2PVFA

Crystal structure of tyrosine phosphorylated activated fgf receptor 2 (fgfr2) kinase domain in complex with atp analog and substrate peptide
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
299
structure length
285
Chain Sequence
ELPEDPKWEFPRDKLTLGKPLGEGAFGQVVMAEAVGIDKDKPVTVAVKMLKDDATEKDLSDLVSEMEMMKMIGKHKNIINLLGACTQDGPLYVIVEYASKGNLREYLRARRPPGMESYQMTFKDLVSCTYQLARGMEYLASQKCIHRDLAARNVLVTENNVMKIADFGLARDINNIDKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLMWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPANCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRILTLTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Fibroblast growth factor receptor 2
publication title A molecular brake in the kinase hinge region regulates the activity of receptor tyrosine kinases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 90
structure length 285
sequence length 299
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2007-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2pvfA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2pvfA01
4RA5A 2WMTA 3S4QA 3E62A 4IWDA 1ZOHA 2XEZA 5HORA 5DYJA 2HZIA 4WKQA 4AZTA 3PY0A 4MYGA 5IQHA 4I3ZA 1CDKA 3DAKA 5L6WL 4YJNA 5L3AA 2Y6MA 4M8TA 1UU8A 2XM9A 5DPVA 2QOKA 4X3FA 2XKDA 4BKZA 5CT7A 3IECA 2X2LA 3FZ1A 3OZ6A 3F2RA 3FLQA 3G15A 2ERKA 3ORPA 3PLSA 3ZUUA 3UMWA 3MY0A 4IVAA 3E5AA 1NXKA 2X1NA 4D28A 2EU9A 4QP3A 4U79A 3BHTA 4D4SA 4O81A 5DMZA 1YOLA 3MB6A 3EL7A 2BRMA 1J91A 5AFVA 4AOTA 5AAFA 4O86A 3ODYX 1RW8A 5IMXA 4GEOA 3R7VA 4BDDA 3BZ3A 4O2PA 3ALOA 3E92A 4BDGA 3EKNA 2G15A 1OZ1A 3PJ8A 1U54A 2YIXA 4YZMA 4E3CA 2DQ7X 3LFBA 1YHSA 4M7IA 4AZSA 4E6DA 2J9MA 4UALA 4ANNA 1JOWB 4LYNA 4O96A 4CYIA 4TZRA 3SRVB 2X6DA 2C5OA 5AWMA 1ZWSA 4L46A 3GU4A 2R7IA 4AZEA 4IX4A 2O0UA 4HGLA 2XKEA 1PMVA 3KULA 3E93A 2FSMX 4ENYA 5EYMA 1WBOA 1W98A 3Q4CA 5DIAA 5HHWA 3UOKA 3PSBA 3W2QA 3ZBXA 4Y72A 2WXVA 4DGNA 3FMHA 5A6OA 4F9BA 3KMMA 4II5A 3LLTA 4FSUA 2QKWB 3R8VA 2PUPA 1V1KA 3ZDIA 3QD2B 3UOHA 3NEWA 4EZ7A 4F6WA 1J7UA 2GS2A 4TW9A 4OTHA 1JQHA 4C38A 4XLVA 2ITWA 4C8BA 4BICA 3QBNA 3C4FA 4PMMA 4ONAA 4FVRA 2QU6A 3OT3A 3H30A 4FTRA 4YJUA 4D2RA 3PVGA 4PDPA 5L6PA 3L8PA 3UOLA 4NM0A 3FPMA 4FNYA 2LGCA 4FTAA 3KRJA 5LQFA 3M42A 4GT5A 4UEUA 1BLXA 4ZLYA 3BYUA 2OJJA 5DNRA 5C26A 4TNDA 3ENMA 3VS5A 4AXAA 4CVAA 2W7XA 3FUPA 4FKJA 4AE6A 5CTPA 1VJYA 2C0OA 3KL8A 2ITNA 5M44A 5J9LA 3NIZA 3QYWA 4FL2A 4EOKA 1KUTA 4HVSA 4BGQA 1WCCA 1ZYDA 2C6MA 2UVZA 3BCEA 1A06A 3FI2A 2BTSA 1O6LA 4JAJA 4JDHA 1G8SA 4GKIA 2CGXA 3AGLA 3QRTA 4AS0A 2FH9A 4U44A 1Z5MA 2PVJA 2VO3A 3K2LA 3FXWA 4WG3A 1KE8A 2WMXA 3ACJA 5M53A 3AD5A 4KSPA 1NVQA 2PVYA 3KXMA 4QTBA 1XH7A 4YSJA 4WUNA 3KKVA 1XO2B 5HKMA 3RWQA 4ANMA 4ZAUA 4C58A 4BIDA 5HIEA 3NYNA 2OW3A 2VTOA 5J8IA 2XJ2A 3G5DA 3RHXA 4YZDA 4CV9A 5C1QB 4R77A 4BCNA 3VNTA 4FV7A 4O27B 2WZJA 4V01A 4QYYA 3OVVA 3PA5A 3V8TA 3GC9A 2JGZA 4FOBA 4FIHA 5HG5A 3DAJA 5HE2A 3GOPA 2YJRA 2GHMA 4FKGA 4QMNA 4J98A 4DEEA 3OXZA 1TKIA 3O8UA 2O63A 4K9YA 5CNOA 4YHJA 5GNKA 2WTKB 3UZPA 4YBKA 2BDWA 3C7QA 3MIYA 4Q2AA 5FXQA 3R9OA 3JY0A 3DPKA 4ACDA 4DCAA 2YM4A 3DGKA 4C3PA 2YAKA 2VO0A 5D1JA 4R7BA 5CEKA 4QNAA 4M3QA 5AA9A 1V0PA 5J95A 1SYKA 4PV0A 2HENA 4ZP5A 4BTKA 3CQUA 3VS6A 3W1FA 2CLQA 2NRUA 4NKSA 2R3GA 3HRFA 3R9NA 2HW6A 4ZLZA 5HO8A 4JAIA 3RGFA 1WBNA 4GK3A 4IB3A 3Q9WA 3VBQA 5F1ZA 4FTNA 3WZDA 2QD9A 4O0RA 3TL8A 1GZOA 3ACKA 2QOFA 2UZNA 4D4VA 5A4CA 4PNKA 5KHWA 3PIZA 3UP2A 5JFWA 3NNXA 4W4WA 2WOTA 3RAIA 2R3IA 3F66A 2PMNX 3ID6C 3LQ3A 3P86A 2X4FA 3QGYA 2GU8A 2PE1A 5EKNA 1YXTA 3P79A 5CWZA 3DKCA 4FZ6A 4G3CA 3LFDA 3TXOA 4HVHA 3R8MA 4EOOA 3DFAA 2XMYA 3RK9A 3VUDA 2PVHA 4G6OA 1Y6AA 2CLXA 2O2UA 3GOKA 3FZSA 5EHLA 2BROA 5LMBA 2E9PA 3PXFA 4ANBA 5B0XA 4CMTA 1Q8ZA 3KXZA 5M09A 3MVHA 5FXSA 2ZJWA 4DH3A 3OEZA 3FY2A 5F9EA 4BGHA 3Q6WA 2QHNA 4IFGA 4XJ0A 3R1YA 3WOWA 3LFEA 3EH9A 4UMTA 2HELA 3BGZA 2W1ZA 1OKVA 3EN6A 3HV3A 4L67A 3DNDA 2YITA 2UW8A 4MHAA 4NIFA 4DG3E 4JI9A 3O8TA 3VUHA 1HOWA 3S95A 2VTSA 4XEYA 5KMMA 4FGRA 3MWUA 2F7ZE 3BIZA 3NW6A 4W4VA 5CAOA 2OF4A 4FKRA 4ZZOA 4HYIA 4YJQA 4ANQA 1XH5A 2GQRA 2FYSA 3OWPA 4ZJVA 4MAOA 3KY2A 1O6KA 3GU6A 5CLPA 5HU3A 4BZOA 4FBXA 4ZK5A 2IZUA 2VO6A 3C50A 3QA8A 2C4GA 3BLRA 3OOGA 4U42A 3W2SA 4BDJA 4BWXA 3HRCA 5AV2A 4BI0A 4UXLA 4E6CA 3FKOA 3FMMA 3LCDA 4AW0A 5KMJA 4ASXA 2OJGA 3EOCA 3BYOA 4CTBA 4ZTLA 3LXPA 3W10A 4I22A 3S3IA 4ZS0A 4F9CA 1K9AA 2CNVA 3FSFA 4RFZA 3U4UA 3HV7A 5DEYA 4QRCA 2BZIB 4O2ZA 3RPSA 1CKIA 4X2GA 5HNBA 5HG9A 2J5EA 4EEVA 4GL9A 3MFTA 2GFSA 4TY1A 4F1OA 4P5ZA 4TYHB 3NUSA 4MD7E 4EHZA 2OZAA 4ACGA 4FF8A 4EWQA 4F7LA 3G6HA 4XP3A 2UZWE 4WNOA 4XYFA 4QQ5A 5AV0A 4Y73A 4RIXB 5AP0A 4DFXE 3HX4A 3ETAA 5KO1A 3A61A 1G8AA 4RVKA 2P55A 3FHRA 5JMSA 4XOZA 2R3NA 4RBLA 4BY9E 3BHHA 2JKMA 4XV3A 1H0WA 2I0VA 3PWYA 4HVDA 4H05A 1UKHA 3KCFA 1H27A 2UW6A 3BPRA 2B9JA 3R9HA 5TR6A 3IQ7A 5CVHA 3HV5A 3NAXA 4FTKA 4DFNA 4I4FA 1BKXA 4CCUA 2RG5A 4GS6A 2YDIA 1GY3A 5EK7A 3ZO2A 4AX8A 4S32A 3THBA 4FODA 1FOTA 3L9LA 