5GJFA

Crystal structure of human tak1/tab1 fusion protein in complex with ligand 3
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
307
structure length
298
Chain Sequence
GPLHMIDYKEIEVEEVVGRGAFGVVCKAKWRAKDVAIKQIRKAFIVELRQLSRVNHPNIVKLYGACLNPVCLVMEYAEGGSLYNVLHGAEPLPYYTAAHAMSWCLQCSQGVAYLHSMQPKALIHRDLKPPNLLLVAGGTVLKICDFGTACDIQTHMTNNKGSAAWMAPEVFEGSNYSEKCDVFSWGIILWEVITRRKPFDEIGGPAFRIMWAVHNGTRPPLIKNLPKPIESLMTRCWSKDPSQRPSMEEIVKIMTHLMRYFPGADEPLQYPCQHSLPGRVEPYVDFAEFYRLWSVDHG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords TAK1 kinase - TAB1 chimera fusion protein
publication title Development of a Method for Converting a TAK1 Type I Inhibitor into a Type II or c-Helix-Out Inhibitor by Structure-Based Drug Design (SBDD)
pubmed doi rcsb
source organism Homo sapiens
total genus 86
structure length 298
sequence length 307
ec nomenclature ec 2.7.11.25: Mitogen-activated protein kinase kinase kinase.
pdb deposition date 2016-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5gjfA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5gjfA01
4GIHA 5IEYA 3KRWA 3R22A 5A4QA 2GS7A 2VX3A 3VUMA 5A4EA 5BVEA 1X8BA 4WG4A 2WKMA 4MTAA 2QLUA 5ANOA 3DA6A 5HG9A 3RVGA 1YXVA 2OF4A 3B2WA 5GZ8A 2GNGA 4YZNA 1FVVA 4YJNA 4RJ8A 4BDCA 3RCDA 3ZSHA 4O0TA 4U80A 4CT2A 4I20A 2JGZA 1J3HA 2O2UA 2XRWA 4QP6A 3V8SA 2ZOQA 4AFJA 3RMFA 5M07A 3QQJA 5TR6A 5LVMA 3PJ1A 1H1WA 5KE0A 2ITXA 4BIBA 1J1BA 4YHTA 2UW9A 3DK7A 5DGZA 2WQOA 2O63A 3NUSA 1OKWA 1TQMA 4QQ5A 4RFYA 4J96A 3ZZWA 4FZFB 4KS8A 2PMLX 4FSZA 4TZRA 3TG1A 4NUSA 2J90A 2A19B 4GU9A 2C5OA 3OZ6A 2JBOA 4MXYA 3R0TA 2V7OA 3E63A 1M2RA 5JN2A 3UG2A 4KD1A 4J53A 4FEXA 1APME 3BQCA 4A7CA 5KMIA 3MH1A 3Q4TA 3LMIA 4ANBA 2OI4X 2YLFA 4IADA 3PIZA 2YN8A 2XM8A 5I5ZA 3E64A 5F95A 4QMUA 2WMTA 2WXVA 4MNEA 4Y5HA 4AP7A 2GHLA 4F0IA 5EDRA 5EYKA 3EQHA 4Y73A 3COIA 2V55A 4IM3A 1JPAA 2QHMA 4XG3A 3EQGA 1VYZA 2OJ9A 4JDIA 2ITUA 4EQUA 4MVFA 4B6LA 1OIYA 4C4FA 3CSVA 4FL1A 1L8TA 4U79A 3DFAA 4AW0A 3Q4UA 3UVQA 4YTFA 2R7BA 3KC3A 4YJVA 5L2WA 5CU3A 5KMJA 4V0GA 4FKOA 2QC6A 2AYPA 3D94A 4O6LA 4HNFA 3VJOA 3BYVA 1ZYSA 2CNVA 3ZO1A 2YDIA 3KL8A 5D10A 5FGKA 1R78A 1Q62A 4BZOA 4NSTA 4APPA 4QTCA 5EI2A 3E7OA 3BKBA 3FZPA 5AAGA 1I44A 3KXZA 3LQ8A 3QWJA 5JKGA 2ZDUA 3IKAA 4K6ZA 4QMYA 4EH4A 3BU3A 3A8XA 3RM6A 5K4IA 4FKTA 2EWAA 3PPKA 3QX2A 5E1SA 2BHEA 1YWNA 3NCZA 1ZYLA 4DINA 2IPXA 4O0WA 1H27A 2HELA 4BCOA 5IU2A 4XLVA 4D2RA 4GG5A 5A6OA 3QCQA 3BHHA 1GZ8A 3U6IA 4FKGA 4F9CA 4FZ7A 1H25A 4IB0A 4JBVA 2HWPA 4C58A 4MXCA 1JNKA 4CFVA 3LXNA 3TCPA 1YRPA 3NUPA 4UYNA 5J9LA 2F7EE 5CZHA 3Q3BA 5H8BA 3WE8A 4I6QA 4U9AA 3EL8A 5AUZA 4QMOA 5J1WA 1CDKA 4ZTSA 5C03A 1OL7A 2OFUA 3DDQA 1SVEA 3OHTA 4KINA 5HG7A 4BCIA 3GC0A 4CRLA 5BVWA 4AOJA 2R3JA 5EM8A 4CMUA 4EK6A 5EQEA 4OBOA 4BBEA 2FSOX 5HO7A 3KB7A 1P14A 4RBLA 4IAIA 2BDJA 4AA0A 1OUKA 3RPOA 2UW8A 3SG9A 3ORZA 3M2WA 2YCSA 5HIBA 1KWPA 4DITA 3FMHA 2W4OA 3NYOA 4Y8DA 1OUYA 3RAWA 5HZNA 3OWLA 5DYJA 3HV3A 4ZJIA 2ZV9A 4QTEA 2H9VA 1IG1A 3ZM4A 1PKDA 2JAMA 4UXLA 3FBVA 2G2IA 3C7QA 3AQVA 2R3MA 4L00A 1U5RA 1YWVA 3NS9A 1KSWA 3CKXA 3RWPA 4QP1A 5F4NA 4J52A 4O22A 1QMZA 3ATTA 5AWMA 1OIQA 3QBNA 3W16A 2BRBA 3D7TB 4IBMA 4ACMA 2BHHA 2QI8A 3I0OA 5HBHA 2PUNA 3V6SA 5FQDC 2W1IA 3ZCLA 3FKOA 5JK3A 3IECA 2FUMA 3FMLA 1WAKA 4IZAA 5D7VA 3ZEPA 3O23A 1QPDA 2VWVA 3R7GA 4QOXA 4HZSA 4L52A 5FTGA 4O86A 2XUUA 4QTBA 1Z5MA 3VBYA 5IQCA 3BRBA 4F4PA 4E4LA 2IN6A 2YM4A 5EM5A 3FZSA 3W32A 4GJ2A 4BGQA 1QPEA 5D11A 1F5QA 4W4YA 2UVYA 1WBWA 3GOKA 3L9MA 3QGWA 4NKSA 3RP9A 2NNWB 4Y83A 4LUEA 4O7RA 3KMUA 4MX9A 4YO6A 4GK3A 3DLZA 4NJDA 5D9HA 1IAJA 4X3FC 4J1RA 5AR2A 5I9YA 5A4CA 1H8FA 4IX5A 4MBIA 4IFCA 4A9RA 4R6VA 1H1SA 3FY0A 4AAAA 2GFCA 4BBMA 5I9VA 5BYYA 4I6BA 3ZM9A 3NUNA 4ITHA 3BWFA 4DAWA 5E1EA 2WTJA 4FSQA 4KABA 2CGXA 4U6RA 5CU6A 5H8GA 3I7CA 4ALWA 2ZB1A 3LFSA 4CFFA 4DG2E 5A14A 5AV0A 2GNHA 1OPLA 3BV2A 5DRBA 3QUDA 4DEDA 3OCGA 2VTLA 2W5HA 4BHNA 4L8MA 3C4XA 3TNWA 3OUNB 4ZTQA 4EH6A 1Y6BA 3BI6A 3COKA 4OTQA 3D7ZA 3QLFA 3UIMA 3EHAA 4X2JA 4ZLOA 2X81A 1JLUE 4KA3A 4KIQA 4OAVB 3WI6A 4BCJA 3TN8A 3EZRA 3SOCA 4IJ9A 3COMA 5I9UA 4C4IA 4QNYA 4FGBA 4CG9A 2W17A 4MCVA 4R77A 3OVVA 3HV7A 4FV6A 4QMQA 2P33A 3SC1A 5GZ9A 3RNYA 3NIEA 3CJFA 2UV2A 4X6QC 3JUHA 4DFLA 3FYJX 3QKMA 3VUIA 3POOA 2BPMA 3MPTA 1JWHA 1XH4A 1YOJA 1M7NA 2WQNA 3POZA 4TYGA 3TIZA 3UC4A 3ZXTA 4I24A 4OW8A 1HCLA 2OF2A 1S9IA 5CF5A 4IZ7A 1FGIA 4JQ8A 2BIYA 3GVUA 3BU6A 4BI2A 5M56A 5M53A 3HMNA 3O7LB 4B8LA 1YDTE 4PPAA 3E92A 4K18A 2E9VA 4X2FA 1LR4A 3D5VA 2R3OA 3PDTA 4U81A 5IUIA 3FE3A 3TZ9A 3KK8A 2RG6A 2BR1A 3DPKA 3P0MA 2PMIA 2XJ2A 4JQ7A 4RIWB 3U8WA 5DI1A 4E6DA 2I0HA 3CD8A 2WTVA 4JAJA 4CFNA 4D9TA 4YLLA 3VS1A 4UBAA 3F6XA 4EWQA 5AX9A 4IAYA 3OOGA 2GQSA 2P0CA 3GEQA 1OGUA 4RFMA 3LQ3A 4ZXTA 4DGLC 4FYOA 4IDVA 3DAKA 4C57A 4UEUA 3CGFA 1XKKA 4FUYA 4AE6A 3PA3A 2C6OA 4BN1A 4RJ4A 3EQCA 3I60A 3C51A 5HTCA 3BLQA 3OEFX 4K11A 3HX4A 4E5AX 2RIOA 3LZBA 4M0YA 2OIDA 4PMSA 2QKWB 5DBXA 4AT4A 5AUUA 3NAXA 3KXGA 3MH3A 4XEYA 3SKCA 3LXKA 4PQNA 2OIBA 4A4LA 3PRFA 4E3CA 1UVRA 3BX5A 3LFBA 1WZYA 2BAJA 2OXDA 2QOIA 3VRZA 1OVEA 4KIOA 4NTSA 2UZOA 1G8SA 1ATPE 2RFEA 3KF7A 4HPTE 4A9SA 4BGGA 5LVLA 