5GJFA

Crystal structure of human tak1/tab1 fusion protein in complex with ligand 3
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
307
structure length
298
Chain Sequence
GPLHMIDYKEIEVEEVVGRGAFGVVCKAKWRAKDVAIKQIRKAFIVELRQLSRVNHPNIVKLYGACLNPVCLVMEYAEGGSLYNVLHGAEPLPYYTAAHAMSWCLQCSQGVAYLHSMQPKALIHRDLKPPNLLLVAGGTVLKICDFGTACDIQTHMTNNKGSAAWMAPEVFEGSNYSEKCDVFSWGIILWEVITRRKPFDEIGGPAFRIMWAVHNGTRPPLIKNLPKPIESLMTRCWSKDPSQRPSMEEIVKIMTHLMRYFPGADEPLQYPCQHSLPGRVEPYVDFAEFYRLWSVDHG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TAK1 kinase - TAB1 chimera fusion protein
publication title Development of a Method for Converting a TAK1 Type I Inhibitor into a Type II or c-Helix-Out Inhibitor by Structure-Based Drug Design (SBDD)
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 86
structure length 298
sequence length 307
ec nomenclature ec 2.7.11.25: Mitogen-activated protein kinase kinase kinase.
pdb deposition date 2016-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5gjfA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5gjfA01
1T46A 4FF8A 3WZUA 5AUXA 2PYWA 1ZXEA 4OBOA 2OF4A 4M69B 4F6WA 4RJ6A 4FEWA 4X2KA 3AMYA 4QMMA 4QYYA 4FE2A 1R0PA 1PXIA 3GCSA 4D5HA 5ANEA 1KE5A 4HOKA 3WE8A 1M7QA 4QTBA 4G5PA 1GZ8A 4WIHA 3WYXA 4A9SA 3OROA 5J9YA 4AZVA 1H1RA 2I40A 3G5DA 1UNHA 4PPBA 4BCGA 1I44A 3LXLA 4E20A 4LG4A 2ITOA 3QX4A 1EH4A 5LMKC 4QTDA 4WD5A 3KGAA 2OKRA 3FDNA 4FTKA 5ACBC 4GU9A 4KIKA 2XK8A 4XOYA 2OBJA 4EOQA 3GQLA 4IX6A 4L53A 4RRVA 3IKAA 3DAJA 3C4WA 4G3GA 4TTHB 2Z60A 4DG3E 3R8VA 3PPZA 3UNZA 3O17A 4HCVA 5HTIA 2VTJA 4XG7A 1WBOA 4Y72A 3QXPA 2BDFA 3EIDA 5C8MA 4PNKA 3ET7A 3R7EA 3P23A 2WMXA 5AJQA 2BAKA 4U40A 3U87A 4GFOA 4AAAA 3GCVA 3L9PA 3DQXA 2KTYA 3CCNA 4AT4A 5EHLA 1J3HA 2C4GA 3L8VA 3C5UA 4YBJA 5EK7A 4E4XA 5CXZA 2C5NA 4FEVA 4I5CA 5CQWA 4L9IA 2BTRA 3I6UA 4QPMA 2B7AA 3HZTA 3OXIA 5KCVA 4K33A 4R8QA 5AP5A 2C0TA 4Y85A 5HORA 3VUTA 2WOUA 2ERKA 3L8SA 2IO6A 3OEFX 4RJ3A 4A9RA 5BYZA 2BAJA 3HECA 4NU1A 4EOSA 1AD5A 4PUZA 5ANJA 1OVEA 5A4TA 4CQGA 4RPVA 3U9NA 3VJOA 2F9GA 4X2FA 2VTPA 3CD3A 4YJRA 5AX3A 4D55A 5I4NA 3MS9A 4QMQA 4DFUA 4U79A 4HVDA 3QGWA 5DA3A 4DEBA 4IB3A 3SKCA 3RP9A 3PUPA 4P90A 4YJTA 1KOBA 4CG8A 3WZKA 3A62A 5C8KA 4O7VA 3KN6A 2WFYA 3VS1A 4DG2E 3U4WA 1XBBA 4TYEA 2PVHA 4RIWA 3F2RA 5I9UA 5CASA 3DBDA 5EM6A 3PWYA 5CEIA 2R3OA 2OF2A 4JNWA 1JLUE 3OHTA 2UZDA 3PJ3A 4Q9SA 1MRUA 3U6IA 3KMWA 1DAWA 2C5OA 3OY3A 2ZM1A 3PXYA 4GIHA 4JDJA 4YBKA 4FSNA 2J50A 3OG7A 3R73A 4B0GA 5LMBA 2VWUA 3ZDIA 2WU7A 3M1SA 3R1YA 5K4JA 2XNBA 4IJ9A 3EN5A 5JZNA 3T3VA 3VQUA 4U8ZA 5DT0A 3MVJA 3PYYA 2FSMX 4GUEA 5AUUA 5EKOA 4BZOA 4N6YA 4D2SA 1YWVA 4CMTA 4KBAA 3JYAA 2NRUA 1Y91A 2J90A 3LFFA 4FX3A 4Y8DA 3IOPA 4ASZA 4EBWA 4HGTA 2WB8A 5AADA 3RPVA 3QRTA 3TCPA 4U0IA 3CQEA 2J0IA 5LVNA 4FVRA 3SGCA 3IW4A 2J0LA 2GS2A 2XK4A 2ITUA 5CF4A 4QNAA 4CFFA 3V5JA 3Q52A 4QPAA 1FVVA 4WRSA 3UZTA 4CGAA 1I09A 1IG1A 1R78A 3W2QA 4HCUA 3SW7A 5HX8A 2VTIA 5HIBA 4LUEA 4BCNA 4DH8A 4ZZNA 3ORIA 5I0BA 1OPLA 1VR2A 2QHNA 4IQ6A 3TDWA 5FLFA 2Y6MA 2W1EA 3EN9A 3R01A 3S95A 3UBDA 4ANOA 3SG9A 4IWQA 2YHVA 3V5PA 3ANRA 4WO5A 3F6XA 4PNIA 3QHWA 1XH4A 2HYYA 4NZWB 4GG7A 4IMYA 3H9RA 2JBOA 2UZOA 2Y8OA 2ZYBA 4F7SA 3L8PA 3FXXA 2H96A 4GK2A 1E9HA 1Q8TA 2JIVA 3E8CA 2OICA 2RKUA 4FK6A 1TQMA 4CYIA 2BZJA 3PG3A 3CBLA 3C4CA 1TQPA 2BDWA 3QYZA 4R7HA 4E7WA 2X4FA 3QUDA 2BRNA 2PMOX 3TI1A 1QPCA 3H9OA 5TT7A 5JGDA 3IDBA 3LCKA 4GK3A 4OTQA 4NTSA 5BUEA 3G0EA 3TNIA 2DS1A 3OZ6A 4ZEGA 2QC6A 3RAHA 1YWRA 5F94A 5AX9A 5B2KA 4AZEA 2Z8CA 2XIYA 3QU0A 4YJVA 3RALA 2BROA 3DXNA 3LFAA 3R00A 1PKDA 3BE9A 3V01A 4O91A 4LMNA 3DOGA 4I41A 5HO8A 3I4BA 2HK5A 4EBVA 3PA3A 4LRKA 2WTDA 4GU6A 2UZTA 4K77A 5TOZA 2C5YA 2ZMCA 4N0SA 3RKBA 5AUWA 5IKWA 5C4KA 2R7BA 2HXQA 5T3QA 2BRBA 3KN5A 5EOBA 3VN9A 2FGIA 2RFSA 3PG1A 2XKDA 3LJ1A 4IAFA 1J7UA 3OWJA 4DEAA 3JY0A 2W7XA 2KULA 4BDEA 2HELA 2WTIA 3PA4A 2IW6A 3QL8A 4IVDA 5A4LA 5KBQA 4NKAA 4FYNA 3OBGA 3R02A 4EK6A 3FSFA 5LJJA 5JH6A 4BVUA 1Y57A 2WQMA 4BCJA 1M7NA 4ZTNA 4C57A 4EKKA 4ZLYA 4HZRA 3VRZA 2B1PA 5CLPA 2X4ZA 4AGUA 4ITHA 3SOAA 5D9HA 3UQGA 5KMMA 5J7BA 3CGFA 2PVJA 3VUMA 3D5VA 2ONLC 2WGJA 5EYCA 4D0WA 4JVGA 5CEKA 5FTOA 4QRCA 2FA2A 2UW7A 4FIHA 5DPVA 5H8EA 4DLIA 5IEVA 2X2KA 5HOAA 5ANIA 2OGVA 4V05A 3QZFA 3WIKA 3ZLSA 1NVQA 3QTWA 3CS9A 4FSWA 3ZLXA 4BDIA 4FKTA 5E8SA 2UW9A 4QP8A 4APPA 4PV0A 4A7CA 3NVKI 5DOSA 3LXNA 4D4YA 2ITVA 3LCDA 4BHZA 4EWQA 4GEOA 4I0SA 4QPSA 2WMAA 5E92A 3OBJA 3PRIA 2YIQA 4BDJA 5LCJA 1LR4A 3EFWA 3O96A 3FKLA 4AOTA 3TTIA 5BVEA 3UO6A 4D4SA 3LKMA 4M8TA 4DBNA 4FV2A 3R8LA 2WXVA 3HV6A 3LOKA 4TY1A 3IW5A 4W4YA 4HVSA 3WZEA 5CY3A 3DK7A 2G15A 3IK3A 4KB8A 2CHLA 5AA8A 2IWIA 4AE9A 1V1KA 2W06A 2OIDA 4DCAA 3HLLA 2VV9A 4PP9A 4W9XA 3BWFA 3ZXTA 4GG5A 4AACA 5C8NA 3VW6A 4OTDA 2X1NA 2XEZA 2HZ4A 1YHVA 1H27A 4IBMA 4CXAA 5IQEA 5HEZA 1YRPA 3HAVA 3O2MA 4KBCA 3QX2A 2X9FA 1E1VA 4YC8A 1BLXA 2J5EA 3MY5A 3QRIA 5CI7A 2F2UA 2QOFA 1OKVA 3E93A 2JKKA 2P33A 4D2PA 4YUQA 4U7ZA 4H1MA 5DN3A 4S31A 4F9WA 4AZWA 3GC9A 4G9CA 2XJ1A 4E4NA 2XB7A 4ZP5A 1OIUA 1OITA 3F2NA 4NFMA 4EH6A 4G2FA 5DT4A 4J71A 2OH4A 3R83A 4O7ZA 2OZAA 4MTAA 4IVCA 3RGFA 4G31A 4J95A 4BIBA 4EQCA 