2PVFA

Crystal structure of tyrosine phosphorylated activated fgf receptor 2 (fgfr2) kinase domain in complex with atp analog and substrate peptide
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
299
structure length
285
Chain Sequence
ELPEDPKWEFPRDKLTLGKPLGEGAFGQVVMAEAVGIDKDKPVTVAVKMLKDDATEKDLSDLVSEMEMMKMIGKHKNIINLLGACTQDGPLYVIVEYASKGNLREYLRARRPPGMESYQMTFKDLVSCTYQLARGMEYLASQKCIHRDLAARNVLVTENNVMKIADFGLARDINNIDKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLMWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPANCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRILTLTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Fibroblast growth factor receptor 2
publication title A molecular brake in the kinase hinge region regulates the activity of receptor tyrosine kinases.
pubmed doi rcsb
source organism Homo sapiens
total genus 90
structure length 285
sequence length 299
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2007-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2pvfA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2pvfA01
2W06A 3C51A 4EH6A 4PTEA 2X4ZA 3DJ6A 3D5XA 4IHPA 4BDDA 2Y6OA 4ZZMA 2V62A 2XM9A 3D15A 1WFCA 1KE7A 3DTCA 3F6XA 3QQKA 4QPSA 5DLSA 2X7OA 5AUXA 2XH5A 5LVMA 4K18A 4KNBA 2UW8A 4F63A 4DH8A 5AR4A 3LFBA 2JD5A 3ROCA 5AV4A 4XX9A 4I5CA 2WGJA 4AE6A 4A4OA 3PSBA 4CMOA 3IPHA 2WTDA 4RJ3A 3ZOSA 3SXRA 2XCKA 2GNLA 5L6OA 5HEZA 4EK5A 4CFNA 5CU6A 2R3LA 2REIA 3EJ1A 3GT8A 4RVLA 4XG7A 4YTIA 4JX7A 3PXRA 4AWIA 4CRSA 1GY3A 3BKBA 3FY0A 4Q9ZA 4KSQA 4EBVA 1S9IA 5A4LA 2OH4A 3ZEPA 4ZS4A 3EZRA 3BQCA 3GENA 2X2MA 3HVCA 3P08A 3QBNA 3R30A 4O1PA 5AV3A 5CQUA 3DA6A 5HBHA 4BDCA 4O7RA 2GHMA 5C27A 4KKHA 4FNWA 5ETIA 4F9WA 1KOAA 2IVTA 5FTOA 2F57A 2VWYA 4JBOA 2XKFA 2QLQA 4FT7A 4KA3A 5GHVA 4H1MA 4O0VA 3VQHA 4RWLA 1Q3WA 2RF9A 5A46A 2JBPA 3ZLWA 3ZO4A 4DCAA 5L8KA 5EI6A 2DUVA 1Q62A 3LFQA 2VTAA 3LIJA 3VUKA 1JWHA 3EH9A 2SRCA 5KE0A 4C57A 2RFEA 4KUJA 1H24A 1GIIA 2C6KA 3KK8A 5ACKA 2PVLA 3ZMMA 2HWOA 4W8DA 3FPMA 5IUGA 5K5XA 4I0SA 2IZRA 4PDOA 5M55A 5FDPA 1XH4A 2I6LA 1JSVA 3MTLA 2EU9A 3UQCA 1Q61A 3QRKA 3DQXA 3PIYA 1I09A 4RIOA 4AZTA 5BVDA 1SM2A 2O3PA 2C1AA 1WBVA 3LCSA 2BAQA 4EOIA 4RC3A 1TVOA 2ITYA 5ANIA 3S0OA 3HP2A 2OXXA 3U6HA 2EUFB 5FUTA 4WNPA 2XUUA 4J52A 2C69A 2I1MA 3K2LA 4DFBA 4J7BA 4KRCA 5T68A 1NXKA 3CP9A 4PQNA 3F82A 2GCDA 3ZO2A 2VTRA 3C13A 2JIUA 2WFYA 4O0YA 1KWPA 2A1AB 2O64A 2H9VA 3UIXA 1GZ8A 4BCFA 4X3FA 5FXQA 5H8BA 2W5AA 2GS7A 3EB0A 2G9XA 1ZOHA 3OVVA 4BCGA 4F9CA 3U55A 4A7CA 4Y83A 1U59A 2WB8A 1HCKA 2E9OA 5LVPA 4Z7HA 3HGKA 3FQEA 3B2TA 4F7JA 3UYSA 1NVSA 1STCE 3CTHA 3G2FA 4J99A 2GFCA 3RPSA 2OW3A 3UJGA 2R9SA 4FZ6A 4DFNA 4C2VA 3WZUA 4CZUA 4UMRA 5AFVA 3LM0A 4HCTA 5DYJA 2UZOA 3QAME 2X7FA 2NRYA 5JK3A 1G8AA 4NZWB 1CSNA 2P55A 4EHZA 4CKRA 3A7GA 3AC2A 2WMVA 1FBNA 2BZJA 3UP7A 1SNXA 2J90A 4QMWA 3BV2A 5DG5A 1H28A 4I6FA 2BDWA 3RNIA 5HD7A 1JKSA 5FEEA 4D1ZA 2R3HA 3ZCLA 3EFJA 2R64A 3UG2A 2G01A 4D2SA 4OUCA 3KXZA 2XIRA 3QTZA 4AS0A 4UWBA 2R3JA 3IW8A 4II5A 1GIHA 4CZYB 4DGOA 5K0XA 1U54A 2X1NA 2OXYA 1OIYA 4I3ZA 2E9UA 2ZB1A 4AU8A 3JR1A 2UVYA 3L8PA 4DLIA 4FIIA 1RJBA 4IX5A 4IX6A 3DCVA 4RPVA 4FR4A 5EQEA 4RSSA 3M42A 4JDKA 3LQ5A 3ZZEA 4CG8A 1XO2B 3CGFA 3QC4A 3BYUA 4TN6A 1UA2A 3H4JA 1YWVA 1B38A 4E4MA 4MWIA 3DU8A 3LXLA 5GZ9A 4GG7A 4C35A 3GCPA 3HV5A 4LI5A 4CNHA 3MPAA 2WTKC 1ZMUA 3H0YA 4MXAA 3WF8A 3UOJA 4ZLOA 3CKXA 5CANA 2WAJA 2FYSA 2YFXA 2W05A 2W1GA 2FH9A 5LMAA 4BL1A 4IB1A 4D2PA 2W4KA 3Q9YA 4XRJA 3DJ7A 4AN9A 2NO3A 3VWAA 1JNKA 3I0OA 4UXQA 2PVYA 3GVUA 3F5XA 5J87A 2FSLX 3VUDA 1YXTA 4QPMA 3IK3A 4GCJA 3R02A 4MXZA 4S30A 1Q5KA 3AD4A 5CY3A 4DEHA 4DEIA 1DAYA 4U8ZA 3N51A 3U6IA 4V0GB 4I1ZA 4BBMA 4TPTA 4DGMA 1W8CA 3FZOA 4RG0A 3IKAA 2OG8A 4ALVA 2YDJA 4XBUA 4M69B 3LMGA 4DTBA 2UW7A 2OZAB 3JS2A 3JVRA 3PZEA 2XBJA 3HV3A 3NLBA 5I9XA 3F69A 3DKCA 3FKLA 5HCZA 4DG2E 3Q3BA 4USFA 5BVNA 2OKRA 3UIBA 5EFQA 1H08A 5J7HA 4IAYA 2XS0A 3FZPA 3NVMB 4BDAA 1PJKA 3MDYA 4MWHA 3QZIA 5E92A 4NW6A 4F6SA 3QU0A 3QHRA 1Z9XA 4A9RA 1FMOE 1OL1A 3LXKA 3R04A 4EORA 1NVRA 3HEGA 3LCKA 4FV5A 5IQHA 1LEZA 3KK9A 4MKCA 3GXLA 5ETCA 4JG8A 2I0YA 2WMQA 5M51A 3UO5A 4QYFA 4IM2A 4AF3A 4M7IA 5A6OA 3NYNA 1JBPE 1ZZ2A 4GUBA 1WMKA 1BYGA 1M17A 4E93A 3PJCA 1H8FA 4MQ1A 5JZJA 3EIDA 3W2SA 2W1ZA 3PE1A 4FC0A 3R22A 3SDJA 4D2RA 2PL0A 3I7CA 4QYHA 1QPJA 2X8DA 4I6BA 4I4EA 5HE3A 5IQIA 3LCTA 4HNIA 3MPMA 4QP6A 4FNYA 1FVVA 2YJSA 3WBLA 3NAYA 4GS6A 3L8VA 4O6LA 5ACBC 4NH1A 5FWKK 4ASZA 4B6LA 3VBWA 4EOLA 4O0WA 3EQBA 2BROA 4K2RA 4MBJA 3U4UA 4J97A 2P0CA 3LFAA 2RG5A 2YITA 5CAOA 2QO7A 3NUAA 2E9PA 1J91A 5KMLA 2YCFA 2ITWA 3NRMA 3O23A 1H1QA 3EQFA 4GJ2A 3SHEA 3R8ZA 4H39A 5FQDC 1OKWA 3CBLA 4AW1A 3P23A 2YWVA 3R7EA 2CJMA 1FQ1B 3A2CA 2C0IA 3BIZA 3V51A 5J5TA 4H58A 5AR2A 3BHVA 3SA0A 3C5UA 4FTQA 3ATSA 3QQFA 4TT7A 2B0QA 4CKJA 1WVWA 5DBXA 3FLZA 3NNUA 3RCDA 4YZMA 4EEVA 4ZZNA 4RWJA 1J1CA 5GJGA 4AOIA 4CRLA 2ETKA 5LMKA 4RIXA 2OXDA 2YN8A 3MH0A 5L2QA 5JRQA 5CEQA 4TYJA 3U54A 3RWPA 3FDNA 5JQ5A 2RGPA 2JAVA 2OFVA 4EC9A 4WUAA 3CJGA 3KL8A 3OG7A 4JL9A 3HYHA 3G9LX 3CGOA 3EYGA 2UZUE 1OGUA 5HTCA 4OT5A 3HUBA 3A8WA 3TN8A 2HXLA 4G6NA 3IECA 4XH6A 4ZJVA 5EKOA 1YHVA 