4GVJA 4IB5A 4F65A 5AX3A 4IWDA 3F5GA 4WO5A 5IUGA 5BMMA 1QPJA 3G0FA 4I0RA 1GZKA 2F57A 4W4VA 2GDOA 3QYWA 2F49A 5HO6A 4K8AA 3UMWA 3UP2A 3KKVA 3VBWA 3VN9A 2FYSA 1H1PA 3CPCA 2XRUA 3FI2A 1B6CB 4ZSJA 4C3RA 5HGIA 5E9EA 2XK4A 3N9XA 2OIQA 4ZTRA 2ITVA 3V3VA 3D7TA 3LCTA 5KNJA 4AS0A 5BUIA 3UBDA 5CYIA 5JGBA 5AP2A 3NW6A 2GNJA 4AT5A 2GPHA 3OCTA 4YJQA 2OJJA 4P4CA 1YWRA 5EW9A 2X8EA 3RAIA 4JBOA 3ZLWA 3GCVA 3AXWA 4XBUA 4HYIA 3DB8A 4AGCA 3VNTA 4I22A 4JAIA 3KXHA 4QMWA 3BQRA 2BKZA 3QRKA 4DCAA 3SRVB 1OIRA 4FEVA 3IPHA 4XP0A 4CT1A 1YW2A 4E73A 3LMHA 3GCSA 4AXAA 4CV9A 4QMTA 1MRVA 3P4KA 4BTMA 3DQXA 3ZC6A 3C4WA 4RJ5A 4ONAA 2UZVA 2DQ7X 4FV8A 2YJSA 4ID7A 4FBXA 3T9IA 1JSTA 1M7QA 1YKRA 5L8JA 4EOLA 3DBDA 3OWKA 3MBLA 5EG3A 1K9AA 4FTLA 4JT3A 4A06A 4DF3A 4HZRA 4R1VA 2XK8A 3OBGA 4FT9A 4ANSA 2RG5A 3GNIB 3CP9A 3WOWA 4C62A 1OBDA 2XNOA 4EUTA 4IEBA 3AT2A 4AZFA 3L8PA 5EDPA 3KU2A 4HVHA 4CD0A 1U54B 2WU6A 4APCA 1OECA 3OG7A 5A6NA 1FMKA 4YGAA 4BFMA 4L9IA 4O96A 5HQ0A 5KUPA 3BLHA 3L9NA 4J8NA 3H4JA 4GV1A 5FP5A 5EW3A 4YJRA 3O0GA 2OZAA 3ODYX 3UVRA 4D0WA 4FL3A 5CNNA 5M51A 4O27B 4GYGA 2VTNA 2XNMA 4DH7A 5KMLA 3OS3A 2VTTA 3LJ2A 4GH2A 1ZOGA 3QYZA 4EUUA 1U4DA 3F3TA 5FEEA 4ZY6A 3TNQB 3LM0A 4J7BA 3UOHA 4XHKB 4QMLA 3PVBA 2HW7A 3QZGA 5HE3A 4JRNA 1M2PA 3ZSIA 4U43A 4YNEA 5J1VA 4NW5A 5FM2A 3P79A 5B2KA 4W8EA 3OUKA 1WBPA 1DI8A 3VIDA 3A60A 4J98A 2XYNA 4WNPA 5CENA 3GU4A 2BFXA 2UW6A 2C6LA 4PTCA 5AP4A 3LXLA 4GYIA 4ALVA 3CLYA 1XH6A 3BWJA 1W8CA 2VWWA 4IB1A 4KB8A 4V01A 2V62A 1NY3A 3C0GA 2W1GA 4RIXB 2YITA 3MY5A 1WBOA 1Z9XA 1IR3A 4QMMA 4RA4A 5C4KA 2X7FA 5ACBC 5K3YA 3DTCA 4FK6A 2E9NA 1OKZA 4XRJA 3UIBA 1G5SA 2JEDA 3FC1X 3O7LD 3FEGA 4QP3A 4JR7A 4FEQA 4DEBA 4XOZA 2CGWA 2W9FB 5LWMA 2CNUA 5B2LA 5HIDA 4LOPA 1YI4A 3DKOA 4RMZA 5IUHA 4EOMA 4H3PA 4V04A 1QCFA 5TO8A 3RZBA 4HOKA 3MV5A 5AAFA 1KE9A 4A9YA 3QAME 4CKJA 4JRVA 3MYGA 5CEPA 3Q5ZA 3Q2JA 4ZMEA 4RC4A 2B53A 3DT1A 2HXLA 3R00A 3MFSA 2E9PA 5HO8A 1AGWA 4R3RA 5FDXA 5A3XA 1RJBA 2WELA 3EN5A 2CKEA 1B39A 4Y85A 3T3UA 1JBPE 4II5A 5CS6A 5EHOA 4RVTA 4USDA 2GS2A 2VRXA 4FOBA 3BEAA 4LV8A 4E1ZA 2C0TA 3E93A 4PDSA 3DKGA 2XJ0A 4F6WA 3EB0A 3QQHA 5I3RA 1CKPA 2IWIA 2XCKA 3FUPA 2ITTA 4BDEA 2PVNA 3II5A 3KCFA 5CSVA 4MD8E 3VBXA 3ZC5A 4EEVA 4FICA 3FLQA 3H9FA 3OEZA 4H36A 4FVPA 1PXKA 4AWIA 5CF4A 3KEXA 4IC8A 3TL8A 2YLEA 3I1AA 4CFMA 3GC7A 3A7GA 4LRJA 3QF9A 2VZ6A 4JX3A 1DI9A 2XS0A 3MA3A 4E7WA 2WTIA 5LMAA 5AM6A 3B2TA 1XBBA 4TYHA 5J7BA 3UODA 1Q8WA 4WKQA 4E5WA 3I6UA 4RX5A 1Q8ZA 3P78A 2UW5A 3DJ7A 3KY2A 3OF0A 2WMQA 1DS5A 3BE9A 3PVGA 2UZTA 3ZLYA 5BVFA 1FBNA 1PXLA 2RL5A 2BDWA 5E92A 1SNUA 4QP2A 1SVHA 4IX3A 2C4GA 5JMSA 3SRVA 1URCA 4Q5HA 3SGCA 5BUJA 2ETRA 4OTIA 5HNBA 4EK5A 4GK4A 5DRDA 5AP5A 2BAQA 3R7EA 4EOOA 4UMTA 3HVCA 4EZ7A 5TOZA 4M7IA 3WIGA 4MHAA 1ZYCA 2GQGA 2IO6A 3QC9A 3VULA 4CLIA 5CF8A 2OH0E 2R3IA 3HAMA 1R3CA 3JYAA 1NA7A 3NRMA 3SD0A 3FMKA 4RIYB 1PXPA 4ACHA 3ZO3A 2B0QA 4G9RA 5DN3A 4BF2A 4Z55A 4NFNA 5DFPA 3LCKA 3KN6A 2UZNA 2OXYA 4J71A 1H00A 4KBCA 2V5QA 2PVMA 2XKEA 3HUBA 1K2PA 4GRBA 1JSUA 4AUAA 5KMOA 2ZM1A 3PPJA 3NYVA 3MFTA 2W1EA 4FUXA 1UU3A 4ASEA 5CVHA 4JG8A 1XH7A 2VWUA 4WNMA 3VHEA 3QWKA 4IVBA 2FVDA 1YVJA 4W9XA 3RNIA 4XG6A 4G5PA 3R21A 2JDVA 4FTNA 4ZSGA 3UPXA 4HCUA 1Q61A 3O8TA 4E4MA 2ZV7A 5HLWA 2EB2A 2VTQA 3FAAA 3Q32A 4L46A 1R0PA 4BDGA 5LCJA 4DFUA 4F0FA 2C69A 4P2KA 1NXKA 5HBJA 4EK8A 3OOMA 3RAHA 1ZOHA 2W1FA 3HV5A 5KZ0A 2X8IA 3IW8A 5E8TA 5J95A 3F3ZA 3P08A 3RK9A 2F2CB 3GU6A 4LV5A 3A99A 4CGAA 4G16A 4HVIA 3MDYA 2QG5A 3I5NA 4XH6A 4FIHA 2ZM3A 3EOCA 5EOLA 5AAEA 1O6LA 4YZ9A 2I40A 2UW7A 5IH6A 2YA9A 2ZB0A 4S33A 1LEWA 3RHKA 5EFQA 3Q52A 1REKA 4Z3VA 3ZU7A 5IG1A 2C0OA 3CGOA 3R04A 1ZZLA 3IW5A 4X6RA 3DV3A 1BKXA 3JPVA 3L8SA 4TYEA 5DT3A 2BKKA 1GIJA 5DOSA 2ZDTA 4CMTA 1GZNA 4BB4A 5CAOA 3MPMA 4HPUE 5J5SA 4F64A 1CM8A 2WQEA 3EIDA 3KA0A 4U97A 1ZZ2A 2W1HA 3QQLA 1UU8A 2EUFB 5KO1A 3C4EA 3NLBA 4GSBA 3DCVA 4CCBA 4RIXA 4RFZA 2WMAA 4TT7A 2E9OA 4A4OA 3AMBA 4PDOA 4EQCA 2CCIA 4WG3A 4GVAA 1BL6A 4IANA 4JJRA 4PTGA 3VVHA 2HCKA 5DT4A 3Q4ZA 4IWOA 1GIHA 4R7BA 2WFYA 5IQAA 2W06A 3OBJA 2JD5A 4FKUA 5HI2A 2FH9A 3QL8A 5L6OA 5DEWA 4QMSA 3HL7A 5FLFA 5BVKA 1XR1A 4CQGA 1AD5A 2Z8CA 4C33A 1Q5KA 4P5QA 5HOAA 4ZK5A 4D1ZA 4MEDA 3W8QA 3FZOA 2C5XA 3AC3A 4TY1A 3VJNA 3S95A 2EXEA 2NRYA 3NX8A 3ORTA 3HRBA 4GFOA 1UU9A 1H07A 4DFNA 4NM3A 4UB7A 3PXKA 3B8QA 4E8AA 5IDPA 2IVTA 4FT0A 4ARKA 1Q3DA 2VGPA 2G1TA 5L2SA 2WGJA 3I6WA 4R7HA 3QC4A 1UKIA 2DUVA 4FEUA 2PY3A 3ORKA 4RX9A 1ZY5A 4O7LA 4QYHA 3D5UA 4ZEGA 5AP6A 4UXQA 4AA5A 5CAVA 3MJ1A 4FF8A 2VTRA 3QFVA 4H58A 3VC4A 2QKRA 1PRYA 1M17A 2C5YA 3DBEA 3I79A 3FXZA 4CV8A 4ZZOA 2J0KA 2BZHB 2A0CX 4IACA 2H34A 5BVNA 5DT0A 2R3FA 3CIKA 4EC8A 5B0XA 4C4JA 3HKOA 2FO0A 3MFRA 3NUYA 1VEBA 3CQUA 3QALE 5GJFA 3V8TA 5IA4A 2P4IA 1LUFA 5J9YA 3BYUA 4W4XA 3Q9WA 2W1CA 3ORLA 2I1MA 3F2NA 3EWHA 3UDBA 3ZUVA 4DBNA 4FV7A 3GU7A 4BDHA 4C0TA 4NZWB 4DGGA 4D28A 2JFLA 1HCKA 4IX6A 4RWLA 4FKPA 3DQWA 4OTPA 3AD5A 3EN4A 5JH6A 3QUEA 5KKRC 4C35A 3H0ZA 2XIRA 4M69B 3R9NA 1J7UA 4FE2A 4CFWA 4EH2A 1OBGA 1ZMWA 3A4PA 2ZMDA 1YXUA 3MVLA 4WD5A 3R9RA 2O0UA 5M57A 5KX8A 3IGGA 2X1NA 4RX7A 1MRUA 3TNPC 1YXTA 2PE2A 4DTAA 4PY1A 3C4ZA 4B8MA 2BVAA 2UVZA 4RWIA 