2Y4PA 4IAAA 3ZSIA 3ZZEA 1XWSA 2OJFE 3DB6A 4S33A 5GNKA 4CFUA 2R5TA 2V0DA 2VWWA 3QD3A 1PF8A 3GCUA 4FK3A 1H1QA 5J5SA 3DLSA 4ITIA 3EWHA 5EH0A 3MN3A 2VX3A 2GCDA 2F49A 5AIRA 4ZIMA 3W2RA 4CEGA 4D0XA 4GKIA 3ZEWA 5FXRA 3EQRA 2XIZA 3ZO3A 4AQCA 2XUUA 3BU3A 2XK3A 2OSCA 3VBYA 2B55A 3VS7A 4X0MA 4G3FA 4HYSA 4EOIA 3UVRA 4GYIA 2Q0BA 5M08A 3EMGA 1UNLA 4U97A 5CVGA 4IVAA 3F82A 1JSVA 1YVJA 3FMDA 5LARA 3P4KA 4FT9A 5DNRA 1XBCA 4IB1A 5DBXA 4TPTA 5LOHA 3CGOA 4P4CA 3Q2JA 4RVMA 2GPHA 3LW0A 1IAHA 4U42A 3FLZA 3EB0A 3I79A 5D7VA 5C01A 4NKSA 5DRDA 4H36A 5HI2A 2E9UA 4I3ZA 5L6WL 3NLBA 3SRVA 5CF8A 2JLDA 4U80A 4JBOA 3N4UA 2QD9A 2YIRA 2ZV2A 2YDIA 4IAZA 5EDRA 4C4HA 3OMVA 3Q04A 3U9CA 3UNKA 4TL0A 4OAVB 4Q5EA 4IFGA 1OECA 3MYGA 4XP0A 5DLSA 3WF5A 5CF5A 3QA0A 1H26A 1PJKA 3AC8A 4FG9A 3LZBA 1R1WA 1UV5A 1YDSE 2BR1A 3WF9A 4AA4A 3KXNA 3BU5A 5F4NA 2HY81 3FQSA 3HA8A 3QC9A 4RX9A 4TWOA 5IA5A 2UV2A 3G90X 5CX9A 3VBQA 4ZZOA 5FTGA 4IX4A 5JFXA 2V62A 1H01A 2VTHA 4M12A 5LCKA 4QP9A 2DQ7X 4WBBB 5AP4A 3VC4A 4FKRA 4TN6A 5JRSA 4ASXA 2W17A 3R6XA 4MVFA 5EYDA 5AV3A 4WKQA 4BCOA 4ANBA 4TYJA 3WARA 2VO3A 4FTJA 4A4XA 4EK4A 4U43A 4AW0A 2GU8A 3QHRA 3W10A 2R0IA 1FMOE 1DAYA 3U51A 5CANA 3NCZA 5CSWA 1U59A 2C6EA 3WOWA 3Q4CA 4EOKA 1V0BA 4UX9A 4DBXA 4XEYA 3UYSA 4R7IA 3UC4A 4JR7A 3PXQA 2UVYA 5AUYA 3V5WA 2HAKA 3NYOA 4I6BA 4OBQA 4CT1A 4ZZMA 4DFXE 3UOHA 4CTBA 4AW2A 2WTKB 3OTUA 5AR2A 3W16A 2VWYA 4ZTSA 3RINA 4H3PA 2UZEA 5K0XA 3KKVA 2QOOA 2J51A 1PKGA 2G01A 3W33A 3MTFA 3ZEPA 4FKPA 5IQAA 4OTWA 3ZBXA 2YWVA 2G1TA 1YXVA 2PVKA 4L00A 4GT4A 4E6CA 3DAEA 4JAIA 1MRYA 3KXMA 2IZTA 4O84A 2OO8X 1YKRA 1OKWA 4OTPA 1BI7A 3P08A 4IWPA 4YJNA 4KIKB 3K5VA 3QD4A 4O86A 2IW9A 1B38A 5FRIA 4YZNA 5JFVA 1QPDA 4W8EA 3CPBA 2O8YA 2YDJA 3LCTA 3FMLA 4NUSA 4PMMA 4QTAA 5IMEA 4QMOA 4QQ5A 1Q8YA 2OK1A 2IZUA 1CDKA 2R3MA 4IADA 5FDXA 3FAAA 4BYIA 2BFYA 4WG3A 3ZS5A 3LQ3A 1FQ1B 3RVGA 1KOAA 2OIBA 2QG5A 3D15A 3LMHA 2QOIA 2CNVA 3ZOSA 3DAKA 3ZCLA 3HRCA 2QCSA 3SLSA 3MVMA 1Z9XA 3OUNB 3VQHA 4LGHA 3QRJA 3QTIA 1ZYSA 2O65A 2X7FA 4O2PA 3D83A 2PUPA 2XIXA 3GEQA 5CU6A 1OPJA 3Q5ZA 4NYEA 4PMTA 4NFNA 4LFIA 5CXHA 4FSRA 4RVLA 5LMAA 4RJ4A 5KX8A 4UYAA 2LGCA 1YXXA 2C6TA 3OCTA 3RM7A 3DKOA 3QZIA 4AWIA 2VX0A 3Q2MA 2JGZA 1IA8A 1UKHA 2J7TA 3U6HA 5JSMA 4PPCA 3EQGA 4DF3A 5IQHA 2AC3A 5KHXA 4M97A 2OXDA 5HO7A 4X2GA 4ACHA 4R3PA 4F63A 3AT4A 3QTZA 4YMJA 5LQFA 3SVVA 4F0GA 3MPMA 1JWHA 2WTKC 5E9EA 3A7JA 4Y83A 4EKLA 3NIEA 4HVHA 3C5IA 3DKFA 3VNTA 2G2IA 3PXRA 3I7CA 3ZFMA 2I6LA 2FVDA 2OH0E 3II5A 3FZ1A 4QYEA 1U54B 4EUUA 3KY2A 4RMZA 4KA3A 5AP2A 3A8XA 1UNGA 3ZTXA 1Y6AA 1JBPE 3BI6A 3H0YA 4BI2A 4RIWB 4ZAUA 5J87A 4FTLA 4IZ5A 3CJFA 1VZOA 2W4KA 2BFXA 3FBVA 5AM7A 3IQ7A 3U54A 4QP4A 3B2WA 5TF9A 5DIAA 3GB2A 4ENYA 4XG6A 4EOJA 3R2YA 2VU3A 3DFAA 2GMXA 3VF8A 1PY5A 3QALE 1H07A 3VBXA 5IEXA 5IQCA 2PHKA 4PDSA 1H0VA 3SQQA 4FTRA 1PXNA 5AUTA 4BL1A 4LYNA 1PW2A 3MFUA 4DTAA 4E6DA 1JVPP 5HG7A 3HV5A 3MJ1A 2VWBA 3PIZA 4E6AA 5DEWA 4CG9A 3C51A 1RJBA 2AC5A 2EU9A 2XKFA 3HVCA 4IDTA 3OCBA 4M68A 4QNYA 4C4FA 2JKQA 4IC7A 2ZV9A 2XP2A 2O3PA 3WZDA 1SNUA 3R8UA 4C2VA 2B52A 1CKJA 4W8DA 1OGUA 2YCSA 4ZY6A 1M17A 4C4JA 3KCKA 2JEDA 5DR6A 2ITQA 3GGFA 3UOLA 1GAGA 1Y8GA 2QR7A 5DE2A 5FGKA 4D1ZA 3UODA 4TZRA 5AP7A 1J1BA 1L3RE 2XNMA 3R22A 4FZAB 4NM7A 4W4WA 3FY0A 3V51A 2OIQA 4A9YA 4DGNA 4O83A 4QMZA 4EH7A 2BZIB 5ACKA 2WEVA 5D12A 4OTGA 2P4IA 4O0WA 3UG2A 3A7GA 3NSZA 3RPYA 2JC6A 1ZYLA 1PXPA 4XCUA 3PSDA 3VS5A 3W55A 3V6RA 1YI6A 3P78A 5E8WA 3D5WA 2ITZA 1DI8A 1CMKE 4NCTC 4ACMA 4E1ZA 5A6OA 4PDYA 3R21A 4Z3VA 2W1CA 5KMNA 2PZRA 3HNGA 4PQNA 3TKUA 3MJ2A 3NS9A 2X2MA 2C5XA 3FEGA 5BYLA 2HXLA 4BCHA 2YCFA 4K2RA 5C1QB 4IW0A 3FQHA 2PY3A 5JQ8A 3ACKA 1CM8A 1XH9A 2VWVA 4UWYA 3EN7A 1SVGA 4W4VA 4MAOA 4Y95A 3WBLA 5GZ8A 3AD4A 4XV2A 3S1HA 3QTSA 4BWPA 3EQDA 3CQWA 1H24A 3QKLA 4EH3A 3Q96A 4FZDB 2JAMA 3AD6A 3C50A 3QQJA 3QUEA 4GW8A 4JS8A 2E2BA 5ETIA 4BC6A 4MXXA 2V55A 1TVOA 1PRYA 3LJ2A 4QQTA 5EI6A 3FLNC 3KRXA 1OIYA 3E63A 1U4DA 2QNJA 2YM3A 4FTUA 4FV7A 4ALWA 4BBFA 5LVMA 2X6DA 2QONA 3C0GA 3Q4TA 4S2ZA 4XG4A 4YTIA 4I6FA 3DV3A 2WQOA 3FMMA 4B99A 1KE9A 1H00A 1B39A 2J0JA 4DFLA 4JI9A 5IZFA 4I6HA 3V8TA 2E9NA 4RGJA 3DGKA 2XNOA 1HCKA 1WBSA 4EC9A 1K9AA 5I9YA 2E9VA 2YM5A 3HDMA 4QMTA 2W96B 1S9IA 3POOA 3WF6A 4RWLA 3RHXA 3L8XA 3F5UA 5HO6A 3GU7A 4WBOA 3OOMA 4JT3A 3VBVA 5AUZA 4IAKA 4B9DA 4E5WA 3FYKX 3P1AA 4MCVA 4J8NA 3AMBA 2Q0NA 1ATPE 1XQZA 3OWPA 4IAIA 4OLIA 3FPQA 2BKZA 1ZZ2A 1XH7A 3WYYA 1SZMA 4G6LA 4ITJA 4AN9A 1OBGA 5GJDA 3EYGA 3MH1A 4HCTA 5KNJA 1GY3A 1REKA 3VS0A 1Q8ZA 3COMA 2XM9A 4I6QA 4XMOA 4S32A 5FWKK 3A99A 4JXFA 2OU7A 1CKPA 4DGMA 1ZY5A 4HNFA 4MBIA 2O64A 3E3PA 2XEYA 4YZDA 3EZRA 4X21A 5AAGA 1KV1A 3Q9YA 1ZZLA 5L6OA 1P5EA 4B8LA 4DTKA 4J98A 4EJNA 2GNLA 4DH3A 4EK8A 5IU2A 2C6MA 2J0KA 2YCRA 2XBJA 2BZKB 2H34A 2NRYA 3QAME 4GL9A 5BVOA 2XYNA 1HOWA 2GTNA 3QD2B 4ID7A 4CRLA 3HV7A 5K5NA 5J1VA 3AT2A 5CSPA 3QQFA 1CKIA 3QCYA 3F88A 3DLZA 5EOLA 3K3IA 2CNQA 3ENMA 2JDTA 3FUPA 5J8IA 3UVPA 4MH7A 5IA4A 2BRMA 5EM5A 4FNWA 2Z02A 2Z7RA 4GFMA 5EM8A 4E5AX 4FV9A 1VYWA 3GFEA 3UP7A 4EH4A 4YTFA 3E7VA 3HGKA 4PTEA 4Z9LA 3U8WA 4EOLA 1DM2A 3DT1A 3OCGA 4YC3A 2P2HA 2UW8A 3Q9ZA 3KMUA 5BQ0A 1ZRZA 5BMMA 4E26A 