3IDBA 5F4NA 3A2CA 4AACA 1BL6A 2QOBA 3DLZA 3W33A 4AFEA 3Q3BA 5K3YA 4W4YA 2PUNA 4TYGA 3FDNA 3Q6UA 4D2WA 2PVKA 5A4EA 3PY1A 4Y83A 3QFVA 3NPCA 3E8EA 2EWAA 3GFEA 4ZMFA 1OIYA 4DA5A 1QPJA 4WNKA 1YI6A 4MWIA 4IAZA 3RI1A 1PMEA 2J4ZA 2JFMA 2WIHA 1H8FA 3P4KA 3QUEA 5BMMA 5AV4A 4IZ7A 5I5ZA 3A7GA 4BIBA 4UXQA 3KK8A 4R78A 4FV4A 4HCUA 5HICA 4F7SA 4FV6A 2Q0NA 2Z7LA 2B54A 3K3IA 3NWWA 2XBJA 3D5WA 5GJDA 3TTJA 4FT9A 1VYWA 4PL4A 4QPAA 2DS1A 4A07A 3G9NA 2QO2A 4EWHA 5IA3A 5M4UA 4B7TA 3QAME 3PJ1A 4LGGA 5AM7A 3F6XA 2XK7A 3SA0A 4HOKA 5EM6A 1OVEA 3PVBA 2F2CB 3ZS5A 1YXUA 3NVKI 4GU9A 4KBKA 2XNMA 4RFMA 5CU0A 2C6KA 3OXTA 5I9ZA 2O64A 4QTEA 3EQDA 4PP7A 1XH4A 2FO0A 2BIYA 4ALVA 4DFZE 3VJNA 3ITZA 4YNEA 4IVBA 3ZXTA 3FLNC 4KBCA 4DFLA 4OTQA 3OT8A 2W9FB 3PXKA 5AUXA 2PZIA 2H8HA 4ACHA 5JQ8A 5L2WA 2P0CA 1WFCA 3FL4A 3RWPA 4KS8A 5LVMA 4IC7A 3QD3A 4LOPA 5EDPA 5LWNA 4FL1A 3PE1A 2A2AA 3HAMA 3AT4A 5LVPA 5LMKC 3GU5A 2PYWA 4N57A 4RMZA 3DU8A 5DR6A 5J87A 4EC8A 5CI6A 3G90X 2YN8A 4HPUE 4J71A 3ZONA 3OEFX 1Q8YA 2ETRA 4D58A 3DK6A 3EQFA 3HMOA 3ODZX 4NM7A 4RGJA 3H10A 3ZH8A 4HCVA 3TACA 5BX0A 5IEVA 4BRXA 4WRSA 4XG6A 4IVDA 1OL6A 1XQZA 5B2KA 2R9SA 4F64A 1L3RE 3S00A 2PZYA 3D9VA 4PPCA 5AV3A 4EH5A 2R3MA 3F5PA 1TQMA 4CKJA 4FTIA 2YJSA 5EW8A 3R8UA 5CANA 5JH6A 3DB6A 4FKPA 5AA8A 5D12A 2X9EA 5TE0A 3QD4A 3TV7A 3E8NA 3FXZA 3K3JA 4IWOA 3PTGA 4IM2A 2W1GA 3EQPA 4ALWA 2VWZA 4YPSA 3U51A 4DTBA 3W8LA 3UP7A 3VRYA 5IU2A 4BHNA 3PPJA 3RPYA 3UC4A 2QR7A 1OPJA 4FT0A 3R7YA 4PF4A 5E8VA 3CEKA 3OTUA 4UYNA 1UA2A 4L53A 4CSVA 4FEVA 2ZMCA 4E4MA 3F3TA 1GIHA 4NFMA 4F9AA 4E4NA 2BAQA 4QQCA 4QTDA 5DOSA 4RPVA 2FGIA 4H39A 4DE4A 2H34A 4IZYA 2IW9A 4FV0A 3WZKA 4J95A 3KREA 5CU4A 3FKLA 2QHMA 2OXDA 2OH0E 1WBWA 4A9RA 2JFLA 1OL1A 2BDFA 5EM8A 5CEOA 4PPBA 3R83A 2PHKA 3C5IA 4DLJA 3NUXA 4XUFA 1SVGA 1PYXA 5HBEA 3PJ3A 3NYXA 2PTKA 3GP0A 4AF3A 2YWPA 3ENHA 4BFMA 5DLSA 2XJ1A 3Q4TA 5HBHA 2WTKC 4K8AA 5JEBA 3TJCA 3TNWA 4GKHA 4FI1A 1WVWA 4ZTHA 4DGMA 2YM8A 5CSWA 4LRMA 1ATPE 4UWBA 1QPDA 3UC3A 1U4DA 4C3RA 4O7WA 3W2OA 2C69A 3TNIA 3H0YA 3TG1A 2F2UA 2ITVA 1GZ8A 4FNWA 5HD7A 1ZMUA 3NUPA 4FV5A 4H1MA 3RNYA 3F82A 3GCUA 4DHFA 2J51A 4EBVA 3DBCA 3MESA 1MQ4A 1PKDA 3CKWA 3G0EA 3LCKA 3CJFA 3QTRA 4GV1A 2XK6A 5IUIA 3ZO3A 4FT3A 4FKWA 4QP9A 4R1YA 5DA3A 3ROYA 4G31A 5DBXA 3OC1A 2W17A 4YZBA 3CLYA 1QMZA 3COIA 2XKFA 2BTRA 4QPSA 4JS8A 4F7JA 5JT2A 1TQIA 1W82A 3UYSA 4CTCA 4QOXA 4QP6A 5BYLA 3Q32A 5HGIA 3QQUA 4DGGA 4IANA 4ZLOA 2Z02A 1JLUE 3VHKA 3CQWA 3V8SA 2WIPA 2ETKA 3U87A 1YOJA 3R1QA 4LRKA 1PJKA 5IDNA 5E91A 1A9UA 4AG8A 2XK9A 4K1BA 3DB8A 2RFDA 4OBOA 4KIOA 4U5JA 5JGDA 3UVPA 3A99A 2F57A 3FMNA 4GJ2A 3CQEA 4BB4A 4TT7A 2VTMA 3FMJA 3ULIA 5B7VA 1R3CA 4X6QC 3GC0A 2W99B 3V3VA 4JVGA 2E2BA 4LGDA 3OUNB 3ZXZA 4AW2A 4I6QA 2I7QA 3BHYA 2X7GA 2VV9A 4IW0A 5H2UA 4LMUA 1K3AA 3R9RA 1YXXA 4AN9A 1NY3A 5HCZA 4WIHA 2UZEA 1PKGA 1DS5A 2QVSE 3FI8A 1OKYA 4M84A 4NW6A 5E8WA 2ZV2A 3IPHA 4O6EA 4O91A 3UZTA 4G5JA 3QUPA 2EXEA 4L3LA 4XRJA 4FG9A 3T3VA 2QCSA 4FK3A 3VBYA 5LVOA 4O7LA 3ERKA 4IAYA 4NZWB 4FIGA 5HG7A 4TXCA 4G3EA 4QMUA 3LPBA 2QNJA 4XHKB 5CZHA 4FIJA 4FSWA 4WA9A 4TRLA 4YNOA 4EH4A 2HY81 1ZXEA 5HNGA 5M55A 4E1ZA 4V0GB 2ITZA 5KMKA 4R8QA 5FXRA 1H24A 1JVPP 2O3PA 4O0UA 2VTNA 5CSPA 3VUKA 3QTSA 4GYGA 2FSLX 3GCQA 3V51A 4AQCA 2CGVA 4I24A 2CSNA 1YVJA 3A4PA 5A54A 4J97A 3W32A 3UQGA 4JG8A 4NTSA 4M15A 2R5TA 2PWLA 3E63A 2J6MA 4ZTNA 4XOYA 4BDEA 4IJPA 2IZRA 5DRBA 3JXWA 2JITA 3H3CA 3OBGA 4FV1A 2I6LA 1H1WA 4AP7A 2XRUA 4X21A 4TYIA 4IZAA 3R21A 1BMKA 3RALA 4PMTA 3HKOA 2WU7A 3BYSA 5A6NA 5HU9A 4F08A 4LG4A 4DG0E 3HEGA 5K9IA 4YGAA 4O7VA 2CN5A 4I6FA 3NYOA 3ZFXA 4EH2A 2UZBA 1YXVA 4E6AA 3BBTB 5KZ0A 2FA2A 3AC1A 4MF1A 4C35A 5J1WA 3CY2A 3DJ6A 2VWXA 3JYAA 4F63A 3R2YA 4J99A 3KB7A 4JT3A 1SVEA 3DA6A 1T46A 4ZY5A 4GG7A 3OOMA 2GQSA 5IUGA 4XBUA 3IW5A 1MRYA 3HDMA 2HCKA 2OF2A 4FV8A 3SX9A 5LWMA 2H96A 2I0YA 1UWJA 1ZMWA 2YABA 1TVOA 3D0EA 4XP2A 4ASEA 4EK4A 2G1TA 3LOKA 5GZ8A 2HAKA 2QURA 2VU3A 3ORZA 2WMWA 3DFCB 3TEIA 2RFSA 1JAMA 4BCOA 2B52A 4EJ7A 3FXXA 4DITA 5IF1A 2C30A 2QQ7A 3KXNA 5ANKA 4HVGA 2VTLA 3MN3A 4NT4A 2R3KA 4WNMA 3DK3A 3O8PA 3V01A 3AT3A 3LQ5A 4PP9A 4FYOA 2B9IA 3MPTA 3RTPA 4FMQA 3V5PA 3VUMA 4H58A 4ANOA 3NSZA 5IPJA 4DINA 3QTIA 1OI9A 4IZ5A 1Z9XA 3UQFA 1XKKA 4FTOA 3SLSA 5F94A 2C68A 4IXPA 4EKKA 2VO7A 3DXNA 4PPAA 1OL7A 2IPXA 1BX6A 3A7FA 3M1SA 4RFYA 4I5HA 1Q3DA 3SW4A 4IHPA 3MYGA 2XP2A 2QKRA 1FQ1B 5EW3A 2WQBA 2W1HA 5TKDA 5IQEA 1BUHA 4FICA 4EHVA 4FEXA 1Q8UA 2YM3A 3PPKA 5A4TA 5L2SA 4W4XA 1ZOEA 4W8DA 4O84A 1MUOA 3H9RA 4KSQA 4U41A 3FI3A 4CMUA 4NEUA 3WI6A 4Y85A 1JKSA 2JBOA 4ZY6A 3QA0A 2C3IB 4TWOA 3UG2A 3DK7A 4CQEA 3ZC5A 1GIJA 4FEQA 4G6LA 5EOBA 4D9TA 2BFYA 5KKRB 2JKQA 1M2PA 3CKXA 4JX7A 1NVSA 4L6QA 5L8JA 2SRCA 5I0BA 4TTHB 4G5PA 3TV4A 1XJDA 2Y9QA 3PG1A 3G33A 4FZAB 1LEZA 1OIQA 5CQWA 3VWAA 4EQCA 1B6CB 3QQKA 4X0MA 2B9FA 1WBTA 4M68A 3WZEA 4L52A 2CKOA 3POOA 1F3MC 2ZDTA 3JS2A 1MRUA 2YCQA 3WF9A 3ZOSA 3P7AA 4MXOA 4APCA 3T9TA 3RZBA 3F88A 4BBFA 5C4LA 4LGHA 2C5VA 2IZSA 1ZOGA 