3SOAA 4TL0A 2PVLA 5G1XA 4RIYA 2GNIA 2VO0A 4FV3A 5FTOA 3HV4A 3TV4A 2BALA 2JKMA 4EOSA 4CLJA 3TNIA 3EQIA 2VWIA 3R9DA 2ZM4A 4D2TA 2OJFE 3RAKA 2PK9A 3H9OA 3ZLSA 4HJOA 2R3PA 2WIHA 4G2FA 4NM7A 5J5TA 2I0VA 3SA0A 3R7YA 1U59A 4C3PA 3KF4A 3S0OA 3GUBA 2CSNA 2R0IA 1YDSE 3G51A 4FKSA 4K9YA 4BCQA 4KIPA 2CLQA 1WCCA 4WHZA 2ERZE 3ULZA 1PMEA 4GU6A 2VWXA 4I41A 2VWYA 3BE2A 4OTHA 4LYNA 4AGWA 2Z60A 4XCUA 1Y91A 3O2MA 5JQ8A 4BRXA 4G3DA 3V01A 1RDQE 3QTZA 1ZYDA 5JFVA 1RQQA 3ZRKA 4DLJA 2ETKA 3DBQA 3VUGA 4FX3A 2VD5A 3QKLA 4NEUA 2YWPA 4L7SA 2WEIA 5D41A 2WMBA 2DYLA 5CF6A 1UNLA 1J7IA 4YC8A 4I21A 3LLAA 3UOKA 4EORA 1OL5A 4EYJA 4XS2A 2YIWA 5EDQA 4D55A 3MA6A 3P7CA 5LMKC 3EFLA 4AG8A 3BGQA 3OROA 4BTKA 4O7VA 2O65A 2QO9A 1V0PA 1VZOA 2YM6A 4FTIA 3E8EA 4HVGA 2XEYA 4O6EA 1IA8A 3ZBXA 1GIIA 1MP8A 2XBAA 5T6KA 5HLPA 3Q5IA 1XJDA 4YTCA 4HGEA 4LGHA 5M55A 4KIKA 1KE8A 5AIRA 3H30A 1G8AA 3P9JA 1DM2A 4BKZA 5BQ0A 4WA9A 5AR5A 5CAUA 2YM3A 4M67A 4KUJA 2NPQA 1FPUA 3TWJA 3LPBA 4PWNA 4L3LA 2QQ7A 1OMWA 3SQQA 2JDOA 2OJGA 3BHUA 3ZO2A 4XNEA 1W98A 3D15A 5CEMA 2BAKA 1YDRE 1ZRZA 2O3PA 3DNEA 2EB3A 2IVVA 2WMXA 3FJQE 3HV6A 3ZHPC 3ZXZA 5L2IA 4GFMA 4HGSA 3OD6X 4CZUA 4G3GA 3LLTA 3DNDA 3QD0A 4O81A 5FM3A 5L6PA 4O1PA 4BCMA 4FIIA 4F7JA 4X7QA 2JDTA 3FY2A 3VS6A 2GTMA 4FIEA 1KE6A 1XHAA 4I0SA 4O82A 4MXOA 5HCYA 3O50A 3UO5A 4A9TA 3A8WA 4ZTLA 3O71A 1GY3A 3AC2A 3T3VA 5KMKA 5L6WL 3UE4A 4RQKA 3HA6A 2XEZA 3OCSA 3OXZA 4QP7A 4EH3A 4QP8A 1YHWA 5CZIA 5JZNA 4RRVA 3RPSA 3U9NA 2R3LA 3UOLA 4EOPA 4G5JA 3QLGA 3U55A 4L44A 4DC2A 4ZLYA 3GI3A 2F7XE 3DDPA 3ENMA 2BZJA 4ZZNA 4YZDA 4ZS4A 4F1OA 4L43A 4UMRA 3ZMMA 3ZBFA 2FSMX 3NYXA 1P5EA 3QTWA 3F2AA 5LWNA 2PMNX 2B55A 4WIHA 3ORPA 4RSSA 2OH4A 5CNOA 1Q99A 3RM7A 4AN9A 1BMKA 2XIXA 3HAVA 2UZDA 4ACDA 4IB3A 3UO4A 2Y6MA 5GINE 5FBOA 2XA4A 2ONLA 3QTIA 3C0IA 4PF4A 4GJ3A 4N57A 4X2KA 4BDKA 4LL0A 3NNWA 4G34A 5C4LA 3LFCA 4CFUA 3E62A 3OT8A 4OLIA 4AZWA 4E26A 5AV1A 3R1QA 4AQCA 5IKWA 4QPAA 2Y6OA 4O1OA 1JSVA 2W1DA 3KRRA 3QRUA 1T46A 2YDKA 3NGAA 4XG8A 1T45A 4AX8A 4O7SA 3PY3A 4ANNA 3PXYA 1PYXA 4FSYA 3UMXA 3N4UA 5FXRA 3ZTXA 5IF1A 3TDVA 3AMAA 4D1XA 1TVOA 1PY5A 3IDBA 2Y4PA 3O96A 4M69A 4B7TA 1FMOE 2Z7LA 3QU0A 4QYEA 5JT2A 2HZ0A 5JFXA 4YZBA 4JG6A 4I6FA 2QG7A 4UMUA 4HCVA 3RALA 4C34A 2W05A 5CXHA 2PWLA 3L8XA 4CEGA 4EKKA 4UV0A 1HOWA 2CLXA 3G9LX 5HHWA 2IJMA 2ITPA 3ROYA 2JC6A 4IW0A 4H1JA 1SYKA 2IZTA 2UW3A 2XCHA 4FTOA 2QNJA 4QP9A 5BMSA 5IMXA 3R7VA 3AGMA 5E8VA 3SXRA 5CU0A 4NJ3A 5JFSA 4RVLA 4OUCA 3F5UA 3PSDA 4KKGA 4U0IA 3U9CA 2WQBA 5KMNA 2SRCA 3G0EA 4YNOA 3MH0A 2ITYA 3A61A 4IVCA 3AT4A 4EOJA 4K33A 3AOXA 3VBVA 3M42A 2X0GA 2X2LA 3MGYA 5HE0A 2HYYA 5I3OA 4AFEA 4ZTMA 5J9ZA 1YXXA 2JDSA 4FTJA 2C1BA 4O0UA 2OW3A 3HMIA 2G2HA 1BUHA 2GS6A 4X2NA 4N70A 4ANMA 4B99A 5LVPA 5D7AA 3HLLA 2OBJA 4UWYA 4F6SA 4C2WA 5JRQA 3F69A 4CMOA 4UN0C 2BFYA 3ENHA 2X39A 2J0MB 1ZY4A 2QOLA 1JKTA 1Y57A 4MWIA 4YJUA 2PPQA 2JKQA 2I6LA 4O0YA 3R8ZA 4BIEA 2RF9A 4FV5A 2B9JA 1PMNA 2PZIA 2VTOA 4BZNA 2UW0A 3P7AA 3IS5A 4Z9LA 3QD4A 4S30A 4FVRA 3FZRA 5IPJA 3PXFA 4GCJA 4C8BA 4RIOA 2V22A 2QO7A 5BUEA 5IDNA 2ITOA 2WOUA 2WMUA 2HZNA 2BRGA 5DR6A 5CI7A 4RJ3A 2ITZA 5EK7A 5AP0A 3BBTB 2BUJA 1A9UA 2A4LA 3DY7A 1AQ1A 3PJ8A 3JVSA 4FT7A 3NZ0A 3PWDA 4E6QA 3VS2A 3FWQA 1XQZA 4FV0A 2XB7A 3MVHA 1KV1A 3M1SA 1TQPA 4E4NA 4O84A 2XNEA 3OMVA 1PXOA 5HEZA 4M15A 5HVYA 3UNZA 2PZYA 1DAWA 3BU5A 4EL9A 5AUYA 5CI6A 1A48A 4IVDA 5E90A 5JSMA 1V0BA 2X7GA 3NWWA 5AA8A 2WZJA 5DWRA 2BRMA 5ETAA 3ZDIA 1DAYA 3QTXA 4GUBA 3V8WA 3UJGA 5K5NA 4NCTC 2VWZA 4BR3A 1BLXA 4FZDB 2VTPA 2BROA 4RPVA 4WRGA 3NNVA 3PPZA 4MD9E 4F7NA 1CTPE 3R1YA 4HW7A 4ZY5A 5FP6A 1OIUA 5CU2A 3G33A 2VUWA 3ID6C 2B4SB 4A4XA 3NCGA 3V5QA 3ZO4A 4WT6A 2QODA 2YCQA 4XV2A 1FOTA 5GJGA 2A1AB 5DMZA 1OPJA 2VWBA 3COHA 1UU7A 3MTFA 3NEWA 4TKSA 3JY0A 3NDMA 4AF3A 1VR2A 1Q41A 1V0OA 2R9SA 1OITA 2YM7A 3DXNA 2IW6A 3DU8A 3K54A 3NW7A 3MY1A 5E7RA 4FIGA 2EVAA 3IK3A 4KRDA 5HG5A 3TACA 3QXPA 4MBJA 3GT8A 2HIWA 2BTRA 3A4OX 4TWOA 2W99B 3TNHA 3ZZEA 4BGHA 2VO7A 4EC9A 5B7VA 4EOQA 4EH8A 4U41A 3VBTA 4BL1A 2B7AA 3G90X 4MNFA 4KRCA 3C0HA 2WTKC 3G6GA 3OCBA 4N0SA 3VUTA 3P86A 3QQUA 3EJ1A 4OT6A 4ZZMA 4UMPA 3QA0A 4BWKA 3ODZX 2X2MA 3A62A 5BVOA 2B9FA 4ACGA 3EN7A 1KE5A 2R0UA 4I1ZA 2OSCA 3QZFA 4Y95A 5ETFA 1UWJA 3EQPA 4YBJA 5HKMA 4L01A 5T3QA 4O91A 4F1MA 3PVUA 2CHLA 2O64A 5JFWA 5JGAA 2H6DA 5EYDA 5ACKA 4CRSA 2GFSA 2HY81 2PVRA 4UWCA 3T9TA 2J4ZA 5IA2A 4ANOA 4EKLA 2W1ZA 4G3FA 3MW1A 3MN3A 5H2UA 5EYCA 1OZ1A 4FNXA 5HG8A 4DCEA 4G1WA 3WYYA 4FTAA 2Q0BA 1KV2A 3E87A 4Z7GA 2XH5A 4PDYA 2F7ZE 3D5WA 1GJOA 3DAJA 3QTSA 3V5LA 3GGFA 2W5AA 2X7OA 3QA8A 3ERKA 5LJJA 1NT2A 3H3CA 2PTKA 4G6NA 4I5MA 4AU8A 4DTKA 3FI8A 3BGZA 4QMPA 3HP2A 4KAOA 4YHJA 5TT7A 2J0LA 4IIRA 4C36A 5IQEA 3NNUA 2XNGA 3RTPA 4BI0A 4EBVA 2B9HA 1PXMA 3F82A 5BX0A 3H10A 3PVWA 2VX0A 2PMOX 3HMPA 1YOLA 4LL5A 1ZOEA 5C8MA 2UZBA 3W33A 5H8EA 3IDPA 3QRJA 1FINA 2YM5A 3ALOA 4FKWA 2BILB 2XK7A 3HP5A 3R8MA 1IEPA 1K3AA 2FB8A 3D0EA 4YLKA 4FSNA 2C6TA 4RZWA 4OTGA 5CWZA 3MESA 5AFVA 4WSQA 3S3IA 4FIJA 2IVSA 4Q2AA 3W2CA 2VX1A 4PP9A 4ASDA 4FTTA 3EFJA 4QT1A 2Q83A 3PLAE 3ZH8A 5CVGA 3LXPA 3V5WA 4E5BA 2UZEA 4O0SA 4IE9A 1YI3A 2PVFA 3R2YA 4AW5A 5E4HA 3FQEA 5EHLA 