZB1A 4RT7A 3KULB 2YWPA 3MVLA 2BPMA 4GRBA 4N70A 3WZDA 4USDA 4FVPA 5CEMA 2YCQA 2YISA 4M69A 5CU6A 3NUNA 4J8MA 2JFLA 2C5VA 4X2GA 5HU9A 4JNWA 4D9TA 4YZDA 2YJRA 3TM0A 3BCEA 4FG7A 4RWLA 3QGWA 3R7VA 2PL0A 3DKOA 3BV3A 3LHJA 4O81A 4BZNA 4W8DA 3VUTA 2CKPA 1WBWA 4P2KA 2JC6A 2WNTA 3Q96A 3K54A 4QMQA 5I9YA 4DN5A 5J1VA 3A61A 2EB2A 5EI8A 2C6DA 4LFIA 5CT0A 3CQWA 3RM6A 4WRSA 5AA8A 4KKEA 1VR2A 3BL7A 2E9UA 1W2FA 3VF8A 4HVDA 1OVEA 1PXPA 3BLQA 5CSHA 4AE9A 4AP7A 4O0XA 4Q9SA 2UW7A 3WILA 3AC8A 3RINA 4WG3A 4Y5QA 4C4HA 1R39A 1XQZA 3FLSA 3FZPA 4YJQA 4S34A 2RG6A 4DG0E 2HW6A 2UVXA 1KUTA 4RIYA 5AUWA 3OCTA 3NYNA 3ZHPC 4O4FA 4BBMA 4W4XA 2BHHA 1P4FA 4FKQA 4FTLA 3K5VA 3CC6A 3MVJA 4FIHA 4MEDA 3W0PA 4XMOA 5L2SA 3SLSA 3I6WA 4GG7A 1ZYDA 4M7IA 3HEGA 5AP4A 3PE1A 4ZJIA 3U6IA 4NM5A 3KF7A 4CLIA 4YHTA 5CAUA 3KREA 3KKVA 4EJ7A 4TRLA 3SXSA 5LCJA 2G1TA 4D1XA 2CNUA 1R0PA 3CGOA 4BN1A 3BU3A 4FG9A 3LFDA 1LP4A 4MQ1A 3ANQA 5HQ0A 2V7OA 1Z9XA 4FNWA 4XV1A 1Q8UA 2JKOA 2QHMA 2XNPA 4RQVA 4FV0A 4RA4A 4XX9A 3RPYA 2O8YA 4JXFA 2HK5A 4EYMA 5ETCA 3VS1A 5JEBA 3OXZA 4HYUA 5L8LA 1ZMVA 2PZ5A 3MH3A 4NW6A 2YWVA 3C4CA 5AP1A 4L3JA 3W0QA 4L3PA 2W05A 4BCFA 3AT4A 3F5UA 5FTGA 4EWHA 1F5QA 4JIAA 4A9RA 2VNWA 1PYEA 3FDNA 1JKLA 4QMMA 4BDGA 4FSTA 2LGCA 2O0UA 3VJOA