2UW6A

Structure of pka-pkb chimera complexed with (s)-2-(4-chloro-phenyl)- 2-(4-1h-pyrazol-4-yl)-phenyl)-ethylamine
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
337
structure length
334
Chain Sequence
SVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVMLVKHMETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLTKLEFSFKDNSNLYMVMEYAPGGEMFSHLRRIGRFEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLMIDQQGYIKVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFSEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC SUBUNIT
publication title Identification of Inhibitors of Protein Kinase B Using Fragment-Based Lead Discovery
pubmed doi rcsb
source organism Bos taurus
molecule tags Transferase/inhibitor
total genus 104
structure length 334
sequence length 337
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2007-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2uw6A01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2uw6A02
4Q5HA 3BHHA 3QD3A 3GUBA 1FQ1B 3UODA 2E9VA 3QRKA 3QZGA 4U40A 5BX0A 5M56A 4CTBA 3H30A 4E26A 1RJBA 3U4WA 2WIHA 2W1IA 3L9PA 3LFQA 4QMLA 2WMUA 3IGGA 4V0GB 3DNEA 3VUTA 3RM6A 1G8SA 4O1OA 4MXAA 1IG1A 5FXSA 5IKWA 3OBGA 3TXOA 3FMEA 1BI8A 4FTOA 3NW7A 4I41A 4KIKA 5AAFA 2E9PA 5B0XA 3VBTA 3EFLA 4BCJA 4BZOA 2VTPA 2IVTA 3SA0A 1GZ8A 2W1HA 2ZV2A 5KKRB 2VRXA 2XM9A 3ANQA 4ENYA 3C4XA 3HL7A 4RJ8A 4QMMA 5AP7A 3FSFA 5M4UA 4DTAA 4LOOA 4IZAA 2F9GA 4IC7A 4ALWA 4O83A 3VS6A 1WCCA 3F6XA 3FYKX 3I5NA 5F20A 4D2PA 1R1WA 2J7TA 2B9JA 3T9TA 5LMKC 2FSOX 4I4EA 3PRIA 4DEHA 4G9CA 4JIAA 4DAWA 3RHXA 1OL2A 5AR3A 1FVVA 4FSWA 4L68A 2R5TA 4TYIA 4WA9A 4AA5A 4DGNA 2QOOA 1TQIA 1ERKA 3OUKA 4ZTSA 2BROA 3FQEA 4JX7A 3VBYA 2LAVA 3UOKA 4XV2A 3QTWA 3LVPA 5BYZA 4YMJA 4HNFA 3ZSHA 5I5ZA 2YDIA 2WTVA 2BZKB 3OWKA 3UMXA 4JQEA 4QT1A 3QGWA 4XBRA 2B9FA 5TT7A 3ZFXA 1F0QA 3HP2A 4BHZA 3ORXA 3TTIA 5FQDC 3AGLA 5TKDA 1PXPA 3OCTA 2OH4A 5FUTA 4O0YA 1BL7A 3V8WA 5CF4A 5FXQA 3KREA 2F57A 3VHKA 1H4LA 5JQ8A 4RX7A 2RFDA 3KA0A 3QUDA 4TWCA 4BCIA 3R63A 4MEDA 2BIKB 5M08A 4CLJA 3L1SA 4YHJA 4QRCA 4B8LA 3MFRA 5HOAA 4EKKA 4BTKA 4GCJA 2PVKA 2GFCA 4GS6A 5EI6A 4IACA 3GOKA 5DG5A 4O2ZA 5T68A 4AA4A 4O38A 4I20A 4FGBA 2UZDA 4FF8A 5GZ8A 2QR7A 1UNHA 2JC6A 5FEEA 3NVKI 4ANQA 4C3PA 3E64A 1XH8A 4IB0A 4ZTLA 4FGRA 3PXRA 3IW6A 2UW8A 2HXQA 3C4ZA 5ACKA 4FEQA 4NU1A 4ZTQA 4CRLA 5M44A 4CMOA 3NCZA 4P5ZA 2PVNA 3CGFA 5EOLA 1J1BA 4QTEA 3TDWA 4DF3A 4EZ7A 3ALOA 3PIZA 5AAEA 2JD5A 3VBXA 4CLIA 3DQWA 3ZUTA 5CU2A 5TO8A 3EZVA 1YQJA 2BRNA 4QMTA 3IDBA 4FIHA 3IO7A 4QNAA 4M8TA 3QXPA 2PMNX 4FOBA 5HVJA 2PYWA 3GCSA 3BELA 3R2YA 4YTFA 2PUIA 2R3RA 4OTFA 5A54A 1ZOHA 1ZY5A 1PMEA 1YDSE 4HVSA 4O81A 4M15A 1ZWSA 3HAVA 1H8FA 4GYGA 5A3XA 4KSQA 5IA0A 4HCTA 4H1JA 3M1SA 2J9MA 4WRGA 4ZJJA 3DK7A 2IPXA 2ACXA 2ZDUA 2XUUA 3WZUA 3S1HA 1H1QA 3IGOA 2B54A 4FKGA 2OK1A 3CPBA 4AGCA 5EYMA 3QX2A 4FV2A 2IW8A 3GC7A 4OTHA 3F5GA 4WNMA 4NYEA 5LQFA 2PU8A 3LQ3A 1M2PA 1YW2A 3W2CA 1RE8A 5IA2A 5IA3A 2ZV9A 3MPMA 4LGDA 1JSVA 2VWVA 5GJGA 4BDKA 3GCUA 2HY0A 4UMRA 4FEUA 2P3GX 3CR0A 2ITXA 4U97A 3F66A 5FEDA 4A9SA 5FM3A 3AG9A 5JRSA 4AGDA 2C6TA 1YWVA 4QMOA 3G6GA 4AN2A 2B53A 3A7HA 4CGAA 4JRNA 3H9OA 4MBIA 5JKGA 1NVRA 2QOKA 3E8EA 1W82A 4ZTRA 4MCVA 4NEUA 2PSQA 5AM6A 4QPAA 3QQUA 3EN9A 4DYMA 2Z8CA 2QHMA 4CFVA 3PIXA 2OU7A 1YOLA 1XHAA 3L9NA 3P9JA 4U44A 5C8NA 4FV3A 2RFSA 3A7IA 3BLHA 5FRIA 3R6XA 2WTKB 5CAQA 3Q6UA 4S31A 2UZVA 4PPAA 3D5VA 4FT7A 3GEQA 1M7NA 2BALA 4HYUA 4APCA 2G15A 4AW0A 4F9CA 5I9ZA 5J1WA 5M53A 4W8DA 4D4RA 5AV3A 3PLAE 3R83A 1PXOA 2XIYA 1U54A 3FI2A 4D5KA 3AC4A 2O0UA 2Z7SA 1CTPE 4XG2A 3ZEWA 2VZ6A 2CNVA 4R78A 3U51A 3P7CA 4L01A 3DBCA 3DKFA 1A9UA 4BVUA 4TWPA 4EH9A 2BFYA 3RMFA 3MESA 5HQ0A 2C30A 3POZA 4FX3A 4USEA 3SC1A 2C4GA 1NVQA 4AWIA 3E5AA 5JGAA 3ELJA 2YEXA 2WOUA 5HNGA 4PL4A 4OTGA 4EHGA 3QKMA 3SLSA 4BRXA 3TV7A 4ONAA 3A99A 3G15A 4EH8A 4V01A 3ETAA 4DFUA 2VTQA 2J0IA 4ZP5A 5LJJA 2X9EA 4FTRA 4DT8A 4EORA 2JIVA 2UZUE 2YIQA 3HMNA 1WZYA 3UNJA 3O0GA 2EUFB 2GHMA 2PVLA 3MIAA 2C6EA 1OL6A 3F88A 4C4JA 1FPUA 4AOJA 5HBJA 2WTKC 3Q96A 4J8NA 4I6BA 3UNZA 4OBOA 4O7LA 4O1PA 2IJMA 4UMUA 4AZTA 2ZJWA 3QQFA 5FWKK 3R8VA 3LFAA 4N4SA 4ZTNA 3VN9A 2GS2A 5HEZA 2R9SA 4Y95A 3MFSA 1YXTA 4U3YA 4BWXA 1U4DA 3KF7A 5E1EA 4M66A 1NY3A 5T6KA 2JFLA 3V5WA 4ASDA 3IONA 4KS7A 4ASXA 4DGMA 3ZO4A 3T3VA 2IW6A 4RC3A 3GQLA 4JT3A 5HLNA 3C5IA 3MPTA 4XRJA 4I5PA 5CU3A 4EEVA 3W1FA 2HZNA 3EFJA 4QMNA 3ZUVA 4X2FA 2C6MA 2IWIA 4GT3A 4BWPA 3I4BA 4TXCA 4ZSJA 3ZHPC 4ANBA 5LMBA 5IQBA 5IQFA 4BCHA 3DLSA 4JXFA 5C01A 4NJDA 2UW3A 2XK4A 2VO3A 3LE6A 3TUDA 4MVFA 4AA0A 1PMNA 1V0OA 3DBQA 4XEYA 1REJA 1BI7A 4E4LA 4KBAA 5LCKA 1MQBA 3JY9A 5ANGA 3SVVA 4QP6A 3ODZX 1AQ1A 3QA8A 2C69A 2OIBA 4BWKA 3BBWA 4MQ1A 4YHFA 5HG8A 4YTIA 3BE9A 3MVJA 5L8LA 1H00A 3EOCA 4G6LA 3WE8A 2PVMA 4BTJA 2CNUA 4DG0E 4DTBA 2WOTA 2DYLA 3MVLA 3COMA 4F9YA 5ANKA 2RFEA 3MH0A 4TYGA 4FV4A 3DPKA 5HO7A 2JLDA 4PTEA 2XNOA 4TYHA 2OJIA 3KEXA 4RT7A 2WGJA 3RM7A 2X6EA 3O7LD 4NM0A 5JK3A 3C1XA 4HNIA 3ORZA 3FL4A 4F4PA 3RNIA 1O6LA 5EW9A 4IVAA 4QP4A 5A4CA 3MTFA 4RX8A 5IEYA 5IMEA 2WIPA 5DFPA 5AUWA 3N9XA 3QQJA 3QTZA 2WTWA 3OXIA 4ZS4A 4DEGA 