5J7HA 4EH9A 4YO4A 3VWAA 1WVXA 2FSLX 3R7OA 3NUSA 4FSTA 4BN1A 2FYSA 3FI2A 3NVMB 4O38A 4ZK5A 5CTPA 3NUAA 2A4LA 2O2UA 5BVKA 3WE4A 5EQPA 4IIRA 2PU8A 5CU4A 3QTQA 4BTMA 1UWJA 3FYJX 3BYOA 3D5XA 1BL6A 2VNYA 3FQEA 3T3UA 4KKEA 4WA9A 4PPAA 4M14A 3RK9A 3TN8A 3TUCA 3MPTA 4FR4A 5D1JA 2WMSA 4F4PA 5HGIA 4AXAA 4DG0E 3GENA 3I60A 3GXLA 2XNNA 3NW6A 3M2WA 2VTSA 2C5VA 1NW1A 5CNOA 4FGBA 5IA2A 2BDJA 4TYHA 3BGPA 2W1IA 4O7SA 1F5QA 4GMYA 5GZ9A 2GHGA 3WF7A 1FGIA 4YO6A 3QQUA 1OKYA 3UNJA 3LPBA 3NRMA 2OLCA 4I20A 3G15A 1XH6A 2GNJA 2C6DA 3TL8A 4CZUA 4I0RA 3R9OA 2XCKA 4ZSLA 4UYNA 1XH8A 4BCKA 3MV5A 4L01A 1W98A 2YISA 3E87A 5GZAA 2YFXA 2BRHA 4ANNA 4AN3A 4JIKA 2XKEA 2ZV7A 1V0PA 3N4VA 1X8BA 3BV3A 1WBTA 2A27A 4N70A 2WELA 3V8WA 3OW4A 2HY0A 3NAXA 4S30A 4NCTA 2OZAB 2ZDUA 4B8MA 5IG1A 2QURA 5FDPA 2HWPA 2XKCA 2VNWA 4CV9A 4G16A 1R3CA 1U54A 4UALA 4D5KA 2CGVA 2QOBA 5AR7A 4ZSAA 3D9VA 5ITAA 4ORKA 5IQFA 3FZSA 4ALVA 4IH8A 5M53A 5DMZA 1F3MC 1W0XC 3LFCA 3TV6A 2CGXA 4AZFA 5JKGA 1WVYA 2J0MB 3VS2A 2IVSA 3EH9A 4KSQA 1OPKA 3C1XA 4FT5A 4BDCA 2ITXA 2WNTA 4NWMA 4AX8A 4O0SA 3VBTA 2A1AB 4B7TA 1U5QA 5BUIA 1U46A 4DHFA 3BCEA 5G6VA 1XBAA 3D2KA 4F64A 4FV8A 3Q60A 3FMEA 3L9MA 4FG7A 4RVKA 3FMNA 2XF0A 2HENA 1G8AA 4DFBA 2G2HA 5FD2A 5CAUA 1FINA 3ODYX 4ZJIA 3VUDA 3SRVB 3EL8A 4J99A 3HMIA 4MNFA 1Q99A 4O0VA 4R3RA 4ANLA 2VTLA 3W2OA 4MF0A 3ZM9A 4F9BA 2BKKA 5A6NA 4FTOA 4U5JA 1WBNA 3FPMA 3QRKA 3NW7A 1P4FA 3OTVA 4EYJA 4YTCA 4V01A 4L43A 4EK5A 1XKKA 2RFEA 4DEIA 5I9XA 1S9JA 4BCIA 3DXPA 2GFCA 3FHRA 4M66A 4C7TA 4HGEA 3O50A 3R28A 4YZMA 4EEVA 2B0QA 4JRVA 5ANOA 4I5PA 3UGCA 4O6LA 3QTUA 2XJ0A 3E8DA 2XA4A 2CLXA 2WMRA 3LAUA 4F70A 3UOJA 2C47A 2VO7A 2R3JA 4QMNA 3QQKA 3BYMA 3SXFA 4Z55A 4F9YA 3TZ7A 4FVQA 3SC1A 3HEGA 4EHEA 2PVFA 4YLKA 3Q4ZA 2UZUE 4Q5HA 3N51A 4XBUA 5ANDA 4CKRA 2OI4X 1YHSA 4EUTA 4XG9A 4UXQA 5KMLA 4O1OA 2EXCX 3QQHA 3E64A 4FKQA 2YWPA 3I6WA 4QT1A 2W5AA 4FOBA 4OW8A 4YGAA 4UWCA 3PP1A 3V5QA 3ZRKA 4JL9A 4EZ7A 3PPKA 4D58A 1XH5A 3BBWA 3GOKA 4C4GA 4RC2A 4BFMA 3C7QA 3BEAA 3EQIA 2G9XA 4I4FA 3ALNA 4P5QA 4ENXA 3O0GA 1GJOA 4RWIA 3KXGA 2I7QA 1ZMWA 4ANMA 4L6QA 5CALA 5HTCA 5ICPA 4FODA 4LOPA 4QMYA 3UMXA 4C3RA 5K4IA 2QG7A 4B4LA 5M56A 3HA6A 2E9OA 2F7ZE 4AG8A 4C61A 4FG8A 3L9NA 4FEQA 3UIXA 1Z57A 5JT2A 2FB8A 2QKWB 4I24A 2R3GA 1YI3A 4QP6A 4KKGA 4PTGA 4R77A 4YZBA 2X39A 3O51A 3BEGA 3HP2A 3QFVA 4FKIA 4QMSA 4RFMA 3MIAA 5FM3A 5H9BA 3RAWA 4F0IA 4AFJA 3ANQA 4KD1A 4M7IA 2ETRA 4O7YA 4RT7A 4M0YA 2NPQA 4WT6A 4KS8A 5A14A 5HIDA 5KZIA 4CYJA 2HWOA 4D4VA 5JQ5A 3QC4A 2VWZA 4JBPA 4U3ZA 1SVHA 3UJGA 3MY0A 4ERWA 3R63A 3BWJA 4ZTLA 1W82A 2VAGA 3ODZX 1LEWA 4ZXTA 3DQWA 3MTLA 3DK3A 2XNPA 4A4LA 3PVGA 4NW6A 2PZIA 4XYFA 4BDBA 4DT9A 3KCFA 4DGGA 3HDNA 4S34A 4JDHA 4AW1A 3VUIA 5J9LA 3LVPA 4NW5A 3WI6A 4EOPA 3EL7A 1IASA 3OWLA 4QO9A 3UDBA 3FXWA 3GI3A 4FTQA 3SD0A 4YU2A 2B4SB 4KINA 3NYNA 4CQEA 2A2AA 4ARKA 5HLWA 3EFLA 2R3IA 4FIEA 2IVUA 1PMVA 5KMIA 2DWBA 3G9LX 3HX4A 4N4SA 4LMUA 5FBNC 5M55A 4DGOA 3SHEA 2YIWA 1VJYA 4R6VA 3RZBA 2REIA 4AW5A 4F1TA 4CKIA 2OFVA 4EJ7A 4BWKA 3TNPC 2YJSA 3FZRA 3VBWA 2ZOQA 4RWJA 5I9ZA 4XUFA 2OXYA 5IUHA 3C4EA 2XJ2A 2E9PA 4UV0A 4IB5A 3CJGA 3F9NA 3QKMA 4K8AA 2V22A 4QMPA 3UMWA 3E92A 2SRCA 5LVOA 2J9MA 2R3PA 4QYFA 2ACXA 4HGLA 4TYIA 4AT5A 3AC5A 3PXFA 2B9IA 3FV8A 3MFSA 1JSTA 4MNEA 5L3AA 3PPJA 4D4RA 3KK8A 3FLYA 1K3AA 5J95A 1NY3A 4PX6A 4NM3A 4YLJA 5CU0A 2ZJWA 3ZU7A 4XG3A 4E4LA 5CZIA 3TTJA 4CCBA 4BKZA 2HZIA 3I81A 3QQGA 4FMQA 4J52A 2CCHA 4M13A 2PSQA 3K54A 3LXPA 5HIEA 4YJPA 3A7IA 3WF8A 4AOIA 2B53A 5C9CA 3F7ZA 4XV9A 2YA9A 4TYGA 4LV8A 5CI6A 1PXJA 5I3OA 4LQMA 4D2VA 2C3JA 1H1WA 3BGQA 4YTHA 3R7GA 4XJ0A 4L42A 2BIYA 5AUVA 5HE1A 2YJRA 4M67A 1ZWSA 3W8QA 3UP2A 1LEZA 1GZKA 3V8SA 4AP7A 5CVHA 1RDQE 3NUPA 1OKZA 3ERKA 5M06A 4AGDA 1JKKA 3UQCA 5M51A 4FT7A 1UU3A 3PVWA 3SOCA 5EG3A 3F69A 3RPRA 4KIQA 3Q4UA 4RQKA 2R3HA 2XK7A 5CVFA 3O8UA 4GV1A 2PVMA 3E7OA 2X7OA 3FZTA 3VUGA 2CCIA 5IH6A 5CENA 4ONAA 5HVKA 2YEXA 4ZTHA 2YITA 5AMNA 1XR1A 4P7EA 4MYGA 4UEUA 4AS0A 5GHVA 4F99A 5EM7A 2CDZA 5L8JA 1OL6A 2UZNA 1APME 3BHTA 3G6HA 5AEPA 5KMOA 3BYUA 3DU8A 4LV5A 4JQ8A 5AAEA 3HP5A 3POZA 4OAUC 1DS5A 3ZZWA 3TIZA 4CT2A 2WPAA 5T6KA 3TACA 2QOCA 5IMXA 5BNJA 3MA6A 3CSVA 1K2PA 3HUBA 1OL1A 2WMBA 4FZ6A 2XNEA 4CTCA 4FEXA 3MH0A 5T68A 1TKIA 4XLIA 4M15A 4ZOGA 3P9JA 5FEEA 2OW3A 4MXYA 2BIKB 4Y46A 3PWDA 3V6SA 3FMHA 3AMAA 1UU8A 4TNDA 4OTIA 3ELJA 4FV5A 4HW7A 3NNXA 1MUOA 2IW8A 5KMJA 4R1YA 5L8LA 4ZMEA 4BWXA 3OWKA 4O7WA 3A2CA 2FUMA 4RQVA 4ZSGA 1AQ1A 3BHUA 4ZJVA 4YNOA 2EB2A 2XVDA 1OUKA 2BCJA 3F2AA 3G51A 4C33A 1BI8A 4EZ3A 4RX5A 4EC8A 3D7TA 3N4TA 5CAPA 4EHVA 2RG5A 1FVRA 3HMNA 3NIZA 3DKGA 4R5SA 3UIUA 5DWRA 4HJOA 4MQ1A 4QMLA 5G1XA 3V04A 5HU9A 5LWMA 5IQDA 1Q4LA 4FTIA 3BELA 5KE0A 4KUJA 4ZMFA 2XK6A 3I0OA 2JFMA 2YIXA 3SAYA 2X7GA 5BX0A 2VTAA 1Q3WA 4ZLOA 3FE3A 1W8CA 5CEMA 3M11A 3I1AA 4XV3A 3IDCA 2PUUA 3GU6A 4HNIA 4XBRA 5EI2A 3LM5A 2EVAA 3O23A 3SV0A 2QKRA 4IC8A 5BVDA 1JQHA 4BI1A 5A9UA 2BVAA 4DFYA 2XIKA 3BYVA 3IGGA 4KABA 4K18A 3LHJA 4L44A 3W18A 4WSQA 4D9TA 1H4LA 1R39A 3TZMA 4EL9A 1KE8A 3UE4A 5HD4A 5CAOA 3UTOA 3HRFA 5HG5A 4DT8A 4FNZA 4QMVA 3SX9A 3CQUA 2QO2A 4RVTA 5BVFA 5AR3A 4UMRA 4EYMA 4M0ZA 3LFQA 4GVJA 