3R30A 3I0QA 1FGIA 1OM1A 2R3HA 1UVRA 1R0PA 3R1NA 4GFGA 4CZUA 5BPYA 2BHHA 2UW0A 4UMQA 1H4LA 4ITJA 1J7LA 5IA1A 2WMAA 1YW2A 2ZM3A 3TZ7A 4FG7A 2GNFA 3EQCA 4L3PA 4O0VA 1JSUA 4IFCA 4FKIA 2WU6A 4XG3A 2WQMA 2I0EA 4I4EA 5CSHA 4ASDA 3NGAA 3RK7A 4FUXA 1O9UA 4CLIA 3TUCA 3QYZA 5HE1A 2IVUA 2W4KA 2IWIA 4FZFB 2LAVA 3RP9A 5EW9A 3V6RA 1CMKE 4BZNA 5KX8A 4M69B 2XK4A 4RX7A 3T9IA 4CG8A 2JDRA 4B99A 4W9XA 5EM7A 3V5WA 1U54B 1IG1A 5D11A 4DH5A 2FSTX 4A9TA 3BQRA 2JDTA 2QLQA 3EB0A 3UTOA 4CKIA 4EYJA 3FJQE 1GOLA 3KMUA 4D4RA 3HYHA 5J1VA 4TYJA 2IO6A 4CGAA 4O0XA 2OH4A 3QCYA 2Z7QA 5AUZA 4DEIA 1H1RA 2X8DA 3EZVA 5AX3A 4U7ZA 5CEMA 3CGFA 3KULB 4BTFA 4BL1A 3RZFA 4EHEA 3TUBA 3TNHA 4YLLA 1WBPA 4RSSA 4ZTMA 4NUSA 4QMSA 3ANQA 1OL2A 3UBDA 2YLFA 4UV0A 1L8TA 4C4EA 4QMXA 2O5KA 4BDIA 4HW7A 3DTCA 2DUVA 4JR7A 5BVWA 3PFQA 2BPMA 3PY3A 5CXZA 2X0GA 3O71A 4MBIA 1V0OA 4WOVA 4XG9A 3V6SA 4LV8A 4BWKA 3KRLA 4EK3A 4O0WA 4YHTA 5A4LA 2J90A 2XB7A 3PG3A 3FAAA 2PU8A 4CZTA 4D0XA 3SG8A 4WSYA 3AGMA 3PJCA 4FEWA 2X39A 5AUYA 3U6HA 1B38A 4GIHA 3ROCA 3R22A 4BHZA 4IWQA 5EI2A 5AIKA 4YP8A 4ERKA 4GJ3A 4TN6A 4QYFA 3W55A 3W16A 2JAVA 3B8QA 4NCTC 3JR1A 4L7SA 4RLLA 5AR7A 3OP5A 3L8XA 5D7VA 2B0QA 4O1PA 3CBLA 2JKKA 2XUUA 4D2SA 5BVOA 2YFXA 4GCJA 4IX3A 4UWCA 3WE8A 3ZM9A 4KKEA 5M4IA 4WUAA 1GNGA 4JLCA 3UG1A 1R0EA 4L01A 1OKZA 4K18A 2Y0AA 2ITYA 2E9NA 4C0TA 3U6IA 5KBQA 4YR8A 4UYAA 1REKA 4YURA 3S0OA 3NAYA 3ORNA 2ZVAA 4C2VA 3LCOA 4FIFA 4MNFA 1PXIA 3PVUA 4DTKA 3U6JA 1H1QA 5JSMA 4DH8A 4M14A 2NRYA 4ZTSA 4QMLA 5L8KA 1H1SA 1ZYLA 3FPQA 4MWHA 3GU8A 2OFUA 3MVJA 5F20A 5CAPA 4ORKA 1H1PA 4QMQA 3QF9A 1P4OA 4UMRA 2CN8A 2EUFB 2X9FA 4EK5A 2BUJA 3F3ZA 3WIGA 1FGKA 1PXNA 2O8YA 4J96A 1WBSA 3UGCA 2BILB 3WZJA 2RL5A 3OWLA 3MS9A 5DEWA 5IG1A 3RM7A 2W9ZB 3D2IA 3HZTA 2XIYA 3P7CA 3FZTA 3KXHA 3VRZA 4KABA 5ETIA 4BC6A 3N4TA 2Q83A 1M2QA 3OG7A 3PSDA 2GS6A 3MPMA 2V5QA 5EHYA 3QQFA 5DGZA 4BDBA 5FM3A 4C4JA 3UYTA 1PMUA 4UZDA 2YZAA 3LMHA 5BVDA 2R3PA 3DNEA 3QWJA 2VWYA 5CF4A 1PXOA 3DCVA 3ORTA 3G51A 2C6TA 3R7GA 4Y8DA 3LZBA 4BWPA 2B4SB 5E1EA 5T68A 3IK3A 4EZ3A 4AA5A 5KNJA 3SOCA 4F0IA 4O7RA 2UZUE 2XNGA 2GTMA 4RX5A 3O50A 2UVXA 4YZ9A 4KRCA 3IGOA 2QO9A 2R3QA 2QOIA 3RM6A 4D5KA 2CCHA 4DEDA 5EYCA 4UN0C 4A7CA 4L68A 4ZZMA 5JFSA 4HGSA 4KIKA 4U81A 1FVTA 4CFFA 2WMBA 4CT1A 1H00A 3MH0A 5CEPA 1JKKA 4Z7HA 3R7IA 3IW8A 4BCKA 2BVAA 4CV8A 4UWYA 3UO5A 2VRXA 4BN1A 4RZVA 2OFVA 2R3OA 2YWVA 4X3JA 4PDSA 3V5JA 3SW7A 3BYVA 4E8AA 3RKBA 3HP2A 5GJFA 2C1BA 4A4XA 1VZOA 3AC4A 3KQ7A 5DR2A 2PUUA 2I40A 2QU5A 5HLWA 4BCGA 5KMNA 3EKKA 4FA2A 2XM8A 5EQPA 5CAQA 1RJBA 1LPUA 4FE2A 3NYVA 2J0LA 1Y8YA 3BE2A 1S9JA 3R00A 4FSQA 5T6KA 4AT3A 3LE6A 4NIFB 4D9UA 3Q5ZA 4QT1A 2X6EA 2W0JA 4XG4A 1KOAA 4O7NA 4OAVB 4R1VA 4AN3A 4EK8A 3TN8A 5FTGA 3GNIB 5B2MA 1OKWA 2OGVA 2V7OA 3FKNA 5C4KA 4ERWA 4WD5A 2O65A 3PXQA 4JXFA 5A4QA 3EWHA 4Z7GA 3QZGA 5J5TA 1B39A 1PW2A 2FB8A 3I5NA 3HV4A 3RBWA 4BDFA 4E26A 2R0IA 4YTFA 4FZDB 4AGCA 4OT5A 2ETMA 3EZRA 2IW6A 3QRIA 3F2NA 1ND4A 3KRXA 1STCE 3MVMA 1PXKA 3Q60A 3L8SA 5IQDA 3CR0A 3EFLA 3QKKA 4GIIA 3LXNA 4ZTRA 3QWKA 5AIRA 4C62A 4CFWA 2XJ0A 5IA5A 5ITAA 5HLNA 2IVTA 3V5QA 4QTCA 3UIBA 3D83A 4XV1A 2G2IA 4KWPA 3SHEA 2J0IA 3G0FA 3SG9A 1IA8A 1G3NA 3LVPA 4USDA 1BYGA 3KCKA 2GPHA 4BI2A 5IEYA 4U3YA 4PL5A 2ZAZA 2XH5A 4I1ZA 5GHVA 4YUQA 4TKSA 3PRFA 3B2TA 3FI4A 4D2VA 3F9NA 4L3JA 1UNHA 3EFKA 4HNIA 3SXSA 3MB7A 4E5BA 3FBVA 3EQHA 3FQHA 3UPZA 1M52A 5I9VA 3CTJA 4RLKA 2AC3A 5KMLA 5IQIA 1YKRA 2BZJA 3Q4UA 2ZM4A 4F99A 2C6EA 3BBWA 3KXXA 2WTIA 3DY7A 4YMJA 3R8ZA 3CC6A 3OY3A 4U3ZA 5GZAA 3MY1A 3C4CA 4EOMA 3U55A 3CTQA 4K77A 4MQ1A 3EFWA 4ZTQA 3NUYA 5GJGA 4MXYA 4HYHA 5C8NA 3IGGA 3PWDA 5BVFA 5IQCA 4I0SA 3VF8A 3BEGA 3DXQA 3PJ2A 4ZSEA 3JVRA 3EYGA 3I1AA 4OGRA 1J1CA 1IRKA 4CFVA 4U8ZA 4PMSA 3FEGA 3LFNA 1UKIA 4K33A 4QP1A 4JDIA 3I7CA 1RQQA 2PVLA 5KCVA 4JQ8A 3DXPA 5H8GA 2C6OA 4FTQA 5ANGA 3N4UA 1YWRA 4TYEA 5HZNA 2F9GA 3Q9ZA 4W9WA 1F5QA 1TQPA 2OICA 4TWPA 5BQ0A 4R3CA 4G3GA 4JDKA 2VX0A 4JQ7A 4MX9A 4USEA 5GIPE 2Z60A 5IA2A 4USFA 2YDKA 2YISA 3GC8A 2EB2A 3PSCA 5C8KA 1OBGA 4BTMA 3E64A 4P90A 5JN2A 2OJ9A 2X4ZA 3TNQB 4QMMA 3KEXA 5AR5A 5L2QA 5E9EA 5H8EA 2ONLA 3D5VA 3CSVA 3FL5A 1SVHA 3BLQA 4TPTA 1CKJA 4D1XA 4UX9A 2C5YA 2W05A 2VTJA 3OCTA 4RIXA 4XV9A 4ACCA 3L9PA 3A62A 3MY5A 1X8BA 3LM0A 4FTTA 4JJRA 4S30A 3SAYA 2ITXA 2REIA 3D7TB 4PX6A 4MD8E 1UU7A 3L9MA 4U97A 3V8WA 3H9OA 3LFQA 4C4FA 4E5AX 3MPAA 4Q9ZA 2OO8X 4Y5HA 2HZNA 1YWNA 3FHIA 3ORXA 4KKHA 1YWVA 3DBQA 4ENXA 2P2HA 5A3XA 5C27A 5AR8A 4C4HA 3L1SA 5JGAA 3EQGA 2YCFA 1PXJA 3I6UA 3FC2A 2VAGA 1J7IA 1XH9A 1YDRE 2OI4X 3U54A 4W8EA 5K4IA 4WG4A 2CJMA 4DH1A 4RWIA 3LW0A 2W1CA 2C47A 2UVYA 2X7OA 5M4FA 3VW6A 5C8MA 3UVRA 4L9IA 4XX9A 5CS6A 1UNLA 2W1FA 1M14A 1KSWA 3HRBA 5KBRA 4A4OA 3AC2A 3HV6A 4JNWA 4PMPA 3BRBA 4XLIA 3Q5IA 1P14A 4QYEA 5JKGA 3U9NA 3NNWA 2NO3A 4BCFA 2ITQA 4DYMA 3PPZA 4G3DA 4RIYA 3TV6A 1PMNA 4A4LA 5L6OA 1FPUA 2Y7JA 5EG3A 2B1PA 1OPKA 4BDCA 4I94A 4I41A 2OIBA 3FLYA 3I5ZA 2XIKA 3BV3A 3VBXA 3GXLA 3DAEA 3RAKA 4QYGA 4EC9A 