5AR8A 5CANA 5I9XA 3DJ6A 1PXIA 5GHVA 3BLRA 4U7ZA 3QD3A 4YJTA 3UYTA 4PP7A 3EZVA 3FC2A 4BYJA 3VQUA 3W2QA 4BYIA 5HX8A 3L1SA 5M4IA 1KE7A 1XWSA 2QR7A 3FYKX 3MVJA 3QUPA 5K5XA 1PW2A 3LFQA 4FSTA 4S2ZA 4S34A 4F99A 5GIPE 3PIYA 4OTDA 3LCSA 3QX4A 4USFA 3UQCA 2CCHA 5IEXA 3CE3A 5CQUA 5HBEA 3FHRA 1PXNA 2W4KA 3PJ2A 4RIWA 2E9UA 3KCKA 2JDRA 4QMXA 3FXXA 4U42A 4W9WA 2Y7JA 4IAKA 4JDHA 4ZS0A 3VS7A 3ZRLA 4X3FB 4D1SA 3N51A 4BY9E 1H01A 4AGDA 3FI4A 5E91A 5EKNA 2XP2A 3E7VA 1STCE 4PPCA 3GFWA 3Q60A 4C59A 5M4FA 4FV4A 3OT3A 4XP2A 4JS8A 1JAMA 4EWHA 4BTFA 3Q9XA 3PIXA 1CSNA 1SNXA 2X9FA 5C8NA 3VUDA 3WZUA 3KN5A 4U5JA 1LEZA 4NIFB 4FK3A 4IDTA 4G6OA 4PL5A 3ZDUA 3U6JA 4DTBA 4JQEA 3SV0A 3P23A 4DH8A 5DVRA 3BYOA 4AZVA 5CTPA 1WMKA 1BX6A 5CEKA 4YPSA 4I94A 4L45A 3CQWA 2DWBA 3QRIA 3P7BA 3D83A 3MY0A 3TTIA 3AC8A 5CXZA 4RJ7A 4XV3A 3PWYA 4AZTA 1YOMA 2DS1A 1P4OA 5EH0A 3R02A 3R63A 3RINA 3U4WA 4GT5A 1QL6A 4F9YA 3PXRA 4WUNA 2HY0A 4MD7E 5E8WA 2R3GA 3WYXA 5AV2A 2YERA 3K5VA 2PE1A 2E2BA 4NW6A 4R1YA 5AUTA 4MQ2A 3Q9YA 3D9VA 3K5UA 3R6XA 3BYMA 4O21A 4MH7A 4EOIA 2J5EA 1Q8TA 2EXCX 4J99A 2QU5A 4GK2A 4C2VA 4DG0E 2RFSA 3O8UA 3K3JA 3EFKA 3ORIA 3IOKA 3R8UA 4F9BA 4FNZA 2WMSA 3C13A 3FDNA 4QP4A 4M14A 4C4GA 5K4JA 3PLSA 2ERKA 3RWQA 3B8RA 3TXOA 4TW9A 4IJPA 4J97A 4DEAA 5LXMA 3ULIA 2IZSA 3DK6A 3IW4A 5HVKA 1BL7A 2BRNA 4USEA 3OC1A 3IO7A 3TKHA 3PRIA 4O7ZA 2OU7A 3CBLA 3TT0A 3DAEA 4FTKA 3KXXA 2YABA 5GZAA 5HNGA 3DXPA 5AEPA 1ERKA 2CKPA 2XKFA 4YU2A 3DKFA 4OTFA 2PU8A 4KWPA 3ET7A 4IHPA 1Q3WA 3HNGA 3I7BA 3KGAA 3M11A 4FTUA 4M12A 5I0BA 3IOPA 5A54A 5DG5A 4ZSLA 3NW5A 4AA4A 3FKNA 4XP3A 3GCPA 3D5XA 3NR9A 4X2GA 4UZHA 2F4JA 4RQVA 3JR1A 5HESA 1W84A 1H1QA 2JKOA 3RBWA 2J6MA 3NUAA 3FQHA 3VUHA 4QPMA 1U54A 2WMVA 2FSTX 2C0IA 3P5KA 3VW8A 2QOFA 4Q5EA 1OB3A 4J8MA 4JOAA 2ITWA 2J7TA 5EM6A 2WOTA 4KSQA 4Y46A 4OBQA 1Y8GA 3CCNA 3ZFYA 2PYWA 2G2FA 1PJKA 3LFAA 3CTHA 3MB6A 4QNAA 3PXQA 4EHZA 4FG8A 1CKJA 3QTRA 4I3ZA 4BBFA 4DGOA 2GTNA 3F9NA 3GU5A 3SAYA 4QTDA 3V5JA 1U46A 3PE1A 4A07A 4JR3A 3CC6A 4F1TA 4YBKA 2Z7SA 4RT7A 4FKIA 4DGNA 4NWMA 4YUQA 5KBQA 4MNEB 3FI3A 2WAJA 1Q97A 2XF0A 2FGIA 2UZWE 4DA5A 4ANQA 1PMVA 4YPDA 3VAPA 3NVMB 3RHXA 3LMGA 3W2RA 2B9IA 1XBAA 3UZTA 4CNHA 1YHSA 2XZSA 4I5CA 4N6YA 3FLSA 4XOYA 3HECA 5BNJA 4I4FA 5IA3A 2QHNA 3HMOA 4D4RA 4HVDA 4YJPA 5HLNA 3GCQA 3FLZA 2GU8A 5EI6A 1JVPP 3IONA 3UIXA 3QCSA 3ZLXA 5LVNA 1WFCA 4RZVA 3HYHA 4JDKA 4X3FA 4FSWA 4O0VA 3WE4A 3BGPA 3FSKA 3L9LA 3O8PA 5E8YA 5ETIA 1JKSA 5L3AA 4O7YA 2YEXA 2XM9A 3BBWA 3MJ2A 3S4QA 4AOTA 2O5KA 3PP0A 4IWQA 4TNDA 5L8LA 1LPUA 4HGLA 4PNKA 3KVWA 4BDBA 3ZONA 1MUOA 1J1CA 4CQEA 4Q9ZA 3UGCA 3PZHA 2WQMA 5IEVA 3PXZA 4JI9A 4AZEA 4NK9A 3W2PA 3MIAA 2RKUA 4HNIA 4WNKA 2UZUE 4ENYA 1VYWA 2FA2A 2ETMA 3AD6A 4NIFA 4CTBA 4CSVA 4UZDA 2XNNA 1KUTA 2WIPA 2GNFA 4EK3A 3GXLA 3EFWA 4CFXA 3UNJA 2YAKA 3DOGA 4R7IA 2C1AA 4W8DA 4XG2A 3H9RA 2OLCA 4ACCA 1KOAA 3PZEA 4EJ7A 2H8HA 2J0IA 3LFDA 2XKCA 1IRKA 3F7ZA 3JVRA 2NP8A 2VTAA 4B4LA 4ZJVA 1ND4A 3JXWA 4XJ0A 1CMKE 2NO3A 3Q2MA 4FG9A 2WMWA 3W8LA 2P2IA 4YSMA 4Z7HA 3R9HA 2YIYA 3UOJA 2W4JA 3CS9A 4IVAA 4LRKA 4WUAA 3WZKA 4F09A 3RJCA 3FZ1A 3PTGA 3RPRA 5M08A 5CSHA 4OR5A 3PA4A 4YZCA 3DBCA 3HDNA 2YZAA 3DKCA 3G9NA 3VUKA 2HENA 2X6DA 3EQBA 2WU7A 1A06A 3OWPA 4PL4A 4QMVA 3SHEA 5JEBA 4IH8A 5CASA 1O9UA 5A4LA 5AR7A 1F3MC 2QOHA 2JLDA 4RWKA 3SG8A 5CAPA 3UO6A 4IAAA 5CLPA 3AGLA 3VRYA 3OY1A 2GNLA 3GOPA 3F3WA 2WTWA 4IWPA 5B2MA 4BDDA 4H3QA 1PMUA 3EMGA 2H96A 1WVXA 5IQIA 3VBQA 3KVXA 2ZV8A 2WPAA 4NCTA 4H1MA 4PDPA 3KQ7A 3FMNA 3TUCA 3EN6A 1Q24A 2P55A 5G6VA 4ZSAA 3VO3A 3UZRA 3BEGA 2BTSA 3E8NA 2OG8A 4IMYA 4YO4A 3WARA 4F7LA 5AP7A 4XUFA 3TZ8A 5TKDA 3G2FA 5JGDA 4NL0A 4ZSEA 5ANEA 4DEIA 3N4VA 3UVPA 3A7FA 3OFMA 2IW9A 1PYEA 2WB8A 4QMNA 4QQJA 4MYGA 3EYHA 3GQLA 3R8VA 5FG8A 4M97A 3FZTA 2BDFA 2PL0A 2WTDA 4YJOA 4L53A 3WIKA 2XVDA 1MQBA 3IGOA 4BIDA 4CZYB 4D5KA 1R39A 5J79A 2F9GA 2V0DA 4RC3A 2OXXA 4GEOA 5FD2A 1GOLA 5GIOE 4NYEA 4R78A 1SVGA 4KBKA 4ERKA 3NVKI 4FOCA 4C3FA 4DFXE 4K2RA 5BPYA 4EJNA 4G31A 3WZEA 5AMNA 4EZ5A 4ZMFA 4MXAA 4WG5A 3CY2A 4TYJA 1L3RE 4ZP5A 4WRSA 5IZFA 5CSXA 2PVYA 1W82A 3R01A 3LKMA 5ITAA 5A4TA 2QURA 1OI9A 2CMWA 4JLCA 4XLIA 1JKKA 3VS4A 3LIJA 4FGRA 4E20A 3OW3A 1E1XA 1FVTA 4LQMA 4P90A 3W55A 4JDJA 3AC4A 2CJMA 5AV3A 3VWAA 3ZFXA 3E3PA 1Q4LA 3LQ5A 4FR4A 3ORXA 2JITA 4R3CA 2LGCA 4F9AA 5CSPA 3QXOA 4FVQA 4EONA 4OT5A 3AC1A 1W0XC 3MWUA 5HD7A 2BCJA 3OP5A 3ZFMA 2I7QA 2PZRA 2J51A 1OL6A 4PUZA 4QD6A 5DHJA 4QTAA 2XNPA 5ANIA 4I93A 1VJYA 3W18A 4D5HA 3UNKA 4FSMA 3R7IA 4FEWA 5KBRA 2YISA 3AD4A 2C6EA 3G6HA 4CCUA 2X4FA 4FZ6A 4FI1A 2ESMA 5IQGA 2CKOA 5DIAA 5AV4A 5HU9A 3TEIA 2VTJA 2XJ1A 3C50A 3QZIA 4PRJA 4GMYA 3VF9A 3SX9A 4F6UA 1Q8UA 1Y6AA 2BIKB 3O17A 5AP1A 2BZIB 3TIYA 2I0YA 2R3NA 3ROCA 4FKRA 4LFIA 3NUXA 4CYJA 2BZKB 3ELJA 4BVUA 2R3QA 3CD3A 3TDWA 3REPA 2GSFA 3E8DA 4QMZA 3EL7A 2UUEA 3FLNC 3GFEA 3PG3A 4PMTA 4MF0A 4RJ6A 3UQGA 4DH1A 4DN5A 2PUIA 5BYLA 4YLJA 1H0WA 3N4TA 2YAAA 3FLYA 4AN3A 1JQHA 2XIZA 2VO6A 1UV5A 3OXTA 3LM5A 5A46A 5C8KA 2C6MA 2X6EA 2CN8A 4M84A 3ZYAA 3RPVA 3UPZA 3CR0A 3QKKA 4DH5A 4M66A 1I09A 4BWXA 3SDJA 4EHVA 1E1VA 5KCVA 4ZAUA 1V1KA 3E8CA 2UW4A 4DYMA 4MKCA 1GNGA 3UTOA 2QONA 3OY3A 3DTWA 