3BZ3A 3LJ0A 3LFSA 4HYSA 3PE1A 4TNBA 1XH5A 3B8QA 4U81A 4UYAA 5BVWA 4JNWA 3RHKA 3TJDA 4AXAA 4RIXA 2GU8A 5CSXA 3IKAA 1CSNA 1PF8A 2OZAA 3I5ZA 3FI3A 4F9AA 5FEQA 5L6WL 1KE5A 2WQMA 4RWKA 3COHA 3KL8A 3RVGA 2WTJA 3UIUA 4AW1A 5HE1A 3V6RA 2VO7A 5A46A 4BKJA 2WMBA 3DKGA 4DHFA 1RW8A 4F6UA 1UU9A 3EN7A 3QWKA 2UZWE 2CCIA 2WHBA 3R9DA 3IW8A 4BDAA 3R73A 2ITQA 5M55A 4J8MA 4BBMA 1FINA 2XK8A 4XH6A 2V55A 3QUEA 5HO6A 4FBXA 2ITNA 3PE2A 4FTKA 4ZK5A 4DG2E 5KX8A 1S9IA 3ZDUA 3V8SA 4JL9A 3U8WA 4E3CA 5C4KA 3KXNA 2ONLA 1JVPP 4YZDA 3SRVA 3VRZA 3PPZA 3W2QA 2Y6MA 4F6WA 3GC0A 3BEAA 3PP1A 4ZTMA 3QZHA 3Q2JA 3RCDA 3TNHA 3TZ7A 4BI0A 2YDJA 4CCBA 3TCPA 4BC6A 3ZSIA 4EHZA 5M4IA 2J4ZA 4N6YA 3RPSA 1ZMVA 4YC3A 5EDQA 3HKOA 5BVKA 2CPKE 5CXZA 3HDNA 4IB3A 3RAWA 3E8NA 4UWYA 4FEWA 1DM2A 5DHJA 2YCSA 2XYUA 2YITA 4DC2A 3CSVA 5A4EA 3A2CA 3QD2B 1L8TA 5L2SA 4D58A 2BCJA 3KF4A 1J1CA 2O64A 2B55A 3VC4A 4D2TA 5AEPA 2IZUA 5BUJA 2YM6A 4H36A 3I6WA 5B2LA 5BNJA 4E6AA 3MVHA 3QXOA 2BHEA 4XV3A 1OM1A 3HV6A 3TZ9A 5AA8A 2C47A 4F1MA 5EYDA 4MWHA 3WF9A 2G1TA 1YI6A 3VAPA 4A9YA 1U54B 4ZJVA 3BU6A 2WB8A 4XBUA 3TUCA 4QPSA 4JI9A 4L3LA 4ANNA 2W4OA 4FUYA 2GPHA 5IUGA 4FIFA 2I6LA 4JJRA 2QOFA 2PUPA 4WUNA 3LFDA 5TOZA 3SDJA 5M57A 4CQGA 5AUTA 2J5FA 2OGVA 3F5PA 3CPCA 3IECA 4M13A 2R2PA 3SQQA 4PP7A 5A4LA 2WELA 3GB2A 4YJTA 5J7BA 2QLQA 2DWBA 2VTRA 4FSTA 4WSYA 4RIYA 2YABA 3HZTA 2QG5A 4O0TA 4QQCA 2BILB 2QO7A 5CSPA 4BBEA 4KBCA 5DEYA 1CKPA 5J8IA 5ACBC 2FUMA 5A6OA 2VGOA 1ZY4A 1DI9A 2Y6OA 3CXWA 2PVRA 3GU8A 5H8BA 4IM0A 2AC3A 4M68A 4GU6A 5AP3A 3HV3A 4CSVA 5J9LA 3HMPA 4LM5A 3OS3A 5CI6A 4M67A 1K3AA 2C3KA 4CMTA 3FAAA 4UMQA 2X7GA 3IQ7A 4YLJA 4BYJA 4Z55A 4JBVA 5IMXA 2XCHA 1B6CB 3CE3A 3DZOA 3ZXTA 2WTIA 4EOLA 1Q24A 2GNJA 3LOKA 4EWHA 4TL0A 1ZARA 5IDPA 5BVOA 4K77A 4D2WA 4HZSA 3TACA 3QRJA 1P14A 4DH3A 3DCVA 5CQUA 1OIUA 3DS6A 3G2FA 3QQHA 3S3IA 5AAGA 2YAKA 4R5SA 4BTMA 4WNOA 3C7QA 2XKFA 1NVSA 5DH3A 2XJ1A 4QQTA 3BGQA 4H1MA 3VUHA 4C4EA 5FD2A 1JOWB 5JRQA 4CG9A 5AIKA 4BDBA 1BYGA 3M42A 4QP1A 1XR1A 3HUCA 4A7CA 4AW5A 1ND4A 1R0PA 3O8TA 3D7TA 5I9YA 3L8SA 3KRXA 3HA6A 3PY1A 5E8UA 2H96A 3BRBA 3RWQA 3H3CA 4BCKA 3TNPC 4MXZA 5GZAA 4GK2A 4RFZA 2UZTA 3EWHA 4HGLA 4AOTA 4CD0A 4U45A 3AT2A 3FEGA 3QD4A 4F0IA 3NWWA 4WHZA 5ANIA 4P2KA 2O5KA 3C51A 3NIZA 3COIA 4BDJA 5AUVA 4G3DA 4LUDA 5FGKA 5K4IA 4BL1A 1PXJA 1STCE 4ACDA 1OIQA 2XNPA 3BV2A 4U80A 3TTJA 3MSSA 4NW6A 3Q4ZA 2HXLA 4ZXTA 1MQ4A 1T46A 1YRPA 4TTHB 5J7HA 3QLFA 2R3HA 3PXZA 5H3QA 3V51A 5AADA 4TYHB 4FL1A 3R9RA 4DEIA 2DQ7X 4P4CA 1APME 4C57A 2KULA 3H0ZA 4WUAA 4DGGA 3PVGA 4LMNA 2EXMA 4QTBA 3S4QA 3NX8A 2OICA 2ZOQA 3AC3A 4ZSLA 4DH8A 2I7QA 4MNEA 2JIIA 3LXKA 4LGHA 1ZOGA 5IH5A 4FSZA 2YIXA 2Z7QA 3AC8A 3R2BA 3FY0A 3W32A 3NYVA 2C3LA 4QYHA 2A4LA 3CQEA 4CZYB 4JR7A 3ZLXA 5KUPA 4EQCA 2QOBA 4O7ZA 2XIKA 3WOWA 1YXVA 4RC4A 4ANOA 4H39A 3FDNA 4AOIA 4I92A 3POOA 4FIJA 5CI7A 3R9OA 3FZSA 1ZYSA 4WD5A 4C36A 2C6OA 5KCVA 4IWQA 4NM3A 4FK3A 4JG6A 2GNLA 3DKCA 4BDHA 4J97A 3A7JA 4PMTA 4S34A 1B38A 4HOKA 2YM5A 4OAVB 4FTIA 3FMNA 3ZC6A 4KIOA 4H3QA 2X39A 4IX3A 4KRCA 3HGKA 5DRBA 3DQXA 3IDPA 5C8KA 5BMSA 2B4SB 4DFBA 5EM8A 4W4XA 4KS8A 4RGJA 3FZ1A 2XRWA 3KFAA 2EXCX 1OI9A 5EHYA 5AV0A 2OJFE 2YERA 1P5EA 1Q5KA 2PZIA 2FB8A 5AR7A 2GFSA 2HK5A 3OCBA 5ANEA 3MA3A 2R3IA 3NNUA 2CHLA 2QLUA 2YLFA 4WNKA 3U87A 1YDRE 2ETKA 4B9DA 5CT7A 5CEPA 5I9WA 3GCPA 2Q0NA 4H58A 5IH6A 5DR9A 5K0KA 3KXXA 3MIYA 5EI2A 3R7YA 4C4GA 5K4JA 4BR3A 2XNEA 4F7JA 1O6KA 1JLUE 4ZJIA 3SD0A 2EB2A 4FTUA 4C8BA 4I6QA 2UZEA 2BHHA 4D1SA 4DFLA 2WO6A 2QQ7A 3BHUA 1Y91A 4EOIA 4C7TA 4C3RA 1OBDA 4GIIA 5F1ZA 1Q61A 2C68A 1WVXA 4I0TA 1OL7A 2C5OA 2VV9A 3AMAA 1VZOA 4XCUA 4JQ7A 3U55A 5K3YA 1KE7A 2BDFA 2QU6A 4E73A 5JGDA 3O50A 5EM7A 3PXKA 3OT8A 2VU3A 4FUXA 5GHVA 4EK8A 2YZLA 1WBWA 3TJCA 5JQ5A 1XWSA 3OUNB 4P7EA 2WU6A 2X2MA 2ZM4A 3WE4A 5FBOA 4IBMA 5C03A 1T45A 2J0KA 3R7IA 4QMQA 4PDPA 5CAPA 4L46A 3C0HA 5J9YA 1Y6BA 4YTHA 4L7FA 2Y8OA 3BKBA 1Q8UA 4UYNA 4NM7A 4R6VA 2WPAA 2JDOA 2R3KA 3MFTA 4RIYB 2YDKA 4AZVA 2B52A 4RWIA 2UW0A 4E1ZA 4KUJA 4OW8A 2CGWA 3L8PA 1ATPE 3RK9A 4FSQA 2OIDA 4RC2A 4TRLA 2E9OA 4AZWA 3BYMA 2AC5A 4O6LA 4QYFA 5E8TA 5CXHA 3JVRA 5CLPA 4UBAA 2PMOX 3LCDA 5CYIA 2CN5A 3R8MA 3KXGA 4HGSA 4IZ7A 3RAIA 5HX6A 3L8XA 4FVRA 3PY3A 4YHTA 3QRUA 1W7HA 1IAJA 4ACCA 5CQWA 5C26A 3D0EA 3P08A 4W8EA 2B9IA 5EDRA 1P4FA 4F70A 2A27A 5EQYA 3R1SA 2VX0A 5E9EA 4N6ZA 4GFMA 1XO2B 4OAUC 3BGZA 3D7ZA 5DT0A 4FZ6A 2WKMA 2ZYBA 4CFNA 4ERWA 3E3PA 2UZOA 4B8MA 4A4OA 5T3QA 3ID6C 4CG8A 4ALUA 4CYIA 4CKIA 2HAKA 3TEIA 1TQMA 4OBQA 2OFUA 5EDPA 1Q62A 5CANA 5IQDA 3QL8A 1OL1A 5CAOA 3Q5ZA 4IAZA 2WQNA 5EOBA 4C37A 4RVLA 3BLQA 4E4MA 4DA5A 3ACJA 4UWBA 3R7VA 3ZRLA 3D7TB 3NUSA 5HTCA 5CEMA 2PUUA 4A9RA 4FV9A 3EYHA 1JAMA 4XP3A 3VF9A 2DUVA 3HLLA 2HW6A 3K5UA 4C3FA 5CAVA 2PZYA 2CKOA 3T3UA 3UP7A 1SZMA 4JRVA 1P2AA 2X4FA 4DEAA 2CGXA 5AUZA 3RINA 5CTPA 3A60A 4EC9A 2YHVA 4RMZA 2R0IA 4M12A 2HZ4A 4PNIA 4RIWA 4Y73A 5DGZA 4DEEA 4GSBA 3PLSA 1CDKA 4GL9A 5ETFA 1XQZA 2G9XA 4HPTE 4UN0C 2X4ZA 5I4NA 3SW4A 4D4SA 4TWNA 4C2VA 1W0XC 4FNYA 3CTJA 4IWDA 5LVLA 4L43A 4EOPA 3PXQA 3AD4A 2O8YA 3OY1A 4MNEB 4FTJA 4BN1A 3OTVA 2XJ2A 1XH9A 2QI8A 3KU2A 5JH6A 4NUSA 3V5TA 4FVPA 5CSHA 