3F2RA 4BI2A 5AUTA 2QHMA 2C68A 5KMKA 1WBPA 3MW1A 3EN7A 4RT7A 4CV9A 2R3RA 3Q5ZA 3ZUUA 4ANLA 1Q8TA 3VS2A 2WMRA 4FTTA 4MCVA 4EONA 5EYDA 2B7AA 2IZTA 2VTQA 3BYMA 2VTMA 5EQPA 3VBTA 1UKIA 3UC4A 1OUKA 3GU6A 2BHHA 2C3LA 2QKWB 2VX0A 3POOA 4MD9E 1H07A 1E9HA 5M56A 5AV0A 3LMIA 5AX3A 4QP1A 3SXFA 4MBLA 3FYKX 3R0TA 3I4BA 4AQCA 1GZKA 3ZSHA 4FV9A 2ZV9A 3F66A 4X2NA 1UNHA 5EDPA 2VTIA 4O7ZA 2YHVA 3DPKA 4AT3A 2IVSA 4YJOA 2J51A 4GG5A 4MXYA 1O9UA 3V8SA 3D4QA 3LFCA 4GIHA 4CQEA 3DV3A 3DS6A 3ZXZA 1G8SA 3S00A 4D9TA 3G15A 1PXLA 2R0UA 4JBQA 1OL6A 4V01A 2WOTA 3L9NA 5CSWA 5AEPA 3PA4A 4W8EA 3NWWA 3KRJA 5HNGA 3AOXA 3QC9A 2GU8A 1JKTA 3HA8A 2HZIA 3TUBA 4A07A 5KKRC 3DB8A 2GNIA 3IG7A 4XOZA 5AAGA 3S1HA 4BF2A 2QOLA 5EHLA 3NYOA 2UZBA 4C7TA 2I0VA 4DEGA 4FV8A 4FSQA 4UX9A 3POZA 2E9NA 3GEQA 3U9CA 4RX8A 2ZJWA 2H34A 5HLPA 4YJQA 5E8YA 3WOWA 3ZDUA 3E8DA 2YZLA 3QL8A 3VUHA 3MB7A 3SW7A 5DA3A 3ET7A 2PZRA 3CLYA 4EYMA 3BYOA 3BHUA 3NNXA 3BHHA 4JVGA 4FGBA 4KABA 3TL8A 3UGCA 4QYGA 3NW5A 4GFGA 3ZFYA 4HPUE 1OPJA 1PY5A 5IQGA 3RPRA 4UY9A 1Z5MA 3H10A 2IN6A 2ITPA 4FSTA 5IQBA 5ETAA 2IZUA 3QTXA 2Y9QA 2ACXA 4L44A 3ZS5A 4UMTA 2W1HA 4PDSA 3OROA 2GS2A 4JLCA 4ACGA 5LVOA 4IX4A 4L68A 3RCJA 3V5QA 4L67A 4FEXA 3PYYA 3H3CA 2WNTA 3E7OA 5HIBA 4FKTA 5E8VA 4NM5A 3SVVA 5AUWA 4XV9A 3GCVA 3R7VA 4BTMA 3I81A 2C3KA 3MS9A 3DXPA 2R2PA 4BZOA 1Q41A 3FBVA 3R6XA 4NJ3A 4Y8DA 4PF4A 4P7EA 3VHKA 5A54A 2VRXA 4IWOA 4FTUA 5IA4A 2C5XA 5L2WA 5CSVA 2YACA 1W98A 2EWAA 4EL9A 4TKSA 2ESMA 5BX0A 2Q83A 5F9EA 1ZY4A 4DFUA 4YBJA 5HLNA 1XH6A 5JGAA 3EN9A 2PZPA 4WG3A 1DAWA 4R7IA 4EQCA 4JAJA 3E64A 3A99A 5HI2A 2GHGA 2W4OA 2UVXA 2RL5A 5JH6A 3VJOA 3E88A 3U51A 5IA2A 3Q52A 3RAHA 4EHEA 2JKQA 4XP2A 1A06A 3R73A 4YNEA 4EQUA 2CCIA 4KSPA 3V6SA 4N0SA 4TWPA 2CNUA 2ITQA 4PX6A 4TYEA 3DB6A 3OBJA 3WI6A 2VWXA 3OT8A 4FIFA 4KBKA 3QLGA 4OBQA 4CCUA 1GJOA 3QYWA 2BDFA 4FF8A 5J9YA 4E26A 2YM6A 4IXPA 3ZBFA 4FKLA 4EH4A 5BVOA 2YLEA 3K5VA 1H1RA 5IQCA 4AW0A 2WMAA 3OXIA 4DH1A 4EZ5A 4JI9A 5HQ0A 3CS9A 5D11A 3DFCB 4G6OA 4XOYA 4TY1A 4O22A 4MH7A 4YJTA 4ZP5A 3V5WA 3QRJA 4ZSLA 3MY0A 1YWRA 1J7IA 2C4GA 2QG5A 3W18A 2XNBA 5EDQA 4G3GA 4L43A 3KULB 4QP8A 4RC4A 2CCHA 5EM8A 3HDNA 3NS9A 5I9UA 5KZIA 4QNAA 3ZO3A 1SVEA 5DEYA 2BIYA 2EB3A 4QMLA 5CI7A 3W55A 5CF4A 2QHNA 1R0PA 3QX4A 4MNEB 4HVSA 3GU5A 5TT7A 1YOJA 3QKKA 2XYUA 4I4FA 4UMPA 1BMKA 4GEOA 4O7LA 2VU3A 1CKIA 2BRHA 4EKKA 4E4NA 2LGCA 2QOBA 1V0PA 3G5DA 4A4XA 3PSCA 3B8QA 3TG1A 2X8EA 4QMVA 5DIAA 4BYIA 1MRVA 3LJ2A 1UKHA 3MY5A 3RPOA 3VQUA 4P90A 3V8TA 1YDTE 2F2CB 2CLXA 3ERKA 2PK9A 2H6DA 5FBOA 4BHZA 3VHEA 1QPDA 5I9VA 5M06A 4BCPA 2X39A 4TL0A 3R1YA 3D0EA 4Z9LA 4FIEA 4NIFA 4MF0A 3PSDA 1VYZA 3F7WA 3FLYA 2YABA 4IC8A 3OWLA 4ZEGA 5K3YA 2XZSA 3QQGA 2P33A 2HENA 2P3GX 4QMTA 2ZM1A 3R7YA 4ZTQA 3NCGA 1DI8A 2ZM4A 3COIA 3DTWA 3AG9A 4ZIMA 3UTOA 3RINA 4R78A 4OTPA 3IOPA 1UWJA 4IM3A 2GNHA 4QMSA 2R4BA 1R1WA 4IQ6A 4YUQA 3FYJX 4BDKA 3SX9A 3KN5A 4R7BA 2PMIA 4HGTA 3DBCA 4EK4A 5DNRA 5B2LA 2YM4A 3KCFA 5HVYA 3E92A 3KXHA 1YHWA 4G5JA 3VBXA 3WYYA 3NX8A 4FIHA 1ND4A 4GIIA 2UZDA 4O7NA 3PJ2A 3UZPA 4PPAA 3VULA 2VUWA 5HD4A 3FC2A 2BTSA 2J50A 1LPUA 4BCIA 2PHKA 2C5NA 3PVGA 2XP2A 2J0KA 3AGMA 4PMPA 4AXAA 5CAUA 2HWPA 5CEOA 3ACKA 4IH8A 2FSOX 3SV0A 1AGWA 5BQ0A 1GOLA 1JOWB 3ZTXA 3KGAA 2WMTA 3PJ8A 4RVMA 5HVKA 5J1VA 2YIWA 4F0FA 2YEXA 4DFLA 5A4QA 5HX6A 3PRIA 1OPLA 3WZDA 1V1KA 4ZXTA 4IADA 1FMKA 2W5HA 3ZRKA 1BX6A 2XEZA 5IA5A 4USEA 2C6DA 3GFEA 5AAEA 1EH4A 3FI8A 3LFSA 2DYLA 4Y5QA 4EI4A 2W1DA 3ATTA 1MUOA 2XK9A 3GC7A 4G1WA 4GH2A 4PNKA 3NW6A 4JNWA 3G90X 2OIBA 2YA9A 5DRDA 1H01A 2QR8A 2FA2A 3QTSA 4E6AA 3HECA 3WARA 3T9IA 4HW7A 4B7TA 4X21A 4ANSA 4O7YA 3LFFA 4LMUA 4JIKA 4L8MA 4BDFA 3C1XA 3CCNA 3K5UA 3LCOA 4L3LA 2PE0A 1BLXA 1ZMVA 2R3KA 2QKRA 4R3PA 5BUJA 2OO8X 5HG5A 5AP4A 5F94A 4RIWB 5J79A 1P2AA 3QCYA 2GDOA 2OJ9A 5D10A 5GZ8A 4AA5A 4NM7A 4XG4A 4AOTA 5AR3A 5CALA 3IQ7A 4G3CA 3LJ0A 4O7WA 3BWFA 5E8ZA 4APCA 4OT6A 3ID6C 3FMJA 4XV1A 4HYHA 4IM0A 5L2TA 1XBAA 3TZ8A 2B1PA 3VS4A 4YPDA 4FTAA 4C3FA 3QKMA 5KUPA 3I6UA 4F4PA 3NUPA 4D9UA 4M14A 1OL2A 2QI8A 3DAJA 4IB3A 3HV4A 3MJ1A 4QMMA 4X2FA 4Y5HA 3V8WA 4PUZA 4TW9A 5M4FA 3ANRA 1M2QA 1CKPA 3GU4A 3DXNA 2UZEA 4JR3A 2XCHA 5D12A 4OGRA 4J95A 5IA3A 3OY1A 4ZY5A 4AN3A 4BCNA 2ETMA 3QUDA 2BIKB 2YWPA 4I22A 3RPYA 3WZKA 2I40A 3UOHA 1H0VA 4X3FC 4HZSA 4IW0A 3OCSA 3RTPA 4BDJA 4UZDA 4EZ7A 4F65A 4GSBA 5CASA 3GP0A 4ZAUA 2XK6A 3RKBA 4JDHA 4IAIA 4PMTA 4TYIA 4YHJA 5D7AA 1KE5A 1ZMWA 2BZHB 5GJDA 4D4VA 4DYMA 5KMJA 1RQQA 5E8TA 5KCVA 3R8LA 3RZBA 3AXWA 3P79A 4YNOA 4EKLA 4HVIA 4ZTRA 1P4OA 4RQKA 1VZOA 3IW6A 3TM0A 1JAMA 3E8EA 2VTHA 3DLZA 2QOIA 4ENYA 4OTGA 4EOQA 4KS7A 3TJDA 1Q24A 3R9NA 1YKRA 2LAVA 3UNZA 3FY2A 3TV4A 5HBJA 3IO7A 4UMQA 1ZRZA 3BE2A 4LYNA 3ULIA 4USDA 4X7QA 3Q2JA 5CU3A 5L2IA 4MNFA 4IVBA 4YLLA 2OWBA 4R3RA 5HESA 1JPAA 2F4JA 4FSZA 5CF6A 3QTWA 1GIJA 2XA4A 2VD5A 4BCQA 3ORTA 2JKOA 3G33A 5AR5A 3QUEA 3FHIA 4RIYB 5DE2A 2PUUA 5C4LA 1B39A 4QMZA 3Q32A 5EG3A 3PP0A 1KV1A 2PULA 1YXSA 3H9FA 3HLLA 3Q2MA 2J5EA 3BE9A 3BYSA 4W9WA 3BEAA 3H0ZA 3A7JA 3PY3A 4HVGA 3G51A 2IO6A 2VWZA 3DT1A 5AM7A 2A4LA 3OT3A 3S3IA 3SOCA 3G6GA 5BVWA 4C38A 3MBLA 2WZJA 1L3RE 3QX2A 4TTHB 4ZLZA 1R0EA 4JAIA 5L2SA 1URWA 2XJ2A 