5EYMA 5CAQA 3KFAA 4F9WA 1H4LA 1H26A 2OGVA 2OZOA 3MFUA 4QO9A 5D12A 2ITNA 4IAFA 4OTWA 3E88A 2R64A 4H39A 2PUPA 3ETAA 4FKVA 1OKYA 1H24A 3GC9A 3OW4A 2IZUA 3S00A 4E4XA 4UALA 2V7AA 4R3PA 4GIIA 3OXIA 4K1BA 4TWCA 5K0KA 1JKLA 5DR2A 3NMUF 3VQHA 4HYSA 3BHVA 1OKVA 5DR9A 4JX7A 3BELA 3HGKA 2VTMA 4GFGA 4DHFA 3BPRA 3R30A 4PX6A 4ANLA 3Q6UA 4HYHA 3ZOSA 3FKLA 1YI6A 2Z7QA 4LGGA 3TJDA 4ITIA 4KSPA 3QHWA 2C3JA 4L3JA 4M8TA 3V04A 3VS0A 2QO2A 3ANQA 4D2SA 3CTJA 2GMXA 4MXXA 4P7EA 5LCKA 2HW6A 4L67A 3S2PA 2B1PA 4IM2A 4U8ZA 3QCXA 3W10A 4G6LA 4YC6A 4Q9SA 2RFNA 4RX8A 1WBVA 3R9OA 2C47A 1J91A 2YCFA 3FPMA 5C27A 3FQSA 3DGKA 4GS6A 1CKIA 1W83A 2CPKE 2YDJA 1FQ1B 2J9MA 1URWA 4H3BA 3R7UA 3NYNA 4X3JA 4XG9A 3UIUA 3F7WA 3EKNA 2KULA 2IVUA 3ACKA 2VU3A 5HU3A 5DLSA 2C3KA 3FMJA 1BI7A 3PSBA 2WD1A 2KTYA 4K0YA 2ZMCA 3DJ5A 4LI5A 4PL3A 4XV1A 2F2UA 3FV8A 3FXWA 4Y5QA 4MXZA 4XYFA 4EK4A 4K77A 4OTRA 1QPCA 2HZIA 3F5XA 4CTCA 4S31A 1NVQA 3LFEA 2C5VA 4WSYA 3ZUUA 3CQEA 4MWHA 5AA9A 4LMUA 2WO6A 4BCNA 4AZSA 4CVAA 2EU9A 1G3NA 3DFCB 2OZAB 1S9JA 2JAVA 4QYYA 3NUUA 2J50A 4IX4A 2R7IA 4CKRA 5KKRB 1ZYJA 3AMYA 3F3VA 1WVWA 4O0RA 3FSFA 3WF5A 1UNHA 4HVSA 3G15A 4IQ6A 4R8QA 3VW6A 2Z02A 4BDIA 5H9BA 2R4BA 3PG1A 4BCHA 4DLIA 4UY9A 2P3GX 4LGDA 2JIUA 2OICA 2R3HA 4DBXA 1O6KA 1Q8YA 3FPQA 2OJIA 3PUPA 4GL9A 3KXNA 5HICA 4ZJJA 5C9CA 3QGYA 5F20A 3R28A 3UC3A 1NVSA 3QD2B 3RI1A 3IQ7A 4MBLA 3SW4A 2HAKA 4DT9A 3NPCA 4G17A 5D1JA 2G15A 1LP4A 1FVRA 5I9ZA 4OAUC 5TE0A 2HK5A 4PTEA 2AC3A 5IMEA 4F63A 5AM7A 4BC6A 3C5UA 1TKIA 3CEKA 3FMEA 4QRCA 5ANDA 5FEDA 1WBSA 1PKGA 2CDZA 5FRIA 5EHYA 3TKUA 3C1XA 3K2LA 4LOOA 4ENXA 3HUCA 1PXJA 3CPBA 4RVKA 4H05A 4CKIA 4RA5A 3OTVA 3C4CA 2WNTA 3CKWA 3K3IA 3Q53A 4FZAB 1SM2A 4GG7A 3E5AA 5FTQA 4EHEA 2W7XA 5J8IA 5HE1A 2XKDA 3HA8A 3R8LA 3PFQA 3LFFA 4HYUA 4LMNA 4DEEA 5M4CA 5M06A 3C4FA 4BDJA 4GKHA 2W96B 4I0TA 1YQJA 5LMBA 4BCKA 1ZARA 5C1QB 5CALA 4FODA 4TN6A 4EOKA 4L42A 3EKKA 2OO8X 3WF8A 3GP0A 4NU1A 2PE0A 1OL2A 1XH9A 2Y9QA 3BYSA 3WF6A 5LOHA 5HD4A 5FWKK 1H0VA 2EXMA 4YSJA 2Z2WA 2PVHA 5HIEA 3UG1A 4MF1A 3PY1A 4BICA 5IISA 5EQYA 2HOGA 5E8XA 3THBA 4FTMA 2PZPA 2PHKA 2JBPA 3IG7A 3VS3A 4AN2A 2VO3A 1YHVA 1OPKA 5ICPA 4U3YA 3F61A 3R71A 4F70A 5ETCA 2QR8A 4IZYA 4IM0A 4LM5A 1J7LA 3V6RA 4E6CA 2ZJWA 3IDCA 2RFDA 4FSRA 4YP8A 3BHYA 1IAHA 4O7NA 4LG4A 3WF9A 5I4NA 3BZ3A 3C5IA 2XK9A 4O38A 3W1FA 1NW1A 2CNQA 4C37A 3CXWA 4BTJA 4C38A 4F7SA 3SXFA 3TI1A 5DPVA 2GQRA 2Y4IC 5FDPA 4EYMA 3PP1A 4YZMA 4BKJA 1E9HA 4TYHB 4KKHA 3RZFA 5CX9A 1UKHA 3MI9A 2YM8A 4GUEA 2QLQA 4I23A 4RWJA 5AJQA 5L2QA 3WF7A 2A2AA 2B52A 4AGUA 4FKQA 5J87A 5KHWA 4IC7A 3IW6A 5IQDA 3FHIA 1ZXEA 3LOKA 3CTQA 5CVFA 3PY0A 3TUBA 4AW1A 2CKQA 1TQIA 3Q6WA 2C6DA 4FV2A 2J2IB 5GJDA 1H1RA 2QD9A 4D4VA 1ZAOA 5F94A 3AG9A 3LCDA 3U87A 4WNOA 3R8PA 2VV9A 3G5DA 5IH5A 4L68A 2PULA 2YIXA 5CT0A 1Y8YA 1M14A 4KBAA 3Q9ZA 3WZDA 2IG7A 5HE2A 1BYGA 4L6QA 2QCSA 4FNWA 4AT3A 4DFZE 3KREA 4B9DA 3KULB 4JVGA 4M3QA 2OFVA 1F0QA 3ORMA 2CGVA 5AIKA 5F9EA 2J5FA 2YWVA 5EQPA 3FMMA 2A27A 3P1AA 3RK7A 4IZ5A 3MTLA 2CGUA 2REIA 1PHKA 1KOBA 2XK3A 5L4QA 4I6HA 4ASZA 3QHRA 3R1NA 2JIVA 1MQ4A 4GW8A 4AOIA 2R3KA 2YCRA 4P5ZA 2P2HA 3MB7A 3RGFA 3F3UA 2C3LA 2VN9A 4BCFA 3KMMA 3DLSA 3GCUA 4D4YA 1R0EA 2R2PA 2R3RA 2X8DA 3C9WA 4JG7A 4U40A 3EQRA 4MQ1A 4Z16A 5I9WA 4WBOA 4QYGA 5L8KA 3EN9A 4TXCA 5E8UA 5CSWA 5FEQA 3SXSA 3WZJA 1SZMA 4DEHA 2JIIA 3L9PA 4I92A 3LHJA 3UZPA 5AP3A 4HCTA 2RGPA 3I5ZA 4M0ZA 5CEOA 1WBTA 3Q04A 5EOBA 3PSCA 4WOVA 4E6AA 3EH9A 4EQMA 3DK3A 4RC2A 2C6KA 2UZLA 4GT3A 3FL4A 3QZHA 5FXSA 5M4UA 1RW8A 5IQHA 3UP7A 4IAZA 4XV9A 3TM0A 3FL5A 4QQCA 2R5TA 1UNGA 2CN5A 3LW0A 1IA9A 3ZEWA 5CY3A 4BWPA 2ACXA 1P4FA 3DZQA 4YTIA 2ONLC 1GAGA 4ZOGA 4DH3A 5DEYA 3QTQA 3ZRMA 3I4BA 3KRXA 4I5HA 2W0JA 2QVSE 1FGKA 4S32A 3VS5A 2VNWA 4AW2A 2W5BA 5HCZA 4YMJA 4XMOA 1MRYA 4C4EA 4FTRA 4EH5A 3MIYA 2YIRA 5IA5A 4YR8A 3GB2A 2LAVA 3D14A 3QRTA 4C61A 4J95A 3ZUTA 1REJA 1SMHA 1XH8A 1YXSA 1UWHA 1ZMUA 3DBFA 4DG3E 3CY3A 5IH4A 2GHGA 2WMRA 4JL9A 3U54A 3QQFA 3HRCA 5FUTA 5CT7A 5DH3A 3RKBA 4RLKA 1ZLTA 1ZWSA 2B54A 4TPTA 4ZIMA 3RCJA 3V5PA 4BI1A 3F5PA 4DFYA 3DS6A 2X2KA 4TNBA 5KZIA 4B0GA 3KXMA 3U51A 4MK0A 4HGTA 4XX9A 3ALNA 1M2QA 4X21A 5IQFA 3PJ3A 4BCPA 5JQ5A 5HVJA 2HXQA 4D58A 4FG7A 4CYIA 3V5TA 5LMKA 2GHMA 3LCOA 3D2IA 3GU8A 4N4SA 2ZYBA 3JS2A 3KK9A 4JNWA 4PPBA 4KS7A 4PMPA 4BKYA 3OTUA 4JIAA 3T8OA 3BCEA 3ORNA 4G3CA 4TTHB 4GKIA 4KKEA 4BZDA 5JZJA 3EYGA 2AC5A 2X4ZA 3PYYA 3Q4CA 4RG0A 4RVMA 3LAUA 3SW7A 5LVOA 2NRUA 3NIZA 5E8SA 3TUDA 4XRLA 2HWOA 3TKIA 1M52A 4D4SA 1EH4A 4UYAA 3NSZA 4EBWA 3ACJA 3TZ7A 3AC5A 4ALUA 4BDAA 4D9UA 3ZS5A 4M13A 1RE8A 2G01A 3ANRA 3E3BX 5CQWA 3GENA 4L3PA 2VAGA 4DFBA 2X9EA 4O83A 4GT4A 3R73A 3MVMA 5C26A 2I0EA 4LOQA 3BHTA 3MH2A 4RGJA 5EI8A 3SVVA 5HORA 4BHZA 2OK1A 2IW8A 4BCGA 5BVDA 4LRMA 4WBBB 3QQGA 4OBPA 1XO2B 4F0GA 4NKAA 3HDMA 4CXAA 4DT8A 3EQFA 5BYZA 4CG8A 5EM7A 4Y72A 2PVKA 3V51A 3BIZA 3DXQA 3R83A 2YJRA 4R5YA 2WHBA 3W2OA 2XNBA 3QTUA 2YHVA 5FBNC 5KMMA 4YHFA 5K0XA 2Z7RA 3RPYA 3MS9A 4EH9A 2ZV2A 1Z57A 2HZ4A 4NT4A 1JOWB 5EW8A 3TZMA 4JBQA 4U3ZA 5HCXA 3QQKA 3A7IA 4U44A 3I0QA 4O2ZA 3RK5A 3O51A 4FSUA 4C7TA 3UYSA 3I81A 5HX6A 4QPSA 2QOBA 4O7WA 5C01A 3WILA 3LFNA 3MSSA 4UMQA 