3LM5A 4RVTA 3T9IA 3V3VA 4IWPA 2YZAA 5ANJA 2W5BA 4QMSA 2NO3A 3TV6A 2AUHA 1R78A 2WQOA 1JKLA 4X7QA 3UIBA 4EJNA 2XK9A 4U9AA 4G17A 4M84A 1IA9A 3ZFMA 2VUWA 3BX5A 1LEZA 3C0GA 4PF4A 4AQCA 4CNHA 5CF6A 4FKPA 4IZYA 4X3FA 2QODA 3KXHA 5DR6A 4CV9A 3E88A 3LCOA 4DGOA 1VR2A 2X8IA 1M17A 3UE4A 2GHGA 4FTAA 4MYGA 3NS9A 4L67A 4D28A 1SVHA 3ZCLA 1JBPE 4B99A 5BVNA 5KMIA 3QTQA 3QBNA 2VTLA 4U42A 4NH1A 3Q04A 4L3JA 3GP0A 4PTGA 4BHNA 3THBA 2C6LA 1GY3A 5E92A 2H8HA 2PMLX 4O22A 4P90A 2ZB0A 1E9HA 5CWZA 3KKVA 1MRYA 3ZUUA 2VWYA 1J7LA 5M06A 3F7WA 3KMWA 4Z3VA 1ZRZA 2BZHB 1GIIA 3TNWA 2JGZA 4IH8A 1WVWA 5I0BA 3DB6A 3LMGA 2QKRA 2XEZA 3Q2MA 5AR8A 4PL3A 3RPRA 3HRBA 5DT3A 5DOSA 2YM7A 4GT5A 3WARA 2OXDA 2HW7A 3U4UA 5E8YA 5JFXA 5AR5A 1PW2A 4WG4A 4FYNA 3EQPA 3NW5A 5C4LA 4AT3A 3R7UA 1H1SA 3BYSA 4BIEA 2CLXA 4BZNA 4M0YA 1DI8A 2VWIA 4LL0A 4EK3A 4YO4A 4FV6A 2C6KA 3QCXA 1YKRA 2OI4X 3QQKA 2KTYA 4IEBA 3NZ0A 2J0JA 5EK7A 2Z7RA 3BGPA 3VVHA 5CENA 4EH4A 5BVFA 2Z02A 3IS5A 4NFMA 4YZBA 2VN9A 4HVDA 1NA7A 3WBLA 3SXFA 4EZ3A 3D2IA 1QPJA 1K2PA 2QURA 4M14A 3OW4A 1GIHA 4UXQA 5EYKA 1H0WA 2R7IA 5IQGA 4XLVA 4DFZE 5GINE 2BRGA 2GNGA 2YIWA 2YN8A 3MV5A 5I3OA 4ZLZA 3HEGA 3EQFA 1OITA 4J53A 4J95A 4N70A 1OGUA 4O7YA 4FG7A 4PUZA 4U8ZA 1ZYJA 1Z5MA 3FPQA 5AP0A 5ITAA 2BMCA 5DEWA 2EB3A 4FL2A 4IHPA 2XZSA 4O27B 3CP9A 4W4YA 4EBVA 1KWPA 1PRYA 3LMIA 5DLSA 3QD0A 2F49A 3HX4A 3RK7A 2YISA 4ZLYA 4CT1A 5K0XA 3EZRA 4BCFA 1OECA 1Q8WA 1Z9XA 3OD6X 4JDHA 3PWYA 4DH7A 3EH9A 2I0HA 3TIYA 3VUKA 4DFYA 4PDYA 4BIBA 4ZAUA 4LV5A 3PPJA 3QTXA 3NUNA 3TT0A 4ZIMA 4DLJA 3N4UA 5IH4A 3DFAA 4IB1A 4OBPA 1UA2A 4L00A 5L6OA 3LFNA 3QTIA 5J1VA 3AD6A 4I3ZA 3U6IA 3RJCA 4NK9A 4PMMA 5EFQA 1PKDA 2QOHA 3G5DA 3KC3A 4E6DA 1JKSA 5DNRA 3FWQA 1RDQE 1REKA 3NSZA 1PMVA 2UVXA 3KB7A 3GOPA 4MF0A 5HO8A 2OW3A 4QMVA 2XYNA 2QO9A 1SVGA 3ATSA 3ZZWA 4IQ6A 4IJ9A 4FOCA 4GFGA 5KZ0A 1WBVA 2OFVA 3NAYA 4IANA 3P7BA 3FMJA 4GKIA 1H08A 2OJGA 2A0CX 2XNGA 4ANMA 5C1QB 4I1ZA 2JDVA 4XOZA 5E8ZA 3W33A 2XK7A 3R30A 3FJQE 3IW4A 4TPTA 3WIGA 4TKSA 4BFMA 4YUQA 1U59A 4AUAA 4IVBA 4XNEA 5KMJA 3UC4A 3BWJA 1FMKA 4I24A 4QO9A 4QP2A 4C2WA 3DK3A 5K5XA 3JUHA 2XNBA 3FZOA 5FP6A 4KIKB 5J87A 4J1RA 4I5HA 4BGHA 4Y72A 4C38A 4R3CA 4P5QA 5HCZA 4AW2A 4YZMA 3A8XA 3PZEA 4EYJA 3ACKA 3AMBA 4O6EA 4FL3A 5ETIA 3RPYA 3GBZA 3HRCA 2A2AA 4PTCA 3R8LA 2JAVA 3G0EA 4FEXA 4IJPA 2ZDTA 2FO0A 3FSKA 3UOHA 3W10A 2XKDA 4NL0A 1OPJA 4X3JA 2Z2WA 5F94A 4GV1A 3MI9A 1OKVA 3CKXA 3C4WA 1BL6A 4FV0A 2H9VA 5JZNA 3FLNC 1IEPA 4TYJA 4TWOA 5KMNA 3E8DA 4KABA 3VS2A 2QG7A 4BICA 4KNBA 1IRKA 3Q53A 3OROA 3EKNA 1F5QA 2VWUA 3QRTA 4Q5EA 3I60A 1OIYA 3PG1A 3FI8A 3NAXA 2WTDA 2UZLA 4EH7A 2V62A 5EKOA 3QHRA 3TV4A 2F7EE 4FTMA 2YIRA 3R8PA 2HOGA 5CZIA 2H6DA 3O23A 5GIPE 4WKQA 2VWBA 4YJNA 4ZTHA 3CJGA 4ZY4A 1QCFA 5BYLA 1DS5A 2VTMA 5HX8A 4HCUA 4ZZNA 3LLAA 3JPVA 3HAMA 4ANSA 3C13A 3ENMA 3W2SA 4EQMA 4MTAA 1SM2A 4LL5A 4MBJA 3MW1A 3DAJA 4FKWA 5J95A 4DEBA 3GU6A 4X2JA 1WVYA 4C34A 2C1AA 5D7AA 4LRKA 5E8WA 1G8AA 2ITZA 2OXXA 1OKWA 2F2UA 3GCVA 3ZBXA 3DLZA 1HCKA 5LWMA 5IQIA 1WMKA 3ITZA 4WNPA 3UVPA 3VUGA 3DBDA 5CNOA 5HU3A 2BIYA 3IW7A 4MF1A 5L8KA 4JQ8A 4A4XA 4BY9E 5FTQA 2BRBA 3IW5A 3VULA 2PPQA 4LG4A 3CLYA 1GIJA 1YVJA 2W1ZA 3HYHA 3R22A 3VF8A 2GNFA 3MBLA 4GRBA 4KA3A 5IDNA 4XS2A 5BUEA 4J71A 2BPMA 4E93A 4RPVA 3CTQA 1XH4A 5JFWA 3ZTXA 3HMIA 3BE2A 3UDBA 4DH1A 3DB8A 4PV0A 1UU7A 4NCTA 2WTCA 3D83A 4ALVA 4EOOA 4WG5A 2OBJA 2W06A 3AT3A 4G16A 5IQEA 1UU8A 3EQCA 4CEGA 1GAGA 2CKPA 1ZYLA 3PJ3A 2R7BA 1GOLA 2EU9A 2ZVAA 3VRYA 5KBQA 3TDVA 3GU4A 3EN6A 3ZU7A 4JAJA 5LCJA 3OWLA 5LVNA 2J90A 3TKUA 1QPEA 4TN6A 5A14A 4EOJA 5BVDA 5AP2A 3QWJA 2AYPA 3GU5A 4I6FA 2RFNA 2XK6A 5K9IA 3MB6A 4IAAA 4Y83A 5AP6A 4YJSA 3ZLWA 3W16A 3O96A 4FKRA 4RSSA 3D5WA 3FHIA 2JIUA 1Y57A 5CEQA 1NT2A 2OG8A 4N0SA 4FIEA 3R9HA 2PHKA 4QNYA 3TIZA 2IZSA 3UYTA 2WFYA 4B0GA 1JNKA 5M51A 5M4FA 3VWAA 3TL8A 3LZBA 3FBVA 2BAQA 2FH9A 5C27A 3TWJA 1YWNA 3KK8A 5TE0A 3ORTA 2PL0A 5HE0A 3AT4A 3HA8A 3NNXA 2YFXA 3NR9A 3IG7A 4XJ0A 4BKYA 1H25A 4AT5A 1PYEA 4EOSA 2XM8A 1IA8A 4TT7A 4ZSEA 5EKNA 2EXEA 4W4VA 4BCGA 3CIKA 4FC0A 4LMUA 4MNFA 4EYMA 3GENA 4MWIA 4N57A 3TNQB 1YHVA 3PWDA 4RLLA 3PSCA 2W1CA 4AE6A 4AP7A 3K5VA 4AZFA 4OLIA 3CY3A 3QKLA 4I94A 4X21A 4F09A 5CF8A 4NIFA 1GJOA 3UNKA 3K54A 4IAIA 1FGKA 5HG5A 3OEFX 5KMMA 3IPHA 1OUKA 2ZMCA 4GFOA 3ODYX 3T8OA 3V04A 5HG7A 1YXUA 3LFBA 3ZLYA 4D9TA 4R3RA 2CGVA 4HZRA 5KBRA 2E2BA 4FTCA 3F5XA 1W83A 4XV1A 2O2UA 3R1QA 1TKIA 3D9VA 1S9JA 4S30A 4C4FA 5DIAA 3P7AA 2BVAA 1YXXA 4J99A 4G9RA 4AZSA 4R7HA 5KMOA 4IFGA 1DAWA 1LEWA 2JDRA 2UW4A 2XH5A 4A06A 2ZAZA 5HCYA 4F1TA 3UJGA 2E9NA 3TUBA 4HYIA 3F3UA 1JPAA 4I23A 1BUHA 3BWFA 3PDTA 1RQQA 3TKHA 4D55A 3DJ6A 3GVUA 4A07A 2P4IA 4EQUA 5AP1A 3R9NA 4BB4A 4MHAA 3SKCA 4XHKB 3FZRA 3I6UA 4IVCA 4OT5A 3C4FA 5F4NA 1U5RA 3OHTA 2PVFA 3FXXA 4QYGA 2XNNA 3JS2A 5KZIA 4FTTA 2GHLA 5A4TA 1FMOE 2WZJA 4G6OA 5TF9A 4RJ5A 3Q3BA 4ENXA 4NZWB 5AFVA 3II5A 4IW0A 2OSCA 3LM0A 2R3OA 4ACHA 4RRVA 3DDQA 3RNYA 5AV4A 2HIWA 2WNTA 3ZONA 4DFXE 5M09A 3PFQA 4IAKA 4O7NA 5L3AA 2VTHA 5H8GA 4CFWA 3V5JA 4ITHA 3BQCA 3FC1X 2UVZA 5FLFA 2I0YA 1H07A 4F64A 3TKIA 2XBJA 2R4BA 3NIEA 2WMXA 4AAAA 2YAAA 4X0MA 4L8MA 5CALA 3KVXA 