3G2FA 1OMWA 3FLWA 2IG7A 1WVYA 2IZTA 1Q62A 5FTQA 3VIDA 3D14A 3REPA 5KZIA 4ASZA 2BKKA 3G6GA 3RAHA 4JL9A 3UIMA 2JLDA 3MA3A 5AP6A 4EI4A 2QI8A 2WGJA 5AR2A 4HJOA 4CT2A 4H3QA 4YJSA 5HIBA 3OCSA 5BVEA 2BAJA 3FE3A 5M07A 2XYNA 5FQDC 2BAKA 3GBZA 1AQ1A 4BR3A 1YRPA 3UIUA 3O17A 4IMYA 3O7LB 4NYEA 3A8WA 1K2PA 2PMIA 1W83A 3A7IA 3IW7A 3PXZA 3SOAA 3NCZA 3WF7A 2WMUA 2XBAA 4YJTA 3VVHA 5AP3A 3ZZWA 4D2PA 2GNLA 3HGKA 4GVAA 2RGPA 3JUHA 2W4JA 3UNZA 2CDZA 4PTGA 3BQCA 4J52A 4DGLC 4YTCA 2QG7A 2Z7SA 4JRVA 1ZLTA 2GMXA 5E7RA 4G16A 5AUWA 2WTWA 4FEUA 2HXLA 3QCXA 4A06A 4BDHA 1G5SA 3CPBA 5M06A 3AMYA 3QKMA 3RPOA 3UE4A 4EOSA 3KVWA 3BV2A 4LOQA 1ZAOA 2ZM1A 4DEAA 3CD3A 5HI2A 3SQQA 5AEPA 4GT4A 4P5QA 4I20A 1RE8A 2WTDA 3MA6A 3A7JA 2B7AA 3LMGA 4M67A 3TDWA 3OW3A 3C1XA 5ANEA 1T45A 5ETCA 3KFAA 1WBVA 4GT3A 5CXHA 1JKLA 3I7BA 4FC0A 2XNOA 3LCSA 4S31A 2WO6A 4I5CA 4DT9A 2PE2A 3W8QA 3QQJA 4O82A 5D10A 3ZC6A 4I23A 3WILA 3V04A 3O96A 4GK2A 4O21A 2W5AA 5J9YA 2OK1A 3GCSA 5IZFA 3WIKA 2XCHA 5AR4A 4IB0A 3TT0A 4ZY4A 4CZYB 5CT0A 4I5MA 3MFUA 5HX8A 5KMOA 4MBJA 2JDVA 3KU2A 4WHZA 4FGBA 4C4IA 4DBXA 2IN6A 4MNEA 3RCDA 3LHJA 4G9CA 3BHVA 3CJGA 4PQNA 2C6IA 5CAVA 4PTEA 2PE0A 3ORIA 3OF0A 3LXLA 1WZYA 1XWSA 1GIIA 3Q53A 3L9NA 3OFMA 4FR4A 4JQEA 1IAHA 3EQIA 4MEDA 1ZRZA 2A19B 2GFCA 4LV5A 1FVRA 3QU0A 3D2KA 3EHAA 2JIIA 2WQEA 4LI5A 5HIDA 3VULA 2R3LA 2YIYA 3TI1A 4GMYA 3RNIA 1EH4A 4NW5A 4S33A 3P7BA 2XS0A 2YCRA 4F9YA 1Q5KA 3FMEA 2BRGA 5ANOA 3CPCA 2JIUA 4U9AA 3VBTA 4RIWB 3OTVA 5LMAA 4LM5A 2RKUA 2RSVA 1W84A 4IAAA 4BYJA 5IKWA 3BELA 3QTXA 1P4FA 2Q0BA 5IA4A 4JRNA 2P3GX 4NCTA 4NU1A 5LXMA 3FMKA 2YIWA 3VS4A 5IEXA 3ZSGA 3HECA 3RPRA 5GZ9A 5EDQA 4NH1A 4G9RA 2ZDUA 5HOAA 5M57A 4JIAA 1S9IA 4YO4A 3ZUTA 3NR9A 5AAEA 5A14A 1P2AA 2CNQA 2CMWA 4FTUA 4KNBA 4QMPA 4RT7A 4RWKA 4DEHA 3MW1A 3QHRA 1FBNA 3R0TA 4EQUA 1UU3A 2HZ4A 4JOAA 4FKLA 5LJJA 4JX3A 4LRJA 3TIZA 5CU6A 2V7AA 2XZSA 3DDQA 2G01A 3O23A 1YDSE 2XIXA 3IOPA 3ORLA 4KINA 2C3LA 1VEBA 2YM7A 4R7HA 5TF9A 2X8EA 3QC9A 4IDVA 5CZIA 4B0GA 5DT3A 3FC1X 4BCIA 5CF5A 4YC3A 3UPXA 3R04A 3EQBA 5L2IA 3TIYA 4DTAA 4X2NA 2X2MA 5K0KA 3C5UA 3MJ2A 4X2KA 4RRVA 4EH3A 3F61A 1XBBA 4IIRA 4QNYA 5C9CA 2W5BA 4ZJJA 4FUYA 4C34A 4EONA 3C4ZA 2J50A 4LFIA 4U0IA 2VWBA 2C5XA 3GQIA 2XIZA 4C57A 1ERKA 4NJ3A 4RG0A 3TTIA 3P78A 4BGGA 2E9UA 4MBLA 4C7TA 4YLJA 3F7WA 2JAMA 3ZZEA 3FYKX 5I3OA 3I81A 3MH2A 4K6ZA 4ZEGA 4EL9A 3WZUA 2KTYA 3AMAA 1GJOA 4PWNA 4HVIA 3QTWA 4YZNA 2W1DA 4OTWA 3NDMA 1RDQE 4F4PA 4YPDA 2X7FA 4JBVA 5IH4A 5E8UA 1SNXA 5IH6A 5DRDA 3ZFYA 4V0GA 5FRIA 3GC7A 3ZFMA 4DN5A 1R39A 5JZJA 3CP9A 4FK6A 3QUDA 5CYIA 4H1JA 2V62A 2OZOA 4YSMA 3WE4A 2ZV7A 4WBOA 4U80A 5EOLA 4LQMA 3O51A 4RJ7A 3QTUA 4RQVA 3GQLA 3KN5A 2WTVA 5CQUA 5CAUA 1APME 1Y8GA 4HGEA 2WEIA 4EH6A 4IADA 4XP0A 3UIXA 3N4VA 4TNBA 1DM2A 5FBNC 3FZRA 3WF8A 3DZQA 5DT4A 1PHKA 2A1AB 3C0HA 3QX2A 3HMPA 3F69A 2UUEA 3R28A 4Y5QA 5EI6A 3VW8A 1XBCA 3IOKA 1YXSA 4I92A 3PDTA 1OITA 4O7YA 3IKAA 4LMNA 5BUJA 3MFRA 3HAVA 4O0SA 4ANLA 3I0OA 3O7LD 4H36A 1NA7A 3GI3A 4QP7A 3WF5A 2XVDA 2A0CX 3R8LA 2C5NA 3HMMA 2OBJA 2BZKB 1QPCA 3P23A 4F09A 4WRGA 5E92A 5JRQA 4RC2A 4H3BA 3DDPA 3GCPA 1GZKA 4MK0A 3VN9A 2H6DA 4I5PA 4G34A 4BKJA 3C51A 4IX5A 3OROA 2PMLX 3SVVA 3CIKA 2GCDA 2PZRA 2EXMA 3P1AA 5E8ZA 4IAKA 4E4XA 4BCHA 5FP6A 3P08A 5EI8A 4IQ6A 3ZEPA 1BI8A 1H25A 2RFNA 4C36A 3F7ZA 2HYYA 1NT2A 1IR3A 3HVCA 4HGTA 1V0BA 4BCJA 3QZHA 2YM5A 4EOQA 4IAIA 2KULA 3K5UA 3JY9A 3MV5A 1R78A 3D7ZA 4QP8A 2A27A 3U9CA 4QMYA 1MQBA 4GYIA 5CVGA 4FSRA 3E7VA 4KBAA 3P0MA 4V05A 4DEBA 4EHGA 5HTCA 3HUCA 1ZZLA 4I6HA 4UY9A 4A9YA 3OBJA 3AMBA 4P4CA 4G17A 4JDJA 2BKZA 3Q52A 4E5WA 3MBLA 5C03A 1SNUA 3C4EA 2HY0A 2BCJA 5BVKA 3NUAA 5LCJA 2OIDA 5HTBA 1CM8A 4TWNA 3PYYA 5AMNA 1ZYSA 1CTPE 5HNIX 4N6YA 1Y91A 4PRJA 4LUEA 3VS2A 3DKFA 3PIXA 4X3FB 2AYPA 4GFOA 4EYMA 2F49A 4NWMA 5HTIA 5IQFA 2X8IA 1W8CA 4EBWA 4G2FA 3P5KA 5JZNA 2F7EE 4L44A 4F6UA 3E8DA 1FMOE 3ZSIA 5ANDA 3W18A 3GGFA 3NNVA 3R8PA 1XR1A 4E6QA 4O0YA 3KK9A 3WYXA 4OTDA 3BI6A 4CFMA 3S1HA 4G1WA 3EIDA 5FTOA 4EH7A 2YA9A 2C6LA 5E8SA 3HUBA 4AOJA 5I4NA 1OGUA 2HZ0A 4GUBA 4Q9SA 3KN6A 4YC8A 4OAUC 4M13A 2R0UA 4GK4A 3Q4ZA 3R71A 3C0GA 3QZFA 3FQEA 5LCKA 2Y4IB 2ZV8A 3VQHA 3ZTXA 3EN5A 1KE9A 5I9WA 4JG6A 1YI4A 2HWPA 4YTHA 3HP5A 4OBPA 2XA4A 4X7QA 5ANJA 3BWJA 4L45A 4BZDA 2QOLA 2B9HA 4PNIA 4J7BA 2V22A 4EUTA 4MQ2A 2JIVA 4GVJA 5AUTA 3BX5A 4AUAA 4E7WA 5KUPA 3UO6A 4I0RA 2XKCA 5ACBC 3AC3A 3SKCA 4U6RA 4XS2A 4BYIA 3DQWA 3E3BX 3NW7A 5AP7A 3R9DA 3QLFA 5H8BA 2JDOA 4CRLA 4OUCA 3AT2A 4MXAA 5EKOA 5FWKK 5GIOE 1NW1A 4QO9A 5E8YA 5FBOA 3HA6A 4DEGA 4MF0A 3TWJA 2C3JA 5HD4A 4FSMA 3SC1A 5M56A 2BMCA 4OTPA 3JVSA 4I0TA 3D5UA 5I3RA 5CNNA 5E90A 3DOGA 3HLLA 4DT8A 4M69A 4OLIA 3GU7A 3QQHA 5DVRA 4CEGA 4U45A 3UNKA 3DJ7A 1ZY4A 2W06A 4X2FA 1KWPA 4N0SA 1M7NA 1I44A 4CLJA 3OS3A 2PVMA 5FP5A 4RQKA 3CCNA 3LMIA 4R7IA 2R4BA 2F7XE 3QGWA 4RJ6A 4AZVA 2YHVA 4XG2A 4UBAA 3QTQA 2Z8CA 5DFPA 4FZ7A 4MXCA 2IJMA 4KIPA 2PPQA 3E7OA 5EH0A 4U43A 4NM3A 5HLPA 5HBJA 4C2WA 3F2AA 3F3WA 4B9DA 5FEQA 