2Y7JA 4YU2A 3E63A 3OS3A 4X6RA 3FKOA 4LMNA 4FGRA 3GQIA 3ULZA 4DGNA 1A48A 1ZY5A 4F99A 2R3NA 3UMWA 2BVAA 4BKJA 4Q2AA 4R5SA 3IS5A 4DFXE 3R28A 4DGLC 2OZOA 4O38A 5IH6A 5L3AA 4OTRA 3FMEA 5ITAA 2ITVA 4K6ZA 2XK4A 2ZDUA 3MFTA 4YC6A 3UVQA 3R00A 2QOKA 3T3VA 3OWKA 1E1VA 2OI4X 5AM6A 4M69A 4WHZA 4HNFA 2WIPA 5FEDA 4DFZE 4TYHB 2OZAA 5K9IA 5ETFA 5AUYA 2CKPA 4WBOA 5EYKA 3VUGA 5M4UA 3R1SA 5A4CA 4KB8A 3DZOA 3UG1A 4ITJA 2F2UA 2JFLA 4OTFA 4YLJA 4ACHA 5LJJA 1IASA 5CSPA 3D7TA 3C7QA 2BKKA 3BV3A 4GFMA 3MY1A 3TZ9A 3ZZWA 4OAVB 5EH0A 2CHLA 3NR9A 3FI4A 3EFKA 3EOCA 3NUSA 4D58A 3L9PA 2PPQA 4CLJA 5HTIA 3NIEA 4QMYA 3DQWA 2J0MB 1YI3A 2WD1A 4YC3A 2UW5A 2B54A 3COKA 4K1BA 1SNUA 4GYIA 4TNBA 5IQEA 4X6QC 5ANOA 3RALA 4IAKA 4KWPA 4HGSA 2WTWA 2ZDTA 3CTJA 4U79A 2V55A 3QZHA 3ZONA 2RFDA 3DNEA 3S2PA 4D0XA 3R7GA 4I5PA 3TEIA 3PWYA 5E91A 3UZRA 3NUXA 4YMJA 3TNIA 5AWMA 3QKLA 3MVLA 5HIDA 3BGZA 4U80A 4RC2A 3IDCA 3WF7A 3ZLYA 4E4XA 3L8SA 1WBTA 4AGUA 2X9EA 1BL7A 4EJNA 3UVRA 4AFEA 1CM8A 4HOKA 1QL6A 4RA4A 1ZOEA 2QO2A 3O8PA 5IG1A 3CEKA 4FYNA 3Q4TA 2QOFA 4GK3A 2FVDA 4U97A 3ZC5A 2A0CX 2VTLA 5M57A 3TIYA 3BELA 3PE2A 5IZFA 4MXCA 1BI7A 4YJVA 5CVHA 3V04A 4RWIA 5HOAA 3KXGA 3Q4CA 2CGWA 4G5PA 5I3RA 5ICPA 4EWHA 1F3MC 5A6NA 1W82A 4H3BA 3OBGA 2BR1A 4OTQA 3PPZA 5F95A 1XWSA 3F2NA 4JJRA 5AX9A 5CNNA 4AW2A 4ANBA 1YW2A 4O2PA 2Y4IC 3VS6A 3KMMA 4L3PA 5BPYA 4FKVA 4C4JA 4UMUA 3SD0A 4L46A 4ITIA 4E6QA 3QQJA 4L00A 1MQ4A 2WU6A 5CLPA 4FV1A 3FLSA 1PXIA 5GNKA 1RDQE 4DT8A 2EXCX 3MSSA 4LOOA 3RHXA 4IWDA 3ORNA 4XLIA 5LMKC 2HOGA 2W96B 3F5GA 3EN4A 2YM7A 3DJ5A 4O0TA 2BRMA 3BHYA 4GJ3A 3VS7A 3MPTA 5HE0A 1TQPA 2X2KA 3WZEA 3BBTB 5J5SA 4HVHA 5JRSA 5JKGA 4L42A 3TDVA 5IUHA 4U9AA 3BHTA 3HP5A 1L8TA 5CS6A 3H9RA 4BZNA 2WELA 3UIUA 4YHFA 4EH3A 4ID7A 1OKYA 2J0JA 3V01A 4EOSA 3QLFA 3UO6A 4NEUA 2JDVA 3LCDA 4AW5A 4J8MA 3E87A 3KXMA 2IJMA 5ANGA 4YSJA 4O91A 3HZTA 2QNJA 3O7LB 4FEWA 1BUHA 1ZYJA 2PTKA 3O71A 3WE8A 4Z55A 3KREA 3OC1A 2XMYA 5F20A 3ORZA 2PVNA 4A9TA 5HO7A 4HYSA 5CAPA 2YM8A 5LXMA 3KRRA 3I1AA 4IACA 5E8WA 4G6LA 4FUXA 3EWHA 3C9WA 3FV8A 3KFAA 4XMOA 2QLUA 5DWRA 3JYAA 3WE4A 2B9FA 1Q8ZA 4XYFA 3MB6A 4IAZA 2YCSA 4QP9A 5AADA 2WXVA 3V5LA 3ORPA 4TYGA 3SC1A 1KE6A 5CX9A 3P4KA 5EM6A 2OF4A 3DKGA 3OTVA 1XH5A 3EL8A 3P9JA 4IC7A 3FLWA 2O0UA 4O2ZA 3RGFA 2VTTA 3EQRA 3K3JA 3KN6A 1W84A 2E9VA 2WO6A 1U5QA 4HZRA 4G17A 1O6KA 5GIOE 5AP6A 1HCLA 4EH7A 4DN5A 4GT4A 3HMOA 4RFMA 4ZLYA 3Q9ZA 1SMHA 3E93A 1O6YA 5FP6A 3QTRA 5JFWA 3FLNC 3R9RA 2YLFA 3QQHA 4BIEA 4EUTA 3ALNA 3B8RA 1NVQA 1IR3A 1IEPA 2JLDA 2PVKA 3P7BA 4FSUA 4CLIA 2WQNA 3Q9WA 5E1EA 2XK8A 3HKOA 4DG3E 5LVNA 3CIKA 3KF4A 2FGIA 1GZNA 2WQMA 3FUPA 3HDMA 2IVVA 1WCCA 3C4FA 4D5HA 1M2PA 4FTCA 2C6LA 2QCSA 2XIKA 3LFDA 4O96A 3ZHPC 3Q96A 3ORMA 5HVJA 4P4CA 4O27B 2XYNA 3UODA 5HICA 3JXWA 5E90A 2VX3A 1G5SA 3R1NA 2ITUA 3R71A 4WNKA 4BGHA 1VR2A 3AT4A 3TIZA 3UMXA 4ZTMA 3MWUA 3D83A 4DFYA 3Q4UA 2X8IA 2ITNA 2RSVA 4GT5A 3QFVA 3H30A 4K77A 4LRJA 3ZU7A 4U6RA 2A2AA 3ORIA 4JOAA 2VO7A 4NU1A 1LR4A 4G3FA 2BRGA 5CT7A 1ZZLA 2C0TA 1UU9A 5A4EA 3OEZA 4FKUA 4FNZA 4N6YA 5C03A 4BWXA 1U54B 2BTRA 3MFSA 4DBNA 4E5WA 3HUCA 4DAWA 4FVQA 4YJSA 5L8JA 4BVUA 3W33A 4ZTSA 3A61A 2WQOA 4QYEA 4A9UA 1REJA 3A7FA 4FV0A 3R7UA 4XG6A 4FKOA 5FTGA 2WQEA 1M7NA 4FZ7A 2ZOQA 3MH1A 3NNVA 1Q3DA 3WF5A 2ZM3A 3PA5A 2I7QA 3CQWA 1BL6A 3PY1A 5I4NA 4QTAA 4KD1A 4WSYA 5M4CA 5HORA 4C3RA 2ONLC 2I0HA 3QALE 4U44A 4YJUA 4GK4A 4L01A 4IJ9A 3DK6A 3AT3A 2F9GA 2XRWA 1FVTA 1OI9A 1PHKA 2V7OA 4FSNA 4QMPA 4XP0A 5TR6A 4C02A 2OJFE 3C0IA 3PIXA 4BRXA 4D2VA 3NGAA 4F1TA 4UN0C 2JEDA 3IW5A 3VS0A 1UU8A 5H3QA 4Z7GA 5KMIA 3LQ8A 3BEGA 3P7CA 4PMMA 1MP8A 1FOTA 2ETRA 2UVZA 2BALA 4KINA 3VJNA 3W2QA 4D0WA 4PRJA 5FTQA 2R3FA 3LM5A 1R3CA 3MA3A 4FA2A 5M08A 3QGYA 4A4LA 4BR3A 4C34A 4LOQA 2ZB0A 2IW9A 2B52A 3GU7A 3F3ZA 4F08A 5IEYA 1WBOA 3KULA 4RFZA 4YZCA 3NDMA 5CQWA 5IMXA 4RJ8A 2Z7LA 4MD8E 5DN3A 3TKHA 3GCSA 2O5KA 2WU7A 3PVBA 4MNEA 5G1XA 3R7IA 4ANOA 1ZYDA 3ZM9A 2YIQA 5CZIA 1R78A 3TNHA 3ZRLA 4CGAA 4IANA 3ZUVA 5M09A 4C37A 4EOOA 3RI1A 5BMSA 5KO1A 4RFYA 5AV1A 4JBVA 4NM0A 2GNJA 3A7HA 3UZTA 4C36A 3QUPA 5BNJA 4IBMA 4TWOA 5HLWA 1GNGA 3UPZA 4I41A 2Z02A 3O2MA 4PL3A 1Y57A 4NT4A 4DITA 5CXHA 2PUPA 3PXQA 3CKWA 5J7BA 5AMNA 4BDIA 3QWJA 5IDPA 3ANQA 4WKQA 3TNWA 4RMZA 2ZVAA 5DR9A 3VF9A 2XKDA 3C4ZA 4FEQA 4WOVA 3HL7A 4YJPA 2FSTX 3R8MA 2GPHA 4BIBA 3MV5A 3AGLA 3R9HA 2PE1A 2AC5A 3DXQA 4OR5A 1Q8WA 2WEIA 5FXSA 1W7HA 3FI3A 2XNGA 3R8PA 1GZOA 2KTYA 3DOGA 3O8UA 2QO9A 4LL5A 1ZYLA 5EI2A 4I92A 3TCPA 5HE2A 4PDPA 3JY9A 4UV0A 4FVRA 5J1WA 2GTNA 5HU3A 1QCFA 4ANNA 3MI9A 3II5A 1GAGA 5DT4A 4GW8A 5EW3A 5HO8A 4C0TA 4D55A 3HAVA 2WMXA 4FSMA 1KE9A 3I6WA 5TE0A 4BBFA 3UQGA 2W9FB 3FZTA 2PZIA 2ZYBA 4FV3A 1F5QA 2AYPA 3RAKA 4NKSA 5EKNA 3BI6A 1H25A 4CTBA 1UVRA 4ONAA 2ITOA 1PXMA 1JQHA 3D14A 3R2YA 4RVKA 5IKWA 4ZZOA 4HGEA 3MIYA 5CU4A 1U46A 2GNFA 4QNYA 5JFVA 3BWJA 4GFOA 3DDPA 4DH7A 2WQBA 5LCKA 4LV8A 4O1OA 4JIAA 4OLIA 3A7IA 3QZGA 4JQEA 2BAJA 4KIKA 5FG8A 4FT5A 2VWBA 5H9BA 3GFWA 3QD2B 5AP2A 5HZNA 5IEXA 2J6MA 2ONLA 1Y8GA 4RIXB 4KBAA 5LVLA 3RPVA 4U41A 2CKEA 2V22A 2CN5A 3AC5A 5CSXA 4UWYA 4QD6A 5HNIX 4I24A 2G1TA 4S31A 4WNMA 3N4VA 1CKJA 1WVYA 2YDKA 3C5IA 1XBBA 4R77A 3UDBA 