1H0VA 1P4OA 2CJMA 5KHWA 1Q8ZA 1YOMA 4BBFA 4YC6A 5AR2A 4ACGA 2ZMDA 4PMSA 2CNQA 3LQ5A 4I4FA 5A4QA 2REIA 4RQVA 5HBEA 4YZNA 2F4JA 3DKOA 5M4CA 3UIMA 5FTGA 4BCQA 1WBSA 5JSMA 4S32A 3Q60A 5CU6A 3F61A 3VIDA 4MXXA 3WI6A 2XF0A 4BDGA 4CZUA 3CEKA 5F95A 4FMQA 3U54A 4UXLA 3BIZA 1M7QA 3OW3A 4YO6A 4UZHA 4XP0A 5AUYA 3PPKA 3OC1A 3PUPA 4OTDA 5DI1A 3ZS5A 4PPBA 5AP4A 3D5XA 4FICA 4IM2A 3VW8A 3UC3A 3PY0A 5E7RA 4EZ5A 5HU9A 5LVPA 3A4OX 4GT4A 4II5A 4W9WA 4ANLA 4I5CA 1XH6A 4F99A 3CQWA 1H1RA 4G5PA 4ZSAA 2YM8A 4TW9A 3BV3A 4IX6A 2YJSA 3PVBA 2UVYA 5AV1A 2CCHA 3RCJA 3UMWA 4ARKA 1WBOA 2BRMA 4K6ZA 1AGWA 3E62A 4FEVA 3R8ZA 5G6VA 4YC8A 4IVDA 4D1XA 3VS1A 1U5QA 3HMOA 3JXWA 3OT3A 3R21A 3CS9A 4I21A 4JR3A 3F2NA 4MBLA 5BMMA 5HLWA 2ZM3A 4KINA 2Y7JA 4E4NA 4D2SA 5J5TA 5EYCA 1H28A 5L4QA 2JDSA 4OR5A 2CKQA 4YNEA 4RIXB 3GU7A 3DBEA 3NUYA 3R00A 4G2FA 2IW9A 2OZAB 2OH0E 3K2LA 4CZTA 5B7VA 4FT9A 4LQMA 2GNIA 4XG6A 3CBLA 4LFIA 2UUEA 4AS0A 2W1GA 2UZBA 2JEDA 3PJ2A 4PP9A 1FVRA 5HIDA 5JT2A 2F2CB 4RG0A 4PX6A 1CKIA 3R7EA 5JFSA 5FG8A 3S95A 2X7OA 1MP8A 3LFFA 4CVAA 5HNIX 4D0XA 4GG5A 5HIBA 5A6NA 4L44A 3JYAA 3ULIA 4D1ZA 3HRFA 2JKQA 3EFKA 3SRVB 2OJ9A 4G31A 4CT2A 4E6CA 4EK6A 3OVVA 2QONA 1Q99A 3FZPA 3OG7A 3UO4A 4NSTA 1ZZ2A 4ZSGA 2W4JA 4E5AX 3OWJA 3NVMB 4GU9A 1PKGA 4MAOA 2CLQA 4YJQA 4R77A 3OMVA 5H2UA 2JDTA 4U41A 4F7SA 3ORPA 2XP2A 2R3PA 2FA2A 3K3JA 3VS7A 2X6DA 2G2FA 4FSMA 1ZZLA 4W4WA 4QMXA 4FT0A 4YPDA 2GS7A 4IC8A 4NCTC 2X81A 5CY3A 3KK9A 3LFCA 2XRUA 2QR8A 5FXRA 4C4HA 5CVGA 3QQLA 4MD9E 4HVGA 3CGOA 5DVRA 4BYIA 1PXNA 3ZLSA 3FXWA 4J96A 4F1OA 4EC8A 3ZDIA 2UW9A 4IX4A 2IVUA 4G3EA 4Y85A 4DH5A 1OB3A 1Z57A 4RFYA 4FR4A 4Z9LA 4KBKA 2OF4A 3F69A 4YZ9A 4NW5A 2QU5A 4R7IA 4ZLOA 4G3FA 4PY1A 3NUPA 3PSDA 4C35A 4EOKA 3VBQA 4HJOA 4NT4A 5EW8A 3DBFA 4FNWA 2V0DA 2ETRA 2QHNA 4OUCA 3DAKA 3NLBA 4KIPA 4E20A 4XRLA 3D14A 4FTQA 1KE6A 3SGCA 1Y6AA 3ZH8A 4I0RA 1J7UA 4O2PA 2XKCA 4UV0A 4YGAA 1XJDA 3PP0A 2ONLC 3QCYA 5EI8A 1K9AA 2RG5A 3G90X 4E4XA 5BYYA 3FQSA 2G2IA 3M11A 3TZ8A 3FLYA 5E8XA 5LVMA 1OZ1A 4IDVA 4FYOA 3VNTA 4F9BA 3GCQA 4M69A 3UVQA 5GJFA 4USDA 3CKWA 2Z7LA 5JEBA 3F82A 4F63A 3A8WA 3CTHA 1XBBA 3C9WA 4GH2A 4ZZMA 2NRUA 4BZDA 3MJ2A 4NKSA 2QOLA 1CKJA 1HOWA 4WOVA 2IZTA 3QRIA 4BTFA 3HV7A 2OLCA 2XNMA 3DGKA 1TQPA 1PHKA 4GYIA 4KKEA 5ETAA 2ITTA 2QC6A 5BUIA 3BQRA 4XMOA 5D7VA 2XCKA 4BKZA 3V5PA 1Q97A 2QCSA 1VYWA 4BI2A 4X6RA 4L3PA 1M2QA 2QNJA 4FIGA 3ROYA 4CXAA 3H9RA 5IA1A 2XMYA 1OPKA 2XBAA 1BMKA 3BBTB 2RSVA 5D1JA 4JDKA 1A48A 5GNKA 2CMWA 1LP4A 3MY1A 4RJ6A 5HORA 3G51A 5D10A 4L7SA 3N4VA 2XKEA 4O7TA 3GFWA 4BCPA 3RBWA 4QQJA 4EOMA 3ZFYA 5DA3A 1JSTA 5BQ0A 3MB7A 3TG1A 4C02A 4O7WA 3ZZEA 4ZMFA 4YPSA 2JBPA 4ZMEA 3ZM4A 4AG8A 2SRCA 1UV5A 2VO0A 3DOGA 3PA4A 5JMSA 5LVOA 3BHTA 4O96A 2XVDA 5IUIA 1A06A 2PWLA 2UW6A 4V05A 5EM5A 3UOLA 1ZYCA 4G3CA 2VTAA 4GK3A 4EH5A 3MH1A 3SXSA 3EN5A 4UZDA 4JVGA 3EIDA 4HCVA 4IE9A 1M52A 4CYJA 3EHAA 1GZKA 1ZXEA 1R0EA 4A9UA 4CCUA 3OBJA 4BDEA 1O9UA 3E87A 3ZM9A 1KV2A 1V0PA 4FV5A 5ICPA 3MN3A 4R8QA 5EHOA 3KRRA 3Q9YA 2PTKA 3VUIA 2YM4A 1SMHA 3HMMA 1XKKA 4H3PA 4O21A 3A7FA 4QMUA 3VUMA 4DBXA 1AD5A 2GNHA 3D5UA 1WAKA 2QD9A 4XG4A 5AMNA 5H9BA 3Q9XA 3UG2A 3VJOA 4X2NA 4FK6A 5DN3A 2ITPA 2RF9A 2XB7A 1VEBA 1XBAA 2VNYA 3LIJA 4MQ2A 3FI4A 5CAUA 3OF0A 4FG9A 2C5XA 3C50A 4JS8A 4JBQA 4JDJA 1J91A 3NNWA 4O86A 4JBOA 5CEKA 5CVFA 3PIYA 3LJ1A 3VHEA 2PY3A 4IXPA 3O7LB 5D9HA 3VUDA 2C0IA 4MKCA 5L2QA 2FYSA 3GNIB 4U0IA 4JBPA 3HP5A 4Z16A 2ITUA 4F6SA 4MXOA 4XX9A 3LCKA 3A4PA 4GVJA 5HD7A 5JZJA 1O6YA 1G3NA 4ORKA 4YBJA 1H26A 1UNGA 3BYUA 5CSWA 5E8SA 1PY5A 5E90A 4FSRA 4NTTA 2FVDA 3FYJX 2YIYA 3MVMA 1MRVA 4ITIA 3REPA 4I5MA 3NMUF 2BDJA 4L52A 2B9HA 2JBOA 2E9UA 4FSUA 3H0YA 5HI2A 2VTOA 3COKA 3FMHA 4ZS0A 4FZAB 2P55A 3F7ZA 4YJOA 3SW7A 3NW6A 5KNJA 1WBNA 1ZMWA 5AR4A 2O63A 4DFNA 4EK4A 5M07A 4YR8A 2VTNA 3I81A 5CEIA 2VX1A 4MD8E 5J5SA 4LYNA 3AC2A 2IVVA 3KCKA 4Z7GA 1JKKA 3LCSA 4FKJA 3GXLA 2P33A 4PNKA 2W5AA 1ZMUA 3I79A 3LJ2A 3R8UA 4JDIA 1UKHA 4C58A 1MRUA 3F3VA 3ORLA 4F65A 2X8DA 2WMTA 5AUXA 4QP3A 5HVKA 3G0FA 4D4VA 3D4QA 3EKKA 1L3RE 4RVKA 2GTNA 4RWLA 4BDCA 3B8RA 4FKOA 4FT3A 2PVHA 3QX4A 2W0JA 5F9EA 1MUOA 2VWZA 5AP5A 3AC5A 1KUTA 2DS1A 4R1YA 2C0OA 4YLKA 2VTJA 3SAYA 3JY0A 5KKRC 4ASEA 4XOYA 3DXPA 1V1KA 4MH7A 5AWMA 4BCNA 3GQIA 1B39A 1W84A 3PJ8A 2C1BA 3ORKA 4AFEA 4XUFA 4M7IA 4C59A 4GIHA 4CFMA 3L9LA 4F7NA 4I0SA 3FZTA 2ZV8A 3HDMA 2QKWB 4OTIA 4W9XA 4EHEA 1Q3DA 4F9WA 1KE8A 4ERKA 2Y9QA 2W1DA 1W8CA 1X8BA 5HBHA 4CQEA 2XIXA 4KSPA 3UO5A 3RK5A 1OBGA 3R7GA 4HGTA 2XIRA 5EM6A 4E7WA 5EQPA 3Q52A 2BKZA 5GJDA 2HENA 2HCKA 1SVEA 2J0LA 5AUUA 5IUHA 4F7LA 4JAIA 3WZEA 4IDTA 1FVTA 5KHXA 3W2OA 4QMWA 3QFVA 3VBWA 4APPA 2VTTA 3HUBA 4CKJA 5D41A 3FE3A 5CX9A 5I9UA 4MD7E 4EI4A 4DT9A 4M69B 3DT1A 3VO3A 3LPBA 4G3GA 2XS0A 4O0UA 4YSJA 4A9TA 1GZOA 1KV1A 3F3ZA 3ORNA 4AGWA 5KO1A 3V8TA 4DCAA 3UZPA 3MH3A 4K18A 4PDSA 3PTGA 3TI1A 4IAFA 4KRDA 4ASZA 2GQRA 4K33A 1CM8A 2FGIA 3E8CA 3MWUA 4GMYA 1OKZA 3ZEPA 2WMSA 5DRDA 3FL5A 2WD1A 1I09A 1KSWA 2GMXA 1WBPA 2ERZE 3L8VA 3VW6A 4AX8A 2XK3A 3QTRA 3P78A 3PJCA 4NFNA 2O3PA 2YLEA 2W5HA 1YWRA 3V5QA 2IO6A 3FXZA 3W8LA 3FUPA 3GFEA 3Q9ZA 4GJ2A 4YU2A 2R0UA 4L42A 3FMLA 4G6NA 