3ZUVA 2XYUA 4K0YA 2YEXA 3SRVA 1OECA 3QQGA 5HVKA 5CSXA 1I09A 5IH5A 2UZDA 4R3RA 4IEBA 3HNGA 5EYDA 5FDXA 3ZDUA 2OXXA 4V04A 4YTIA 4ZOGA 4APPA 1E9HA 4O1OA 1Q4LA 5EM5A 3LJ1A 4F9WA 5JQ5A 1QCFA 3IW6A 5HE0A 3V5TA 2WOUA 2W4OA 3GFWA 4ZZNA 5HQ0A 3GB2A 3NNUA 5LMKA 5DWRA 2CKQA 1XBAA 3KMWA 4AZWA 4S2ZA 4D0WA 3TKHA 2BZHB 2JBPA 4G6NA 4BDKA 3LXKA 4EORA 3SD0A 3QCSA 1UWHA 2WFYA 4CYJA 3QXOA 3SXFA 3MDYA 3OW4A 5CEIA 3BYMA 3AD4A 3EN9A 3MI9A 4XG8A 2Z7RA 3FY0A 5M08A 1DI9A 3KF4A 1KE6A 2UW3A 4NJDA 5G6VA 2J5FA 2GSFA 2HW7A 3FWQA 3PXYA 3TZ9A 5J7BA 2C0TA 3NW5A 3LAUA 2XRWA 3HMNA 4J53A 2Z2WA 4HPTE 2YACA 4L00A 3S2PA 2CHLA 4C02A 1F0QA 2PUIA 1AD5A 3QD0A 4WBBB 3DTWA 3ZRMA 1H26A 2EB3A 2C0IA 2GS7A 1E1VA 4NM5A 2PZPA 5FLFA 3BE9A 1OPLA 3W2PA 4TWCA 1YDTE 2I1MA 4FSYA 1U5RA 4RA4A 3ZYAA 4KIKB 4M97A 3QL8A 4RJ8A 5D7AA 5I9YA 1KV2A 1IAJA 3VUTA 3PP0A 4KRDA 1NVRA 4ITHA 1ZYCA 3PXRA 3NX8A 4CFXA 5FEEA 4QMWA 1YQJA 3I4BA 4PL3A 2CGUA 4MH7A 4ARKA 3VBVA 4O38A 1OL5A 4FTLA 2A4LA 2PZ5A 2XEYA 3FLZA 5HVYA 1DI8A 3WARA 4EH8A 2BRBA 4FOCA 4QMVA 4PTCA 5HG8A 3PZHA 5AR3A 4GH2A 4ZMEA 3F3UA 1FMKA 4P2KA 2HXQA 4RJ4A 1OBDA 2OIQA 5JRSA 4DG2E 3FMDA 4DF3A 3BKBA 3A60A 4EUUA 4GFMA 3B8RA 2BRNA 3H9FA 2QODA 4RVLA 4C37A 4EOPA 5CALA 4IDTA 3BGQA 2HOGA 3ZLYA 2ITOA 4E20A 5E4HA 5IQBA 5FM2A 2ZB1A 4ZS4A 3UODA 4ALUA 2P2IA 5EFQA 3FSKA 3AOXA 1IA9A 4HNFA 4FNXA 1M2RA 4DLIA 1W0XC 2QONA 1URCA 5IISA 2VWVA 3OY1A 5FEDA 3TUDA 4KUJA 1A48A 4DH7A 3IS5A 3KVXA 3MVLA 5JGBA 3SGCA 3B2WA 2OXYA 2E9VA 1OUKA 4EOJA 2R7BA 3W2CA 4GUEA 5BUEA 1KV1A 1W7HA 3QXPA 4Q5EA 1JPAA 3MJ1A 2VX3A 3E88A 2F4JA 3C4WA 4MKCA 5E8XA 5TO8A 3PA4A 2V0DA 2OLCA 2G2FA 4G3FA 4N70A 4B8LA 2BHEA 4Z3VA 3COHA 3Q2JA 1ZZ2A 2RIOA 3KC3A 1ZARA 5FGKA 4FTCA 2JDSA 4AWIA 4FSTA 5HCXA 3SV0A 4FYNA 2YERA 2VGOA 4P7EA 1MP8A 4FNZA 4ZJIA 5T3QA 4L7FA 3VS3A 2VWUA 4GW8A 2HK5A 3BGPA 3HL7A 4QMZA 5AP5A 3ZM4A 4OW8A 5JK3A 3ZSHA 1WMKA 3I6WA 4LL0A 5DHJA 5D41A 3BU5A 4D2TA 2ZOQA 3ORKA 3QLGA 1KE7A 1LR4A 4XNEA 2WMSA 3M2WA 4BDAA 1GAGA 1ZMVA 4YO6A 4PDYA 3EFJA 4J8NA 2QG5A 3O0GA 4M66A 2OZAB 3QQLA 4IB5A 4J8MA 4IACA 2W96B 2WNTA 3ZLWA 1U59A 3GEQA 3A4OX 4FKTA 2XIRA 4IE9A 3M11A 4OTRA 5EQEA 3EYHA 2P33A 4FVQA 3DZOA 3WBLA 4AW1A 2XNEA 3RPVA 4AFJA 4B6LA 3IONA 3FZOA 3LFSA 4ACMA 1UNGA 3AXWA 3PZEA 2WQNA 4QYHA 4RX8A 3LIJA 5EDRA 4FKUA 3OWJA 3VS0A 3LFAA 2GNHA 5DH3A 5HCYA 3PLAE 3TM0A 2WKMA 4M0YA 4MVFA 3LJ0A 4JIKA 4XG7A 2R3FA 3UJGA 5BYZA 4M0ZA 5K4JA 2OSCA 3UO4A 5AAGA 3KRWA 4NSTA 1SM2A 3GT8A 3OWKA 4HZRA 4LOOA 3AD6A 2BALA 3COKA 1O6YA 1VYZA 5ANIA 2YLEA 5K5NA 5FD2A 3VBWA 1CSNA 2VTTA 2E9OA 4IM0A 4K2RA 2XCKA 4IB1A 3DLSA 2GNIA 4X3FC 4C59A 4F0FA 4AT4A 4F1TA 3F5GA 2R3JA 4YJRA 4AE9A 2WELA 3KRRA 4TYHA 5CY3A 3EMGA 4PUZA 1Q41A 4GRBA 3GVUA 2ZV9A 5BMSA 2RG6A 1WVXA 3C9WA 3PRIA 3TKUA 2GTNA 1PY5A 5HVJA 3QKLA 3U4WA 1H08A 3IG7A 4FVPA 2VWWA 1JWHA 4ZSAA 4FV3A 3ZMMA 3DKOA 2Y4IC 4C61A 4MTAA 4BCQA 1WAKA 3BU3A 2VUWA 2OJIA 4BIEA 5IA0A 4OR5A 5AJQA 3A8XA 2WAJA 3T3UA 2R3RA 3CE3A 2VZ6A 3R1SA 5DI1A 3FV8A 4DC2A 2OWBA 3DQXA 1H0VA 4MD9E 1GZNA 4UMPA 5FG8A 3KXGA 3VAPA 2ERZE 4UZHA 4JBPA 4AN2A 4FSZA 5EQYA 3GENA 4RIYB 5HEZA 1PF8A 4QMTA 3NUUA 5BUIA 4IJ9A 5TOZA 2W1IA 3UMXA 3HA8A 4O7ZA 4IM3A 4BBMA 3I79A 3R73A 4KD1A 2YZLA 4L43A 4F70A 4I21A 3TJDA 2BIKB 4AA4A 3KA0A 2WQOA 3BLHA 5DE2A 1MRVA 3R7UA 3QALE 2XNBA 2UW7A 3D7TA 2YM6A 3AC8A 3D5XA 4F65A 3EN7A 1Q24A 3MIAA 2JD5A 2W5HA 3R7EA 4S34A 5AP2A 4AT5A 5DT0A 2ITUA 4KA3A 1Q97A 5CF6A 3RJCA 4EQMA 4L42A 4CFUA 3DV3A 4YU2A 1SMHA 2OKRA 2J2IB 4FKOA 3ZO4A 2RF9A 3LFCA 1BI7A 2VTRA 4R5YA 5ETFA 5IQGA 1YHWA 3R63A 3VS7A 5J7HA 5BNJA 4UB7A 3ALNA 2GQGA 4YJOA 2J0MB 2B53A 5CF8A 3RK5A 3T8OA 1E1XA 4H3PA 3DBDA 4A9SA 1OB3A 1JNKA 3Q2MA 4WSQA 4FKQA 4E93A 3NS9A 4BCPA 4BI1A 2WMRA 3VHEA 2HWOA 3QRUA 4LL5A 4FTMA 3RHKA 1H07A 2H9VA 3CGOA 4HCTA 3JPVA 4DFBA 3KGAA 3WF6A 2BR1A 2Y6OA 3OUKA 4AGWA 4E73A 4EKLA 2OG8A 3LQ8A 4QP4A 1YHVA 4AZFA 3CXWA 5FUTA 4XRLA 4D5HA 2WD1A 1KE5A 4GG5A 2C6DA 2PMOX 1M7QA 2VNYA 4RWJA 2VX1A 2ACXA 4FX3A 4CKRA 3NUNA 2QOHA 3NVMB 3BU6A 4IVCA 3ZLXA 5CI7A 2X2KA 2Y8OA 3CS9A 5KE0A 5AUVA 3OCBA 3II5A 4K11A 4NK9A 1ZY5A 1IASA 2UZLA 4F1MA 4JBOA 4BF2A 5D9HA 2YAAA 4NL0A 3LLAA 4FL3A 2EVAA 3RVGA 4Z55A 2IVVA 3NZ0A 1UV5A 4R3PA 3PP1A 3EQRA 3DJ5A 4ZSGA 1SZMA 4Y95A 3UZRA 4DFYA 4F7NA 3NRMA 3D94A 4QTAA 4F0GA 3OXIA 3EL8A 3LCTA 2J0JA 3TNPC 1HCKA 1M17A 3E87A 4O6LA 1JSVA 3CTHA 3R7OA 1ZYJA 2VGPA 3ZU7A 4KKGA 3BHUA 4EOIA 4D1SA 2XNPA 4MNEB 3UVQA 3QC4A 1URWA 4FTJA 5G1XA 3HMIA 3ATSA 4J1RA 4M12A 5A46A 3ZRKA 1JSTA 5AV1A 2VTQA 2NNWB 1HCLA 2ESMA 4O7SA 4FIEA 3TZMA 4UMUA 5DN3A 5I9UA 4HZSA 4GU6A 3ANRA 2PVRA 3ZHPC 4N6ZA 4BBEA 2QLUA 4Z9LA 3MGYA 3VC4A 3HDNA 1DAWA 2VD5A 5CEQA 3RCJA 4FSNA 3AC5A 2DWBA 4TL0A 2WTCA 4XMOA 4B8MA 3E3PA 2CKEA 2EXCX 4XCUA 4ZXTA 1LP4A 4I93A 3FLSA 2YIQA 2X81A 5HESA 4JR3A 4CXAA 3E8CA 3P9JA 3C13A 4AGUA 4O83A 5J9ZA 4FT7A 3R02A 3ULZA 3Q9XA 3BWFA 3IDCA 3ELJA 1KOBA 4I6BA 4IAFA 3RMFA 3OD6X 3MFSA 4AA0A 1J3HA 1Z57A 3AG9A 4AU8A 1BL7A 3TZ8A 5AP4A 2JEDA 2QO7A 1DAYA 3VS1A 5JFXA 