3NVKI 1VYWA 4MXXA 3N4TA 4W4XA 4FTOA 5CYIA 4N57A 3JY0A 1XH8A 2BZKB 3CXWA 4OTDA 3F2AA 3TNPC 4XG8A 4F0GA 5I0BA 4MAOA 3WF9A 2JIIA 4H36A 4FIJA 4FICA 3CY3A 3BU5A 3TJCA 4I6HA 2PVJA 4XHKB 4X2KA 4TRLA 4CMTA 2CDZA 3LVPA 2YAAA 4QOXA 4ACMA 4LOPA 4CV8A 2HK5A 4UALA 4QQ5A 4PP7A 4BTFA 3MVMA 1REKA 4FV7A 1YDSE 4MHAA 5L4QA 5GJFA 1QMZA 4YO4A 4IVDA 5KBRA 4EWQA 5CEPA 4JRVA 3R63A 4ZK5A 3VN9A 2QU6A 3DK7A 4MBIA 5KMOA 1PXOA 2V0DA 3KRWA 3C0GA 2X2LA 3LOKA 4IAFA 4ZMFA 4DTAA 3ITZA 2A27A 4WBBB 4IB5A 5DMZA 2OICA 2VO6A 4C4HA 3ZSIA 2OSCA 4B4LA 3RNYA 2VTNA 3H9OA 4XEYA 3VBVA 2C6TA 3ZRMA 2C6OA 3KEXA 2FB8A 1P4FA 4AA4A 5IPJA 4FUYA 3BGQA 3FXZA 3RK9A 3P78A 4GUEA 3VC4A 3FMNA 5JFXA 2YIXA 4DTKA 5EI8A 4GU9A 3LXPA 1OVEA 4IVCA 4I94A 4QMOA 4BCMA 3UNKA 3E8CA 3EHAA 3I7BA 4FODA 3DKFA 3PG1A 4FKQA 4O82A 3F3VA 4BB4A 5DHJA 3IDBA 3LHJA 2C3IB 2XKEA 4DEAA 1YI6A 4TWNA 1PMUA 1RE8A 3SRVA 4C8BA 4FKPA 3NNWA 4FTLA 3RMFA 5EOBA 3WIGA 3ODZX 4C58A 1DI9A 1KV2A 1OB3A 4BTKA 2BFXA 2XRUA 4J8NA 2B9HA 3OMVA 4K0YA 4F6WA 1OIQA 5K4JA 4R1VA 5JGDA 2GS6A 4EOKA 5H8GA 3OF0A 4FIGA 3LW0A 4CYIA 1IAJA 4AZEA 1ZWSA 5JN2A 3FMDA 4YSMA 4C4IA 3TUCA 4O83A 4ARKA 1Q8YA 3EQIA 4O0XA 4M67A 3R8UA 4F0IA 3O7LD 1Y6BA 1NT2A 1OKVA 4FEVA 3KVWA 2O2UA 5DR2A 5IEVA 3NMUF 2XK7A 4LRKA 1YXXA 4M0ZA 3D2IA 1SZMA 4QP4A 3LZBA 4QTCA 4C62A 5LCJA 3LFNA 4O7VA 4YO6A 4RVTA 4D1SA 4BCJA 5EM7A 2QONA 3AD5A 1ZARA 3NUUA 2A19B 3QHWA 4RZWA 3D5WA 3SW4A 2G2IA 4FKRA 4UEUA 3NPCA 3VF8A 4CXAA 3QRTA 4XJ0A 2ITTA 3SAYA 4PDYA 4J71A 2VWVA 3JVSA 4WD5A 2IW6A 3DLSA 3GC9A 2PVMA 3ELJA 4ZTNA 4AGCA 3MESA 2GHLA 1LEWA 3OFMA 3QA8A 5FLFA 3ENMA 3KXNA 3ZXTA 1E1XA 4Z16A 3OWPA 3PUPA 5FDXA 3OP5A 3NW7A 3SG8A 3GUBA 4C2WA 3W16A 4BC6A 4RJ5A 3W32A 4E3CA 4EOMA 2Y4PA 2QQ7A 3TZMA 1H1WA 1KE8A 2JKMA 2XIXA 2PMLX 2PVFA 4FTNA 4O0UA 3KU2A 3QD4A 4E6CA 3W2PA 3VAPA 4E20A 4N4SA 5GINE 5HX8A 3DAEA 3UBDA 3KMUA 2G2HA 3LKMA 1VEBA 2B9IA 4Y95A 5IISA 3QCQA 1JSTA 4ZJIA 3PJ3A 2C5VA 4U3ZA 5FGKA 1APME 2F7ZE 5E7RA 4DH5A 2XNEA 3R9DA 1PYXA 3BBWA 1JVPP 3FI2A 3GNIB 3E62A 5AP0A 3MYGA 4EBWA 3N4UA 4J1RA 4U0IA 5FRIA 5E1SA 3FZRA 4AGDA 4G2FA 2HCKA 3VW8A 1MRUA 2YCRA 5HKMA 1QPEA 3RM7A 2W1EA 3DAKA 4H3PA 3ZYAA 2GNGA 4MK0A 5I9YA 2C1BA 4L53A 2Z7QA 3ENHA 4JT3A 3OZ6A 2QOQA 4ZY6A 4CFWA 3KC3A 4W4YA 5FBNC 5B2KA 4FNXA 4KIOA 3PP1A 4YBKA 5DT3A 4BGGA 1XJDA 5HIEA 5J9LA 5KKRB 3NYXA 4YR8A 5E4HA 3MGYA 3QGWA 3IW7A 3F3WA 3VUIA 4NM3A 4G16A 4DCEA 2P4IA 5HE1A 4U45A 4BZDA 5L6PA 2W4JA 1J7LA 4FX3A 3ALOA 3IGGA 4IZ5A 4EH2A 2H8HA 1XH7A 3DBFA 4O21A 1BI8A 2YDIA 4PL5A 4HCVA 4FE2A 2WMWA 1H1PA 1OECA 1URCA 2HW6A 2WMUA 3EQHA 3P0MA 2XF0A 4I0TA 3FZSA 3NSZA 4JQ8A 4NTSA 4UWCA 3OY3A 5CVGA 3VRZA 4XG3A 5JFSA 2OJJA 2YISA 4WIHA 3BLRA 1O6LA 2P2HA 4CYJA 2Y0AA 4D5KA 2VN9A 2PUIA 3Q53A 4EQMA 3Q60A 4XG2A 3FXXA 2HXQA 1IA8A 4LV5A 4XNEA 2O63A 3HMMA 4FL2A 1YI4A 3QTQA 3MN3A 3EZVA 4ZTHA 4CEGA 3P86A 2CPKE 3ACJA 4GRBA 2EB2A 4FSRA 1H27A 2YM3A 4QQTA 3U9NA 2PU8A 2BCJA 1ZAOA 4KIPA 4AE9A 5CT0A 3FSKA 2J5FA 4NW5A 5FM2A 3VS3A 2HELA 3KCKA 3OW4A 3M11A 5CZHA 5A14A 1PKGA 3OW3A 4F64A 4BFMA 4NK9A 3A60A 2VO0A 3G6HA 2YIYA 4C4EA 1ERKA 3GB2A 3QRUA 4JX3A 3DKOA 4XRLA 1PKDA 1OPKA 4D4SA 2UZNA 4YTCA 4JQ7A 4LQMA 4MQ2A 4F1MA 2W5BA 4YJNA 2VZ6A 2ZV7A 2XEYA 4HYIA 3EL7A 3I79A 3VS5A 2WTVA 5LMBA 2Z60A 2FO0A 5IH5A 3OD6X 3ODYX 2DS1A 3FQSA 3EYHA 2R3MA 4XG9A 4B0GA 3DK3A 2R3OA 4NYEA 2WTJA 4FK6A 4RBLA 3ZC6A 4AG8A 4NSTA 3HRCA 4O0RA 3QWKA 2Z8CA 3D5VA 4L52A 4ACDA 4E73A 4WA9A 2WTCA 2IW8A 2QC6A 3L9LA 3WILA 3UYTA 3PZHA 4QP2A 4QTEA 2XK3A 5IDNA 3G0FA 4EOJA 5BYYA 4C33A 4IX3A 3SOAA 4BKYA 5K4IA 2OBJA 3MVJA 3EQGA 3K3IA 4FG7A 3PVUA 4QT1A 4U7ZA 3UNJA 2F7XE 2C6IA 4R6VA 4E5AX 4V0GA 3PVWA 4AZWA 4EK6A 2GFSA 2J4ZA 1JKKA 5TKDA 4HGLA 4F70A 3E3PA 4BDEA 4O0SA 4OBOA 3RP9A 4FT0A 1PMVA 2BKZA 3F5UA 3L1SA 4FMQA 4YGAA 3O8TA 2AC3A 4FTJA 5CVFA 3QQUA 3PLAE 2PYWA 2X7GA 5AUVA 3F3TA 2JDOA 3Q04A 3ZLXA 2VWIA 3SLSA 4C4GA 4DEEA 2OJIA 3BX5A 4LGGA 5BMMA 4ZY4A 5AUUA 5ANDA 3EMGA 4PP9A 4DF3A 3LXNA 5K5NA 1K9AA 3ZBXA 4TXCA 5LWNA 3W1FA 4AOJA 5HCXA 3ZDIA 4YP8A 2Z7RA 2G15A 2W1CA 3MFUA 4UYNA 3T8OA 4BGQA 4FL1A 5FD2A 2ITXA 2UZWE 5CNOA 4QQCA 1WZYA 2JKKA 3RWQA 3C4WA 1OZ1A 2BAKA 2ERZE 5FEQA 3FWQA 4R3CA 3UOKA 3FL4A 3B2WA 5IF1A 3AC3A 3VNTA 3QD3A 4I5HA 4ALWA 5IA0A 1FINA 5I3OA 2Q0NA 2XNMA 3HRFA 3UQFA 2VTSA 4OTHA 3E5AA 5KMNA 4PPBA 4FKSA 4F7NA 2C6EA 2HY0A 3OEFX 4ZSAA 5IQDA 4HYUA 1F0QA 2B55A 3C4EA 4RX7A 4YJRA 2UZLA 1IG1A 4FTRA 2WMBA 4XS2A 3IDPA 4GKIA 4NKAA 5AV2A 2G2FA 4NCTC 3R83A 3PIZA 4AT4A 5CU0A 5EYCA 4IFGA 4BI0A 4FZDB 3BYVA 4MD7E 5D7VA 2DWBA 3OOGA 3JPVA 5IMEA 2UW4A 4K11A 4IJPA 3MVHA 5DPVA 1OL5A 2ZV2A 4AFJA 2CNQA 2R5TA 3EKNA 2YJRA 4W9XA 5KBQA 2HY81 5ANJA 5HGIA 2XVDA 4C3PA 2J0LA 3W2CA 4E6DA 5C26A 1YVJA 3PXKA 3UPXA 3NUYA 2PMNX 1SVHA 2QG7A 4CQGA 4EH8A 4AN2A 3HRBA 3AC8A 4FOBA 2JC6A 4FZFB 3W8LA 1UNLA 3LQ3A 5AP7A 2X4FA 4UXLA 5CTPA 5ANEA 1ZYCA 4BKZA 4U43A 5BVEA 4D2TA 4O86A 1K3AA 2UW9A 5BYLA 1OL7A 2R0IA 4M84A 5AIKA 4BIDA 1CMKE 4CSVA 2B4SB 4EH9A 4D4YA 5J8IA 1R39A 2IZSA 5IH4A 3R21A 4M8TA 3U87A 1P14A 4QMXA 4GL9A 5EHOA 2OJGA 4QP7A 2E2BA 4WNOA 4O81A 2CSNA 5C8KA 1S9JA 2PZ5A 4M3QA 2UW6A 4AA0A 5T3QA 3WF6A 2QVSE 4EYJA 3LMHA 5IQFA 5AIRA 3TTJA 1V0BA 3GBZA 3QA0A 3RBWA 