1H1PA 4RQKA 3RZFA 4QD6A 3BLRA 3EFWA 3C4CA 3EQDA 3QCSA 4GG7A 3OCSA 4OTRA 4QP9A 5ANOA 4BIDA 1Y8GA 3V01A 1SYKA 3E7VA 3VQUA 5FBNC 4MXCA 5E1SA 2IVSA 3DJ7A 2V7AA 4IX5A 4WO5A 4QP7A 2RGPA 4FT5A 2UV2A 3O71A 3RKBA 3BI6A 3OCGA 1SNXA 4YLLA 5HE3A 3WIKA 4K11A 2HYYA 3WF8A 5IA5A 4QOXA 3G6HA 4ITJA 2EVAA 5I3RA 5TR6A 5J9ZA 3OWPA 4FZ7A 5BVEA 3DJ5A 3LCTA 4RWJA 3ANRA 5HESA 1CMKE 3FHRA 5HLPA 3UP2A 5DR2A 3QC4A 5HNBA 4L6QA 1OVEA 2FSTX 4PL5A 5G1XA 1URWA 4PPCA 3UPZA 3KY2A 2I0EA 3GC9A 4D9UA 5L2IA 2CKEA 3D2KA 4FSYA 4RIWB 5FM2A 1KOAA 2GSFA 3FLZA 2ERKA 2WMVA 3EB0A 3UO6A 3WF6A 5KE0A 5LOHA 1PYXA 2J6MA 3RP9A 4RFMA 4OGRA 4IFCA 4QMZA 3WF5A 3ATTA 3OXZA 2R3MA 3GGFA 5C9CA 4FA2A 2VGPA 5A9UA 4RBLA 2PUNA 4AN9A 3QGYA 4CFFA 1J7IA 2PZ5A 1LUFA 3MFUA 1KE9A 1OIRA 3DZQA 2ZB1A 3BYVA 3MDYA 3O8PA 4ZZOA 4D5HA 2ITWA 3DTWA 3H4JA 3UQCA 3DAEA 3WZKA 3E3BX 4NKAA 3N51A 4L53A 4TY1A 3ZYAA 3ZMMA 5IQCA 3KRJA 2YCQA 3KMMA 4FODA 4IIRA 4X2KA 2R3LA 4QYEA 5CS6A 4E5WA 2OKRA 5CEOA 3WYYA 3BU5A 3FMMA 2FSLX 4C4IA 4S2ZA 4EJ7A 5DYJA 1PXIA 3LXNA 4X3FB 4U43A 2JITA 4CV8A 3OP5A 3C5UA 2Y0AA 4EHVA 3NYOA 2WQBA 4O0VA 4DTKA 3JR1A 2IG7A 1JKTA 4XG9A 2V22A 3W18A 3UVRA 3MH2A 3I1AA 4FNXA 4YZCA 3DDPA 3BYOA 5DBXA 5IISA 3HNGA 1ZOEA 1ZYDA 3NRMA 3FLWA 3AOXA 2X2LA 1ZAOA 2GCDA 1EH4A 3E63A 2OIQA 4IZ5A 2OZOA 3I0QA 4PRJA 4Z7HA 3SXRA 3KXZA 3O51A 4FKVA 4HVHA 4QTCA 4JOAA 3RPOA 3P79A 4EUUA 3OEZA 3MTLA 2IN6A 4KWPA 1QPDA 5DT4A 3PA5A 4K8AA 3FQHA 2HZ0A 4R5YA 1ZLTA 4Q9SA 3Q5IA 4WSQA 2RG6A 2BTSA 3EN4A 5L2WA 1NW1A 3MYGA 2NPQA 2WEIA 4DITA 2WQEA 4GW8A 3FKLA 2QOIA 3ORIA 4ZY6A 4U79A 2C6IA 4J98A 4MXYA 2GTMA 4UY9A 4XP2A 1H24A 4FZDB 3RTPA 3QUPA 4C62A 4RJ7A 4KB8A 4QTAA 4TNDA 4E8AA 5HIEA 2ETMA 2W9FB 4IADA 2A19B 3U9CA 5FP5A 2EWAA 4BDDA 1J3HA 4EKLA 3ZRMA 3KQ7A 3QQGA 3GT8A 4R7BA 2Z60A 3P0MA 4IB5A 4WT6A 1I44A 3QYWA 1BLXA 3CC6A 3EL7A 4FSNA 4X3FC 3MGYA 4QYYA 1OKYA 3Q4CA 4DGLC 5KMLA 5GZ9A 4USFA 3NUUA 3S2PA 1Y8YA 5IQAA 4IMYA 1IASA 3OTUA 2C5YA 5CZHA 4BGQA 4X2GA 2GQSA 4HVIA 2ITOA 5CVHA 3SG9A 3GI3A 2OF2A 5AV2A 5KMKA 4R1VA 4I22A 4J52A 4F0GA 1HCLA 2UW5A 4DINA 5L2TA 5CSVA 3AC1A 3RI1A 4GKHA 4QQ5A 3P1AA 3VQHA 3O2MA 2C3JA 2PE2A 2VNWA 4O0SA 3KULA 5CU0A 2WMAA 5EHLA 4QTDA 3PJ1A 4EWQA 4PQNA 3NUXA 5LARA 4WBOA 2QOQA 1OL5A 4UALA 1H1WA 4Y46A 2HWOA 5L8JA 3ROCA 4AFJA 5DMZA 5I9XA 1OPLA 4GVAA 4DN5A 5IQHA 4L9IA 2HY81 3BCEA 3AD5A 1FOTA 4DBNA 5AA9A 3ZBFA 2X1NA 2BRHA 3Q32A 4I93A 4NWMA 3S00A 4S33A 4GJ3A 2YA9A 3I7BA 2ZV7A 2VO6A 2PE1A 4QP8A 4EUTA 1Q4LA 4BCOA 2IZRA 2YWPA 4LRJA 4PDOA 3LKMA 4XG7A 3P4KA 3LHJA 4GUEA 3UPXA 2NP8A 2A1AB 3RALA 2XIZA 3R04A 4ZY5A 3R02A 2P2HA 4TYEA 3DV3A 2Q0BA 4UB7A 4EH2A 1G5SA 3HVCA 5IG1A 2WU7A 3UZTA 5J79A 4OTQA 3ZSGA 3PSBA 4AU8A 4G1WA 3DNDA 3QAME 4O0WA 4PWNA 4Y8DA 3VS5A 3Q9WA 4LOQA 4AZEA 3QLGA 1H01A 4UMTA 4YBKA 4AE9A 1M2RA 2XEYA 1UU3A 3BHYA 3UBDA 3G33A 3L9MA 3ZRKA 4DLIA 3RWPA 3P86A 4YJVA 2I1MA 4JG8A 4EK5A 1QPCA 3MPAA 2RKUA 2PZRA 4O0RA 4OTPA 3AGMA 2PMIA 3NGAA 5IU2A 1LR4A 2XJ0A 1KOBA 2B7AA 3QTSA 3WZDA 5IF1A 3O17A 3BU3A 3CD3A 4JX3A 4F08A 4I6HA 3ET7A 2ZM1A 3VS4A 4EBWA 5E91A 4EOQA 3H10A 1YXSA 3NPCA 1VYZA 5HHWA 3UZRA 4NM5A 3EQRA 3F9NA 5AX9A 3EYGA 4RA5A 2BKKA 3R0TA 4AACA 3F2RA 2GS6A 4RZWA 4TZRA 2BAKA 5H8EA 4FE2A 2YCFA 5I9VA 2W1FA 3SX9A 2YCRA 4FV1A 4IWOA 3EQIA 4AGUA 4QMPA 4XLIA 4KAOA 4J7BA 4JG7A 4FG8A 5HVYA 3QZFA 4BDFA 4O84A 1DAYA 3IOKA 1SNUA 3EQHA 5CNNA 3SOCA 5HZNA 2JKOA 1Q41A 3ENHA 3QHWA 3W2RA 3ZO3A 3U6HA 3OY3A 4YJUA 2FSMX 1XH7A 5D12A 3BHVA 2B1PA 5C8MA 4XG8A 5JFVA 1R3CA 3NYXA 4WRSA 5GIOE 3PRFA 4PMPA 2UW7A 2UZNA 5ANDA 3V6SA 4B7TA 3TZMA 5JGBA 2Q83A 1WFCA 3KXMA 4UWCA 4U5JA 3E7OA 3DTCA 2BDWA 3QF9A 4FNZA 3NDMA 4R3PA 4D2RA 4XYFA 3P23A 4WBBB 2QOCA 5HE2A 3UGCA 4CFUA 2O65A 2PVJA 3NYNA 3E93A 3H9FA 3NNVA 4O82A 3Q4UA 3R28A 4IM3A 5CU4A 4BDIA 2WMRA 5IA4A 3OXTA 1XBCA 1PXMA 1H27A 3KGAA 4ID7A 3UG1A 2C5NA 2HELA 3DXNA 5HKMA 3RPVA 3LQ8A 3DU8A 4AT4A 5HTIA 3M2WA 2Y4PA 3A61A 3FV8A 3QCQA 3I7CA 4RZVA 3ZC5A 3W55A 3RAHA 4H05A 4QMYA 5FTOA 3OZ6A 2BTRA 2W05A 4GEOA 4MX9A 3ULZA 3FC2A 3CY2A 2J5EA 5HTBA 2BAJA 1M14A 2V5QA 3OOMA 1F3MC 2R3QA 4DG3E 2I40A 2W1EA 5LMKA 3G9LX 4UMPA 3FKNA 3SHEA 5D11A 3F5UA 2XA4A 3AQVA 3U6JA 4O7VA 3V5LA 5B2MA 2R3FA 3DA6A 3LW0A 1YI4A 2VWWA 3DFCB 3IK3A 4EH6A 5LWNA 4MK0A 3PVUA 1URCA 2CN8A 2WEVA 2PE0A 4FKQA 4G34A 4GUBA 3ORMA 4O91A 1E1VA 2VAGA 2W9ZB 3WZJA 4DEDA 4JLCA 4E6QA 3R1YA 2BZJA 3HV5A 1UNLA 4V0GA 2J2IB 3SOAA 3UQGA 4YJPA 3QALE 2JKMA 3VS0A 3ZXZA 3KMUA 4DE4A 3LFEA 3NEWA 3LXLA 3PYYA 2YJRA 3MA6A 2X9FA 2G2HA 2CGUA 2LGCA 4LI5A 2GDOA 3LXPA 5EG3A 4DCEA 3TM0A 1NXKA 3U9NA 4B6LA 2R3GA 1R39A 2J0MB 2RL5A 3E92A 2PULA 4K0YA 3C0IA 3QZIA 4LGGA 2OXYA 4U6RA 2CSNA 4FKLA 4CFXA 3VJNA 5L6PA 3AMYA 4OT6A 4FVQA 2YACA 2X2KA 3PZHA 2C5VA 3R01A 5CASA 4YTCA 3I0OA 2R3NA 5EW3A 3NUAA 2X7FA 3KULB 4UEUA 2WAJA 3FLSA 3TNIA 5BPYA 4KKGA 3DY7A 4D2VA 4BI1A 3PXFA 4BGGA 3F2AA 4FZFB 3PXYA 4EL9A 4GK4A 2P2IA 4HPUE 3B2WA 1JWHA 1UWJA 3EMGA 2Y4IB 5AJQA 5HG9A 2ITYA 3KRLA 4UX9A 4RIOA 4YURA 3LAUA 4K9YA 4XG3A 3ZO1A 3MS9A 3NCGA 1YHWA 3FLQA 4AF3A 3KN5A 4YNOA 2WXVA 5IZFA 5DPVA 3PG3A 4KD1A 2J50A 4CKRA 2PZPA 2WMWA 2W17A 2C0TA 4FV7A 1V0BA 3JVSA 3EQBA 3FPMA 3CD8A 3F3TA 3KN6A 4B4LA 