2DYLA 4RZWA 3FYJX 4YHFA 3QHWA 1JBPE 4C4GA 5B2LA 3C0IA 5M51A 4DFUA 1U5QA 1Q8TA 3D15A 3TDVA 3OHTA 2BRHA 5ACKA 4FV2A 2JC6A 4RVMA 4QD6A 4RC4A 5KKRC 2CNUA 1UU9A 3DT1A 3R01A 4OBQA 3C4XA 4YC6A 5I9XA 2PULA 2WEVA 4KS7A 4QQTA 2UZTA 2XNNA 5KMIA 4QMOA 4MCVA 3NCGA 5CX9A 2IVSA 2C3KA 4MXZA 2G9XA 4MXXA 4CMOA 4U40A 3BEAA 4ZIMA 2J0KA 2VTAA 4RIOA 4DAWA 5M4CA 4IX6A 5AX9A 3D4QA 1OIRA 4DBNA 3ATTA 5L8LA 4EZ5A 5CU3A 5AADA 5K0XA 2QOCA 4HYUA 5HX6A 5KHXA 2JKOA 1XH8A 2YIRA 3QRKA 5GINE 1PXLA 3QX4A 2XF0A 4KAOA 3U8WA 4CNHA 2FUMA 2ZMDA 4Q5HA 4RJ3A 4WG5A 5CENA 2BDJA 4B4LA 2ZB0A 3FMLA 3N9XA 1IEPA 5DG5A 1U46A 4IBMA 5DR9A 4ITIA 4L8MA 4QP2A 4F6SA 4YJVA 1H28A 3Q9YA 4BTJA 2NPQA 4RX9A 1XHAA 3PIYA 4E4LA 5HO7A 3VQUA 4HYSA 5HO6A 4CFNA 4RIWA 2UZVA 3MTLA 3OMVA 4O22A 3FQSA 3LFFA 3VO3A 5EHOA 3UQCA 4YZCA 1Q61A 4JG7A 5LVLA 5IDPA 2PVNA 3VJOA 3UDBA 5AUUA 4FG8A 3PUPA 3VUGA 2GNJA 4D4YA 4NKAA 3A7HA 1YOMA 1H01A 2QC6A 3DKGA 4O0TA 1PYEA 2AUHA 4OT6A 4AW5A 3ZRLA 2VNWA 4NFNA 4DGOA 4O7TA 3KF7A 2CCIA 4QQJA 4EK6A 4RJ5A 4FKSA 3K5VA 3R2BA 2C1AA 5AP1A 3VUIA 2XK8A 4CQGA 5E1SA 3VF9A 1Q8WA 3O2MA 1LEWA 3ZO1A 4WNPA 4ANSA 3F3VA 2V55A 2B55A 5J5SA 2ITPA 4BCMA 4IH8A 5CU2A 5L4QA 4ZSJA 2ONLC 5K5XA 3DS6A 3ORMA 2ZYBA 4X6RA 2GHGA 3LM5A 4Z16A 4EOLA 1PXPA 3MSSA 2WMVA 2PY3A 4CD0A 5CASA 2CPKE 4AGDA 2UW9A 2VWIA 4WO5A 2GNGA 4AAAA 2I0HA 3DBFA 3LKMA 4RC3A 5FDPA 4X2JA 1OIUA 3Q04A 1FINA 2R2PA 2QOQA 2WMQA 4WT6A 5H3QA 4Y46A 5HE3A 1QL6A 4OTIA 2P4IA 4KIQA 3IW4A 5L2TA 2CKPA 5LARA 3L8VA 1P5EA 5F95A 1LUFA 5IMEA 1AGWA 3PE2A 3CY3A 2UW5A 4FV9A 3UNJA 1PXMA 4D1ZA 2UW4A 2WHBA 4XV2A 1Y57A 1REJA 2NP8A 5CSVA 2PVFA 2UZOA 2R64A 5EYKA 2UV2A 3LJ2A 3IO7A 4RWLA 5LOHA 3QRJA 1Q99A 4PY1A 1FVVA 2XK3A 3GUBA 5A9UA 3F5XA 3UOJA 3GCVA 5IQAA 4EH9A 1J1BA 4LUDA 4NTTA 2GHLA 5C01A 4D55A 4DCEA 4ZSLA 5LVNA 3DBEA 3RAWA 4XH6A 3SXRA 4EJNA 1PRYA 3ET7A 3POZA 3ZLSA 5BYYA 2VTHA 3EJ1A 3WYYA 2VN9A 3Q96A 2QR8A 2QOOA 4CCBA 3QZIA 5CVFA 4GSBA 1OUYA 2OU7A 4N4SA 3QTZA 2VTPA 5ETAA 3ZCLA 5J79A 3W2RA 4CRSA 5BVNA 3NMUF 5IUHA 4KB8A 1JKTA 5TT7A 2OJFE 2CGWA 2HIWA 3R6XA 3K54A 3MH3A 2YCSA 4XBRA 3SDJA 1QPEA 4IC8A 3EN4A 4FKVA 2AC5A 3NIEA 2VTIA 3H0ZA 2WPAA 1Q3WA 3MTFA 4JBQA 2GDOA 5E8TA 3TKIA 3ZBFA 3ZEWA 1CKPA 3COMA 3TCPA 3V5LA 4R5SA 1XH6A 4YJPA 4A9UA 2J7TA 3I60A 4YBJA 3QCQA 2BFXA 2W1EA 2Y4PA 2PSQA 3CD8A 2IW8A 1R1WA 4R6VA 5JFVA 2ITTA 3NLBA 2FSOX 3H4JA 2FVDA 3N51A 4FT5A 4IWPA 2YDJA 4PDOA 1VR2A 2G2HA 2WTJA 3F5UA 3PA3A 4BKYA 4YLKA 3FZPA 5AM6A 5ICPA 4CG9A 3PVWA 4OTFA 2WB8A 3AQVA 4FIIA 4QPMA 3OCGA 3G9LX 4OTGA 3RINA 4BVUA 4AOIA 4C3FA 2PK9A 3IDPA 4RVTA 1Y6BA 3MH1A 4C33A 4ID7A 2RFEA 2PL0A 1YI3A 5H9BA
chains in the Genus database with same CATH superfamily
4RA5A 2WMTA 3S4QA 3E62A 4IWDA 1ZOHA 2XEZA 5HORA 5DYJA 2HZIA 4WKQA 4AZTA 3PY0A 4MYGA 5IQHA 4I3ZA 1CDKA 3DAKA 3AKLA 2X0QA 5L6WL 4AAYA 4YJNA 5L3AA 2Y6MA 4M8TA 1UU8A 2XM9A 5DPVA 2QOKA 4X3FA 2XKDA 4BKZA 5CT7A 3IECA 2X2LA 3FZ1A 3OZ6A 3F2RA 3FLQA 3G15A 2ERKA 3ORPA 3PLSA 3ZUUA 3UMWA 4AXEA 3MY0A 4IVAA 3E5AA 1NXKA 2X1NA 4D28A 2EU9A 4QP3A 4U79A 3BHTA 4D4SA 4O81A 5DMZA 1YOLA 3MB6A 3EL7A 2BRMA 1J91A 5AFVA 4AOTA 5AAFA 4O86A 3ODYX 1RW8A 5IMXA 4GEOA 3R7VA 4BDDA 3BZ3A 4O2PA 3ALOA 3E92A 4BDGA 3EKNA 2G15A 1OZ1A 3PJ8A 1U54A 2YIXA 4YZMA 4E3CA 2DQ7X 3LFBA 1YHSA 4M7IA 4AZSA 4E6DA 2J9MA 4UALA 4ANNA 1JOWB 4LYNA 4O96A 4CYIA 3BLAA 4TZRA 3SRVB 2X6DA 2C5OA 5AWMA 1ZWSA 4L46A 3GU4A 2R7IA 4AZEA 4IX4A 2O0UA 4HGLA 4O4EA 2XKEA 1PMVA 3KULA 3E93A 2FSMX 4ENYA 5EYMA 1WBOA 1W98A 3Q4CA 5DIAA 5HHWA 3UOKA 3PSBA 3W2QA 3ZBXA 4Y72A 2WXVA 4DGNA 3FMHA 5A6OA 4F9BA 3KMMA 4II5A 3LLTA 4FSUA 2QKWB 3R8VA 2PUPA 1V1KA 3ZDIA 3QD2B 3UOHA 3NEWA 4EZ7A 4F6WA 1J7UA 2GS2A 4TW9A 4OTHA 1JQHA 4C38A 4XLVA 2ITWA 4C8BA 4BICA 3QBNA 3C4FA 4PMMA 4ONAA 4FVRA 2QU6A 3OT3A 3H30A 4FTRA 4YJUA 4D2RA 3PVGA 4PDPA 5L6PA 3L8PA 3UOLA 4NM0A 3FPMA 4FNYA 2LGCA 4FTAA 3KRJA 5LQFA 3M42A 4GT5A 4UEUA 1BLXA 4ZLYA 3BYUA 2OJJA 5DNRA 5C26A 4TNDA 3ENMA 3VS5A 4AXAA 4CVAA 2W7XA 3FUPA 4FKJA 4AE6A 5CTPA 1VJYA 2C0OA 3KL8A 2ITNA 5M44A 5J9LA 3NIZA 3QYWA 4FL2A 4EOKA 1KUTA 4HVSA 4BGQA 1WCCA 1ZYDA 2C6MA 2UVZA 3BCEA 1A06A 3FI2A 2BTSA 1O6LA 4JAJA 4JDHA 1G8SA 4GKIA 2CGXA 3AGLA 3QRTA 4AS0A 2FH9A 4U44A 1Z5MA 2PVJA 2VO3A 3K2LA 3FXWA 4WG3A 1KE8A 2WMXA 3ACJA 5M53A 3AD5A 4KSPA 1NVQA 2PVYA 3KXMA 4QTBA 1XH7A 4YSJA 4WUNA 3KKVA 1XO2B 5HKMA 3RWQA 4ANMA 4ZAUA 4C58A 4BIDA 5HIEA 3NYNA 2OW3A 2VTOA 5J8IA 2XJ2A 3G5DA 3RHXA 4YZDA 4CV9A 5C1QB 4R77A 4BCNA 3VNTA 4FV7A 4O27B 2WZJA 4V01A 4QYYA 3OVVA 3PFYA 3PA5A 3V8TA 3GC9A 2JGZA 4FOBA 4FIHA 5HG5A 3DAJA 5HE2A 3GOPA 2YJRA 2GHMA 4FKGA 4QMNA 4J98A 4DEEA 3OXZA 1TKIA 3O8UA 2O63A 4K9YA 5CNOA 4YHJA 5GNKA 2WTKB 3UZPA 4YBKA 2BDWA 3C7QA 3MIYA 4Q2AA 5FXQA 3R9OA 3JY0A 3DPKA 4ACDA 4DCAA 2YM4A 3DGKA 4C3PA 2YAKA 2VO0A 5D1JA 4R7BA 5CEKA 4QNAA 4M3QA 5AA9A 1V0PA 5J95A 1SYKA 4PV0A 2HENA 4ZP5A 4BTKA 3CQUA 3VS6A 3W1FA 2CLQA 2NRUA 4NKSA 2R3GA 3HRFA 3R9NA 2HW6A 4ZLZA 5HO8A 4JAIA 3RGFA 1WBNA 4GK3A 4IB3A 3Q9WA 3VBQA 5F1ZA 4FTNA 3WZDA 2QD9A 