4KKHA 3IW6A 1RE8A 4FICA 4FYOA 5M4UA 3GT8A 4NIFB 1Q62A 4CCUA 4UY9A 1JSUA 4DC2A 5KKRB 4QQJA 4RSSA 2YABA 3D2IA 3DB8A 3KRJA 3ID6C 4K1BA 4ERKA 2RIOA 4QOXA 5JZJA 2B9FA 3CE3A 3G6GA 4XOZA 3QCSA 4XG8A 3R9HA 3ZC5A 5J79A 4G6OA 4JG8A 3G2FA 4TWNA 5LVLA 5FEQA 4GSBA 4F9CA 4LL0A 3LCOA 4FL3A 3ZO4A 5HLPA 1ZOHA 5TR6A 1Q5KA 2H9VA 2GNIA 3OF0A 5ETAA 2W5HA 3P5KA 3VHEA 1LPUA 4TYHB 5KZ0A 2W99B 5DH3A 1YDTE 4F08A 5I3RA 3FXZA 1M2RA 4ACDA 1BMKA 2ITTA 2YERA 4JBVA 1GZOA 1QPEA 3UC3A 3DBQA 1YOMA 3CPCA 5HICA 2OJGA 3GCPA 4USEA 3PIXA 4H58A 2ITNA 3COKA 3DJ5A 3ZH8A 2BHEA 4TNBA 4FVPA 1ERKA 3CTHA 4X6RA 3DS6A 3FZOA 2YLFA 1UWHA 3H30A 4HYUA 2ZB0A 2WTCA 3FI4A 4QP7A 2WU6A 2WMUA 1IRKA 3UOKA 2AYPA 4RC3A 3UZRA 3GCQA 3H9FA 3GFWA 3I7BA 5EDQA 2W1HA 3TXOA 3MVLA 2ESMA 3B8QA 1H28A 2GHMA 4OTHA 3OXTA 4CZTA 4LL5A 4D2WA 2YM7A 3KULA 3GBZA 3ETAA 3UO4A 3BLRA 2CKEA 3RAIA 3E62A 3SXRA 1YI4A 2QQ7A 3QD0A 2WQEA 4BDAA 3CR0A 5B0XA 3CY3A 5GIOE 3LFNA 4B6LA 3SXSA 3O71A 5J5TA 5JGAA 3NUYA 3C13A 3AGLA 1OL7A 3QWJA 5FXSA 4BY9E 4DINA 2WTJA 1FPUA 5GJFA 1W83A 2NNWB 5AV4A 5A46A 3ZO2A 4WUAA 5KKRC 3ULIA 3N9XA 5A4CA 4IDVA 4HZSA 4O0TA 2Z7SA 4R1VA 3DXQA 2DUVA 4QMUA 1NVSA 2VTTA 2R9SA 3DK6A 5E8TA 3TG1A 3H0ZA 3CEKA 4ANQA 3CY2A 5HU3A 2YZLA 4FEUA 1UU9A 1ZY4A 3F7WA 4O81A 3R04A 1CTPE 2YACA 3COHA 3TT0A 2GFSA 5L2SA 2C1BA 3H3CA 5F9EA 2JAVA 3CLYA 4IVBA 3FKNA 5ETCA 2ZMDA 2A0CX 3KL8A 4L3LA 5HHWA 2VTOA 4EOMA 3HV4A 3NYXA 5EI8A 4YNEA 4EOOA 3KREA 1PXKA 4L67A 4M3QA 1P2AA 4JQ7A 1UKIA 3VW8A 5JGBA 3NMUF 1JKTA 4D2TA 3FC2A 1P14A 5JFWA 1Q97A 4CNHA 3NDMA 3DJ6A 4R3CA 1OIRA 4F6SA 4IWOA 3F3TA 2W1FA 3ORKA 2GS7A 3ORMA 3WIGA 3TKIA 3R0TA 3ENHA 4MK0A 3SW4A 5L8KA 3JR1A 3VS4A 2ZM4A 3OT3A 3PXKA 4O0XA 3TV7A 2V5QA 2EXEA 4QMXA 4Z7HA 2YDKA 3QLGA 1LUFA 4IM2A 4YJOA 5B7VA 2UW3A 2HOGA 1JPAA 2C3KA 3FWQA 4HYIA 5TKDA 2QOHA 5M07A 2C68A 4I21A 3SDJA 2J5FA 3CTQA 4EORA 4L68A 2CN8A 4HPTE 4NEUA 2HZ0A 4AUAA 3TV4A 4BYJA 4DITA 2XH5A 5JEBA 3GUBA 3OVVA 5IH5A 5CT7A 5BMSA 4FL1A 4GUBA 3E5AA 4BRXA 3EN6A 3DJ7A 4FL2A 3T9TA 2QR8A 4GYGA 2CKOA 3WILA 1O6LA 2CLQA 3DZOA 4ZSEA 2OJJA 4PMPA 2NP8A 1PYEA 5M09A 2Y7JA 1ZMVA 4E8AA 4E3CA 5HNGA 3TWJA 2QOKA 2R3FA 2GNGA 4IANA 4JOAA 2J2IB 4G3EA 4OUCA 5A4EA 4UMTA 3TNHA 4GT3A 4OGRA 2PVLA 3EKNA 3JUHA 2OWBA 4FKGA 2UW4A 4XNEA 4HVGA 4KS7A 4UMUA 3AT3A 5KMKA 5EDPA 5JRQA 2C1AA 1M52A 4CFMA 5CAVA 5D41A 3MA3A 1YOJA 4F6UA 5D10A 2IJMA 3ZUVA 2PMNX 4H3QA 4KSPA 1J7LA 3EN4A 4R78A 3DBFA 5CS6A 4Y73A 2BAQA 2VN9A 4MD9E 5L2TA 4BI0A 2J4ZA 4BF2A 5M57A 1QPJA 2UVXA 3THBA 4OR5A 4BTFA 3OW3A 3LIJA 3BV2A 5EFQA 1KSWA 4YZCA 4V0GB 5FEDA 3BHVA 5IUGA 5EQYA 5IH4A 3Q6UA 4KAOA 1GZNA 2C30A 4ZS0A 3PSCA 4H1JA 4YLLA 2IZRA 4Y5HA 2YLEA 3BQCA 3VRYA 3ZUUA 4J53A 4AA5A 2W1ZA 5CNNA 2ETKA 2X2LA 2HW6A 2V7OA 3TDVA 1UVRA 3ORXA 2O63A 4MWIA 4YP8A 1ZMUA 2A19B 4A4OA 4FV0A 2XIRA 5KUPA 4L8MA 4QTCA 3VAPA 3KRRA 4BTJA 1ZYCA 1NVRA 2R3NA 4FKOA 2CKQA 3SA0A 4I23A 3S0OA 4YZ9A 2GQRA 1MQBA 4QQCA 5CSXA 1ZOEA 4F7NA 2W9FB 3U4UA 3AC1A 3H10A 4AN2A 3IPHA 4IB0A 2OG8A 2C6LA 4R5YA 4A06A 3Q3BA 2YM6A 5LXMA 3F3VA 4G3CA 5FM2A 2GQGA 5F1ZA 3O8TA 4BGQA 3OT8A 3QGYA 4G17A 3UZPA 3U6JA 3EQCA 3UVQA 4Q9ZA 3ZXZA 3F3ZA 3HUCA 3NNUA 5HE0A 3ORTA 4A9UA 5K9IA 1UA2A 3EQBA 4JDKA 3PDTA 4YHFA 3PE1A 3HL7A 1W84A 2RFDA 2UZBA 4F09A 3QLFA 3CXWA 3BQRA 1M2QA 4RIXA 4LGGA 2P0CA 2BZHB 3E3BX 2Z2WA 4NIFA 3A4OX 4PMSA 2QVSE 1IEPA 2UW0A 3RZFA 3LLAA 3NCGA 3A60A 4UMQA 4CMOA 4MD7E 5C27A 5HZNA 1H08A 3F5XA 2IVTA 4EH8A 1SYKA 3JS2A 3FLWA 3EFKA 3PJ8A 3ZMMA 2ITWA 2JIIA 3P7AA 4IHPA 4RFZA 5BYYA 1YWNA 4GJ2A 3ORZA 4NT4A 3HKOA 5FQDC 3W32A 3LXKA 3HMPA 5L2IA 3KQ7A 4IJPA 4K0YA 5DVRA 2C6OA 2ZB1A 4E6QA 3KFAA 3T8OA 4MNEB 3OEZA 2O5KA 1ZLTA 4IWDA 4D2RA 2XS0A 2X8DA 2YN8A 4GH2A 2QO7A 3ALOA 3IONA 4C38A 3E8NA 1H1PA 3OP5A 2Q83A 5CSVA 4C2WA 1OMWA 3AC4A 3QF9A 4PTCA 2VWIA 1DI9A 1L8TA 4Z7GA 4R7BA 3QZGA 3TUBA 5C26A 4FTTA 2LAVA 4FZFB 2ITPA 3QXOA 4GKHA 3MFRA 4JG6A 1WMKA 3UPZA 5JK3A 4MXCA 4FT0A 4X3JA 4D1XA 4P2KA 1YQJA 1URCA 4G1WA 4XP2A 3KB7A 5H8BA 5JFSA 1J91A 3AD5A 4NL0A 3KVWA 2PMIA 3O7LB 4RZVA 4BDGA 5ANKA 1GIIA 3TEIA 5LVPA 3FC1X 4EONA 3F61A 4PDPA 3GC8A 4FTAA 2YAKA 3MH3A 5AIKA 3RPOA 4I4EA 3EQPA 5AV0A 3NX8A 3QTRA 4OTRA 4USDA 5IA0A 3KMMA 4UZHA 2VTQA 4KNBA 3RNIA 1OL2A 4FUXA 4UWBA 3RK7A 1Y8YA 3PJ2A 4FSMA 2YM4A 5DEYA 4ACCA 3F5GA 4IX3A 4DAWA 4N6ZA 2IN6A 4BDDA 2C0OA 3NUUA 3I5ZA 4EQMA 3PVUA 4NM5A 5EW8A 3ZO1A 3G9NA 3PY1A 4J97A 4JX3A 4AE6A 1WFCA 3ZFXA 5AP0A 1WCCA 4BIDA 2YAAA 5E4HA 2XNGA 1ZAOA 3QCQA 2JDVA 5DHJA 4UXLA 3VS6A 3QYWA 4XX9A 4FV6A 3IOKA 4EK3A 3FHIA 3E8EA 2BALA 5F20A 5AV1A 2H8HA 4EI4A 4JRNA 4RLLA 3PJCA 3GU4A 3MSSA 4KWPA 4APCA 3ZSGA 1W7HA 5EQEA 1NXKA 5E1SA 2BILB 2ERZE 4ZS4A 3EJ1A 3IG7A 4FNXA 4FZ7A 3TIYA 5J9ZA 2C3LA 3DPKA 4D9UA 3R71A 4W9WA 4FKWA 4RIOA 1JKSA 2VUWA 3V5TA 4Z16A 3BHHA 3MVHA 3P86A 4O2ZA 5C4LA 3B8RA 4KIOA 2WD1A 3C4ZA 4CSVA 2HZNA 2WMTA 4LGDA 4XRJA 2UZVA 4RG0A 5HG8A 4FV1A 3G0FA 3D7TB 1NA7A 4L52A 1PXMA 5IDPA 5L2WA 4PRJA 3RM6A 3FY2A 5E1EA 3H4JA 4TT7A 4C36A 3AC3A 3C4XA 4X7QA 3S3IA 1WBWA 3LE6A 4PY1A 4TRLA 4H3BA 4WNPA 2JDOA 4FV4A 3S2PA 5HBJA 2IPXA 4M84A 2XMYA 3R30A 5FG8A 1NT2A 3BU6A 2ITYA 5EKNA 4GT5A 4XH6A 4FKVA 4ZY5A 2OJ9A 4MKCA 3NNVA 5CYIA 2FO0A 5AV2A 