5J7HA 5E8ZA 3HEGA 4BDFA 3KULA 1R1WA 4YJSA 4UX9A 4C02A 3F88A 4TWNA 3VF8A 5HTIA 3HZTA 2IZRA 3LE6A 2WTKB 4FYNA 3IW7A 3GC8A 3LJ1A 4FV1A 2OWBA 5KHXA 2WEVA 4PV0A 4A9UA 3FLWA 5IA0A 3Q96A 4MAOA 2PVJA 4ERWA 3F66A 3MPAA 3ATSA 4CZTA 3VHKA 4ASXA 2G9XA 3KRLA 5AADA 3AT3A 3D2KA 4XG7A 3DB6A 3R2BA 4ZLZA 1ZMVA 2C3IB 4FT3A 5JRSA 4D0XA 5HTBA 4DE4A 5ANKA 1O6YA 2VNYA 4ZTNA 3PE2A 3W2SA 2BMCA 5AUVA 4QYFA 4X0MA 5AUWA 2VTSA 2XMYA 4TWPA 4EHGA 4FIFA 2C30A 3WBLA 3DZOA 2Y4IB 4D2VA 4JIKA 3BV3A 3H0YA 5T68A 4V0GB 2Y8OA 3D4QA 4NH1A 2ZAZA 4V05A 2C68A 5F1ZA 2FSLX 3LJ0A 4I5PA 2PSQA 4PMMA 2WTCA 5M44A 5DE2A 4FTQA 4O7TA 4IFGA 2OKRA 5LARA 4FNYA 1H28A 2BRHA 4KIKB 5TF9A 2ZVAA 4FV9A 3SLSA 3GBZA 4FA2A 3L8VA 1P2AA 2GCDA 4FC0A 5FXQA 1OL1A 2RSVA 3A2CA 3KMWA 2W9ZB 3JY9A 3ZSGA 2VGOA 4FKLA 3OWJA 1U5QA 4JXFA 2YIQA 3HMMA 5DA3A 5AUXA 3U4UA 2QOOA 2UVXA 4G9CA 3A7HA 4N6ZA 4ITJA 4EH7A 5A9UA 4G3EA 5CEQA 5L2TA 3NNXA 3PA5A 4FKJA 4OGRA 5CEIA 4F08A 5AR3A 3R7OA 4TYIA 2XK6A 3UQFA 2YZLA 4DGMA 5IQBA 4O2PA 5DNRA 2QOKA 3S1HA 2XIYA 2XYUA 4R5SA 3R1SA 4KNBA 5CU4A 5EKOA 4EZ3A 1W7HA 2PZ5A 1H08A 1PF8A 4D2WA 1IASA 2ITQA 2QU6A 5ANJA 4L7FA 1GZOA 1WVYA 1OM1A 2YACA 1NVRA 5AR4A 4ZTHA 1BI8A 1UA2A 2QOCA 2C6IA 4FL2A 2JFMA 1B38A 4EI4A 2JKKA 4M68A 3EQDA 4XG4A 4AE9A 3F2RA 2O8YA 4AACA 2J0JA 5HNIX 4NTTA 4O0XA 4DEGA 4YURA 4FMQA 4RLLA 3ITZA 1XH5A 4U45A 3QCYA 4NFMA 2QOQA 3LVPA 5ANGA 2XBJA 3U6HA 4D2PA 3NAYA 3HRFA 5IA1A 5LQFA 4NM5A 2YFXA 4NM0A 4FT5A 5K9IA 2PUUA 4IXPA 2C5NA 3TV7A 2XIKA 4I4EA 1XBCA 4W4WA 4LUDA 3FMDA 4PNIA 4YTHA 3GQIA 4XBRA 4YC3A 4QQTA 2AUHA 2Q0NA 2Y0AA 1WBNA 3A7JA 3TJCA 4E93A 4ORKA 5M09A 3KRJA 5H3QA 4C4HA 4JBPA 4UWBA 5GNKA 3PJCA 3CJGA 4FTCA 2VTIA 3TTJA 4ZY4A 4TRLA 3TV6A 2VTHA
chains in the Genus database with same CATH superfamily
4GIHA 5IEYA 3KRWA 3R22A 5A4QA 2GS7A 2VX3A 3VUMA 5A4EA 5BVEA 1X8BA 4WG4A 2WKMA 4MTAA 2QLUA 5ANOA 3DA6A 5HG9A 3RVGA 3UDZA 1YXVA 2OF4A 3B2WA 5GZ8A 2GNGA 4YZNA 1FVVA 4YJNA 4RJ8A 4BDCA 3RCDA 3ZSHA 4O0TA 4U80A 4CT2A 4I20A 2JGZA 1J3HA 2O2UA 2XRWA 4QP6A 3V8SA 2ZOQA 4AFJA 3RMFA 5M07A 3QQJA 5TR6A 5LVMA 3PJ1A 1H1WA 5KE0A 2ITXA 4BIBA 1J1BA 4YHTA 2UW9A 3DK7A 5DGZA 2WQOA 2O63A 3NUSA 1OKWA 1TQMA 4QQ5A 4RFYA 4J96A 3ZZWA 4FZFB 4KS8A 2PMLX 4FSZA 4TZRA 3TG1A 4NUSA 2J90A 2A19B 4GU9A 2C5OA 3OZ6A 2JBOA 4MXYA 3R0TA 2V7OA 3E63A 1M2RA 5JN2A 3UG2A 4KD1A 4J53A 4FEXA 1APME 3BQCA 4A7CA 5KMIA 4O4CA 3MH1A 3Q4TA 3LMIA 4O4DA 4ANBA 2OI4X 2YLFA 4IADA 3PIZA 2YN8A 2XM8A 5I5ZA 3E64A 5F95A 4QMUA 2WMTA 2WXVA 4MNEA 4AXCA 4Y5HA 4AP7A 2GHLA 4F0IA 5EDRA 5EYKA 3EQHA 4Y73A 3COIA 2V55A 4IM3A 1JPAA 2QHMA 4XG3A 3EQGA 1VYZA 2OJ9A 4JDIA 2ITUA 4EQUA 4MVFA 4B6LA 1OIYA 4C4FA 3CSVA 4FL1A 1L8TA 4U79A 3DFAA 4AW0A 3Q4UA 3UVQA 4YTFA 2R7BA 3KC3A 4YJVA 5L2WA 5CU3A 5KMJA 4V0GA 4FKOA 2QC6A 2AYPA 3D94A 4O6LA 4HNFA 3VJOA 3BYVA 1ZYSA 2CNVA 3ZO1A 2YDIA 3KL8A 5D10A 5FGKA 1R78A 1Q62A 4BZOA 4NSTA 4APPA 4QTCA 5EI2A 3E7OA 3BKBA 3FZPA 5AAGA 1I44A 3KXZA 3LQ8A 3QWJA 5JKGA 2ZDUA 3IKAA 4K6ZA 4QMYA 4EH4A 3BU3A 3A8XA 3RM6A 5K4IA 4FKTA 2EWAA 3PPKA 3QX2A 5E1SA 2BHEA 1YWNA 3NCZA 1ZYLA 4DINA 2IPXA 4O0WA 1H27A 2HELA 4BCOA 5IU2A 4XLVA 4D2RA 4GG5A 5A6OA 3QCQA 3BHHA 1GZ8A 3U6IA 4FKGA 4F9CA 4FZ7A 1H25A 4IB0A 4JBVA 2HWPA 4C58A 4MXCA 1JNKA 4CFVA 3LXNA 3TCPA 1YRPA 3NUPA 4UYNA 5J9LA 2F7EE 5CZHA 3Q3BA 5H8BA 3WE8A 4I6QA 4U9AA 3EL8A 5AUZA 4QMOA 5J1WA 1CDKA 4ZTSA 5C03A 1OL7A 2OFUA 3DDQA 1SVEA 3OHTA 4KINA 5HG7A 4BCIA 3GC0A 4CRLA 5BVWA 4AOJA 2R3JA 5EM8A 4CMUA 4EK6A 5EQEA 4OBOA 4BBEA 2FSOX 5HO7A 3KB7A 1P14A 4RBLA 4IAIA 2BDJA 4AA0A 1OUKA 3RPOA 2UW8A 3SG9A 3ORZA 3M2WA 2YCSA 5HIBA 1KWPA 4DITA 3FMHA 2W4OA 3NYOA 4Y8DA 3NFFB 1OUYA 3RAWA 5HZNA 3OWLA 5DYJA 1W2FA 3HV3A 2ZV9A 4ZJIA 4QTEA 2H9VA 1IG1A 3AKLA 3ZM4A 1PKDA 2JAMA 4UXLA 3FBVA 2G2IA 3C7QA 3AQVA 2R3MA 4L00A 1U5RA 1YWVA 3NS9A 1KSWA 3CKXA 3RWPA 4QP1A 5F4NA 4J52A 4O22A 1QMZA 3ATTA 5AWMA 1OIQA 3QBNA 3W16A 2BRBA 3D7TB 4IBMA 4ACMA 2BHHA 2QI8A 3I0OA 5HBHA 2PUNA 3V6SA 5FQDC 2W1IA 3ZCLA 3FKOA 5JK3A 3IECA 2X0OA 2FUMA 3FMLA 1WAKA 4IZAA 5D7VA 3ZEPA 3O5AA 3O23A 1QPDA 2VWVA 3R7GA 4QOXA 4HZSA 4L52A 5FTGA 4O86A 2XUUA 4QTBA 1Z5MA 3VBYA 5IQCA 3BRBA 4F4PA 4E4LA 2IN6A 2YM4A 5EM5A 3FZSA 3W32A 4GJ2A 4BGQA 1QPEA 5D11A 1F5QA 4W4YA 2UVYA 1WBWA 3GOKA 3L9MA 3QGWA 4NKSA 3RP9A 2NNWB 4Y83A 4LUEA 4O7RA 3KMUA 4MX9A 4YO6A 4GK3A 3DLZA 4NJDA 5D9HA 1IAJA 4X3FC 4J1RA 5AR2A 5I9YA 5A4CA 1H8FA 4IX5A 4MBIA 4IFCA 4A9RA 4R6VA 1H1SA 3FY0A 4AAAA 2GFCA 4BBMA 5I9VA 5BYYA 4I6BA 3ZM9A 3NUNA 4ITHA 3BWFA 4DAWA 5E1EA 2WTJA 4FSQA 4KABA 2CGXA 4U6RA 5CU6A 5H8GA 3I7CA 4ALWA 2ZB1A 3LFSA 4CFFA 4DG2E 5A14A 5AV0A 2GNHA 1OPLA 3BV2A 5DRBA 3QUDA 4DEDA 3OCGA 2VTLA 2W5HA 4BHNA 4L8MA 3C4XA 3TNWA 3OUNB 4ZTQA 1VLRA 4EH6A 1Y6BA 3BI6A 3COKA 4OTQA 3D7ZA 3QLFA 3UIMA 3EHAA 4X2JA 4ZLOA 2X81A 2XANA 1JLUE 4KA3A 4KIQA 4OAVB 3WI6A 4BCJA 3TN8A 3EZRA 3SOCA 4IJ9A 3COMA 5I9UA 4C4IA 4QNYA 4FGBA 4CG9A 2W17A 4MCVA 4R77A 3OVVA 3HV7A 4FV6A 4QMQA 2P33A 3SC1A 5GZ9A 3RNYA 3NIEA 3CJFA 2UV2A 4X6QC 3JUHA 4DFLA 3FYJX 3QKMA 3VUIA 3POOA 2BPMA 3MPTA 1JWHA 1XH4A 1YOJA 1M7NA 2WQNA 3POZA 4TYGA 3TIZA 3UC4A 3ZXTA 4I24A 4OW8A 1HCLA 2OF2A 1S9IA 5CF5A 4IZ7A 1FGIA 4JQ8A 2BIYA 3GVUA 3BU6A 