2PSQA 4D28A 3A4OX 4CD0A 3R01A 2NP8A 3UO4A 4G9RA 3QRIA 2O65A 3V5TA 2C47A 2JITA 4R8QA 4PPCA 3DBDA 2VTJA 3VIDA 4Z3VA 4U81A 2QURA 3O50A 2W1IA 5K0KA 4EK3A 3PRFA 3OCGA 4RA5A 1AD5A 4WG5A 3N9XA 4AP7A 4C59A 3D7ZA 2R3GA 2Y6MA 4FSWA 4N70A 4XV3A 4CT1A 5C8NA 4LUEA 4OTIA 2C5OA 4EHGA 5CF8A 4LRMA 5CAQA 3NYVA 5CEIA 3WIKA 3AT2A 3VO3A 3EQPA 3VS1A 4X2GA 3ORXA 2VGPA 2X9FA 4FL3A 2AUHA 3GU8A 3AC1A 3LLTA 4EOPA 2UZTA 2P2IA 3PPJA 4FKIA 4M97A 3D2KA 4U5JA 5JGBA 5BVFA 3RK7A 2VTOA 3BU6A 2QOOA 5E8SA 2C5YA 3FEGA 2RIOA 4X3JA 3OUNB 5EM5A 3OXZA 2EVAA 2VGOA 5CU2A 3PWDA 4DA5A 2F49A 2GSFA 5AA8A 4IZYA 2GQRA 2NNWB 2WKMA 2B53A 4V04A 4I23A 5CI6A 4U42A 3RZFA 4NCTA 5C9CA 1SYKA 3O51A 5HHWA 5D41A 3OTUA 2CGVA 4RJ6A 1BKXA 2YERA 1NY3A 3D7TB 3EQCA 5F4NA 4QMNA 3HAMA 4OW8A 1P5EA 2R3IA 4PTGA 2PE2A 2PZYA 2R7IA 3FHRA 4WUNA 3RHKA 4YZ9A 4A9SA 3COMA 2HW7A 2C30A 1WAKA 4PL4A 4PWNA 4EC8A 3FZ1A 1FPUA 4XBRA 3UIMA 3DFAA 4M0YA 1H00A 4OBPA 4X3FB 4DLJA 4ZMEA 2UV2A 4HCUA 3VUMA 3ZO1A 3P1AA 2PWLA 3U6JA 4RLKA 3BPRA 5HG9A 3O17A 4LL0A 2IVUA 5KMMA 1KOBA 3ORKA 4EZ3A 3W2OA 1PF8A 3DY7A 4M15A 2VNYA 3RK5A 4B9DA 2BMCA 5I9WA 1OMWA 2BRNA 2OU7A 4BDGA 1Y6AA 5DVRA 4YHTA 4PNIA 3TACA 4F9AA 4EUUA 3CQEA 4ZJJA 4IWQA 5TOZA 3UP2A 2CMWA 3QXPA 3FPQA 3ZFMA 3GCUA 2VWWA 4BBEA 3R8VA 3LLAA 4TWCA 4ZOGA 4KAOA 4FKWA 5CF5A 3V3VA 2ZMDA 2J0IA 3QXOA 4XV2A 3QCSA 2JDSA 3BZ3A 2WOUA 5FXRA 3ZSGA 3AQVA 1H4LA 1PXNA 2JDTA 3KVXA 3O96A 5CEKA 1YHSA 3U8WA 3UE4A 4ANQA 2UW3A 3EQDA 2UZVA 4C4FA 2Y8OA 3IW4A 2GQGA 4FK3A 4H1JA 4FTMA 5HG7A 4G34A 4RZVA 3TT0A 2Q0BA 4B8MA 3CPCA 4MTAA 2XBAA 5AR8A 3OWJA 4WRGA 3HA6A 5H2UA 4GU6A 3G9NA 3GI3A 5H8EA 4AUAA 4FVPA 3CC6A 5E8XA 4YZDA 4AAAA 4RWKA 3D9VA 4CKIA 1PXKA 3PPKA 4RLLA 2R3QA 2YCQA 3C4XA 5D9HA 3T3UA 2IPXA 4ERKA 5IQAA 3HV6A 1PXPA 2ZAZA 3C4CA 5DT0A 4F09A 3AMAA 3V5JA 3DBQA 4UZHA 3SKCA 5AP1A 4E4LA 3CD8A 5EOLA 5AUZA 3FQHA 5B2MA 5KNJA 1B6CB 3GC8A 1CDKA 3MJ2A 4GVJA 4DEBA 3WYXA 1K2PA 3MH2A 2RFNA 3VBYA 1TQIA 5J9ZA 2W7XA 1CTPE 4BHNA 2XJ0A 3OXTA 3KY2A 4P2KA 4R1YA 4ASXA 1WVXA 3PTGA 3BCEA 4XCUA 5AAFA 5LOHA 3A8XA 3W10A 4LGHA 4N6ZA 5TO8A 3V6RA 3MH3A 5T6KA 2OIDA 5J95A 4GV1A 2OFUA 3ORLA 3E7VA 4CG9A 4V05A 2OIQA 5EYMA 3GOPA 4E5BA 1PMNA 4FKGA 5F1ZA 2EXEA 1AQ1A 4RX9A 5EW8A 3Q9XA 3JUHA 4FG8A 5E8UA 3BQRA 4IWPA 1PYEA 4APPA 4O84A 5D1JA 4TNDA 3UOLA 4CFXA 3S4QA 4YURA 5B7VA 2QU5A 2RFSA 1OKZA 1ATPE 1XKKA 3CR0A 4K33A 2CN8A 3AMYA 3COHA 4G3DA 3ZUTA 2QODA 5AP3A 4DT9A 3F5PA 1G3NA 4IEBA 4W4VA 4Y73A 3FSFA 3UC3A 3GOKA 3QTIA 4FTIA 4BDHA 4MXOA 2J2IB 3QYZA 4DHFA 3LE6A 2O8YA 5CSHA 3BRBA 3TUDA 3PXYA 1J3HA 1OIRA 3R2BA 3EFWA 3IONA 1T45A 2ERKA 4DG0E 5KZ0A 1YDRE 4EK8A 2YM5A 3PA3A 3A62A 2WMSA 5CENA 4GMYA 3E3BX 3U4WA 5C1QB 5LARA 4PV0A 3TWJA 5M53A 4FT3A 3MIAA 4IMYA 3FMLA 3HMNA 1TKIA 4P5ZA 1XH9A 4G31A 4HJOA 4YLKA 3TTIA 2FSMX 4MEDA 4UBAA 4Y72A 4HVDA 4QP3A 4QPAA 3PLSA 5JSMA 5DR6A 1IA9A 4GVAA 4YTHA 1FVRA 1FGIA 3D5UA 2V5QA 4ANMA 3NZ0A 3S95A 1NA7A 4J98A 3HMIA 2W1FA 4ITHA 4W4WA 3GQLA 1X8BA 4JG6A 4B8LA 3AC4A 5DH3A 4MYGA 4JDIA 1YOLA 1V0OA 1QPCA 1YOMA 3I5NA 3MTFA 1FGKA 1T46A 3NEWA 2JGZA 3Q4ZA 4K9YA 4WSQA 2PMOX 2WIHA 2XKCA 2XIYA 3KF7A 1KUTA 2J7TA 4YZBA 5GZAA 5HNBA 3FMHA 4LGDA 4F7LA 2Y4IB 4R7HA 4I21A 4B99A 4CTCA 4FG9A 4FZAB 3RJCA 2NPQA 3KA0A 3EFLA 2JAMA 4J53A 4FSYA 2VTPA 1MQBA 5EDRA 1DS5A 4S2ZA 4I20A 4MVFA 3RM6A 1Q8UA 4ASEA 1OBGA 4FEUA 1YRPA 2XNPA 2PY3A 1M2RA 4LFIA 5A4TA 4BCHA 2CNVA 1XHAA 2VAGA 3DDQA 4FOCA 2WTKB 2BFYA 1OBDA 4DBXA 3R9OA 4P5QA 1VJYA 2JDRA 4PTCA 2W9ZB 3GGFA 2OH0E 4L9IA 4K8AA 1NW1A 3EKKA 3SGCA 3OHTA 5ANKA 5DI1A 5BUEA 3PDTA 5DEWA 5C01A 4EH5A 4CFMA 2Z2WA 2ITZA 4KRDA 3F61A 5C4KA 2HZ4A 4NTTA 4M12A 3FKNA 2X81A 5AR7A 3P7AA 4E1ZA 1JLUE 2HZ0A 3CE3A 4DINA 4ZS0A 1W83A 2PVHA 2BZIB 3QCXA 4GT3A 3RAWA 4D1XA 5A3XA 3KQ7A 4F9BA 4QRCA 5CWZA 1IRKA 3KB7A 4ENXA 5HBEA 3CY2A 3BU3A 2C3JA 3ROYA 4CT2A 4IFCA 1WBNA 4QMQA 1H26A 2BUJA 1WBSA 3PFQA 4Q9SA 3M1SA 2W17A 3AMBA 4BCOA 1I44A 4RIWA 4RQVA 4IDVA 5EW9A 3AD6A 4ZSJA 4DH3A 2X6DA 3PXZA 3GCQA 5E9EA 2F7EE 2OLCA 1Q4LA 1TQMA 5A9UA 4BYJA 2Z7SA 3VVHA 5LQFA 3EN5A 3GC0A 5EQYA 3TNQB 4NFMA 3RVGA 4L3JA 2JFMA 4AZVA 1OITA 4XP3A 2GQSA 2WTIA 4GYGA 2I0EA 4QTBA 1OUYA 2B9JA 3V5PA 4IDTA 5EHYA 4L7SA 2J9MA 2XNOA 4JBPA 4PMSA 4XLVA 1ZYSA 5AJQA 5DOSA 4YC8A 3Q6WA 4E8AA 4GKHA 4QO9A 3KXXA 3KRXA 5FP5A 1Z57A 1XQZA 4QQJA 4CFFA 2GMXA 4CZTA 4I5MA 4QYYA 2XM8A 1IAHA 4Y85A 3QTUA 4C61A 4F9YA 5KX8A 4FKJA 4YZNA 2QR7A 4AACA 3ZM4A 3TKIA 2OK1A 1PXJA 1U5RA 2YAKA 3DGKA 2CGXA 2ZMCA 3DBEA 4FT9A 2EXMA 3Q5IA 2JBOA 4DEDA 4NL0A 4JXFA 2QOCA 3HX4A 4KS8A 3P5KA 2XJ1A 3I5ZA 5L8LA 2CLQA 4S34A 2V7AA 4S32A 4BDBA 3FL5A 2CKOA 5CEMA 4Q5EA 3A4PA 3HNGA 4JRNA 4QMUA 2RKUA 3OUKA 5DRBA 2VO3A 4BI1A 3VBQA 4ERWA 3Q6UA 3EN6A 1Q99A 2R7BA 3L9MA 2GTMA 3LAUA 2CGUA 5BVKA 4BICA 1PRYA 4F7SA 1YWNA 1Q97A 4FTKA 4CFUA 4D4RA 4IE9A 4NUSA 3VUTA 3W2RA 4O7SA 4BY9E 5DFPA 1UNGA 5TF9A 3OCBA 2BDJA 2HZNA 5DGZA 3BLQA 3I60A 5JEBA 1YXVA 5JQ8A 4UYAA 5HO6A 3MFRA 4ACCA 2UW0A 3G0EA 4L45A 4J96A 2R3PA 4BCKA 4GK2A 4U40A 4EJ7A 3NCZA 4L7FA 5CXZA 3QQLA 1UU7A 3WZJA 5M44A 4AZFA 3FE3A 4RIYA 4JS8A 2BRBA 2QD9A 4I0RA 1HOWA 3C50A 3LFEA 2PUNA 3HV7A 4XUFA 4MX9A 5HCYA 2CKQA 3SQQA 2YIRA 4ZSGA 4YTFA 1ZXEA 3IOKA 5KHXA 4U3YA 4ZSEA 