1JNKA 2OXXA 2RGPA 3CD8A 3DNEA 5CEOA 4RBLA 4DYMA 3W8LA 3Q53A 3Q9WA 1IA9A 5E8XA 2J6MA 4RIYB 4BCFA 2WEIA 3RWQA 3BGZA 5D11A 4BKJA 4WOVA 3IDPA 4BCMA 3UIMA 4O1PA 4FTMA 4LRMA 4J1RA 1WBPA 3LMGA 3NPCA 5KO1A 1PMUA 4O6EA 2VGOA 3OS3A 4FTCA 3KK9A 5DI1A 1Q8UA 4YJSA 2P2IA 4AGWA 2QI8A 1PMNA 5GINE 4L45A 4OT6A 3T9IA 5CU3A 2ZDTA 3RTPA 4CRSA 4WNOA 2ZVAA 4XG2A 4HYHA 3NZ0A 4XP3A 3FLSA 3GNIB 4YC6A 1G5SA 3DNDA 5IA3A 2R7IA 2C6KA 4FSYA 5DT3A 4JBQA 3ROCA 4C34A 4USFA 3R9NA 3VJNA 4BZNA 1WBVA 4E4MA 2R3KA 5TE0A 4F7LA 5L4QA 5M4FA 4GS6A 5AP1A 3NNWA 4JR3A 1BKXA 3JPVA 4FV3A 5EW3A 1FBNA 4C4EA 4FKSA 3P0MA 4O82A 3LFEA 4II5A 2R3RA 4DLJA 2BTSA 3MDYA 2WIHA 3K3JA 4V0GA 4HPUE 4AT3A 1OIQA 3NGAA 4FUYA 5I9WA 4JLCA 3DDQA 4O21A 3PY3A 2PE0A 4YSJA 4AFEA 5LMKA 4W4XA 2BRGA 2CPKE 3PZEA 3ATSA 4FIJA 3PA5A 5A54A 3JY9A 3LFDA 4MD8E 4RJ5A 4TWPA 3W2PA 1ZYJA 1H0WA 2R64A 3W2CA 1URWA 4BDFA 1A48A 3MESA 3DCVA 4DFNA 1WVWA 2PMLX 1PHKA 5EYKA 3MFTA 4X2NA 4A07A 5H2UA 1TQIA 1BX6A 5A3XA 3KULB 4XRLA 4L3PA 3DKCA 2VO6A 5HESA 4FTNA 4HGSA 5I5ZA 3RAKA 3ACJA 3OFMA 3VS3A 4ZY4A 2R3LA 5FXQA 4DN5A 4CD0A 2FSTX 2QHMA 1V0OA 4NTTA 2VD5A 3DBCA 5HVYA 2NO3A 1JAMA 4RA5A 1T45A 5E91A 1STCE 2UW5A 3NR9A 4FA2A 3MI9A 5E90A 1KE7A 1XO2B 5E8UA 4EZ5A 4MHAA 1B6CB 2HIWA 3C9WA 1OBDA 2OJIA 3KF7A 1FGKA 5EYMA 5IF1A 4DA5A 4Q2AA 1H25A 3PY0A 3R2BA 2FSOX 1O6KA 5EHYA 4M69A 3GU8A 3BHYA 4YSMA 4JG7A 4QP3A 3AOXA 3D7ZA 2FH9A 4YHTA 3F66A 2GHLA 3CC6A 1O6YA 2W05A 4KBKA 5E8YA 5HLNA 1OZ1A 4L7SA 3MY1A 2RL5A 2PE2A 2AUHA 2CSNA 2V7AA 1J1CA 3Q9XA 4MXOA 4DGLC 4EHGA 4MEDA 3QZHA 3P7CA 4FSQA 4U45A 2C3IB 4I22A 5IDNA 4YR8A 4XHKB 3PP0A 4ZLZA 4CVAA 1E1XA 1MQ4A 3E88A 4GCJA 3TM0A 3RI1A 1Q61A 4WHZA 3VHKA 4H39A 4UN0C 3RCDA 4U3YA 4QTEA 3LM0A 3QQLA 3ORPA 3PIYA 2GQSA 5HQ0A 5FP6A 1PXOA 4PDOA 3AXWA 2F7XE 4PWNA 4KRCA 4RC4A 4DTBA 1PXLA 5CWZA 3QRUA 3PLAE 2WMWA 4MXZA 3PJ1A 4JJRA 3TNWA 3GQIA 3R8PA 5HKMA 3LFSA 3K5UA 4C02A 3HMMA 4D1SA 2PL0A 4ZSJA 2YZAA 3ZONA 5L6PA 4L3JA 2WOTA 3TZ8A 3A7FA 3KEXA 4AOJA 5CT0A 1FVTA 4PL5A 3FZPA 4FNYA 1J7IA 2P3GX 4DH1A 3ZHPC 3TKHA 3HYHA 3R7IA 3FLQA 3AGMA 1PMEA 2WIPA 3VUHA 1KE6A 1OUYA 3RMFA 3RNYA 4ANSA 3GVUA 1QL6A 3OOGA 3PLSA 4K6ZA 4X2JA 4AF3A 4CV8A 3Q5IA 4LOQA 4C58A 4DEHA 2UVZA 2C6IA 1GIHA 3F3UA 5DR2A 4BBEA 5E8VA 4FGRA 4F0FA 5HE3A 1F0QA 4BICA 5IPJA 2PK9A 4I94A 3DTWA 2PZ5A 2VWXA 4YJUA 2XZSA 3ZSHA 4IFCA 3Q6WA 4K11A 1ZOGA 4GVAA 3RCJA 4CZYB 4YJQA 3P79A 2JD5A 3DBEA 4TXCA 5BUJA 4O0RA 2EB3A 3VIDA 3ORLA 2CGUA 4XLVA 2Z7QA 5HCYA 5K5XA 4OTFA 4DH7A 1VYZA 4TWCA 5E8ZA 4AZSA 2GS6A 3R7VA 2CMWA 2VRXA 3VUKA 4C37A 4WUNA 2UZLA 3IW8A 4RJ7A 4WNKA 1KUTA 1A9UA 2W9ZB 3TZ9A 3JVRA 5FP5A 5FBOA 5HCZA 2R0UA 2YM8A 2BUJA 2CNUA 3HAMA 4IM3A 4TW9A 4PP7A 5GIPE 3CTJA 5AP6A 2PULA 4U9AA 3W2SA 4GK4A 4CLIA 2W0JA 3L1SA 4BKYA 2F2CB 4WG4A 2PUIA 4BCQA 3TJDA 2CJMA 3RHKA 2R3QA 2DYLA 2IZSA 2Y0AA 2CN5A 3GC0A 5E7RA 2VTMA 2RG6A 2I0HA 4G5JA 3R7UA 3BLQA 5M4CA 1ZARA 2WHBA 3ATTA 3D5UA 2WO6A 2JIUA 4FIGA 3NUXA 2Y9QA 3ROYA 4LUDA 1Q24A 3JVSA 4BGHA 3KC3A 4BHNA 3OD6X 4RA4A 4QYHA 4RFYA 5DR9A 2QODA 5DRBA 5A4QA 3FJQE 5AFVA 3R1SA 4CKJA 3UPXA 2QU5A 2RFNA 4DEEA 3OUKA 2WAJA 3EQFA 4IZ7A 4JIAA 5CF6A 3RPSA 4C4IA 1SMHA 5IISA 3ORNA 4RIYA 2WQNA 3ZDUA 3QBNA 3TUDA 3EYHA 1GIJA 2UUEA 4KRDA 4DE4A 4O22A 1VEBA 3A61A 4LRJA 1XJDA 4F1OA 4X3FB 3RJCA 1FMKA 1KV2A 2P55A 1MP8A 2VX1A 2JFLA 4I5HA 4O0UA 5AR5A 5BVWA 1GOLA 3D14A 3FKOA 5HNBA 4DCEA 3V5LA 4E5BA 3NWWA 3OC1A 4O0YA 3ZRLA 4C0TA 4RIXB 4ASDA 4C35A 4E73A 4CLJA 3ZLWA 5K0KA 3NYVA 4GJ3A 2WQBA 3IW7A 4WRGA 2HW7A 4G34A 3PZHA 5DFPA 3DDPA 1OM1A 3F3WA 1Z5MA 2CGWA 4ALUA 3VULA 5HCXA 2EXMA 4J7BA 4PL4A 5AR4A 3ZRMA 1Q8WA 3F5PA 3A7HA 3AC2A 2ONLA 1R0EA 5IEYA 3EHAA 2PZPA 5AR8A 2XRUA 3EOCA 4QMWA 4NJ3A 4EQUA 1G3NA 2ZAZA 4IZAA 2QU6A 1Q41A 3KF4A 3UQFA 4BBMA 3CIKA 3REPA 5HBEA 3FL4A 4YPSA 2WMVA 2XRWA 3MB7A 3W1FA 4DH5A 4JDIA 4C59A 3R1NA 4D28A 4FKUA 3LLTA 3QTXA 4I1ZA 5L2QA 3RBWA 4U44A 4QD6A 2BPMA 3V3VA 1M2PA 4CMUA 5JMSA 2X6EA 3EZVA 4FIFA 3GU5A 2JDRA 5AWMA 5HVJA 4ASEA 5M44A 4K9YA 3ULZA 4FBXA 3AG9A 4N57A 1ZYDA 4P5ZA 5ANGA 3FSKA 4I5MA 4AA0A 4CFWA 2UZWE 3PRFA 3NEWA 4EH2A 2X8IA 2HCKA 2VZ6A 5HNIX 1QCFA 2IG7A 3WZJA 2ZV8A 4UB7A 2JITA 2OZOA 3A8WA 1KWPA 2WTWA 2X81A 4YURA 3LJ0A 4F1MA 1Y6BA 5AM6A 2I0YA 4X3FC 2XCHA 4O7TA 1UU7A 4IZYA 4U81A 5IUIA 3R8ZA 3PVBA 1GNGA 3TNQB 1OL5A 3BRBA 3KVXA 1RQQA 4JQEA 4BDHA 1U5RA 2EUFB 2RSVA 4UMPA 3PTGA 4ZTMA 3JXWA 3UG1A 4RZWA 2R4BA 2XM8A 3BKBA 3IECA 4IAYA 3I0QA 4QYGA 1YW2A 5CEPA 1YXUA 2B9JA 2O0UA 2X8EA 4G3DA 3OY1A 3LQ5A 4PL3A 4HVIA 4ZTQA 4DEDA 2XBAA 2PE1A 4O27B 4EH5A 3ZM4A 4XV1A 5HE2A 2VTRA 3EFJA 3MH2A 3LQ8A 5KBRA 5LWNA 1SM2A 3ZYAA 2ETMA 3AQVA 1JKLA 5CZHA 2W4OA 3LCSA 2F4JA 5CQUA 3U55A 5DG5A 5K3YA 4F9AA 3DFCB 4LI5A 1Q3DA 3K2LA 3O7LD 2B54A 5M4IA 5I9VA 4EWHA 4MF1A 1WAKA 5HTBA 4IE9A 4TKSA 5AAFA 4JAJA 3VVHA 3IS5A 2JBPA 4IM0A 3EQHA 4DEGA 4NK9A 2W1GA 5JN2A 5HBHA 4IEBA 5H8GA 5HG9A 1IAJA 1BUHA 3Q32A 3MW1A 2BHHA 5BPYA 3L9LA 4LM5A 4U6RA 2PUNA 5D7AA 3SG8A 2X9EA 3ZFYA 3R1QA 2YCQA 1QMZA 3KRWA 2H6DA 5CEQA 3D4QA 2YIYA 4I92A 3BZ3A 3ZUTA 2VO0A 4XS2A 4G6NA 3MWUA 4EHZA 3QCXA 3VO3A 4V04A 3UO5A 1REJA 1YXSA 3HV3A 3CKWA 3D0EA 4FSUA 4MX9A 4H05A 3DZQA 2PTKA 1OI9A 5IQBA 1JOWB 