4HW7A 5AM7A 1UWHA 4KIQA 5JN2A 3OOGA 3R7OA 5DE2A 3ZOSA 4O0XA 4IAYA 4RLKA 4O7RA 1Q3WA 2HWPA 2YWVA 1GZNA 2YM3A 3FMDA 4A4LA 5DWRA 4EONA 5AX3A 4NJ3A 5IEXA 1FGIA 2P0CA 5IPJA 1PJKA 5ETCA 4FIIA 4RX5A 3O8UA 2PK9A 4Q2AA 1QL6A 4NIFB 4Y5QA 3P5KA 3W2PA 4Y5HA 3PA3A 4YP8A 4E5BA 4WIHA 1GNGA 1Q8YA 2F7ZE 1OUYA 2QO2A 4YSMA 4HYHA 2RIOA 3VBVA 2NRYA 4O7SA 3EQGA 1YI3A 2GQGA 2BFXA 3S0OA 3ZO2A 2F7XE 3R71A 2VTSA 4FKUA 4FTLA 1BKXA 2JKKA 1WBTA 1LPUA 4M97A 1IAHA 3RGFA 3QC9A 4YJRA 4AN3A 2CDZA 1PXKA 1Q8TA 3FKOA 5HGIA 2Y4IC 3UOJA 3HV4A 2VD5A 5EQEA 4HGEA 1UVRA 3A7GA 2JAMA 2JFMA 3BPRA 3D15A 3HECA 4FTNA 1YHSA 3KVWA 4FKTA 3WF7A 4CMUA 4Q9ZA 2X0GA 2OWBA 3K3IA 3QKKA 3QYZA 4EH3A 3UQFA 5E4HA 2VTIA 2WMQA 2G01A 4D0WA 1E1XA 2V7OA 2W96B 5LMAA 3MY0A 4G5JA 3LMHA 4BF2A 3AXWA 3D94A 3FY2A 3N4TA 3GC8A 3ERKA 5CT0A 1JQHA 4M0ZA 4U3ZA 3UYSA 1YDTE 2BZIB 4C0TA 2C6DA 2H34A 4ACMA 2NNWB 4RX9A 5LXMA 4OTWA 2W4KA 1U46A 3KRWA 3CJFA 5HCXA 3C4EA 3W8QA 4CTCA 4U7ZA 4C61A 3IOPA 3QU0A 4RJ4A 3EJ1A 4FKIA 4ZEGA 4ZOGA 1UKIA 3SV0A 3WYXA 2J51A 5B2KA 1JSUA 4M3QA 4LOPA 1PMUA 3LLTA 4XV9A 2X8EA 3F3WA 4K2RA 2R64A 3FMKA 3KCFA 4D4YA 1PXLA 4RJ3A 1W98A 3DK6A 4F0FA 1BX6A 2OO8X 3MJ1A 4LUEA 1FBNA 2B0QA 5IEVA 3QTUA 3EL8A 3QA0A 2PVYA 2QVSE 2ESMA 4K1BA 5E8VA 5FDXA 3BEGA 2W99B 4L45A 3B2TA 1VJYA 4RA4A 3PVWA 3G9NA 4H3BA 4FV8A 4JIKA 4KKHA 5CF5A 3UTOA 2I0VA 2HZIA 5HD4A 4X6QC 2ITVA 3A62A 3Q6WA 2VX3A 3UIXA 1TVOA 3IDCA 5HICA 3WILA 1OMWA 2VWXA 3TN8A 3CCNA 3R1NA 2OJJA 4FKSA 5EH0A 3VS3A 3ALNA 3RAKA 3OFMA 4WG3A 3RZBA 4QPMA 5AIRA 4BCMA 3DXQA 4LV8A 2R3JA 2BR1A 4C33A 3Q4TA 4LRMA 4FI1A 1YOJA 4CRSA 2W7XA 3MY5A 4RVMA 4V04A 3SG8A 4NTSA 2BUJA 5FDPA 2C3IB 5K5NA 1IR3A 3CQUA 1QMZA
chains in the Genus database with same CATH superfamily
4Q5HA 3BHHA 3QD3A 3GUBA 1FQ1B 3UODA 2E9VA 3QRKA 3QZGA 4U40A 5BX0A 5M56A 4CTBA 3H30A 4E26A 1RJBA 3U4WA 2WIHA 2W1IA 3L9PA 3LFQA 4QMLA 2WMUA 3IGGA 4V0GB 3DNEA 3VUTA 3RM6A 1G8SA 4O1OA 4MXAA 1IG1A 5FXSA 5IKWA 3OBGA 3TXOA 3FMEA 1BI8A 4FTOA 3NW7A 4I41A 4KIKA 5AAFA 2E9PA 5B0XA 3VBTA 3EFLA 4BCJA 4BZOA 2VTPA 2IVTA 1G8JA 3SA0A 1GZ8A 2W1HA 2ZV2A 5KKRB 2VRXA 2XM9A 3ANQA 4ENYA 3C4XA 3HL7A 4RJ8A 4QMMA 5AP7A 3FSFA 5M4UA 4DTAA 4LOOA 4IZAA 2F9GA 4IC7A 4ALWA 4O83A 3VS6A 1WCCA 3F6XA 3FYKX 3I5NA 5F20A 4D2PA 1R1WA 2J7TA 3TYKA 2B9JA 3T9TA 5LMKC 2FSOX 4I4EA 3PRIA 4DEHA 4G9CA 4JIAA 4DAWA 3RHXA 1OL2A 5AR3A 1FVVA 4FSWA 4L68A 2R5TA 4TYIA 4WA9A 4AA5A 4DGNA 2QOOA 1TQIA 1ERKA 3OUKA 4ZTSA 2BROA 3FQEA 4JX7A 3VBYA 2LAVA 3UOKA 4XV2A 3QTWA 3LVPA 5BYZA 4YMJA 4HNFA 3ZSHA 5I5ZA 2YDIA 2WTVA 2BZKB 3OWKA 3UMXA 4JQEA 4QT1A 3QGWA 4XBRA 2B9FA 5TT7A 3ZFXA 1F0QA 3HP2A 4BHZA 3ORXA 3TTIA 5FQDC 3AGLA 5TKDA 1PXPA 3OCTA 2OH4A 5FUTA 4O0YA 1BL7A 3V8WA 5CF4A 5FXQA 3KREA 2F57A 3VHKA 1H4LA 5JQ8A 4RX7A 2RFDA 3KA0A 3QUDA 4TWCA 4BCIA 3R63A 4MEDA 2BIKB 5M08A 4CLJA 3L1SA 4YHJA 4QRCA 4B8LA 3MFRA 5HOAA 4EKKA 4BTKA 4GCJA 2PVKA 2GFCA 4GS6A 5EI6A 4IACA 3GOKA 5DG5A 4O2ZA 5T68A 4AA4A 2ZFYA 4O38A 4I20A 4FGBA 3PUFC 2UZDA 4FF8A 5GZ8A 2QR7A 1UNHA 2JC6A 5FEEA 3NVKI 4ANQA 4C3PA 4AXFA 3E64A 1XH8A 4IB0A 4ZTLA 4FGRA 3PXRA 3IW6A 2UW8A 2HXQA 3C4ZA 5ACKA 4FEQA 4NU1A 4ZTQA 4CRLA 5M44A 4CMOA 3NCZA 4P5ZA 2PVNA 3CGFA 5EOLA 1J1BA 4QTEA 3TDWA 4DF3A 4EZ7A 3ALOA 3PIZA 5AAEA 1W2DA 2JD5A 3VBXA 3DQWA 3ZUTA 4CLIA 5CU2A 5TO8A 3EZVA 1YQJA 2BRNA 4QMTA 3IDBA 4FIHA 3IO7A 4QNAA 4M8TA 3QXPA 2PMNX 4FOBA 5HVJA 2PYWA 3GCSA 3BELA 3R2YA 4YTFA 2PUIA 2R3RA 4OTFA 5A54A 1ZOHA 1ZY5A 1PMEA 1YDSE 4HVSA 4O81A 4M15A 1ZWSA 3HAVA 1H8FA 4GYGA 5A3XA 4KSQA 5IA0A 4HCTA 4H1JA 3M1SA 2J9MA 4WRGA 4ZJJA 3DK7A 2IPXA 2ACXA 2ZDUA 2XUUA 3WZUA 3S1HA 1H1QA 3IGOA 2B54A 4FKGA 2OK1A 3CPBA 4AGCA 5EYMA 3QX2A 4FV2A 2IW8A 3GC7A 4OTHA 3F5GA 4WNMA 4NYEA 5LQFA 2PU8A 3LQ3A 1M2PA 1YW2A 3W2CA 1RE8A 5IA2A 5IA3A 2ZV9A 3MPMA 4LGDA 1JSVA 2VWVA 5GJGA 4BDKA 3GCUA 2HY0A 4UMRA 4FEUA 2P3GX 3CR0A 2ITXA 4U97A 3F66A 5FEDA 4A9SA 5FM3A 3AG9A 5JRSA 4AGDA 2C6TA 1YWVA 4QMOA 3G6GA 4AN2A 2B53A 3A7HA 4CGAA 4JRNA 3H9OA 4MBIA 5JKGA 1NVRA 2QOKA 3E8EA 1W82A 4ZTRA 4MCVA 4NEUA 2PSQA 5AM6A 4QPAA 3QQUA 3EN9A 4DYMA 2Z8CA 2QHMA 4CFVA 3PIXA 2OU7A 1YOLA 1XHAA 3L9NA 3P9JA 4U44A 5C8NA 4FV3A 2RFSA 3A7IA 3BLHA 5FRIA 3R6XA 2WTKB 5CAQA 3Q6UA 4S31A 2UZVA 4PPAA 3D5VA 4FT7A 3GEQA 1M7NA 2BALA 4HYUA 4APCA 2G15A 4AW0A 4F9CA 5I9ZA 5J1WA 5M53A 4W8DA 4D4RA 5AV3A 3PLAE 3R83A 1PXOA 2XIYA 1U54A 3FI2A 4D5KA 3AC4A 2O0UA 2Z7SA 1CTPE 4XG2A 3ZEWA 2VZ6A 2CNVA 4R78A 3U51A 3P7CA 4L01A 3DBCA 3DKFA 1A9UA 4BVUA 4TWPA 4EH9A 2BFYA 3RMFA 3MESA 5HQ0A 2C30A 3POZA 4FX3A 4USEA 3SC1A 2C4GA 1NVQA 4AWIA 3E5AA 5JGAA 3ELJA 2YEXA 2WOUA 5HNGA 4PL4A 4OTGA 4EHGA 3QKMA 3SLSA 4BRXA 3TV7A 4ONAA 3A99A 3G15A 4EH8A 4V01A 3ETAA 4DFUA 2VTQA 2J0IA 4ZP5A 5LJJA 2X9EA 4FTRA 4DT8A 4EORA 2JIVA 2UZUE 2YIQA 3HMNA 1WZYA 3UNJA 3O0GA 2EUFB 1OGYA 2GHMA 2PVLA 3MIAA 1ST4A 2C6EA 1OL6A 3F88A 4C4JA 1FPUA 4AOJA 5HBJA 2WTKC 3Q96A 4J8NA 4I6BA 3UNZA 4OBOA 2XAOA 4O7LA 4O1PA 3W0MA 2IJMA 4UMUA 4AZTA 2ZJWA 3QQFA 5FWKK 3R8VA 3LFAA 4N4SA 4ZTNA 3VN9A 2GS2A 5HEZA 2R9SA 4Y95A 3MFSA 1YXTA 4U3YA 4BWXA 2XANA 1U4DA 3KF7A 5E1EA 4M66A 1NY3A 5T6KA 2JFLA 3V5WA 4ASDA 3IONA 4KS7A 4ASXA 4DGMA 3ZO4A 3T3VA 2IW6A 4RC3A 3GQLA 