4KIKB 4FV2A 3KMWA 4X2JA 5LWMA 3O0GA 2XIZA 1XR1A 4UB7A 4IIRA 3ZFXA 3CPBA 4WRSA 5FM3A 5CAVA 1W0XC 3F7ZA 2KULA 4D2WA 1M14A 2VNWA 2W99B 5G6VA 4BN1A 5BYZA 3F9NA 3W8QA 5HU9A 1WBWA 2DQ7X 4F6UA 4RRVA 3QD0A 1Y91A 4FYOA 5HG8A 1YQJA 2X6EA 3PJ1A 3L8XA 3T9TA 3TXOA 3TDWA 3SXSA 5EK7A 4H05A 2XB7A 3CTQA 2ZV8A 5IU2A 3LJ1A 1YXUA 4O6EA 3TKUA 4BWPA 5AP5A 1OM1A 3DZQA 4QTDA 2C0OA 1UU3A 4FV6A 1LUFA 5L6WL 4CCBA 3ETAA 5JT2A 5GIPE 4ASDA 3CJFA 1H0WA 4AGWA 1M52A 4TYHA 1PMEA 1H1SA 2OGVA 4AZSA 4BTJA 4CFVA 4KKGA 4A06A 4DGGA 3SG9A 3ZLSA 5M4IA 3CQUA 1MRYA 3THBA 5HTBA 3TV7A 2PVRA 2BILB 1JSUA 3M2WA 5JZNA 2H96A 3R7OA 3NUNA 4AT5A 2IG7A 4L6QA 4R5YA 3PG3A 1U4DA 2OF2A 4CVAA 1ZOGA 2X0GA 2HYYA 4HPTE 4DC2A 5I9ZA 4IZAA 4O7TA 3D94A 1OIUA 4G9CA 2WEVA 3RAIA 5BUIA 4S33A 2VX1A 3F3UA 4KKEA 4OAUC 1J1BA 4X0MA 5I5ZA 4FV4A 2HIWA 3LPBA 3QZFA 4ZTLA 4Q5HA 5M07A 3IGOA 4M68A 3HMPA 3OOMA 2QOHA 3QF9A 2FUMA 4I93A 2WPAA 2HAKA 3VRYA 4WT6A 4LM5A 5IA1A 2W0JA 4WG4A 4F1OA 3K54A 4A9YA 4MF1A 4JR7A 3VW6A 4Y46A 3CD3A 3F88A 3FLQA 4NFNA 4M66A 4RGJA 4DE4A 4BWKA 2JIVA 1PW2A 1ZLTA 4G3EA 5B0XA 5C8MA 1SVGA 3TV6A 4ALUA 1UWHA 4LUDA 4PY1A 1XBCA 4H3QA 1RW8A 3KRLA 3MA6A 4AX8A 3R1QA 1JKLA 4IB0A 2BHEA 5IUIA 3BLHA 3FMMA 2IWIA 1Y8YA 2UUEA 3KKVA 4NIFB 4YPSA 1M7QA 2WHBA 2XNNA 4RX5A 4E7WA 3REPA 3FJQE 4IAAA 3TZ7A 4FI1A 3NIZA 3FXWA 1UV5A 3UVPA 3TI1A 4JG7A 3I0QA 4LG4A 4RJ4A 4KIQA 4ORKA 3PY0A 4TZRA 3ZEWA 2NRUA 2YZAA 3SRVB 3BGPA 2RG6A 4NWMA 1A9UA 4NJDA 4CMUA 3CSVA 2C6MA 3ZH8A 4FBXA 3DNDA 3FC1X 1LP4A 2VWUA 1KSWA 3OCTA 1DM2A 4I6QA 4IZ7A 3NAXA 1J7UA 4JDJA 3PXFA 5JMSA 4EHVA 3C0HA 4WO5A 5KHWA 2VV9A 4KBCA 4OTWA 3FAAA 4IVAA 3FMKA 3E8NA 4M13A 5AA9A 2BPMA 4RJ7A
chains in the Genus database with same CATH superfamily
2W06A 3C51A 4EH6A 4PTEA 2X4ZA 3DJ6A 3D5XA 4IHPA 4BDDA 2Y6OA 4ZZMA 2V62A 2XM9A 3D15A 1WFCA 1KE7A 3DTCA 3F6XA 3QQKA 4QPSA 5DLSA 2X7OA 5AUXA 2XH5A 5LVMA 4K18A 4KNBA 2UW8A 4F63A 4DH8A 5AR4A 3LFBA 2JD5A 3ROCA 5AV4A 4XX9A 4I5CA 2WGJA 4AE6A 4A4OA 3PSBA 4CMOA 3IPHA 2WTDA 4RJ3A 3ZOSA 3SXRA 2XCKA 2GNLA 5L6OA 5HEZA 4EK5A 4CFNA 5CU6A 2R3LA 2REIA 3TYKA 3EJ1A 3GT8A 4RVLA 4XG7A 4YTIA 4JX7A 3PXRA 4AWIA 4CRSA 1GY3A 3BKBA 3FY0A 4Q9ZA 4KSQA 4EBVA 1S9IA 5A4LA 2OH4A 3ZEPA 4ZS4A 3EZRA 3BQCA 3GENA 2X2MA 3HVCA 3P08A 3QBNA 3R30A 4O1PA 5AV3A 5CQUA 3DA6A 5HBHA 4BDCA 4O7RA 2GHMA 5C27A 4KKHA 4FNWA 5ETIA 4F9WA 1KOAA 2IVTA 5FTOA 2F57A 2VWYA 4JBOA 2XKFA 2QLQA 4FT7A 4KA3A 5GHVA 4H1MA 4O0VA 3VQHA 4RWLA 1Q3WA 2RF9A 5A46A 2JBPA 3ZLWA 3ZO4A 4DCAA 5L8KA 5EI6A 2DUVA 1Q62A 3LFQA 2VTAA 3LIJA 3VUKA 1JWHA 3EH9A 2SRCA 5KE0A 4C57A 2RFEA 4KUJA 1H24A 1GIIA 2C6KA 3KK8A 5ACKA 2PVLA 3ZMMA 2HWOA 4W8DA 3FPMA 5IUGA 5K5XA 4I0SA 2IZRA 4PDOA 5M55A 5FDPA 1XH4A 2I6LA 1JSVA 3MTLA 2EU9A 3UQCA 1Q61A 3QRKA 3DQXA 3PIYA 1I09A 4RIOA 4AZTA 5BVDA 1SM2A 2O3PA 2C1AA 1WBVA 3LCSA 2BAQA 4EOIA 4RC3A 1TVOA 2ITYA 5ANIA 3S0OA 3HP2A 2OXXA 3U6HA 2EUFB 5FUTA 4WNPA 2XUUA 4J52A 2C69A 2I1MA 3K2LA 4DFBA 4J7BA 4KRCA 5T68A 1NXKA 3CP9A 4PQNA 3F82A 2GCDA 3ZO2A 2VTRA 3C13A 2JIUA 2WFYA 4O0YA 1KWPA 2A1AB 2O64A 2H9VA 3UIXA 1GZ8A 4BCFA 4X3FA 5FXQA 5H8BA 2W5AA 2GS7A 3EB0A 2G9XA 1ZOHA 3OVVA 4BCGA 4F9CA 3U55A 4A7CA 4Y83A 1U59A 2WB8A 1HCKA 2E9OA 5LVPA 4Z7HA 3HGKA 3FQEA 3B2TA 4F7JA 3UYSA 1NVSA 1STCE 3CTHA 3G2FA 4J99A 2GFCA 3RPSA 2OW3A 3UJGA 2R9SA 4FZ6A 4DFNA 4C2VA 3WZUA 4CZUA 4UMRA 5AFVA 3LM0A 4HCTA 5DYJA 2UZOA 3QAME 2X7FA 2NRYA 5JK3A 1G8AA 4NZWB 1CSNA 2P55A 4EHZA 4CKRA 3A7GA 3AC2A 2WMVA 1FBNA 2BZJA 3UP7A 1SNXA 2J90A 4QMWA 3BV2A 5DG5A 1H28A 4I6FA 2BDWA 3RNIA 5HD7A 1JKSA 5FEEA 4D1ZA 2R3HA 3ZCLA 3EFJA 2R64A 3UG2A 2G01A 4D2SA 4OUCA 3KXZA 3W0PA 2XIRA 3QTZA 4AS0A 4UWBA 2R3JA 3IW8A 4II5A 1GIHA 4CZYB 4DGOA 5K0XA 1U54A 2X1NA 2OXYA 1OIYA 4I3ZA 2E9UA 2ZB1A 4AU8A 3JR1A 2UVYA 3L8PA 4DLIA 4FIIA 1RJBA 4IX5A 4IX6A 3DCVA 4RPVA 4FR4A 5EQEA 4RSSA 3M42A 4JDKA 3LQ5A 3ZZEA 4CG8A 1XO2B 3CGFA 3QC4A 3BYUA 4TN6A 1UA2A 3H4JA 1YWVA 1B38A 4E4MA 4MWIA 3DU8A 3LXLA 5GZ9A 4GG7A 4C35A 3GCPA 3HV5A 4LI5A 4CNHA 3MPAA 2WTKC 1ZMUA 3H0YA 4MXAA 3WF8A 3UOJA 4ZLOA 3CKXA 5CANA 2WAJA 2FYSA 2YFXA 2W05A 2W1GA 2FH9A 5LMAA 4BL1A 4IB1A 4D2PA 2W4KA 3Q9YA 4XRJA 3DJ7A 4AN9A 2NO3A 3VWAA 1JNKA 3I0OA 4UXQA 2PVYA 3GVUA 3F5XA 5J87A 2FSLX 3VUDA 1YXTA 4QPMA 3IK3A 4GCJA 3R02A 4MXZA 4S30A 1Q5KA 3AD4A 5CY3A 4DEHA 4DEIA 1DAYA 4U8ZA 3N51A 3U6IA 4V0GB 4I1ZA 4BBMA 4TPTA 4DGMA 1W8CA 3FZOA 4RG0A 3IKAA 2OG8A 4ALVA 2YDJA 4XBUA 4M69B 3LMGA 4DTBA 2UW7A 2OZAB 3JS2A 3JVRA 3PZEA 2XBJA 3HV3A 3NLBA 4O4CA 5I9XA 3F69A 3DKCA 3FKLA 5HCZA 4DG2E 3Q3BA 4USFA 5BVNA 2OKRA 3UIBA 5EFQA 1H08A 5J7HA 4IAYA 2XS0A 3FZPA 3NVMB 4BDAA 1PJKA 3MDYA 4MWHA 3QZIA 5E92A 4NW6A 4F6SA 3QU0A 3QHRA 1Z9XA 4A9RA 1FMOE 1OL1A 3LXKA 3R04A 4EORA 1NVRA 3HEGA 3LCKA 4FV5A 5IQHA 1LEZA 3KK9A 4MKCA 3GXLA 5ETCA 4JG8A 2I0YA 2WMQA 5M51A 3UO5A 4QYFA 4IM2A 4AF3A 4M7IA 5A6OA 3NYNA 1JBPE 1ZZ2A 4GUBA 1WMKA 1BYGA 1M17A 4E93A 3PJCA 1H8FA 4MQ1A 5JZJA 3EIDA 3W2SA 2W1ZA 3PE1A 4FC0A 3R22A 3SDJA 4D2RA 2PL0A 3I7CA 4QYHA 1QPJA 2X8DA 4I6BA 4I4EA 5HE3A 5IQIA 3LCTA 4HNIA 3MPMA 4QP6A 4FNYA 1FVVA 2YJSA 3WBLA 3NAYA 4GS6A 3L8VA 4O6LA 5ACBC 4NH1A 5FWKK 4ASZA 4B6LA 3VBWA 4EOLA 4O0WA 3EQBA 2BROA 4K2RA 4MBJA 3U4UA 4J97A 2P0CA 