4O0RA 3TL8A 1GZOA 3ACKA 2QOFA 2UZNA 4D4VA 5A4CA 4PNKA 5KHWA 3PIZA 3UP2A 5JFWA 3NNXA 4W4WA 2WOTA 3RAIA 2R3IA 3F66A 2PMNX 3ID6C 3LQ3A 3P86A 2X4FA 3QGYA 2GU8A 2PE1A 5EKNA 3VONA 1YXTA 3P79A 5CWZA 3DKCA 4FZ6A 4G3CA 3LFDA 3TXOA 4HVHA 3R8MA 4EOOA 3DFAA 4MUQA 3W0RA 2XMYA 3RK9A 3VUDA 2PVHA 4G6OA 1Y6AA 2CLXA 2O2UA 3GOKA 3FZSA 5EHLA 2BROA 5LMBA 2E9PA 3PXFA 4ANBA 5B0XA 4CMTA 1Q8ZA 3KXZA 5M09A 3MVHA 5FXSA 2ZJWA 4DH3A 3OEZA 3FY2A 5F9EA 4BGHA 3Q6WA 2QHNA 4IFGA 4XJ0A 3R1YA 3WOWA 3LFEA 3EH9A 4UMTA 2HELA 3BGZA 2W1ZA 1OKVA 3EN6A 3HV3A 4L67A 3DNDA 2YITA 2UW8A 4MHAA 4NIFA 4DG3E 4JI9A 3O8TA 3VUHA 1HOWA 3S95A 2VTSA 4XEYA 5KMMA 4FGRA 3MWUA 2F7ZE 3BIZA 3NW6A 4W4VA 5CAOA 2OF4A 4FKRA 4ZZOA 4HYIA 4YJQA 4ANQA 1XH5A 2GQRA 2FYSA 3OWPA 4ZJVA 4MAOA 3KY2A 1O6KA 3GU6A 5CLPA 5HU3A 4BZOA 4FBXA 4ZK5A 2IZUA 2VO6A 3C50A 3QA8A 2C4GA 3BLRA 3OOGA 4U42A 3W2SA 4BDJA 4BWXA 3HRCA 5AV2A 4BI0A 4UXLA 4E6CA 3FKOA 3FMMA 3LCDA 4AW0A 5KMJA 3AKKA 4ASXA 2OJGA 3EOCA 3BYOA 4CTBA 4ZTLA 3LXPA 3W10A 4I22A 3S3IA 4ZS0A 4F9CA 1K9AA 2CNVA 3FSFA 4RFZA 3U4UA 3HV7A 5DEYA 4QRCA 2BZIB 4O2ZA 3RPSA 1CKIA 2XAOA 4X2GA 5HNBA 5HG9A 2J5EA 4EEVA 4GL9A 3MFTA 2GFSA 4TY1A 4F1OA 4P5ZA 4TYHB 3NUSA 4MD7E 4EHZA 2OZAA 4ACGA 4FF8A 4EWQA 4F7LA 3G6HA 4XP3A 2UZWE 4WNOA 4XYFA 4QQ5A 5AV0A 4Y73A 4RIXB 5AP0A 4DFXE 3HX4A 3ETAA 5KO1A 3A61A 1G8AA 4RVKA 2P55A 3FHRA 5JMSA 4XOZA 2R3NA 4RBLA 4BY9E 3BHHA 2JKMA 4XV3A 1H0WA 2I0VA 3PWYA 4HVDA 4H05A 1UKHA 3KCFA 1H27A 2UW6A 3BPRA 2B9JA 3R9HA 5TR6A 3IQ7A 5CVHA 3HV5A 3NAXA 4FTKA 4DFNA 4I4FA 1BKXA 4CCUA 2RG5A 4GS6A 2YDIA 1GY3A 5EK7A 3ZO2A 4AX8A 1TFFA 4S32A 3THBA 4FODA 1FOTA 3L9LA 3IDBA 5F4NA 3A2CA 4AACA 1BL6A 2QOBA 3DLZA 3W33A 4AFEA 3Q3BA 5K3YA 4W4YA 2PUNA 4TYGA 3FDNA 3Q6UA 4D2WA 2PVKA 5A4EA 4DHZA 3PY1A 4Y83A 3QFVA 3NPCA 3E8EA 2EWAA 3GFEA 4ZMFA 1OIYA 4DA5A 1QPJA 4WNKA 4DHIB 1YI6A 4MWIA 4IAZA 3RI1A 1PMEA 2J4ZA 2JFMA 2WIHA 1H8FA 3P4KA 3QUEA 5BMMA 5AV4A 4IZ7A 5I5ZA 3A7GA 4BIBA 4UXQA 3KK8A 4R78A 4FV4A 4HCUA 5HICA 4F7SA 4FV6A 2Q0NA 2Z7LA 2B54A 3K3IA 3NWWA 2XBJA 3D5WA 5GJDA 3TTJA 4FT9A 1VYWA 4PL4A 4QPAA 2DS1A 4A07A 3G9NA 2QO2A 4EWHA 5IA3A 5M4UA 4B7TA 3QAME 3PJ1A 4LGGA 5AM7A 3F6XA 2XK7A 3SA0A 4HOKA 5EM6A 1OVEA 3PVBA 2F2CB 3ZS5A 1YXUA 3NVKI 4GU9A 4KBKA 2XNMA 4RFMA 5CU0A 2C6KA 3OXTA 5I9ZA 2O64A 4QTEA 3EQDA 4PP7A 1XH4A 2FO0A 2BIYA 4ALVA 4DFZE 3VJNA 2IEWA 3ITZA 4YNEA 4IVBA 3ZXTA 3FLNC 4KBCA 4DFLA 4OTQA 3OT8A 2W9FB 3PXKA 5AUXA 2PZIA 2H8HA 4ACHA 5JQ8A 5L2WA 2P0CA 1WFCA 3FL4A 3RWPA 4KS8A 5LVMA 4IC7A 3QD3A 4LOPA 5EDPA 5LWNA 4FL1A 3PE1A 2A2AA 3HAMA 3AT4A 5LVPA 5LMKC 3GU5A 2PYWA 4N57A 4RMZA 3DU8A 5DR6A 5J87A 4EC8A 5CI6A 3G90X 2YN8A 4HPUE 4J71A 3ZONA 3OEFX 1Q8YA 2ETRA 4D58A 3DK6A 3EQFA 3HMOA 3ODZX 4NM7A 4RGJA 3H10A 3ZH8A 4HCVA 3TACA 5BX0A 5IEVA 4BRXA 4WRSA 4XG6A 4IVDA 1OL6A 1XQZA 5B2KA 2R9SA 4F64A 1L3RE 3S00A 2PZYA 3D9VA 4PPCA 5AV3A 4EH5A 2R3MA 3F5PA 1TQMA 4CKJA 4FTIA 2YJSA 5EW8A 3R8UA 5CANA 5JH6A 3DB6A 4FKPA 5AA8A 5D12A 2X9EA 5TE0A 3QD4A 3TV7A 3E8NA 3FXZA 3K3JA 4IWOA 3PTGA 4IM2A 2W1GA 3EQPA 4ALWA 2VWZA 4YPSA 3U51A 4DTBA 3W8LA 3UP7A 3VRYA 5IU2A 4BHNA 3PPJA 3RPYA 3UC4A 3TYKA 2QR7A 1OPJA 4FT0A 3R7YA 4PF4A 5E8VA 3CEKA 3OTUA 4UYNA 1UA2A 4L53A 4CSVA 4FEVA 2ZMCA 4E4MA 3F3TA 1GIHA 4NFMA 4F9AA 4E4NA 2BAQA 4QQCA 4QTDA 4LV7A 5DOSA 4RPVA 2FGIA 4H39A 4DE4A 2H34A 4IZYA 2IW9A 4FV0A 3WZKA 4J95A 3KREA 5CU4A 3FKLA 2QHMA 2OXDA 2OH0E 1WBWA 4A9RA 2JFLA 1OL1A 2BDFA 5EM8A 5CEOA 4PPBA 3R83A 2PHKA 3C5IA 4DLJA 3NUXA 4XUFA 1SVGA 1PYXA 5HBEA 3PJ3A 3NYXA 2PTKA 3GP0A 4AF3A 2YWPA 3ENHA 4BFMA 5DLSA 2XJ1A 3Q4TA 5HBHA 2WTKC 4K8AA 5JEBA 3TJCA 3TNWA 4GKHA 4FI1A 1WVWA 4ZTHA 4DGMA 2YM8A 5CSWA 4LRMA 1ATPE 4UWBA 1QPDA 3UC3A 1U4DA 4C3RA 4O7WA 3W2OA 2C69A 3TNIA 3H0YA 3TG1A 2F2UA 2ITVA 1GZ8A 4FNWA 5HD7A 1ZMUA 3NUPA 4FV5A 4H1MA 3RNYA 3F82A 3GCUA 4DHFA 2J51A 4EBVA 3DBCA 3MESA 1MQ4A 2A98A 1PKDA 3CKWA 3G0EA 3LCKA 3CJFA 3QTRA 4GV1A 2XK6A 5IUIA 3ZO3A 4FT3A 4FKWA 4QP9A 4R1YA 5DA3A 3ROYA 4G31A 5DBXA 3OC1A 2W17A 4YZBA 3CLYA 1QMZA 3COIA 2XKFA 2BTRA 4QPSA 4JS8A 4F7JA 5JT2A 1TQIA 1W82A 3UYSA 4CTCA 4QOXA 4QP6A 5BYLA 3Q32A 5HGIA 3QQUA 4DGGA 4IANA 4ZLOA 2Z02A 1JLUE 3P5JC 3VHKA 3CQWA 3V8SA 2WIPA 2ETKA 3U87A 1YOJA 4DHJA 3R1QA 4LRKA 1PJKA 5IDNA 5E91A 3W0NA 1A9UA 4AG8A 2XK9A 4K1BA 3DB8A 2RFDA 4OBOA 4KIOA 4U5JA 5JGDA 3UVPA 3A99A 2F57A 3FMNA 4GJ2A 3CQEA 4BB4A 4TT7A 2VTMA 3FMJA 3ULIA 5B7VA 1R3CA 4X6QC 3GC0A 2W99B 3V3VA 4JVGA 2E2BA 4LGDA 3OUNB 3ZXZA 4AW2A 4I6QA 2I7QA 3BHYA 2X7GA 2VV9A 4IW0A 5H2UA 4LMUA 1K3AA 3R9RA 1YXXA 4AN9A 1NY3A 5HCZA 4WIHA 2UZEA 1PKGA 1DS5A 2QVSE 3FI8A 1OKYA 4M84A 4NW6A 5E8WA 2ZV2A 3IPHA 4O6EA 4O91A 3UZTA 4G5JA 3QUPA 2EXEA 4L3LA 4XRJA 4FG9A 3T3VA 2QCSA 4FK3A 3VBYA 5LVOA 4O7LA 3ERKA 4IAYA 4NZWB 4FIGA 5HG7A 4TXCA 4G3EA 4QMUA 3LPBA 2QNJA 4XHKB 5CZHA 4FIJA 4FSWA 4WA9A 4TRLA 4YNOA 4EH4A 2HY81 1ZXEA 5HNGA 5M55A 4E1ZA 4V0GB 2ITZA 5KMKA 4R8QA 5FXRA 1G8KA 1H24A 1JVPP 2O3PA 4O0UA 2VTNA 5CSPA 3VUKA 3QTSA 4GYGA 2FSLX 3GCQA 3V51A 4AQCA 2CGVA 4I24A 2CSNA 