3DA6A 1PYXA 4I0TA 3MBLA 4X6QC 4NM0A 1BYGA 2WKMA 5FTQA 4G9RA 2Y6OA 5IQGA 1A06A 1O9UA 1HCLA 4MWHA 3DY7A 4NJDA 3PE2A 2C0IA 3KXZA 4U41A 2XK9A 4BGGA 3COIA 2IVVA 4J96A 4DFZE 4O7LA 2QOLA 1H1SA 2PWLA 2W5BA 3BYSA 3MGYA 4C8BA 2WMQA 2QLQA 4BZDA 4WNMA 4PF4A 2QOQA 4GFGA 3BIZA 4IX5A 4UZDA 2OFUA 5EHOA 2UW6A 5HD7A 4C3PA 3PSBA 3LMIA 4BB4A 4FI1A 3BBTB 4IACA 5B2MA 1SVEA 2PPQA 3HMOA 4ZTRA 3R8MA 5BVNA 3BE2A 3BPRA 5H3QA 3ZLYA 4BCPA 5CAQA 3C0HA 3PFQA 3R7YA 2QO9A 4CFNA 3ITZA 4MQ2A 4O7RA 2GTMA 4OBPA 1IR3A 4FT3A 4BTKA 1WZYA 2PVNA 4CFXA 3FI3A 2WZJA 3KRLA 2Z7LA 4Y5QA 4C3FA 4GRBA 4ZJJA 2G2FA 4BR3A 2Y4IB 4F7JA 3R9RA 1XHAA 5TO8A 1ND4A 4RX8A 3C4FA 4J8MA 4BIEA 4RJ8A 4BDKA 4CFVA 5CSHA 4WG5A 3IGOA 4IXPA 2GDOA 3FI8A 4FKJA 3D94A 1MRVA 5DYJA 1M14A 3FL5A 3PXZA 3QWKA 2CKPA 4YHJA 2EWAA 3KA0A 4KIPA 3MPAA 4O96A 5KHWA 4MBJA 5IA1A 5AP3A 1YOLA 2I1MA 2QLUA 2VTNA 3OCSA 5DGZA 3UIBA 4C62A 3O8PA 5F95A 5IQIA 3B2TA 2BMCA 1OB3A 1RW8A 4FIIA 4QP2A 2C69A 4QP1A 3RK5A 4AGCA 3BX5A 1P4OA 3FMKA 3HRBA 3IO7A 4MXAA 4UBAA 5ETFA 3QUPA 4NH1A 3CP9A 2B9HA 4RX7A 2GNHA 2PVRA 4OT5A 4F65A 2GSFA 4MBLA 5HX6A 4O7NA 3LFBA 5FUTA 4I93A 3TJCA 5CU2A 4L46A 1BL7A 4GIIA 4ACGA 3KXHA 1YHWA 4RLKA 3KU2A 2JKOA 3NW5A 1G8SA 1SNXA 4FC0A 4YPDA 1AGWA 5AA9A 3FMJA 1YDRE 2F7EE 3KXXA 3GC7A 3GOPA 4FKLA 3NAYA 3ZC6A 3DTCA 5C03A 5J1WA 1H8FA 4WSYA 2PVYA 3QKKA 4AU8A 1YXTA 4A9TA 2W4JA 1CSNA 2I0VA 3MIYA 1LP4A 3UYTA 4JX7A 3MB6A 3VF9A 2JDSA 2PZYA 3NUNA 4LOOA 4NSTA 4FSZA 3BLHA 3I5NA 3OXZA 2XYUA 5B2LA 4E93A 3RWPA 3ZBFA 2Y4IC 2F57A 3GP0A 3QA8A 3CKXA 1FOTA 4X3FA 4AZTA 2VGPA 2ZM3A 2X0GA 4FOCA 3R9DA 2GNFA 2R2PA 5GJGA 3S00A 2RF9A 2W1DA 3G33A 3M42A 3P7BA 3S4QA 2JKMA 4RWKA 2I0EA 2WTVA 3EKKA 4L7FA 3A4PA 5EW9A 3C0IA
chains in the Genus database with same CATH superfamily
1T46A 4FF8A 3WZUA 5AUXA 2PYWA 1ZXEA 4OBOA 2OF4A 4M69B 4F6WA 4RJ6A 4FEWA 4X2KA 3AMYA 4QMMA 4QYYA 4FE2A 1R0PA 1PXIA 3GCSA 4D5HA 5ANEA 1KE5A 4HOKA 3WE8A 1M7QA 4QTBA 4G5PA 1GZ8A 4WIHA 3WYXA 4A9SA 3OROA 5J9YA 4AZVA 1H1RA 2I40A 3G5DA 1UNHA 4PPBA 4BCGA 1I44A 3LXLA 4E20A 4LG4A 2ITOA 3QX4A 1EH4A 5LMKC 4QTDA 4WD5A 3KGAA 2OKRA 3FDNA 4FTKA 5ACBC 4GU9A 4KIKA 2XK8A 4XOYA 2OBJA 4EOQA 3GQLA 4IX6A 4L53A 4RRVA 3IKAA 3DAJA 3C4WA 4G3GA 4TTHB 2Z60A 4DG3E 3R8VA 3PPZA 3UNZA 3O17A 4HCVA 5HTIA 2VTJA 4XG7A 1WBOA 4Y72A 3QXPA 2BDFA 3EIDA 5C8MA 4PNKA 3ET7A 3R7EA 3P23A 2WMXA 5AJQA 2BAKA 4U40A 3U87A 4GFOA 4AAAA 3GCVA 3L9PA 3DQXA 3W0SA 2KTYA 3CCNA 4AT4A 5EHLA 1J3HA 2C4GA 3L8VA 3C5UA 4YBJA 5EK7A 4E4XA 5CXZA 4MUQA 2C5NA 4FEVA 4I5CA 5CQWA 4L9IA 2BTRA 3I6UA 4QPMA 2B7AA 3HZTA 3OXIA 5KCVA 4K33A 4R8QA 5AP5A 2C0TA 4Y85A 5HORA 3VUTA 2WOUA 2ERKA 3L8SA 2IO6A 3OEFX 4RJ3A 4A9RA 5BYZA 2BAJA 3HECA 4NU1A 4EOSA 1AD5A 4PUZA 5ANJA 1OVEA 5A4TA 4CQGA 4RPVA 3U9NA 3VJOA 2F9GA 4X2FA 2VTPA 3CD3A 4YJRA 5AX3A 4D55A 5I4NA 3MS9A 4QMQA 4DFUA 4U79A 4HVDA 3QGWA 5DA3A 4DEBA 4IB3A 3SKCA 3RP9A 3PUPA 4P90A 4YJTA 1KOBA 4CG8A 3WZKA 3A62A 5C8KA 4O7VA 3KN6A 2WFYA 3VS1A 4DG2E 3U4WA 1XBBA 4TYEA 2PVHA 4RIWA 3F2RA 5I9UA 5CASA 3DBDA 5EM6A 3PWYA 5CEIA 2R3OA 2OF2A 4JNWA 1JLUE 3OHTA 2UZDA 3PJ3A 4Q9SA 1MRUA 3U6IA 3KMWA 1DAWA 2C5OA 3OY3A 2ZM1A 3PXYA 4GIHA 4JDJA 4YBKA 4FSNA 5BV3A 2J50A 3OG7A 3R73A 4B0GA 5LMBA 2VWUA 3ZDIA 2WU7A 3M1SA 3R1YA 5K4JA 2XNBA 4IJ9A 3EN5A 5JZNA 3T3VA 3VQUA 4U8ZA 5DT0A 3MVJA 3PYYA 2FSMX 4GUEA 5AUUA 5EKOA 4BZOA 4N6YA 4D2SA 1YWVA 4CMTA 4KBAA 3JYAA 2NRUA 1Y91A 2J90A 3LFFA 4FX3A 4Y8DA 3IOPA 4ASZA 4EBWA 4HGTA 2WB8A 3BL9A 5AADA 3RPVA 3QRTA 3TCPA 4U0IA 3CQEA 2J0IA 5LVNA 4FVRA 3SGCA 3IW4A 2J0LA 2GS2A 2XK4A 2ITUA 5CF4A 4QNAA 4CFFA 3V5JA 3Q52A 4QPAA 1FVVA 4WRSA 3UZTA 4CGAA 1I09A 1IG1A 1R78A 4AXFA 3W2QA 4HCUA 3O5AA 3SW7A 5HX8A 2XAOA 2VTIA 5HIBA 4LUEA 3AKKA 4BCNA 4QDEA 4DH8A 4ZZNA 3ORIA 5I0BA 1OPLA 1VR2A 2QHNA 4IQ6A 3TDWA 5FLFA 2Y6MA 2W1EA 3EN9A 3R01A 3S95A 3UBDA 4ANOA 3SG9A 4IWQA 2YHVA 3V5PA 3ANRA 4WO5A 3F6XA 4PNIA 3QHWA 1XH4A 2HYYA 4NZWB 4GG7A 4IMYA 3H9RA 2JBOA 1TFFA 2UZOA 2Y8OA 2ZYBA 4F7SA 3L8PA 3FXXA 2H96A 4GK2A 1E9HA 1Q8TA 2JIVA 3E8CA 2OICA 2RKUA 4FK6A 1TQMA 4CYIA 2BZJA 3PG3A 3CBLA 3C4CA 1TQPA 2BDWA 3QYZA 4R7HA 4E7WA 2X4FA 3QUDA 2BRNA 2PMOX 3TI1A 1QPCA 3H9OA 5TT7A 5JGDA 3IDBA 3LCKA 4GK3A 4OTQA 4NTSA 5BUEA 3G0EA 3TNIA 2DS1A 4QEBA 3OZ6A 4ZEGA 2QC6A 3RAHA 1YWRA 5F94A 5AX9A 5B2KA 4AZEA 2Z8CA 2XIYA 3QU0A 4YJVA 3RALA 2BROA 3DXNA 3LFAA 3R00A 1PKDA 3BE9A 3V01A 4O91A 4LMNA 3DOGA 4I41A 5HO8A 3I4BA 2HK5A 4EBVA 3PA3A 4LRKA 2WTDA 4GU6A 2UZTA 4K77A 5TOZA 2C5YA 2ZMCA 4N0SA 3RKBA 5AUWA 5IKWA 5C4KA 2R7BA 2HXQA 2ZFYA 5T3QA 2BRBA 3KN5A 5EOBA 3VN9A 2FGIA 2RFSA 3PG1A 2XKDA 3LJ1A 4IAFA 1J7UA 3OWJA 4DEAA 3AKJA 3JY0A 2W7XA 2KULA 4BDEA 1W2CA 2HELA 2WTIA 2IW6A 3PA4A 3QL8A 4IVDA 5A4LA 5KBQA 4F78A 4NKAA 4FYNA 3OBGA 3R02A 4EK6A 3FSFA 5LJJA 5JH6A 4BVUA 1Y57A 2WQMA 4BCJA 1M7NA 4ZTNA 4C57A 4EKKA 4ZLYA 4HZRA 3VRZA 2B1PA 5CLPA 2X4ZA 4AGUA 4ITHA 3SOAA 5D9HA 3UQGA 5KMMA 5J7BA 3CGFA 2PVJA 3VUMA 3D5VA 2ONLC 2WGJA 5EYCA 4D0WA 4JVGA 5CEKA 5FTOA 4QRCA 2FA2A 2UW7A 4FIHA 5DPVA 5H8EA 4DLIA 5IEVA 2X2KA 5HOAA 5ANIA 2OGVA 4V05A 3QZFA 3WIKA 3ZLSA 1NVQA 3QTWA 3CS9A 4FSWA 3ZLXA 4BDIA 4FKTA 5E8SA 2UW9A 4QP8A 4APPA 4PV0A 4A7CA 3NVKI 5DOSA 3LXNA 4D4YA 2ITVA 