4JT3A 5HLNA 3C5IA 3MPTA 4XRJA 4I5PA 5CU3A 4O4BB 4EEVA 3W1FA 2HZNA 2X0PA 3EFJA 4QMNA 3ZUVA 4X2FA 2C6MA 2IWIA 4GT3A 4BWPA 3I4BA 4TXCA 4ZSJA 3ZHPC 4ANBA 5LMBA 5IQBA 5IQFA 4BCHA 3DLSA 4JXFA 5C01A 4NJDA 2UW3A 2XK4A 2VO3A 3LE6A 3TUDA 4MVFA 4AA0A 1PMNA 1V0OA 3DBQA 4XEYA 1REJA 1BI7A 4E4LA 4KBAA 5LCKA 1MQBA 3JY9A 5ANGA 3SVVA 4QP6A 3ODZX 1AQ1A 3QA8A 2C69A 2OIBA 4BWKA 3BBWA 4MQ1A 4YHFA 5HG8A 4YTIA 3BE9A 3MVJA 5L8LA 1H00A 3EOCA 4G6LA 3WE8A 2PVMA 4BTJA 2CNUA 4DG0E 4AXCA 4DTBA 2WOTA 2DYLA 3MVLA 3COMA 4F9YA 5ANKA 2RFEA 3MH0A 4TYGA 4FV4A 3DPKA 5HO7A 2JLDA 4PTEA 2XNOA 4TYHA 2OJIA 3KEXA 4RT7A 2WGJA 3RM7A 2X6EA 3O7LD 4NM0A 5JK3A 3C1XA 4HNIA 3ORZA 3FL4A 4F4PA 3RNIA 1O6LA 5EW9A 4IVAA 4QP4A 5A4CA 3MTFA 4RX8A 5IEYA 5IMEA 2WIPA 5DFPA 5AUWA 3N9XA 3QQJA 3QTZA 2WTWA 3OXIA 4ZS4A 4DEGA 3BZ3A 3LJ0A 3LFSA 4HYSA 3PE1A 4TNBA 1XH5A 3B8QA 4U81A 4UYAA 5BVWA 4JNWA 3RHKA 3TJDA 4AXAA 4RIXA 2GU8A 5CSXA 3IKAA 1CSNA 1PF8A 2OZAA 3I5ZA 3FI3A 4F9AA 5FEQA 5L6WL 1KE5A 2WQMA 4RWKA 3COHA 3KL8A 3RVGA 2WTJA 3UIUA 4AW1A 5HE1A 3V6RA 2VO7A 5A46A 4BKJA 2WMBA 3DKGA 4DHFA 1RW8A 4F6UA 1UU9A 3EN7A 3QWKA 2UZWE 2CCIA 2WHBA 3R9DA 3IW8A 4BDAA 3R73A 2ITQA 5M55A 4J8MA 4BBMA 1FINA 2XK8A 4XH6A 2V55A 3QUEA 5HO6A 4FBXA 2ITNA 3PE2A 4FTKA 4ZK5A 4DG2E 5KX8A 1S9IA 3ZDUA 3V8SA 4JL9A 3U8WA 4E3CA 5C4KA 3KXNA 2ONLA 1JVPP 4YZDA 3SRVA 3VRZA 3PPZA 3W2QA 2Y6MA 4F6WA 3GC0A 3BEAA 3PP1A 4ZTMA 3QZHA 3Q2JA 3RCDA 3TNHA 3TZ7A 4BI0A 2YDJA 4CCBA 3TCPA 4BC6A 3ZSIA 4EHZA 5M4IA 2J4ZA 4N6YA 3RPSA 1ZMVA 4YC3A 5EDQA 3HKOA 5BVKA 2CPKE 5CXZA 3HDNA 4IB3A 3RAWA 3E8NA 4UWYA 4FEWA 1DM2A 5DHJA 2YCSA 2XYUA 2YITA 4DC2A 3CSVA 5A4EA 3A2CA 3QD2B 1L8TA 5L2SA 4D58A 2BCJA 3KF4A 1J1CA 2O64A 2B55A 3VC4A 4D2TA 5AEPA 2IZUA 5BUJA 2YM6A 4H36A 3I6WA 5B2LA 5BNJA 4E6AA 3MVHA 3QXOA 2BHEA 4QDVA 4XV3A 1OM1A 3HV6A 3TZ9A 5AA8A 2C47A 4F1MA 5EYDA 4MWHA 3WF9A 2G1TA 1YI6A 3VAPA 4A9YA 1U54B 4ZJVA 3BU6A 2WB8A 3W0OA 4XBUA 3TUCA 4QPSA 4JI9A 4L3LA 4ANNA 2W4OA 4FUYA 2GPHA 2NYAA 5IUGA 4FIFA 2I6LA 4JJRA 2QOFA 2PUPA 4WUNA 3LFDA 5TOZA 3SDJA 5M57A 4CQGA 5AUTA 2J5FA 2OGVA 3F5PA 3CPCA 3IECA 4M13A 2R2PA 3SQQA 4PP7A 5A4LA 2WELA 3GB2A 4YJTA 5J7BA 2QLQA 2DWBA 2VTRA 4FSTA 4WSYA 4RIYA 2YABA 3HZTA 2QG5A 4O0TA 4QQCA 2BILB 2QO7A 5CSPA 4BBEA 4KBCA 5DEYA 1CKPA 5J8IA 5ACBC 2FUMA 5A6OA 2VGOA 1ZY4A 1DI9A 2Y6OA 3CXWA 2PVRA 3GU8A 5H8BA 4IM0A 2AC3A 4M68A 4GU6A 5AP3A 3HV3A 4CSVA 5J9LA 3HMPA 4LM5A 4AXDA 3OS3A 5CI6A 4M67A 1K3AA 2C3KA 4CMTA 3FAAA 4UMQA 3UDTA 2X7GA 3IQ7A 4O4CA 4YLJA 4BYJA 4Z55A 4JBVA 5IMXA 2XCHA 1B6CB 3CE3A 3DZOA 3ZXTA 2WTIA 4EOLA 1Q24A 2GNJA 3LOKA 4EWHA 4TL0A 1ZARA 5IDPA 5BVOA 4K77A 4D2WA 4HZSA 3TACA 3QRJA 1P14A 4DH3A 3DCVA 5CQUA 1OIUA 3DS6A 3G2FA 3QQHA 3S3IA 5AAGA 2YAKA 4R5SA 4BTMA 4WNOA 3C7QA 2XKFA 1NVSA 5DH3A 2XJ1A 4QQTA 3BGQA 4H1MA 3VUHA 4C4EA 5FD2A 1JOWB 5JRQA 4CG9A 5AIKA 4BDBA 1BYGA 4DDIA 3M42A 4QP1A 1XR1A 3HUCA 4A7CA 4AW5A 1ND4A 1R0PA 3O8TA 3D7TA 5I9YA 3L8SA 3KRXA 3HA6A 3PY1A 5E8UA 2H96A 3BRBA 3RWQA 3H3CA 3BL9A 4BCKA 3TNPC 4MXZA 5GZAA 4GK2A 4RFZA 2UZTA 3EWHA 4HGLA 4AOTA 4CD0A 4U45A 3AT2A 3FEGA 3QD4A 4F0IA 3NWWA 4WHZA 5ANIA 4P2KA 2O5KA 3C51A 3NIZA 3COIA 4BDJA 5AUVA 4G3DA 4LUDA 5FGKA 5K4IA 4BL1A 1PXJA 1STCE 4ACDA 1OIQA 2XNPA 3BV2A 4O4EA 4U80A 3TTJA 3MSSA 4NW6A 3Q4ZA 2HXLA 4ZXTA 1MQ4A 1T46A 1YRPA 4TTHB 5J7HA 3QLFA 2R3HA 3PXZA 5H3QA 3V51A 5AADA 4TYHB 4FL1A 3R9RA 4DEIA 2DQ7X 4P4CA 1APME 4C57A 2KULA 3H0ZA 4WUAA 4DGGA 3PVGA 4LMNA 2EXMA 4QTBA 3S4QA 3NX8A 2OICA 2ZOQA 3AC3A 4ZSLA 4DH8A 2I7QA 4MNEA 3P5JC 2JIIA 3LXKA 4LGHA 1ZOGA 5IH5A 4FSZA 2YIXA 2Z7QA 3AC8A 3R2BA 3FY0A 3W32A 4DHJA 3NYVA 2C3LA 4QYHA 2A4LA 3CQEA 4CZYB 4JR7A 3ZLXA 5KUPA 4EQCA 2QOBA 4O7ZA 2XIKA 3WOWA 1YXVA 4RC4A 4ANOA 4H39A 3FDNA 4AOIA 4I92A 4QDEA 3POOA 4FIJA 5CI7A 3R9OA 3FZSA 1ZYSA 4WD5A 4C36A 2C6OA 5KCVA 4IWQA 4NM3A 4FK3A 4JG6A 2GNLA 3DKCA 4BDHA 4J97A 3A7JA 4O4FA 4PMTA 4S34A 1B38A 4HOKA 2YM5A 4OAVB 4FTIA 3FMNA 3ZC6A 4KIOA 4H3QA 2X39A 4IX3A 4KRCA 3HGKA 5DRBA 3DQXA 3IDPA 5C8KA 5BMSA 2B4SB 4DFBA 5EM8A 4W4XA 4KS8A 4RGJA 3FZ1A 2XRWA 3KFAA 2EXCX 1OI9A 5EHYA 5AV0A 2OJFE 2YERA 1P5EA 1Q5KA 2PZIA 2FB8A 5AR7A 2GFSA 2HK5A 3OCBA 5ANEA 3MA3A 2R3IA 3NNUA 2CHLA 2QLUA 2YLFA 4WNKA 3U87A 1YDRE 2ETKA 4B9DA 5CT7A 5CEPA 5I9WA 3GCPA 2Q0NA 4H58A 5IH6A 5DR9A 5K0KA 3KXXA 3MIYA 5EI2A 3R7YA 4C4GA 5K4JA 4BR3A 2XNEA 4F7JA 1O6KA 1JLUE 4ZJIA 3SD0A 2EB2A 4FTUA 4C8BA 4I6QA 2UZEA 2BHHA 4D1SA 4DFLA 2WO6A 2QQ7A 3BHUA 1Y91A 4EOIA 4C7TA 4C3RA 1OBDA 4GIIA 5F1ZA 1Q61A 2C68A 1WVXA 4I0TA 1OL7A 2C5OA 2VV9A 3AMAA 1VZOA 4XCUA 4JQ7A 3U55A 5K3YA 1KE7A 2BDFA 2QU6A 4E73A 5JGDA 3O50A 5EM7A 3PXKA 3OT8A 2VU3A 4FUXA 5GHVA 4EK8A 2YZLA 1WBWA 3TJCA 5JQ5A 1XWSA 3OUNB 4P7EA 2WU6A 2X2MA 2ZM4A 3WE4A 5FBOA 4IBMA 5C03A 1T45A 2J0KA 3R7IA 4QMQA 4PDPA 5CAPA 4L46A 3C0HA 5J9YA 1Y6BA 3BLAA 4YTHA 4L7FA 2Y8OA 3BKBA 1Q8UA 4UYNA 4NM7A 4R6VA 2WPAA 2JDOA 2R3KA 3MFTA 4RIYB 2YDKA 4AZVA 2B52A 4RWIA 2UW0A 4E1ZA 4KUJA 4OW8A 2CGWA 3L8PA 1ATPE 3RK9A 4FSQA 2OIDA 4RC2A 4TRLA 2E9OA 4AZWA 3BYMA 2AC5A 4O6LA 4QYFA 5E8TA 5CXHA 3JVRA 5CLPA 4UBAA 2PMOX 3LCDA 5CYIA 2CN5A 3R8MA 3KXGA 4HGSA 4IZ7A 3RAIA 5HX6A 3L8XA 4FVRA 3PY3A 4YHTA 3QRUA 1W7HA 1IAJA 4ACCA 