3LFAA 2RG5A 2YITA 5CAOA 2QO7A 3NUAA 2E9PA 1J91A 5KMLA 2YCFA 2ITWA 3NRMA 3O23A 1H1QA 3EQFA 4GJ2A 3SHEA 3R8ZA 4H39A 5FQDC 1OKWA 3CBLA 4AW1A 3P23A 2YWVA 3R7EA 2CJMA 1FQ1B 3A2CA 2C0IA 3BIZA 3V51A 5J5TA 4H58A 5AR2A 3NFFB 3BHVA 3SA0A 3C5UA 4FTQA 3ATSA 3QQFA 4TT7A 2B0QA 4CKJA 1WVWA 5DBXA 3FLZA 3NNUA 3RCDA 4YZMA 4EEVA 4ZZNA 4RWJA 1J1CA 5GJGA 4AOIA 4CRLA 2ETKA 5LMKA 4RIXA 2OXDA 2YN8A 3MH0A 5L2QA 5JRQA 5CEQA 4TYJA 3U54A 3RWPA 3FDNA 5JQ5A 2RGPA 2JAVA 2OFVA 4EC9A 4WUAA 3CJGA 3KL8A 3OG7A 4JL9A 3HYHA 3G9LX 3CGOA 3EYGA 2UZUE 1OGUA 5HTCA 4OT5A 3HUBA 3A8WA 3TN8A 2HXLA 4G6NA 3IECA 4XH6A 4ZJVA 5EKOA 1YHVA 3F2RA 3BL9A 4BI2A 5AUTA 2QHMA 2C68A 5KMKA 1WBPA 3MW1A 3EN7A 4RT7A 4CV9A 2R3RA 3Q5ZA 3ZUUA 4ANLA 1Q8TA 3VS2A 2IF8A 2WMRA 4FTTA 4MCVA 4EONA 5EYDA 2B7AA 2IZTA 2VTQA 3BYMA 2VTMA 5EQPA 3VBTA 1UKIA 3UC4A 1OUKA 3GU6A 2BHHA 2C3LA 2QKWB 2VX0A 3POOA 4MD9E 1H07A 1E9HA 5M56A 5AV0A 3LMIA 5AX3A 4QP1A 3SXFA 4MBLA 3FYKX 3R0TA 1TZDA 3I4BA 4AQCA 1GZKA 3ZSHA 4FV9A 2ZV9A 3F66A 4X2NA 1UNHA 5EDPA 2VTIA 4O7ZA 2YHVA 3DPKA 4AT3A 2IVSA 4YJOA 2J51A 4GG5A 4MXYA 1O9UA 3V8SA 3D4QA 3LFCA 4GIHA 4O4DA 4CQEA 3DV3A 3DS6A 3ZXZA 1G8SA 3S00A 4D9TA 3G15A 1PXLA 2R0UA 4JBQA 1OL6A 4V01A 2WOTA 3L9NA 5CSWA 5AEPA 3PA4A 4BJJB 4W8EA 3NWWA 3KRJA 5HNGA 3AOXA 3QC9A 2GU8A 1JKTA 3HA8A 2HZIA 3TUBA 4A07A 5KKRC 3DB8A 2GNIA 3IG7A 4XOZA 5AAGA 3S1HA 4BF2A 2QOLA 3BLAA 5EHLA 3NYOA 2UZBA 4C7TA 2I0VA 4DEGA 4FV8A 4FSQA 4UX9A 3POZA 2E9NA 3GEQA 3U9CA 4RX8A 2ZJWA 2H34A 5HLPA 4YJQA 5E8YA 3WOWA 3ZDUA 3E8DA 2YZLA 3QL8A 3VUHA 3MB7A 3SW7A 5DA3A 3ET7A 2PZRA 3CLYA 4EYMA 3BYOA 3BHUA 3NNXA 3BHHA 4JVGA 4FGBA 4KABA 3TL8A 3UGCA 4QYGA 3NW5A 4GFGA 3ZFYA 4HPUE 1OPJA 1PY5A 5IQGA 3RPRA 4UY9A 1Z5MA 4DHJA 3H10A 2IN6A 2ITPA 4FSTA 5IQBA 5ETAA 2IZUA 3QTXA 2Y9QA 2ACXA 4L44A 3ZS5A 4UMTA 2W1HA 4PDSA 3OROA 2GS2A 4JLCA 4ACGA 5LVOA 4IX4A 4L68A 3RCJA 3V5QA 4L67A 4FEXA 3PYYA 3H3CA 2WNTA 3E7OA 5HIBA 4FKTA 5E8VA 4NM5A 3SVVA 5AUWA 4XV9A 3GCVA 3R7VA 4BTMA 3I81A 2C3KA 3MS9A 3DXPA 2R2PA 4BZOA 1Q41A 3FBVA 3R6XA 4NJ3A 4Y8DA 4PF4A 4P7EA 3VHKA 5A54A 2VRXA 4IWOA 4FTUA 5IA4A 2C5XA 5L2WA 5CSVA 2YACA 1W98A 2EWAA 4EL9A 4TKSA 2ESMA 5BX0A 2Q83A 5F9EA 1ZY4A 4DFUA 4YBJA 5HLNA 1XH6A 5JGAA 3EN9A 2PZPA 4WG3A 1DAWA 4R7IA 4EQCA 4JAJA 3E64A 3A99A 5HI2A 2GHGA 2W4OA 2UVXA 2RL5A 5JH6A 3VJOA 3E88A 3U51A 5IA2A 3Q52A 3RAHA 4EHEA 2JKQA 4XP2A 1A06A 3R73A 4YNEA 4EQUA 2CCIA 4KSPA 3V6SA 4N0SA 4TWPA 2CNUA 2ITQA 4PX6A 4TYEA 3DB6A 3OBJA 3WI6A 2VWXA 3OT8A 4FIFA 4KBKA 3QLGA 4OBQA 4CCUA 1GJOA 3QYWA 2BDFA 4FF8A 5J9YA 4E26A 2YM6A 4IXPA 3ZBFA 4FKLA 4EH4A 5BVOA 2YLEA 3K5VA 1H1RA 5IQCA 4AW0A 2WMAA 3OXIA 4DH1A 4EZ5A 4JI9A 5HQ0A 3CS9A 5D11A 3DFCB 4G6OA 4XOYA 4TY1A 4O22A 4MH7A 4YJTA 4ZP5A 3V5WA 3QRJA 4ZSLA 3MY0A 1YWRA 1J7IA 2C4GA 2QG5A 3W18A 2XNBA 5EDQA 4G3GA 4L43A 3KULB 4QP8A 4RC4A 2CCHA 5EM8A 3HDNA 3NS9A 5I9UA 5KZIA 4QNAA 3ZO3A 1SVEA 5DEYA 2BIYA 2EB3A 4QMLA 5CI7A 3W55A 5CF4A 2QHNA 1R0PA 3QX4A 4MNEB 4HVSA 3GU5A 5TT7A 1YOJA 3QKKA 2XYUA 4I4FA 4UMPA 1BMKA 4GEOA 4O7LA 3W0RA 2VU3A 1CKIA 2BRHA 4EKKA 4E4NA 2LGCA 2QOBA 1V0PA 3G5DA 4A4XA 3PSCA 3B8QA 3TG1A 2X8EA 4QMVA 5DIAA 4BYIA 1MRVA 3LJ2A 4FJVA 1UKHA 3MY5A 3RPOA 3VQUA 4P90A 3V8TA 1YDTE 2F2CB 2CLXA 3ERKA 2PK9A 2H6DA 5FBOA 4BHZA 3VHEA 1QPDA 5I9VA 5M06A 4BCPA 2X39A 4TL0A 3R1YA 3D0EA 4Z9LA 4FIEA 4NIFA 4MF0A 3PSDA 1VYZA 3F7WA 3FLYA 2YABA 4IC8A 3OWLA 4ZEGA 5K3YA 2XZSA 3QQGA 2P33A 2HENA 2P3GX 4QMTA 2ZM1A 3R7YA 4ZTQA 3NCGA 1DI8A 2ZM4A 3COIA 3DTWA 3AG9A 4ZIMA 3UTOA 3RINA 4R78A 4OTPA 2XAMA 3IOPA 1UWJA 4IM3A 2GNHA 4QMSA 2R4BA 1R1WA 4IQ6A 4YUQA 3FYJX 4BDKA 3SX9A 3KN5A 4R7BA 2PMIA 4HGTA 3DBCA 4EK4A 5DNRA 5B2LA 2YM4A 3KCFA 5HVYA 3E92A 3KXHA 1YHWA 4G5JA 3VBXA 3WYYA 3NX8A 4FIHA 1ND4A 4GIIA 2UZDA 4O7NA 3PJ2A 3UZPA 4PPAA 3VULA 2VUWA 5HD4A 3FC2A 2BTSA 2J50A 1LPUA 4BCIA 2PHKA 2C5NA 3PVGA 2XP2A 2J0KA 3AGMA 4PMPA 4AXAA 5CAUA 2HWPA 1W2FA 5CEOA 3ACKA 4IH8A 2FSOX 3SV0A 1AGWA 5BQ0A 1GOLA 1JOWB 3ZTXA 3KGAA 2WMTA 3PJ8A 4RVMA 5HVKA 5J1VA 2YIWA 4F0FA 2YEXA 4DFLA 5A4QA 5HX6A 3PRIA 1OPLA 3WZDA 1V1KA 4ZXTA 4IADA 1FMKA 2W5HA 3ZRKA 1BX6A 2XEZA 5IA5A 4USEA 2C6DA 3GFEA 5AAEA 1EH4A 3FI8A 3LFSA 2DYLA 4Y5QA 4EI4A 3VONA 2W1DA 3ATTA 1MUOA 2XK9A 3GC7A 4G1WA 4GH2A 4PNKA 3NW6A 4JNWA 3G90X 2OIBA 2YA9A 5DRDA 1H01A 2QR8A 2FA2A 3QTSA 4E6AA 3HECA 3WARA 3T9IA 4HW7A 4B7TA 4X21A 4ANSA 4O7YA 3LFFA 3AKKA 4LMUA 4JIKA 4L8MA 4BDFA 3C1XA 3CCNA 3K5UA 3LCOA 4L3LA 2PE0A 1BLXA 1ZMVA 2R3KA 2QKRA 4R3PA 5BUJA 2OO8X 5HG5A 5AP4A 5F94A 4RIWB 5J79A 1P2AA 3QCYA 2GDOA 2OJ9A 5D10A 5GZ8A 4AA5A 4NM7A 4XG4A 4AOTA 5AR3A 5CALA 3IQ7A 4G3CA 3LJ0A 4O7WA 3BWFA 5E8ZA 4APCA 4OT6A 3ID6C 3FMJA 4XV1A 4HYHA 4IM0A 5L2TA 1XBAA 3TZ8A 2B1PA 3VS4A 4YPDA 4FTAA 4C3FA 3QKMA 5KUPA 3I6UA 4F4PA 3NUPA 4D9UA 4M14A 1OL2A 2QI8A 3DAJA 4IB3A 3HV4A 3MJ1A 4QMMA 4X2FA 4Y5HA 3V8WA 4PUZA 4TW9A 5M4FA 3ANRA 1M2QA 1CKPA 3GU4A 3DXNA 2UZEA 4JR3A 2XCHA 5D12A 4OGRA 4J95A 5IA3A 3OY1A 4ZY5A 4AN3A 4BCNA 4QDVA 2ETMA 3QUDA 2BIKB 2YWPA 4I22A 3RPYA 1XMMA 3WZKA 2I40A 3UOHA 1H0VA 4X3FC 4HZSA 4IW0A 3OCSA 3RTPA 4BDJA 4UZDA 4EZ7A 4F65A 4GSBA 5CASA 3GP0A 4ZAUA 2XK6A 3RKBA 4JDHA 4IAIA 4PMTA 4TYIA 4YHJA 5D7AA 1KE5A 1ZMWA 2BZHB 5GJDA 4D4VA 4DYMA 5KMJA 