3LCDA 4BHZA 4EWQA 4GEOA 4I0SA 4QPSA 2WMAA 5E92A 3OBJA 3PRIA 2YIQA 4BDJA 5LCJA 1LR4A 3EFWA 3O96A 3FKLA 4AOTA 4AAYA 3TTIA 5BVEA 3UO6A 4D4SA 3LKMA 4M8TA 4DBNA 4FV2A 3R8LA 2WXVA 3HV6A 3LOKA 4TY1A 3IW5A 4W4YA 1TZDA 4HVSA 3WZEA 5CY3A 3DK7A 2G15A 3IK3A 4KB8A 2CHLA 1XMLA 3W0NA 5AA8A 2IWIA 4AE9A 1V1KA 2W06A 2OIDA 4DCAA 3HLLA 2VV9A 4PP9A 4W9XA 3BWFA 3ZXTA 4GG5A 4AACA 5C8NA 3VW6A 4OTDA 2X1NA 2XEZA 2HZ4A 1YHVA 1H27A 4IBMA 4CXAA 5IQEA 5HEZA 1YRPA 3HAVA 3O2MA 4KBCA 3QX2A 2X9FA 1E1VA 4YC8A 1BLXA 2J5EA 3MY5A 3QRIA 5CI7A 2F2UA 2QOFA 1OKVA 3E93A 2JKKA 2P33A 4D2PA 4YUQA 4U7ZA 4H1MA 5DN3A 4S31A 4F9WA 4AZWA 3GC9A 4G9CA 2XJ1A 4E4NA 2XB7A 4ZP5A 1OIUA 1OITA 3F2NA 4NFMA 4EH6A 4G2FA 5DT4A 4J71A 2OH4A 3R83A 4O7ZA 2OZAA 4MTAA 4IVCA 3RGFA 4G31A 4J95A 4BIBA 4EQCA 2Y4PA 4IAAA 3ZSIA 3ZZEA 1XWSA 2OJFE 3DB6A 4S33A 5GNKA 4CFUA 2R5TA 2V0DA 2VWWA 3QD3A 1PF8A 3GCUA 4FK3A 1H1QA 5J5SA 3DLSA 4ITIA 3EWHA 5EH0A 3MN3A 2VX3A 2GCDA 2F49A 5AIRA 4ZIMA 3W2RA 4CEGA 4D0XA 4GKIA 3ZEWA 5FXRA 3EQRA 2XIZA 3ZO3A 4AQCA 2XUUA 3BU3A 2XK3A 2OSCA 3VBYA 2B55A 4FRFA 3VS7A 4X0MA 4G3FA 4HYSA 4EOIA 3UVRA 4GYIA 2Q0BA 5M08A 3EMGA 1UNLA 4U97A 5CVGA 4IVAA 3F82A 1JSVA 4DHJA 1YVJA 3FMDA 5LARA 3P4KA 4FT9A 5DNRA 1XBCA 4IB1A 5DBXA 4TPTA 5LOHA 3CGOA 4P4CA 3Q2JA 4RVMA 2GPHA 3LW0A 1IAHA 4U42A 3FLZA 3EB0A 3I79A 5D7VA 5C01A 4NKSA 5DRDA 4H36A 5HI2A 2E9UA 4I3ZA 5L6WL 3NLBA 3SRVA 5CF8A 2JLDA 4U80A 4JBOA 3N4UA 2QD9A 2YIRA 2ZV2A 2YDIA 4IAZA 5EDRA 4C4HA 3OMVA 3Q04A 3U9CA 3UNKA 4TL0A 4OAVB 4Q5EA 4IFGA 1OECA 3MYGA 4XP0A 5DLSA 3WF5A 5CF5A 3QA0A 1H26A 1PJKA 3AC8A 4FG9A 3LZBA 1R1WA 1UV5A 1YDSE 2BR1A 3WF9A 4AA4A 3KXNA 3BU5A 5F4NA 2HY81 3FQSA 3HA8A 3QC9A 4RX9A 4TWOA 5IA5A 2UV2A 3G90X 5CX9A 3VBQA 4ZZOA 5FTGA 4IX4A 1W2FA 5JFXA 2V62A 1H01A 2VTHA 4M12A 5LCKA 4QP9A 2DQ7X 4WBBB 4AXDA 5AP4A 3VC4A 4FKRA 4TN6A 5JRSA 4ASXA 1W2DA 2W17A 3R6XA 4MVFA 5EYDA 5AV3A 4WKQA 4BCOA 4ANBA 4TYJA 3WARA 2VO3A 4FTJA 4A4XA 4EK4A 4U43A 4AW0A 2GU8A 3QHRA 3W10A 2R0IA 1FMOE 1DAYA 3U51A 5CANA 3NCZA 5CSWA 1U59A 2C6EA 3WOWA 3Q4CA 4EOKA 1V0BA 4UX9A 4DBXA 4XEYA 3UYSA 4R7IA 3UC4A 4JR7A 3PXQA 2UVYA 5AUYA 3V5WA 2HAKA 3NYOA 4I6BA 4OBQA 4CT1A 4ZZMA 4DFXE 3UOHA 4CTBA 4AW2A 2WTKB 3OTUA 5AR2A 3W16A 2VWYA 4ZTSA 3RINA 4H3PA 2UZEA 5K0XA 3KKVA 2QOOA 2J51A 1PKGA 2G01A 3W33A 3MTFA 3ZEPA 4FKPA 5IQAA 4OTWA 3ZBXA 2YWVA 2G1TA 1YXVA 2PVKA 4L00A 4GT4A 4E6CA 3DAEA 4JAIA 1MRYA 3KXMA 2IZTA 4O84A 2OO8X 1YKRA 1OKWA 4OTPA 1BI7A 1OGYA 3P08A 4IWPA 4YJNA 4KIKB 3K5VA 3QD4A 4O86A 2IW9A 1B38A 5FRIA 4YZNA 5JFVA 1QPDA 4W8EA 3CPBA 2O8YA 2YDJA 3LCTA 3FMLA 4NUSA 4PMMA 4QTAA 5IMEA 4BJJB 4QMOA 4QQ5A 1Q8YA 2OK1A 2IZUA 1CDKA 2R3MA 4IADA 5FDXA 3FAAA 4BYIA 2BFYA 4WG3A 3ZS5A 3LQ3A 1FQ1B 3RVGA 1KOAA 2OIBA 2QG5A 3D15A 3LMHA 2QOIA 2CNVA 3ZOSA 3DAKA 3ZCLA 3HRCA 2QCSA 3SLSA 3MVMA 1Z9XA 3OUNB 3VQHA 4LGHA 3QRJA 3QTIA 1ZYSA 2O65A 2X7FA 4O2PA 3D83A 2PUPA 2XIXA 3GEQA 5CU6A 1OPJA 3Q5ZA 4NYEA 4PMTA 4NFNA 4LFIA 5CXHA 4FSRA 4RVLA 5LMAA 4RJ4A 5KX8A 4UYAA 2LGCA 1YXXA 2C6TA 3OCTA 3RM7A 3DKOA 3QZIA 4AWIA 2VX0A 3Q2MA 2JGZA 1IA8A 1UKHA 2J7TA 3U6HA 5JSMA 4PPCA 3EQGA 4DF3A 5IQHA 2AC3A 5KHXA 4M97A 2OXDA 5HO7A 4X2GA 4ACHA 4R3PA 4F63A 3AT4A 3QTZA 4YMJA 5LQFA 3SVVA 4F0GA 3MPMA 1JWHA 2WTKC 5E9EA 3A7JA 4Y83A 4EKLA 3NIEA 4HVHA 3C5IA 3DKFA 3VNTA 2G2IA 3PXRA 3I7CA 3ZFMA 2I6LA 2FVDA 2OH0E 3II5A 3FZ1A 4QYEA 1U54B 4EUUA 3KY2A 4RMZA 4KA3A 5AP2A 3A8XA 1UNGA 3AKLA 3ZTXA 1Y6AA 1JBPE 3BI6A 3H0YA 4BI2A 4RIWB 4ZAUA 5J87A 4FTLA 4IZ5A 3CJFA 1VZOA 2W4KA 2BFXA 3FBVA 5AM7A 3IQ7A 3U54A 4QP4A 3B2WA 5TF9A 5DIAA 3GB2A 4ENYA 4XG6A 4EOJA 3R2YA 2VU3A 3DFAA 2GMXA 3VF8A 1PY5A 3QALE 1H07A 3VBXA 5IEXA 5IQCA 2PHKA 4PDSA 1H0VA 3SQQA 4FTRA 1PXNA 5AUTA 4BL1A 4LYNA 1PW2A 3MFUA 4DTAA 4E6DA 1JVPP 5HG7A 3HV5A 3MJ1A 2VWBA 3PIZA 4E6AA 5DEWA 4CG9A 3C51A 1RJBA 2AC5A 2EU9A 2XKFA 3HVCA 4IDTA 3OCBA 4M68A 4QNYA 4C4FA 2JKQA 4IC7A 2ZV9A 2XP2A 2O3PA 3WZDA 1SNUA 3R8UA 4C2VA 2B52A 1CKJA 4W8DA 1OGUA 2YCSA 4ZY6A 1M17A 4C4JA 3KCKA 2JEDA 5DR6A 2ITQA 3GGFA 3UOLA 1GAGA 1Y8GA 2QR7A 5DE2A 5FGKA 4D1ZA 3UODA 4TZRA 5AP7A 1J1BA 1L3RE 2XNMA 3R22A 4FZAB 4NM7A 4W4WA 3FY0A 3V51A 2OIQA 4A9YA 4DGNA 4O83A 4QMZA 4EH7A 2BZIB 3PFYA 5ACKA 2WEVA 5D12A 4OTGA 2P4IA 4O0WA 3UG2A 3A7GA 3NSZA 3RPYA 2JC6A 1ZYLA 1PXPA 4XCUA 3PSDA 3VS5A 3W55A 3V6RA 1YI6A 3P78A 5E8WA 3D5WA 2ITZA 1DI8A 1CMKE 4NCTC 4ACMA 4E1ZA 5A6OA 4PDYA 3R21A 4Z3VA 2W1CA 5KMNA 2PZRA 3HNGA 4PQNA 3TKUA 3MJ2A 3NS9A 2X2MA 2C5XA 3FEGA 5BYLA 2HXLA 4BCHA 2YCFA 4K2RA 5C1QB 4IW0A 3FQHA 2PY3A 5JQ8A 3ACKA 1CM8A 1XH9A 2VWVA 4UWYA 3EN7A 1SVGA 2X0OA 4MAOA 4W4VA 4Y95A 3WBLA 3AD4A 5GZ8A 4XV2A 3S1HA 3QTSA 4BWPA 3EQDA 3CQWA 1H24A 3QKLA 4EH3A 3Q96A 4FZDB 3W0MA 2JAMA 3AD6A 3C50A 3QQJA 3QUEA 4GW8A 4JS8A 2E2BA 5ETIA 4BC6A 4MXXA 2V55A 1TVOA 1PRYA 3LJ2A 1G8KA 4QQTA 5EI6A 3FLNC 3KRXA 1OIYA 3E63A 1U4DA 2QNJA 2YM3A 4FTUA 4FV7A 4ALWA 4BBFA 5LVMA 2X6DA 2QONA 3C0GA 3Q4TA 4S2ZA 4XG4A 4YTIA 4I6FA 3DV3A 2WQOA 3FMMA 4B99A 1KE9A 1H00A 1B39A 2J0JA 4DFLA 4JI9A 5IZFA 4I6HA 3V8TA 2E9NA 4RGJA 3DGKA 2XNOA 1HCKA 1WBSA 4EC9A 1K9AA 5I9YA 2E9VA 2YM5A 3HDMA 4QMTA 2W96B 1S9IA 3POOA 3WF6A 4RWLA 3RHXA 3L8XA 3F5UA 5HO6A 3GU7A 4WBOA 3OOMA 4JT3A 3VBVA 