4BI2A 5M56A 5M53A 3HMNA 3O7LB 4B8LA 1YDTE 4PPAA 3E92A 4K18A 2E9VA 4X2FA 1LR4A 3D5VA 2R3OA 3PDTA 4U81A 5IUIA 3FE3A 3TZ9A 3KK8A 2RG6A 2BR1A 3DPKA 3P0MA 2PMIA 2XJ2A 4JQ7A 4RIWB 3U8WA 5DI1A 4E6DA 2I0HA 3CD8A 2WTVA 4JAJA 4CFNA 4D9TA 4YLLA 3VS1A 4UBAA 3F6XA 4EWQA 5AX9A 4IAYA 3OOGA 2GQSA 2P0CA 3GEQA 1OGUA 4RFMA 3LQ3A 4ZXTA 4DGLC 4FYOA 4IDVA 3DAKA 4C57A 4UEUA 3CGFA 1XKKA 4FUYA 4AE6A 3PA3A 2C6OA 2IEWA 4RJ4A 4BN1A 3EQCA 3I60A 3AKKA 1ST4A 3C51A 5HTCA 3BLQA 3OEFX 4K11A 3HX4A 4E5AX 2RIOA 3LZBA 4M0YA 2OIDA 4PMSA 2QKWB 5DBXA 4AT4A 5AUUA 4BJJB 3NAXA 3KXGA 3MH3A 4XEYA 3SKCA 3LXKA 4PQNA 2OIBA 4A4LA 3PRFA 4E3CA 1UVRA 3BX5A 3LFBA 1WZYA 2BAJA 2OXDA 2QOIA 3VRZA 1OVEA 4KIOA 4NTSA 2UZOA 1G8SA 1ATPE 2RFEA 3KF7A 4HPTE 4A9SA 4BGGA 5LVLA 4GVJA 4IB5A 4F65A 5AX3A 4IWDA 3F5GA 4WO5A 5IUGA 5BMMA 1QPJA 3G0FA 4I0RA 1GZKA 2F57A 4W4VA 2GDOA 3QYWA 2F49A 5HO6A 4K8AA 3UMWA 3UP2A 3KKVA 3VBWA 4O4FA 2FYSA 3VN9A 1H1PA 3CPCA 2XRUA 3FI2A 1B6CB 4ZSJA 4C3RA 5HGIA 5E9EA 2XK4A 3N9XA 2OIQA 4ZTRA 2ITVA 3V3VA 3D7TA 3LCTA 5KNJA 4AS0A 5BUIA 3UBDA 5CYIA 5JGBA 5AP2A 3NW6A 3W0MA 2GNJA 4AT5A 2GPHA 3OCTA 4YJQA 2OJJA 4P4CA 1YWRA 5EW9A 2X8EA 3RAIA 4JBOA 3ZLWA 3GCVA 3AXWA 4XBUA 4HYIA 3DB8A 4AGCA 3VNTA 4I22A 4JAIA 3KXHA 4QMWA 3BQRA 2BKZA 3QRKA 4DCAA 3SRVB 1OIRA 4FEVA 3IPHA 4XP0A 4CT1A 1YW2A 4E73A 3LMHA 3GCSA 4AXAA 4CV9A 4QMTA 1MRVA 3P4KA 4BTMA 3DQXA 3ZC6A 3C4WA 4RJ5A 4ONAA 2UZVA 2DQ7X 4FV8A 2YJSA 4ID7A 4FBXA 3T9IA 1JSTA 1M7QA 1YKRA 5L8JA 4EOLA 3DBDA 3OWKA 3MBLA 5EG3A 1K9AA 4FTLA 4JT3A 4A06A 4DF3A 4HZRA 4R1VA 2XK8A 3OBGA 4FT9A 4ANSA 2RG5A 3GNIB 3CP9A 3WOWA 4C62A 1OBDA 2XNOA 4EUTA 4IEBA 3AT2A 4AZFA 3L8PA 5EDPA 3KU2A 4HVHA 4CD0A 1U54B 2WU6A 4APCA 1OECA 3OG7A 5A6NA 1FMKA 4YGAA 4BFMA 4L9IA 4O96A 5HQ0A 5KUPA 3BLHA 3L9NA 4J8NA 3H4JA 4GV1A 5FP5A 5EW3A 4YJRA 3O0GA 2OZAA 3ODYX 3UVRA 4D0WA 4FL3A 5CNNA 5M51A 4O27B 4GYGA 2VTNA 2XNMA 4DH7A 5KMLA 3OS3A 2VTTA 3LJ2A 4GH2A 1ZOGA 3QYZA 4EUUA 1U4DA 3F3TA 5FEEA 4ZY6A 3TNQB 3LM0A 4J7BA 3UOHA 4XHKB 4QMLA 3PVBA 2HW7A 3QZGA 5HE3A 4JRNA 1M2PA 3ZSIA 4U43A 4YNEA 5J1VA 4NW5A 5FM2A 3P79A 5B2KA 4W8EA 3OUKA 1WBPA 1DI8A 3VIDA 3A60A 4J98A 2XYNA 4WNPA 5CENA 3GU4A 2BFXA 2UW6A 2C6LA 4PTCA 5AP4A 3LXLA 4GYIA 4ALVA 3CLYA 1XH6A 3BWJA 1W8CA 2VWWA 4IB1A 4KB8A 4V01A 2V62A 1NY3A 4QDVA 3C0GA 2W1GA 4RIXB 2YITA 3MY5A 1WBOA 1Z9XA 1IR3A 4QMMA 4RA4A 5C4KA 2X7FA 5ACBC 5K3YA 3DTCA 4FK6A 1G8KA 2E9NA 1OKZA 4XRJA 3UIBA 1G5SA 2JEDA 3FC1X 3O7LD 3FEGA 4QP3A 4JR7A 4FEQA 4DEBA 4XOZA 2CGWA 2W9FB 5LWMA 2CNUA 5B2LA 5HIDA 4LOPA 1YI4A 3DKOA 4RMZA 5IUHA 4EOMA 4H3PA 4V04A 1QCFA 5TO8A 3RZBA 4HOKA 2XALA 4I6LA 3MV5A 5AAFA 1KE9A 4A9YA 3QAME 4CKJA 4JRVA 3MYGA 5CEPA 3Q5ZA 3Q2JA 4ZMEA 4RC4A 2B53A 3DT1A 2HXLA 3R00A 3MFSA 2E9PA 5HO8A 1AGWA 4R3RA 4BJJA 5FDXA 5A3XA 1RJBA 2WELA 3EN5A 2CKEA 1B39A 4Y85A 2NYAA 3T3UA 1JBPE 4II5A 5CS6A 5EHOA 4RVTA 4USDA 2GS2A 2VRXA 4FOBA 3BEAA 4LV8A 4E1ZA 2C0TA 3E93A 4PDSA 3DKGA 2XJ0A 4F6WA 3EB0A 3QQHA 5I3RA 1CKPA 2IWIA 2XCKA 3FUPA 2ITTA 4BDEA 2PVNA 3II5A 3KCFA 5CSVA 4MD8E 3VBXA 3ZC5A 4EEVA 4FICA 3FLQA 3H9FA 3OEZA 4H36A 4FVPA 1PXKA 4AWIA 5CF4A 3KEXA 4IC8A 3TL8A 2YLEA 3I1AA 4CFMA 3GC7A 3A7GA 4LRJA 3QF9A 2VZ6A 4JX3A 1DI9A 2XS0A 3MA3A 4E7WA 2WTIA 5LMAA 5AM6A 3B2TA 1XBBA 4TYHA 5J7BA 3UODA 1Q8WA 4WKQA 4E5WA 3I6UA 4RX5A 1Q8ZA 3P78A 2UW5A 3DJ7A 3KY2A 3OF0A 2WMQA 1DS5A 3BE9A 3PVGA 2UZTA 3ZLYA 5BVFA 1FBNA 1PXLA 2RL5A 2BDWA 5E92A 1SNUA 4QP2A 1SVHA 4IX3A 2C4GA 5JMSA 3SRVA 1URCA 4Q5HA 3SGCA 5BUJA 2ETRA 4OTIA 5HNBA 4EK5A 4GK4A 5DRDA 5AP5A 2BAQA 3R7EA 4EOOA 4UMTA 3HVCA 4EZ7A 5TOZA 4M7IA 3WIGA 4MHAA 1ZYCA 2GQGA 2IO6A 3QC9A 3VULA 4CLIA 5CF8A 2OH0E 2R3IA 3HAMA 1R3CA 3JYAA 1NA7A 3NRMA 3SD0A 3FMKA 4RIYB 1PXPA 4ACHA 3ZO3A 2B0QA 4G9RA 5DN3A 4BF2A 4Z55A 4NFNA 5DFPA 3LCKA 3KN6A 2UZNA 2OXYA 4J71A 4O4BB 1H00A 4KBCA 2V5QA 2PVMA 2XKEA 3HUBA 1K2PA 4GRBA 1JSUA 4AUAA 5KMOA 2ZM1A 3PPJA 3NYVA 3MFTA 2W1EA 4FUXA 1UU3A 4ASEA 5CVHA 4JG8A 1XH7A 2VWUA 4WNMA 3VHEA 3QWKA 1G8JA 4IVBA 2FVDA 1YVJA 4W9XA 3RNIA 4XG6A 4G5PA 3R21A 2JDVA 4FTNA 4ZSGA 3UPXA 4HCUA 2ZFYA 1Q61A 3O8TA 4E4MA 2ZV7A 5HLWA 2EB2A 2VTQA 3FAAA 3Q32A 4L46A 1R0PA 4BDGA 5LCJA 3W0PA 4DFUA 4F0FA 2C69A 4P2KA 1NXKA 5HBJA 4EK8A 3OOMA 3RAHA 1ZOHA 2W1FA 3HV5A 5KZ0A 2X8IA 3IW8A 5E8TA 5J95A 3F3ZA 3P08A 3RK9A 2F2CB 3GU6A 4LV5A 3A99A 4CGAA 4G16A 4HVIA 3MDYA 2QG5A 3I5NA 4XH6A 4FIHA 2ZM3A 3EOCA 5EOLA 5AAEA 1O6LA 4YZ9A 2I40A 2UW7A 5IH6A 2YA9A 2ZB0A 4S33A 1LEWA 3RHKA 5EFQA 3Q52A 1REKA 4Z3VA 3ZU7A 5IG1A 2C0OA 3CGOA 3R04A 1ZZLA 3IW5A 4X6RA 3DV3A 1BKXA 3JPVA 3L8SA 4TYEA 5DT3A 2BKKA 1GIJA 5DOSA 2ZDTA 4CMTA 1GZNA 4BB4A 5CAOA 3MPMA 4HPUE 5J5SA 4F64A 1CM8A 2WQEA 3EIDA 3KA0A 4U97A 1ZZ2A 2W1HA 3QQLA 1UU8A 2EUFB 5KO1A 3C4EA 3NLBA 4GSBA 3DCVA 4CCBA 4RIXA 4RFZA 2WMAA 4TT7A 2E9OA 4A4OA 3AMBA 4PDOA 4EQCA 2CCIA 4WG3A 4GVAA 1BL6A 4IANA 4JJRA 4PTGA 3VVHA 2HCKA 5DT4A 3Q4ZA 4IWOA 1GIHA 4R7BA 2WFYA 1XMLA 5IQAA 2W06A 3OBJA 2JD5A 4FKUA 5HI2A 2FH9A 3QL8A 5L6OA 5DEWA 4QMSA 3HL7A 5FLFA 5BVKA 1XR1A 4CQGA 1AD5A 2Z8CA 4C33A 1Q5KA 4P5QA 5HOAA 4ZK5A 4D1ZA 4MEDA 3W8QA 3FZOA 2C5XA 3AC3A 4TY1A 3VJNA 3S95A 2EXEA 2NRYA 3NX8A 3ORTA 3HRBA 4GFOA 1UU9A 1H07A 4DFNA 4NM3A 4UB7A 3PXKA 3B8QA 