4BJJA 5CQWA 5C26A 3D0EA 3P08A 4W8EA 2B9IA 5EDRA 1P4FA 4F70A 2A27A 5EQYA 3R1SA 2VX0A 5E9EA 4N6ZA 4GFMA 1XO2B 4OAUC 3BGZA 3D7ZA 5DT0A 4FZ6A 2WKMA 2ZYBA 4CFNA 4ERWA 3E3PA 2UZOA 4B8MA 4A4OA 5T3QA 3ID6C 4CG8A 4ALUA 4CYIA 4CKIA 2HAKA 3TEIA 1TQMA 4OBQA 2OFUA 5EDPA 1Q62A 5CANA 5IQDA 3QL8A 1OL1A 5CAOA 3Q5ZA 4IAZA 2WQNA 5EOBA 4C37A 4RVLA 3BLQA 4E4MA 4DA5A 3ACJA 4UWBA 3R7VA 3ZRLA 3D7TB 3NUSA 5HTCA 5CEMA 2PUUA 4A9RA 4FV9A 3EYHA 1JAMA 4O4DA 4XP3A 3VF9A 2DUVA 3HLLA 2HW6A 3K5UA 4C3FA 5CAVA 2PZYA 2CKOA 3T3UA 3UP7A 1SZMA 4JRVA 1P2AA 2X4FA 4DEAA 2CGXA 5AUZA 3RINA 5CTPA 3A60A 4EC9A 2YHVA 4RMZA 2R0IA 4M12A 2HZ4A 4PNIA 4RIWA 4Y73A 5DGZA 4DEEA 4GSBA 3PLSA 1CDKA 4GL9A 5ETFA 1XQZA 2G9XA 4HPTE 4UN0C 2X4ZA 5I4NA 3SW4A 4D4SA 4TWNA 4C2VA 1W0XC 4FNYA 3CTJA 4IWDA 5LVLA 4L43A 4EOPA 3PXQA 3AD4A 2O8YA 3OY1A 4MNEB 4FTJA 4BN1A 3OTVA 2XJ2A 1XH9A 2QI8A 3KU2A 5JH6A 4NUSA 3V5TA 4FVPA 5CSHA 3LM5A 4RVTA 3T9IA 3V3VA 4IWPA 2YZAA 5ANJA 2W5BA 4QMSA 2NO3A 3TV6A 2AUHA 1R78A 2WQOA 1JKLA 4X7QA 3UIBA 4EJNA 2XK9A 4U9AA 4G17A 4M84A 1IA9A 3ZFMA 2VUWA 3BX5A 1LEZA 3C0GA 4PF4A 4AQCA 4CNHA 5CF6A 1W2FA 4FKPA 4IZYA 4X3FA 2QODA 3KXHA 5DR6A 4CV9A 3E88A 3LCOA 4DGOA 1VR2A 2X8IA 1M17A 3UE4A 2GHGA 4FTAA 4MYGA 3NS9A 4L67A 4D28A 1SVHA 3ZCLA 1JBPE 4B99A 5BVNA 5KMIA 3QTQA 3QBNA 3AKLA 2VTLA 4U42A 4NH1A 3Q04A 4L3JA 3GP0A 4PTGA 4BHNA 1VLRA 3THBA 2C6LA 1GY3A 5E92A 2H8HA 2PMLX 4O22A 4P90A 2ZB0A 4FJVA 1E9HA 5CWZA 3KKVA 1MRYA 3ZUUA 2VWYA 1J7LA 5M06A 3F7WA 3KMWA 4Z3VA 1ZRZA 2BZHB 1GIIA 3TNWA 2JGZA 4IH8A 1WVWA 5I0BA 3DB6A 3LMGA 2QKRA 2XEZA 3Q2MA 5AR8A 4PL3A 3RPRA 3HRBA 5DT3A 5DOSA 2YM7A 4DHIB 4GT5A 3WARA 2OXDA 2HW7A 3U4UA 5E8YA 1TFFA 5JFXA 5AR5A 1PW2A 4WG4A 4FYNA 3EQPA 3NW5A 5C4LA 4AT3A 3R7UA 1H1SA 3BYSA 4BIEA 2CLXA 4BZNA 4M0YA 1DI8A 2VWIA 4LL0A 4EK3A 4YO4A 4FV6A 2C6KA 3QCXA 1YKRA 2OI4X 3QQKA 2KTYA 4IEBA 3NZ0A 2J0JA 5EK7A 2Z7RA 3BGPA 3VVHA 5CENA 4EH4A 5BVFA 2Z02A 3IS5A 4NFMA 4YZBA 2VN9A 4HVDA 1NA7A 3WBLA 3SXFA 4EZ3A 3D2IA 1QPJA 1K2PA 2QURA 4M14A 3OW4A 1GIHA 4UXQA 5EYKA 1H0WA 2R7IA 5IQGA 4XLVA 4DFZE 5GINE 2BRGA 2GNGA 2YIWA 2YN8A 3MV5A 5I3OA 4ZLZA 3HEGA 3EQFA 1OITA 4J53A 4J95A 4N70A 1OGUA 4O7YA 4FG7A 4PUZA 4U8ZA 1ZYJA 1Z5MA 3FPQA 5AP0A 5ITAA 2BMCA 5DEWA 2EB3A 4FL2A 4IHPA 2XZSA 4O27B 3CP9A 4W4YA 4EBVA 1KWPA 1PRYA 3LMIA 5DLSA 3QD0A 2F49A 3HX4A 3RK7A 2YISA 4ZLYA 4CT1A 5K0XA 3EZRA 4BCFA 1OECA 1Q8WA 1Z9XA 3OD6X 4JDHA 3PWYA 4DH7A 4AXEA 3EH9A 2I0HA 3TIYA 3VUKA 4DFYA 4PDYA 4BIBA 4ZAUA 4LV5A 3PPJA 3QTXA 3NUNA 3TT0A 4ZIMA 4DLJA 3N4UA 5IH4A 4BJJB 3DFAA 4IB1A 4OBPA 1UA2A 4L00A 5L6OA 3LFNA 3QTIA 5J1VA 3AD6A 4I3ZA 3U6IA 3RJCA 4NK9A 4PMMA 5EFQA 1PKDA 2QOHA 3G5DA 3KC3A 4E6DA 1JKSA 5DNRA 3FWQA 1RDQE 1REKA 3NSZA 1PMVA 2UVXA 3KB7A 3GOPA 4MF0A 5HO8A 2OW3A 4QMVA 2XYNA 2QO9A 1SVGA 3ATSA 3ZZWA 4IQ6A 3W0NA 4IJ9A 4FOCA 4GFGA 5KZ0A 1WBVA 2OFVA 3NAYA 4IANA 3P7BA 3FMJA 4GKIA 1H08A 2OJGA 2A0CX 2XNGA 4ANMA 1ST0A 5C1QB 4I1ZA 2JDVA 4XOZA 5E8ZA 3W33A 2XK7A 3R30A 3FJQE 3IW4A 4TPTA 2XARA 3WIGA 4TKSA 4BFMA 4YUQA 1U59A 4AUAA 4IVBA 4XNEA 5KMJA 3UC4A 3BWJA 1FMKA 4I24A 4QO9A 4QP2A 4I6LA 4C2WA 3DK3A 5K5XA 3JUHA 2XNBA 3FZOA 5FP6A 4KIKB 5J87A 4J1RA 4I5HA 4BGHA 4Y72A 4C38A 4R3CA 4P5QA 5HCZA 4AW2A 4YZMA 3A8XA 3PZEA 4EYJA 3ACKA 3AMBA 4O6EA 4FL3A 5ETIA 3RPYA 3GBZA 3HRCA 2A2AA 4PTCA 3R8LA 2JAVA 3G0EA 4FEXA 4IJPA 2ZDTA 2FO0A 3FSKA 3UOHA 3W10A 2XKDA 4NL0A 1OPJA 4X3JA 2Z2WA 5F94A 4GV1A 3MI9A 1OKVA 3CKXA 3C4WA 1BL6A 4FV0A 2H9VA 5JZNA 3FLNC 1IEPA 4TYJA 4TWOA 5KMNA 3E8DA 4KABA 3VS2A 2QG7A 4BICA 4KNBA 1IRKA 3Q53A 3OROA 3EKNA 1F5QA 2VWUA 3QRTA 4Q5EA 3I60A 1OIYA 3PG1A 3FI8A 3NAXA 2WTDA 2UZLA 4EH7A 2V62A 5EKOA 3QHRA 3TV4A 2F7EE 4FTMA 2YIRA 3R8PA 2HOGA 5CZIA 2H6DA 3O23A 5GIPE 3BL7A 4WKQA 2VWBA 4YJNA 4ZTHA 2IEWA 3CJGA 4ZY4A 1QCFA 5BYLA 1DS5A 2VTMA 5HX8A 4HCUA 4ZZNA 3LLAA 3JPVA 3HAMA 4ANSA 3C13A 3ENMA 3W2SA 4EQMA 4MTAA 1SM2A 4LL5A 4MBJA 3MW1A 3DAJA 4FKWA 5J95A 4DEBA 3GU6A 4X2JA 1WVYA 4C34A 2C1AA 5D7AA 4LRKA 5E8WA 1G8AA 2ITZA 2OXXA 1OKWA 2F2UA 3GCVA 3ZBXA 3DLZA 1HCKA 5LWMA 5IQIA 1WMKA 3ITZA 4WNPA 3UVPA 3VUGA 3DBDA 5CNOA 3AKJA 5HU3A 2BIYA 3IW7A 4MF1A 5L8KA 4JQ8A 4A4XA 4BY9E 5FTQA 2BRBA 3IW5A 3VULA 2PPQA 4LG4A 3CLYA 1GIJA 1YVJA 2W1ZA 3HYHA 3R22A 3VF8A 4F78A 2GNFA 3MBLA 4DDGA 4GRBA 4KA3A 5IDNA 4XS2A 5BUEA 4J71A 2BPMA 4E93A 4RPVA 3CTQA 1XH4A 5JFWA 3ZTXA 3HMIA 3BE2A 3UDBA 4DH1A 3DB8A 4PV0A 1UU7A 4NCTA 2WTCA 3D83A 4ALVA 4EOOA 4WG5A 2OBJA 2W06A 3AT3A 4G16A 5IQEA 1UU8A 3EQCA 4CEGA 1GAGA 2CKPA 1ZYLA 3PJ3A 2R7BA 1GOLA 2EU9A 2ZVAA 3VRYA 5KBQA 3TDVA 3GU4A 3EN6A 3ZU7A 4JAJA 5LCJA 3OWLA 5LVNA 2J90A 3TKUA 1QPEA 4TN6A 5A14A 4EOJA 5BVDA 5AP2A 3QWJA 2AYPA 3GU5A 4I6FA 2XK6A 2RFNA 5K9IA 3MB6A 4IAAA 4Y83A 5AP6A 4YJSA 3ZLWA 2XAMA 3W16A 3O96A 4FKRA 4RSSA 3D5WA 3FHIA 2JIUA 1Y57A 5CEQA 1NT2A 2OG8A 4N0SA 4FIEA 3R9HA 2PHKA 4QNYA 3TIZA 2IZSA 3UYTA 2WFYA 4B0GA 1JNKA 4JMQA 5M51A 5M4FA 3VWAA 3TL8A 3LZBA 3FBVA 2BAQA 2FH9A 5C27A 3TWJA 1YWNA 3KK8A 5TE0A 3ORTA 2PL0A 5HE0A 3AT4A 3HA8A 3NNXA 2YFXA 3NR9A 3IG7A 4XJ0A 4BKYA 1H25A 4AT5A 1PYEA 4EOSA 2XM8A 1IA8A 4TT7A 4ZSEA 5EKNA 2EXEA 4W4VA 4BCGA 3CIKA 4FC0A 4LMUA 4MNFA 4EYMA 3GENA 4MWIA 4N57A 3TNQB 1YHVA