5AUZA 4IAKA 4B9DA 4E5WA 3FYKX 3P1AA 4MCVA 4J8NA 3AMBA 2Q0NA 1ATPE 1XQZA 3OWPA 4IAIA 4OLIA 3FPQA 2BKZA 1ZZ2A 1XH7A 3WYYA 1SZMA 4G6LA 4ITJA 4AN9A 1OBGA 5GJDA 3EYGA 3MH1A 4HCTA 5KNJA 1GY3A 1REKA 3VS0A 4AXCA 1Q8ZA 3COMA 2XM9A 4I6QA 4XMOA 4S32A 5FWKK 3A99A 4JXFA 2OU7A 1CKPA 4DGMA 1ZY5A 4HNFA 4MBIA 2O64A 3E3PA 2XEYA 4YZDA 3EZRA 4X21A 5AAGA 1KV1A 3Q9YA 1ZZLA 5L6OA 1P5EA 4B8LA 4DTKA 4J98A 4EJNA 2GNLA 4DH3A 4EK8A 5IU2A 2C6MA 2J0KA 2YCRA 2XBJA 2BZKB 2H34A 2NRYA 3QAME 4GL9A 5BVOA 2XYNA 1HOWA 2GTNA 3QD2B 4ID7A 4CRLA 3HV7A 5K5NA 5J1VA 3AT2A 5CSPA 3QQFA 1CKIA 3QCYA 3F88A 3DLZA 5EOLA 3K3IA 2CNQA 3ENMA 2JDTA 3FUPA 5J8IA 3UVPA 4MH7A 5IA4A 2BRMA 5EM5A 4FNWA 2Z02A 2Z7RA 4GFMA 5EM8A 4E5AX 4FV9A 4JMQA 1VYWA 3GFEA 3UP7A 4EH4A 4YTFA 3UDZA 3E7VA 3HGKA 4PTEA 4Z9LA 3U8WA 4EOLA 1DM2A 3DT1A 3OCGA 4YC3A 2P2HA 2XANA 2UW8A 3Q9ZA 3KMUA 5BQ0A 1ZRZA 5BMMA 4E26A 5J7HA 4EH9A 4YO4A 4O4CA 3VWAA 1WVXA 2FSLX 3R7OA 3NUSA 4FSTA 4BN1A 2FYSA 3FI2A 3NVMB 4O38A 4ZK5A 5CTPA 3NUAA 2A4LA 2O2UA 5BVKA 3WE4A 5EQPA 4IIRA 2PU8A 5CU4A 3QTQA 4BTMA 1UWJA 3FYJX 3BYOA 3D5XA 4BJJA 1BL6A 2VNYA 3FQEA 3T3UA 4KKEA 4WA9A 4PPAA 4M14A 3RK9A 3TN8A 3TUCA 3MPTA 4FR4A 5D1JA 2WMSA 4F4PA 5HGIA 4AXAA 4DG0E 3GENA 3I60A 3GXLA 2XNNA 3NW6A 3M2WA 2VTSA 2C5VA 1NW1A 5CNOA 4FGBA 5IA2A 2BDJA 4TYHA 3BGPA 2W1IA 4O7SA 1F5QA 4GMYA 5GZ9A 2GHGA 3WF7A 1FGIA 4YO6A 3QQUA 1OKYA 3UNJA 3LPBA 3NRMA 2OLCA 3BL7A 4I20A 3G15A 1XH6A 2GNJA 2C6DA 3TL8A 4CZUA 4LDTA 4I0RA 3R9OA 2XCKA 4ZSLA 4UYNA 1XH8A 4BCKA 2AQXA 3MV5A 4L01A 1W98A 2YISA 3E87A 5GZAA 2YFXA 2BRHA 4ANNA 4AN3A 4JIKA 2XKEA 2ZV7A 1V0PA 3N4VA 1X8BA 3BV3A 1WBTA 2A27A 4N70A 2WELA 3V8WA 3OW4A 2HY0A 3NAXA 4S30A 4NCTA 2OZAB 2ZDUA 4B8MA 5IG1A 2QURA 5FDPA 2HWPA 2XKCA 2VNWA 4CV9A 4G16A 1R3CA 1U54A 4UALA 4D5KA 2CGVA 2QOBA 5AR7A 4ZSAA 3D9VA 5ITAA 4ORKA 5IQFA 3FZSA 4ALVA 4IH8A 5M53A 5DMZA 1F3MC 1W0XC 3LFCA 3TV6A 2CGXA 4AZFA 5JKGA 1WVYA 2J0MB 3VS2A 1XMMA 2IVSA 3EH9A 4KSQA 3P5JC 1OPKA 3C1XA 4FT5A 4BDCA 2ITXA 2WNTA 4NWMA 4AX8A 4O0SA 3VBTA 2A1AB 4B7TA 1U5QA 5BUIA 1U46A 4DHFA 3BCEA 5G6VA 1XBAA 3D2KA 4F64A 4FV8A 3Q60A 3FMEA 3L9MA 4FG7A 4RVKA 3FMNA 2XF0A 2HENA 1G8AA 4DFBA 2G2HA 5FD2A 5CAUA 1FINA 1G8JA 3ODYX 4ZJIA 3VUDA 3SRVB 3EL8A 4J99A 3HMIA 4MNFA 1Q99A 4O0VA 4R3RA 4ANLA 2VTLA 3W2OA 4MF0A 3ZM9A 4F9BA 2BKKA 5A6NA 4FTOA 4U5JA 1WBNA 3FPMA 3QRKA 3NW7A 1P4FA 3OTVA 4EYJA 4YTCA 4V01A 4L43A 4EK5A 1XKKA 3BLAA 2RFEA 4DEIA 5I9XA 1S9JA 4BCIA 3DXPA 2GFCA 3FHRA 4M66A 4C7TA 4HGEA 3O50A 3R28A 4YZMA 4EEVA 2B0QA 4JRVA 5ANOA 4I5PA 3UGCA 4O6LA 4AQKA 3QTUA 2XJ0A 3E8DA 2XA4A 2CLXA 2WMRA 3LAUA 4F70A 3UOJA 2C47A 2VO7A 3VONA 2R3JA 4QMNA 3QQKA 3BYMA 3SXFA 4Z55A 4F9YA 3TZ7A 4FVQA 3SC1A 3HEGA 4EHEA 3W0OA 2PVFA 4YLKA 3Q4ZA 2UZUE 4Q5HA 3N51A 4XBUA 5ANDA 4CKRA 2OI4X 1YHSA 4EUTA 4XG9A 4UXQA 5KMLA 4O1OA 2EXCX 3QQHA 3E64A 4FKQA 2YWPA 3I6WA 4QT1A 2W5AA 4FOBA 4OW8A 4YGAA 4UWCA 3PP1A 3V5QA 3ZRKA 4JL9A 4EZ7A 3PPKA 4D58A 1XH5A 3BBWA 3GOKA 4C4GA 4RC2A 4BFMA 3C7QA 3BEAA 2XAMA 3EQIA 2G9XA 4I4FA 3ALNA 4P5QA 4ENXA 3O0GA 1GJOA 4RWIA 3KXGA 2I7QA 1ZMWA 4ANMA 4L6QA 5CALA 5HTCA 5ICPA 4FODA 4LOPA 4QMYA 3UMXA 4C3RA 5K4IA 2QG7A 4B4LA 5M56A 3HA6A 2E9OA 2F7ZE 4AG8A 4C61A 4FG8A 3L9NA 4FEQA 3UIXA 1Z57A 5JT2A 2FB8A 2QKWB 4I24A 2R3GA 1YI3A 4QP6A 4KKGA 4PTGA 4R77A 4YZBA 2X39A 3O51A 3BEGA 3HP2A 3QFVA 4FKIA 4QMSA 4RFMA 3MIAA 5FM3A 5H9BA 3RAWA 4F0IA 4AFJA 3ANQA 4KD1A 4M7IA 2ETRA 4O7YA 4RT7A 4M0YA 2NPQA 4WT6A 4KS8A 5A14A 5HIDA 5KZIA 4CYJA 2HWOA 4D4VA 5JQ5A 3QC4A 2VWZA 4JBPA 4U3ZA 1SVHA 3UJGA 3MY0A 4ERWA 3R63A 3BWJA 4ZTLA 1W82A 2VAGA 3ODZX 1LEWA 4ZXTA 3DQWA 3MTLA 3DK3A 2XNPA 4A4LA 3PVGA 4NW6A 2PZIA 4XYFA 4BDBA 4DT9A 3KCFA 4DGGA 3HDNA 4S34A 4JDHA 4AW1A 3VUIA 5J9LA 3LVPA 4NW5A 3WI6A 4EOPA 3EL7A 1IASA 3OWLA 4QO9A 3UDBA 3FXWA 3GI3A 4FTQA 3SD0A 4YU2A 2B4SB 4KINA 3NYNA 4CQEA 2A2AA 4ARKA 5HLWA 3EFLA 2R3IA 4FIEA 2IVUA 1PMVA 5KMIA 2DWBA 3G9LX 3HX4A 4N4SA 4LMUA 5FBNC 5M55A 4DGOA 3SHEA 2YIWA 1VJYA 4R6VA 3RZBA 2REIA 4AW5A 4F1TA 4CKIA 2OFVA 4EJ7A 4BWKA 3TNPC 2YJSA 3FZRA 3VBWA 2ZOQA 4RWJA 5I9ZA 4XUFA 2OXYA 5IUHA 3C4EA 2XJ2A 2E9PA 4UV0A 4IB5A 3CJGA 3F9NA 3QKMA 4K8AA 2V22A 4QMPA 3UMWA 3E92A 2SRCA 5LVOA 2J9MA 2R3PA 4QYFA 2ACXA 4HGLA 4TYIA 4AT5A 3AC5A 3PXFA 3W0RA 2B9IA 3FV8A 3MFSA 1JSTA 4MNEA 5L3AA 3PPJA 4D4RA 3KK8A 3FLYA 1K3AA 5J95A 1NY3A 4PX6A 4NM3A 4YLJA 5CU0A 2ZJWA 3ZU7A 4XG3A 4E4LA 5CZIA 3TTJA 4CCBA 4BKZA 2HZIA 3I81A 3QQGA 4FMQA 4J52A 2CCHA 4M13A 2PSQA 3K54A 3LXPA 5HIEA 4YJPA 3A7IA 3WF8A 4AOIA 2B53A 5C9CA 3F7ZA 4XV9A 4AXEA 2YA9A 4TYGA 4LV8A 5CI6A 1PXJA 5I3OA 4LQMA 4D2VA 2C3JA 1H1WA 3BGQA 4YTHA 3R7GA 4XJ0A 4L42A 2BIYA 5AUVA 5HE1A 2YJRA 4M67A 1ZWSA 3W8QA 3UP2A 1LEZA 1GZKA 3V8SA 4AP7A 5CVHA 1RDQE 3NUPA 1OKZA 3ERKA 5M06A 4AGDA 1JKKA 3UQCA 5M51A 4FT7A 1UU3A 3PVWA 3SOCA 5EG3A 3F69A 3RPRA 4KIQA 3Q4UA 4RQKA 2R3HA 2XK7A 5CVFA 3O8UA 4GV1A 2PVMA 3E7OA 2X7OA 3FZTA 3VUGA 2CCIA 5IH6A 5CENA 4ONAA 5HVKA 2YEXA 4ZTHA 2YITA 5AMNA 1XR1A 4P7EA 4MYGA 4UEUA 4AS0A 5GHVA 4F99A 5EM7A 2CDZA 5L8JA 1OL6A 2UZNA 1APME 3BHTA 3G6HA 5AEPA 5KMOA 3BYUA 3DU8A 4LV5A 4JQ8A 5AAEA 3HP5A 3POZA 4OAUC 1DS5A 3ZZWA 3TIZA 4CT2A 2WPAA 5T6KA 3TACA 2QOCA 5IMXA 5BNJA 3MA6A