4E8AA 5IDPA 2IVTA 4FT0A 4ARKA 1Q3DA 2VGPA 2G1TA 5L2SA 2WGJA 3I6WA 4R7HA 3QC4A 1UKIA 2DUVA 4FEUA 2PY3A 3ORKA 4RX9A 1ZY5A 4O7LA 4QYHA 3D5UA 4ZEGA 5AP6A 4UXQA 4AA5A 5CAVA 3MJ1A 4FF8A 2VTRA 3QFVA 4H58A 3VC4A 2QKRA 1PRYA 1M17A 2C5YA 3DBEA 3I79A 3FXZA 4CV8A 4ZZOA 2J0KA 2BZHB 2A0CX 4IACA 2H34A 5BVNA 5DT0A 2R3FA 3CIKA 4EC8A 5B0XA 4C4JA 3HKOA 2FO0A 3MFRA 3NUYA 1VEBA 3CQUA 3QALE 5GJFA 3V8TA 5IA4A 2P4IA 1LUFA 5J9YA 3BYUA 4W4XA 3Q9WA 2W1CA 3ORLA 2I1MA 3F2NA 3EWHA 3UDBA 3ZUVA 4DBNA 4FV7A 3GU7A 4BDHA 4C0TA 4NZWB 4DGGA 4D28A 2JFLA 1HCKA 4IX6A 4RWLA 4FKPA 3DQWA 4OTPA 3AD5A 3EN4A 5JH6A 3QUEA 5KKRC 4C35A 3H0ZA 2XIRA 4M69B 3R9NA 1J7UA 4FE2A 4CFWA 4EH2A 1OBGA 1ZMWA 3A4PA 2ZMDA 1YXUA 3MVLA 4WD5A 3R9RA 2O0UA 5M57A 5KX8A 3BL7A 3IGGA 2X1NA 4RX7A 1MRUA 3TNPC 1YXTA 2PE2A 4DTAA 4PY1A 3C4ZA 4B8MA 2BVAA 2UVZA 4RWIA 3SOAA 4TL0A 2PVLA 5G1XA 4RIYA 2GNIA 2VO0A 4FV3A 5FTOA 3HV4A 3TV4A 2BALA 2JKMA 4EOSA 4CLJA 3TNIA 4DHZA 3EQIA 2VWIA 3R9DA 2ZM4A 4D2TA 2OJFE 3RAKA 2PK9A 3H9OA 3ZLSA 4HJOA 2R3PA 2WIHA 4G2FA 4NM7A 5J5TA 2I0VA 3SA0A 3R7YA 1U59A 4C3PA 3KF4A 3S0OA 3GUBA 2CSNA 2R0IA 1YDSE 3G51A 4FKSA 4K9YA 4BCQA 4KIPA 2CLQA 1WCCA 4WHZA 2ERZE 3ULZA 1PMEA 4GU6A 2VWXA 4I41A 2VWYA 3BE2A 4OTHA 4LYNA 4AGWA 2Z60A 4XCUA 1Y91A 3O2MA 5JQ8A 4BRXA 4G3DA 3V01A 1RDQE 3QTZA 1ZYDA 5JFVA 1RQQA 3ZRKA 4DLJA 2ETKA 3DBQA 3VUGA 4FX3A 2VD5A 3QKLA 4NEUA 2YWPA 4L7SA 2WEIA 5D41A 2WMBA 2DYLA 5CF6A 1UNLA 1J7IA 4YC8A 4I21A 3LLAA 3UOKA 4EORA 1OL5A 4EYJA 4XS2A 2YIWA 5EDQA 4D55A 3MA6A 3P7CA 5LMKC 3EFLA 4AG8A 3BGQA 3OROA 4BTKA 4O7VA 2O65A 2QO9A 1V0PA 1VZOA 2YM6A 4FTIA 3E8EA 4HVGA 2XEYA 4O6EA 1IA8A 3ZBXA 1GIIA 1MP8A 2XBAA 5T6KA 5HLPA 3Q5IA 2XARA 1XJDA 4YTCA 4HGEA 4LGHA 5M55A 4KIKA 1KE8A 5AIRA 3H30A 1G8AA 3P9JA 1DM2A 4BKZA 5BQ0A 4WA9A 5AR5A 5CAUA 2YM3A 4M67A 4KUJA 2NPQA 1FPUA 3TWJA 3LPBA 4PWNA 4L3LA 2QQ7A 1OMWA 3SQQA 2JDOA 2OJGA 3BHUA 3ZO2A 4XNEA 1W98A 3D15A 5CEMA 2BAKA 1YDRE 1ZRZA 2O3PA 3DNEA 2EB3A 2IVVA 2WMXA 3FJQE 3HV6A 3ZHPC 3ZXZA 5L2IA 4GFMA 4HGSA 3OD6X 4CZUA 4G3GA 3LLTA 3DNDA 3QD0A 4O81A 5FM3A 5L6PA 4O1PA 4BCMA 4FIIA 4F7JA 4X7QA 2JDTA 3FY2A 3VS6A 2GTMA 4FIEA 1KE6A 1XHAA 4I0SA 4O82A 4MXOA 5HCYA 3O50A 3UO5A 4A9TA 3A8WA 4ZTLA 3O71A 1GY3A 3AC2A 3T3VA 5KMKA 5L6WL 3UE4A 4RQKA 3HA6A 2XEZA 3OCSA 3OXZA 4QP7A 4EH3A 4QP8A 1YHWA 5CZIA 5JZNA 4RRVA 3RPSA 3U9NA 2R3LA 3UOLA 4EOPA 4G5JA 3QLGA 3U55A 4L44A 4DC2A 4ZLYA 3GI3A 2F7XE 3DDPA 3ENMA 2BZJA 4ZZNA 4YZDA 4ZS4A 4F1OA 4L43A 4UMRA 3ZMMA 3ZBFA 2FSMX 3NYXA 1P5EA 3QTWA 3F2AA 5LWNA 2PMNX 2B55A 4WIHA 3ORPA 4RSSA 2OH4A 5CNOA 1Q99A 3RM7A 4AN9A 1BMKA 2XIXA 3HAVA 2UZDA 4ACDA 4IB3A 3UO4A 2Y6MA 5GINE 5FBOA 2XA4A 2ONLA 3QTIA 3C0IA 4PF4A 4GJ3A 4N57A 4X2KA 4BDKA 4LL0A 3NNWA 4G34A 5C4LA 3LFCA 4CFUA 3E62A 3OT8A 4OLIA 4AZWA 4E26A 5AV1A 3R1QA 4AQCA 5IKWA 4QPAA 2Y6OA 4O1OA 1JSVA 2W1DA 3KRRA 3QRUA 3BLAA 1T46A 2YDKA 3NGAA 4XG8A 1T45A 4AX8A 4O7SA 2X0QA 3PY3A 3PXYA 1PYXA 4FSYA 3UMXA 4ANNA 3N4UA 5FXRA 3ZTXA 5IF1A 1TFFA 3TDVA 3AMAA 4D1XA 1TVOA 1PY5A 3IDBA 2Y4PA 3O96A 4M69A 4B7TA 1FMOE 2Z7LA 3QU0A 4QYEA 5JT2A 2HZ0A 5JFXA 4YZBA 4JG6A 4I6FA 3AKJA 2QG7A 4UMUA 4HCVA 3RALA 4C34A 2W05A 5CXHA 2PWLA 3L8XA 4CEGA 4EKKA 4UV0A 1HOWA 2CLXA 3G9LX 5HHWA 2IJMA 2ITPA 3ROYA 2JC6A 4IW0A 4H1JA 1SYKA 2IZTA 2UW3A 2XCHA 4FTOA 2QNJA 4QP9A 5BMSA 5IMXA 3R7VA 3AGMA 5E8VA 3SXRA 5CU0A 4NJ3A 5JFSA 4RVLA 4OUCA 1W2DA 3F5UA 3PSDA 4KKGA 4U0IA 3U9CA 2WQBA 5KMNA 2SRCA 3G0EA 4YNOA 3MH0A 2ITYA 3PFYA 3A61A 4IVCA 3AT4A 3UDSA 4EOJA 4K33A 3AOXA 3VBVA 3M42A 2X0GA 2X2LA 3MGYA 5HE0A 2HYYA 5I3OA 4AFEA 4ZTMA 5J9ZA 1YXXA 3ML1A 2JDSA 4FTJA 2C1BA 4O0UA 2OW3A 3HMIA 2G2HA 1BUHA 2GS6A 4X2NA 4N70A 4ANMA 4B99A 5LVPA 5D7AA 4FJVA 3HLLA 2OBJA 4UWYA 4F6SA 4C2WA 5JRQA 3F69A 4CMOA 4UN0C 2BFYA 3ENHA 2X39A 2J0MB 1ZY4A 2QOLA 1JKTA 1Y57A 4MWIA 4YJUA 2PPQA 2JKQA 2I6LA 4O0YA 3R8ZA 4BIEA 2RF9A 4FV5A 2B9JA 1PMNA 2PZIA 2VTOA 4BZNA 2UW0A 3P7AA 3IS5A 4Z9LA 3QD4A 4S30A 4FVRA 3FZRA 5IPJA 3PXFA 4GCJA 4C8BA 4RIOA 2V22A 2QO7A 5BUEA 5IDNA 2ITOA 2WOUA 2WMUA 2HZNA 2BRGA 5DR6A 5CI7A 4RJ3A 2ITZA 5EK7A 5AP0A 3BBTB 2BUJA 1A9UA 2A4LA 1OGYA 3DY7A 1AQ1A 3PJ8A 3JVSA 4FT7A 3NZ0A 3PWDA 4E6QA 3VS2A 3FWQA 1XQZA 4FV0A 2XB7A 3MVHA 1KV1A 3M1SA 1TQPA 4E4NA 4O84A 2XNEA 3OMVA 1PXOA 5HEZA 4M15A 5HVYA 3UNZA 2PZYA 1DAWA 3BU5A 4EL9A 5AUYA 5CI6A 1A48A 4IVDA 5E90A 5JSMA 1V0BA 2X7GA 3NWWA 5AA8A 2WZJA 5DWRA 2BRMA 5ETAA 3ZDIA 1DAYA 3QTXA 4GUBA 3V8WA 3UJGA 5K5NA 4NCTC 2VWZA 4BR3A 1BLXA 4FZDB 2VTPA 2BROA 4RPVA 4WRGA 3NNVA 3PPZA 4MD9E 4F7NA 1CTPE 3R1YA 4HW7A 4ZY5A 5FP6A 1OIUA 5CU2A 3G33A 2VUWA 3ID6C 2B4SB 4A4XA 3NCGA 3V5QA 3ZO4A 4WT6A 2QODA 2YCQA 4XV2A 1FOTA 5GJGA 2A1AB 5DMZA 1OPJA 2VWBA 3COHA 1UU7A 3MTFA 2XAMA 4O7WA 3NEWA 4TKSA 3JY0A 3NDMA 4AF3A 1XMMA 1VR2A 1Q41A 1V0OA 2R9SA 1OITA 2YM7A 3DXNA 2IW6A 3DU8A 3K54A 3NW7A 4AXFA 3MY1A 5E7RA 4FIGA 2EVAA 3IK3A 4KRDA 5HG5A 3TACA 3QXPA 4MBJA 3GT8A 2HIWA 2BTRA 3A4OX 4TWOA 2W99B 3TNHA 3ZZEA 4BGHA 2VO7A 4EC9A 5B7VA 3W0OA 4EOQA 4EH8A 4U41A 3VBTA 4BL1A 2B7AA 3G90X 4MNFA 4KRCA 3C0HA 2WTKC 3G6GA 3OCBA 4N0SA 3VUTA 3P86A 3QQUA 3EJ1A 4OT6A 4ZZMA 4UMPA 3QA0A 4BWKA 3ODZX 2X2MA 3A62A 5BVOA 2B9FA 4ACGA 3EN7A 1KE5A 2R0UA 4I1ZA 2OSCA