1RQQA 5E8TA 5KCVA 3R8LA 3RZBA 3AXWA 3P79A 4YNOA 4EKLA 4HVIA 4ZTRA 1P4OA 4RQKA 1VZOA 3IW6A 3TM0A 4AXDA 1JAMA 3E8EA 2VTHA 3DLZA 2QOIA 4ENYA 4OTGA 4EOQA 4KS7A 3TJDA 1Q24A 3R9NA 1YKRA 2LAVA 3UNZA 3FY2A 3TV4A 5HBJA 3IO7A 4UMQA 1ZRZA 3BE2A 4LYNA 3ULIA 4USDA 4X7QA 3Q2JA 5CU3A 5L2IA 4MNFA 4IVBA 4YLLA 2OWBA 4R3RA 5HESA 1JPAA 2F4JA 4FSZA 5CF6A 3QTWA 1GIJA 2XA4A 2VD5A 4BCQA 3ORTA 2JKOA 3G33A 5AR5A 3QUEA 3FHIA 4RIYB 5DE2A 2PUUA 5C4LA 1B39A 4QMZA 3Q32A 5EG3A 3PP0A 1KV1A 2PULA 1YXSA 3H9FA 3HLLA 3Q2MA 2J5EA 3BE9A 3BYSA 4W9WA 3BEAA 3H0ZA 3A7JA 3PY3A 4HVGA 3G51A 2IO6A 2VWZA 3DT1A 5AM7A 2A4LA 3OT3A 3S3IA 3SOCA 3G6GA 5BVWA 4C38A 3MBLA 2WZJA 1L3RE 3QX2A 4TTHB 4ZLZA 1R0EA 4JAIA 5L2SA 1URWA 2XJ2A 2Y7JA 4YU2A 3E63A 3OS3A 4X6RA 3FKOA 4LMNA 4FGRA 3GQIA 3ULZA 4DGNA 1A48A 1ZY5A 4F99A 2R3NA 3UMWA 2BVAA 4BKJA 4Q2AA 4R5SA 3IS5A 4DFXE 3R28A 4DGLC 2OZOA 4O38A 5IH6A 5L3AA 4OTRA 3FMEA 5ITAA 2ITVA 3W0QA 4K6ZA 2XK4A 2ZDUA 3MFTA 4YC6A 3UVQA 3R00A 2QOKA 3T3VA 3OWKA 1E1VA 2OI4X 5AM6A 4M69A 1G8JA 4WHZA 4HNFA 2WIPA 5FEDA 4DFZE 4TYHB 2OZAA 5K9IA 5ETFA 5AUYA 2CKPA 4WBOA 5EYKA 3VUGA 5M4UA 3R1SA 5A4CA 4KB8A 3DZOA 3UG1A 4ITJA 2F2UA 2JFLA 4OTFA 4YLJA 4ACHA 5LJJA 1IASA 5CSPA 3D7TA 3C7QA 2BKKA 3BV3A 3AKJA 4GFMA 3MY1A 3TZ9A 3ZZWA 4OAVB 5EH0A 2CHLA 3NR9A 3FI4A 3EFKA 3EOCA 3NUSA 4D58A 3L9PA 2PPQA 4CLJA 5HTIA 3NIEA 4QMYA 3DQWA 2J0MB 1YI3A 2WD1A 4YC3A 2UW5A 2B54A 3COKA 4K1BA 1SNUA 4GYIA 4TNBA 5IQEA 4X6QC 5ANOA 3RALA 4IAKA 4KWPA 4HGSA 2WTWA 2ZDTA 3CTJA 4U79A 2V55A 3QZHA 3ZONA 2RFDA 3DNEA 3S2PA 4D0XA 3R7GA 4I5PA 3TEIA 3PWYA 5E91A 3UZRA 3NUXA 4YMJA 3TNIA 5AWMA 3QKLA 3MVLA 5HIDA 3BGZA 4U80A 4RC2A 3IDCA 3WF7A 3ZLYA 4E4XA 3L8SA 1WBTA 4AGUA 2X9EA 1BL7A 4EJNA 3UVRA 4AFEA 1CM8A 4HOKA 1QL6A 4RA4A 1ZOEA 2QO2A 3O8PA 5IG1A 3CEKA 4FYNA 3Q4TA 2QOFA 4GK3A 2FVDA 4U97A 3ZC5A 2A0CX 2VTLA 5M57A 3TIYA 3BELA 3PE2A 5IZFA 4MXCA 1BI7A 4YJVA 5CVHA 3V04A 4RWIA 5HOAA 3KXGA 3Q4CA 2CGWA 4G5PA 5I3RA 5ICPA 4EWHA 1F3MC 5A6NA 1W82A 4H3BA 3OBGA 2BR1A 4OTQA 3PPZA 5F95A 1XWSA 3F2NA 4JJRA 5AX9A 5CNNA 4AW2A 4ANBA 1YW2A 4O2PA 2Y4IC 3VS6A 3KMMA 4L3PA 5BPYA 4FKVA 4C4JA 4UMUA 3SD0A 4L46A 4ITIA 4E6QA 3QQJA 4L00A 1MQ4A 2WU6A 5CLPA 4FV1A 3FLSA 1PXIA 5GNKA 1RDQE 3UDTA 2EXCX 3MSSA 4LOOA 3RHXA 4IWDA 3ORNA 4XLIA 5LMKC 3ML1A 2HOGA 2W96B 3F5GA 3EN4A 2YM7A 3DJ5A 4O0TA 2BRMA 3BHYA 4GJ3A 3VS7A 3MPTA 5HE0A 1TQPA 2X2KA 3WZEA 3BBTB 5J5SA 4HVHA 5JRSA 5JKGA 4L42A 3TDVA 5IUHA 4U9AA 3BHTA 3HP5A 1L8TA 5CS6A 3H9RA 4BZNA 2WELA 3UIUA 4YHFA 4EH3A 4ID7A 1OKYA 2J0JA 3V01A 4EOSA 3QLFA 3UO6A 4NEUA 2JDVA 4QEBA 3LCDA 4AW5A 4J8MA 3E87A 3KXMA 2IJMA 5ANGA 4YSJA 4O91A 3HZTA 2QNJA 3O7LB 4FEWA 1BUHA 1ZYJA 2PTKA 3O71A 3WE8A 4Z55A 3KREA 3OC1A 2XMYA 5F20A 3ORZA 2PVNA 4A9TA 5HO7A 4HYSA 2XAOA 5CAPA 2YM8A 5LXMA 3KRRA 3I1AA 4IACA 5E8WA 4G6LA 4FUXA 3EWHA 3C9WA 3FV8A 3KFAA 4XMOA 2QLUA 5DWRA 3JYAA 3WE4A 2B9FA 1Q8ZA 4XYFA 3MB6A 4IAZA 2YCSA 4QP9A 5AADA 2WXVA 3V5LA 3ORPA 4BJJA 3BL7A 4TYGA 3SC1A 1KE6A 5CX9A 3P4KA 5EM6A 2OF4A 3DKGA 3OTVA 1XH5A 3EL8A 3P9JA 4IC7A 3FLWA 2O0UA 4O2ZA 3RGFA 2VTTA 3EQRA 3K3JA 3KN6A 1W84A 2E9VA 2WO6A 1U5QA 4HZRA 4G17A 1O6KA 5GIOE 5AP6A 1HCLA 4EH7A 4DN5A 4GT4A 3HMOA 4RFMA 4AQKA 4ZLYA 3Q9ZA 1SMHA 3E93A 1O6YA 5FP6A 3QTRA 5JFWA 3FLNC 3R9RA 2YLFA 3QQHA 4BIEA 4EUTA 3ALNA 2AQXA 3B8RA 1NVQA 1IR3A 1IEPA 2JLDA 2PVKA 3P7BA 4FSUA 4CLIA 2WQNA 3Q9WA 5E1EA 2XK8A 3HKOA 4DG3E 5LVNA 3CIKA 3KF4A 2FGIA 1GZNA 2WQMA 3FUPA 3HDMA 2IVVA 1WCCA 3C4FA 4D5HA 1M2PA 4FTCA 2C6LA 2QCSA 2XIKA 3LFDA 4O96A 3ZHPC 3Q96A 3ORMA 5HVJA 3W0OA 4P4CA 4O27B 2XYNA 3UODA 5HICA 3JXWA 5E90A 2VX3A 1G5SA 3R1NA 2ITUA 3R71A 4WNKA 4BGHA 1VR2A 3AT4A 3TIZA 3UMXA 4ZTMA 3MWUA 3D83A 4DFYA 3Q4UA 2X8IA 2ITNA 2RSVA 4GT5A 3QFVA 3H30A 4K77A 4LRJA 3ZU7A 4U6RA 2A2AA 3ORIA 4JOAA 2VO7A 4NU1A 1LR4A 4G3FA 2BRGA 5CT7A 1ZZLA 2C0TA 1UU9A 5A4EA 3OEZA 4FKUA 4FNZA 4N6YA 5C03A 4BWXA 1U54B 2BTRA 3MFSA 4DBNA 4E5WA 3HUCA 4DAWA 4FVQA 4YJSA 5L8JA 4BVUA 3W33A 4ZTSA 3A61A 2WQOA 4QYEA 4A9UA 1REJA 3A7FA 4FV0A 3R7UA 4XG6A 4FKOA 5BV3A 5FTGA 2WQEA 1M7NA 4FZ7A 2ZOQA 3MH1A 3NNVA 1Q3DA 3WF5A 2ZM3A 3PA5A 2I7QA 3CQWA 1BL6A 3PY1A 5I4NA 4QTAA 4KD1A 4WSYA 5M4CA 5HORA 4C3RA 2ONLC 4O4EA 2I0HA 3QALE 4U44A 4YJUA 4GK4A 3TMOA 4L01A 4IJ9A 3DK6A 3AT3A 2F9GA 2XRWA 1FVTA 1OI9A 1PHKA 2V7OA 4FSNA 4QMPA 4XP0A 5TR6A 4C02A 2OJFE 3C0IA 3PIXA 4BRXA 4D2VA 3NGAA 4F1TA 4UN0C 2JEDA 3IW5A 3VS0A 1UU8A 5H3QA 4Z7GA 5KMIA 3LQ8A 3BEGA 3P7CA 4PMMA 1MP8A 1FOTA 2ETRA 2UVZA 2BALA 4KINA 3VJNA 3W2QA 4D0WA 4PRJA 4O4BB 2R3FA 3LM5A 1R3CA 3MA3A 5FTQA 4FA2A 3QGYA 5M08A 4A4LA 4BR3A 4C34A 4LOQA 2ZB0A 2IW9A 2B52A 3GU7A 3F3ZA 4F08A 5IEYA 1WBOA 3KULA 4RFZA 4YZCA 3NDMA 5CQWA 5IMXA 4RJ8A 2Z7LA 4MD8E 5DN3A 3TKHA 3GCSA 2O5KA 1VLRA 2WU7A 3PVBA 4MNEA 5G1XA 3R7IA 4ANOA 1ZYDA 3ZM9A 2YIQA 5CZIA 1R78A 3TNHA 3ZRLA 4CGAA 4IANA 3ZUVA 5M09A 4C37A 4EOOA 3RI1A 5BMSA 5KO1A 4RFYA 5AV1A 4JBVA 4NM0A 2GNJA 3A7HA 3UZTA 4C36A 3QUPA 5BNJA 4IBMA 4TWOA 5HLWA 1GNGA 3UPZA 4I41A 2Z02A 3O2MA 4PL3A 1Y57A 4NT4A 4DITA 5CXHA 2PUPA 3PXQA 3CKWA 5J7BA 3P5JC 5AMNA 4BDIA 3QWJA 5IDPA 3ANQA 4WKQA 3TNWA 4RMZA 2ZVAA 5DR9A 3VF9A 4DDIA 2XKDA 3C4ZA 4FEQA 4WOVA 3HL7A 4YJPA 2FSTX 3R8MA 2GPHA 4BIBA 3MV5A