1YVJA 3A4PA 5A54A 4J97A 3W32A 3UQGA 4JG8A 4NTSA 4M15A 2R5TA 2PWLA 3E63A 2J6MA 4ZTNA 4XOYA 4BDEA 4IJPA 2IZRA 5DRBA 3JXWA 2JITA 3H3CA 3OBGA 4FV1A 2I6LA 1H1WA 4AP7A 2XRUA 4X21A 4TYIA 4IZAA 3R21A 1BMKA 3RALA 4PMTA 3HKOA 2WU7A 3BYSA 5A6NA 5HU9A 4F08A 4LG4A 4DG0E 3HEGA 5K9IA 4YGAA 4O7VA 2CN5A 4I6FA 3NYOA 3ZFXA 4EH2A 2UZBA 1YXVA 4E6AA 3BBTB 5KZ0A 2FA2A 3AC1A 4MF1A 4C35A 5J1WA 3CY2A 3DJ6A 2VWXA 3JYAA 4F63A 3R2YA 4DDIA 4J99A 3KB7A 4JT3A 1SVEA 3DA6A 1T46A 4ZY5A 4GG7A 3OOMA 2GQSA 5IUGA 4XBUA 3IW5A 1MRYA 3HDMA 2HCKA 2OF2A 4FV8A 3SX9A 5LWMA 2H96A 2I0YA 1UWJA 1ZMWA 2YABA 1TVOA 3D0EA 4XP2A 4ASEA 4EK4A 2G1TA 3LOKA 5GZ8A 2HAKA 2QURA 2VU3A 3ORZA 2WMWA 3DFCB 3TEIA 2RFSA 1JAMA 4BCOA 2B52A 4EJ7A 3FXXA 4DITA 5IF1A 2C30A 2QQ7A 3KXNA 5ANKA 4HVGA 2VTLA 3MN3A 4NT4A 2R3KA 4WNMA 3DK3A 3O8PA 3V01A 3AT3A 3TMOA 3LQ5A 4PP9A 4FYOA 2B9IA 3MPTA 3RTPA 4FMQA 3V5PA 3VUMA 4H58A 4ANOA 3NSZA 5IPJA 4DINA 3QTIA 1OI9A 4IZ5A 1Z9XA 3UQFA 1XKKA 4FTOA 3SLSA 5F94A 2C68A 4IXPA 4EKKA 2VO7A 3DXNA 4PPAA 1OL7A 2IPXA 1BX6A 3A7FA 3M1SA 4RFYA 4QDVA 4I5HA 1Q3DA 3SW4A 4IHPA 3MYGA 2XP2A 2QKRA 1FQ1B 5EW3A 2WQBA 2W1HA 5TKDA 5IQEA 1BUHA 4FICA 4EHVA 4FEXA 1Q8UA 2YM3A 3PPKA 5A4TA 5L2SA 4W4XA 1ZOEA 4W8DA 4O84A 1MUOA 3H9RA 4KSQA 4U41A 3FI3A 4CMUA 4NEUA 3WI6A 4Y85A 1JKSA 2JBOA 4ZY6A 3QA0A 2C3IB 4TWOA 3UG2A 3DK7A 4CQEA 3ZC5A 1GIJA 4FEQA 4G6LA 5EOBA 4D9TA 2BFYA 5KKRB 2JKQA 1M2PA 3CKXA 4JX7A 1NVSA 4L6QA 5L8JA 2SRCA 5I0BA 4TTHB 4G5PA 3TV4A 1XJDA 4FJVA 2Y9QA 3PG1A 3G33A 4FZAB 1LEZA 1OIQA 5CQWA 3VWAA 4EQCA 1B6CB 3QQKA 4X0MA 2B9FA 1WBTA 4M68A 3WZEA 4L52A 2CKOA 3POOA 1F3MC 2ZDTA 3JS2A 2XALA 1MRUA 2YCQA 3WF9A 3ZOSA 3P7AA 4MXOA 4APCA 3T9TA 3RZBA 3F88A 4BBFA 5C4LA 4LGHA 2C5VA 2IZSA 1ZOGA 3R30A 3I0QA 1FGIA 1OM1A 2R3HA 1UVRA 1R0PA 3R1NA 4GFGA 4CZUA 5BPYA 2BHHA 2UW0A 4UMQA 1H4LA 4ITJA 1J7LA 5IA1A 2WMAA 1YW2A 2ZM3A 3TZ7A 4FG7A 2GNFA 3EQCA 4L3PA 4O0VA 1JSUA 4IFCA 4FKIA 2WU6A 4XG3A 2WQMA 2I0EA 4I4EA 5CSHA 4ASDA 3NGAA 3RK7A 4FUXA 1O9UA 4CLIA 3TUCA 3QYZA 5HE1A 2IVUA 2W4KA 2IWIA 4FZFB 2LAVA 3RP9A 5EW9A 3V6RA 1CMKE 4BZNA 5KX8A 4M69B 2XK4A 4RX7A 3T9IA 4CG8A 2JDRA 4B99A 4W9XA 5EM7A 3V5WA 1U54B 1IG1A 1ST0A 5D11A 4DH5A 2FSTX 4A9TA 3BQRA 2JDTA 2QLQA 3EB0A 3UTOA 4CKIA 4EYJA 3FJQE 1GOLA 3KMUA 4D4RA 3HYHA 5J1VA 4TYJA 2IO6A 4CGAA 4O0XA 2OH4A 3QCYA 2Z7QA 5AUZA 4DEIA 1H1RA 2X8DA 3EZVA 5AX3A 4U7ZA 5CEMA 3CGFA 3KULB 4BTFA 4BL1A 3RZFA 4EHEA 3TUBA 3TNHA 4YLLA 1WBPA 4RSSA 4ZTMA 4NUSA 4QMSA 3ANQA 1OL2A 3UBDA 2YLFA 4UV0A 1L8TA 4C4EA 4QMXA 2O5KA 4BDIA 4HW7A 3DTCA 2DUVA 4JR7A 5BVWA 3PFQA 2BPMA 3PY3A 5CXZA 2X0GA 3O71A 4MBIA 1V0OA 4WOVA 4XG9A 3V6SA 4LV8A 4BWKA 3KRLA 4EK3A 4O0WA 4YHTA 5A4LA 2J90A 2XB7A 3PG3A 3FAAA 2PU8A 4CZTA 4D0XA 3SG8A 4WSYA 3AGMA 3PJCA 4FEWA 2X39A 5AUYA 3U6HA 1B38A 4GIHA 3ROCA 3R22A 4BHZA 4IWQA 5EI2A 5AIKA 4YP8A 4ERKA 4GJ3A 4TN6A 4QYFA 3W55A 3W16A 2JAVA 3B8QA 4NCTC 3JR1A 4L7SA 4RLLA 5AR7A 3OP5A 3L8XA 5D7VA 2B0QA 4O1PA 3CBLA 2JKKA 2XUUA 4D2SA 5BVOA 2YFXA 4GCJA 4IX3A 4UWCA 3WE8A 3ZM9A 4KKEA 5M4IA 2XARA 4WUAA 1GNGA 4JLCA 3UG1A 1R0EA 4L01A 1OKZA 4K18A 2Y0AA 2ITYA 2E9NA 4C0TA 3U6IA 5KBQA 4YR8A 4UYAA 1REKA 4YURA 3S0OA 3NAYA 3ORNA 2ZVAA 4C2VA 3LCOA 4FIFA 4MNFA 1PXIA 3PVUA 4DTKA 3U6JA 1H1QA 2IF8A 5JSMA 4DH8A 4M14A 2NRYA 4ZTSA 4QMLA 5L8KA 1OGYA 1H1SA 1ZYLA 3FPQA 4MWHA 3GU8A 2OFUA 3MVJA 5F20A 5CAPA 4ORKA 1H1PA 4QMQA 3QF9A 1P4OA 4UMRA 2CN8A 2AEGA 2EUFB 2X9FA 4EK5A 2BUJA 3F3ZA 3WIGA 1FGKA 1PXNA 2O8YA 4J96A 1WBSA 3UGCA 2BILB 3WZJA 2RL5A 3OWLA 3MS9A 5DEWA 5IG1A 3RM7A 2W9ZB 3D2IA 3HZTA 2XIYA 3P7CA 3FZTA 3KXHA 3VRZA 4KABA 5ETIA 4BC6A 3N4TA 2Q83A 1M2QA 3OG7A 3PSDA 2GS6A 3MPMA 2V5QA 5EHYA 3QQFA 5DGZA 4BDBA 5FM3A 4C4JA 3UYTA 1PMUA 3O5AA 4UZDA 2YZAA 3LMHA 5BVDA 2R3PA 3DNEA 3QWJA 2VWYA 5CF4A 1PXOA 3DCVA 3ORTA 3G51A 2C6TA 3R7GA 4Y8DA 3LZBA 4BWPA 2B4SB 5E1EA 5T68A 3IK3A 4EZ3A 4AA5A 5KNJA 3SOCA 4F0IA 1W2CA 4O7RA 2UZUE 2XNGA 2GTMA 4RX5A 3O50A 2UVXA 4YZ9A 4KRCA 3IGOA 2QO9A 1W2DA 2QOIA 2R3QA 3RM6A 4D5KA 2CCHA 4DEDA 5EYCA 4UN0C 4A7CA 4L68A 4ZZMA 5JFSA 4HGSA 4KIKA 4U81A 1FVTA 4CFFA 2WMBA 4CT1A 3BL9A 1H00A 2AQXA 3MH0A 5CEPA 1JKKA 4Z7HA 3R7IA 3IW8A 4BCKA 2BVAA 4CV8A 4UWYA 3UO5A 2VRXA 4BN1A 4RZVA 2OFVA 2R3OA 2YWVA 4X3JA 4PDSA 3V5JA 2NYAA 3SW7A 3BYVA 4E8AA 3RKBA 3HP2A 5GJFA 2C1BA 4A4XA 1VZOA 3AC4A 3KQ7A 5DR2A 2PUUA 2I40A 2QU5A 5HLWA 1XMLA 4BCGA 5KMNA 3EKKA 4FA2A 2XM8A 5EQPA 5CAQA 1RJBA 1LPUA 4FE2A 3NYVA 2J0LA 1Y8YA 4O4DA 3BE2A 1S9JA 3R00A 4FSQA 5T6KA 4AT3A 3LE6A 4NIFB 4D9UA 3Q5ZA 4QT1A 2X6EA 2W0JA 4XG4A 1KOAA 4O7NA 4OAVB 4R1VA 4AN3A 4EK8A 3TN8A 5FTGA 3GNIB 5B2MA 1OKWA 2OGVA 2V7OA 3FKNA 5C4KA 4ERWA 4WD5A 2O65A 3PXQA 4JXFA 5A4QA 3EWHA 4Z7GA 3QZGA 5J5TA 1B39A 1PW2A 2FB8A 3I5NA 3HV4A 3RBWA 4BDFA 4E26A 2R0IA 4YTFA 4FZDB 4AGCA 4OT5A 2ETMA 3EZRA 2IW6A 3QRIA 3F2NA 1ND4A 3KRXA 1STCE 3MVMA 1PXKA 3Q60A 3L8SA 5IQDA 3CR0A 3EFLA 3QKKA 4GIIA 3LXNA 4ZTRA 3QWKA 5AIRA 4C62A 4CFWA 2XJ0A 5IA5A 5ITAA 5HLNA 4FRFA 2IVTA 3V5QA 4QTCA 3UIBA 3D83A 4XV1A 2G2IA 4KWPA 3SHEA 2J0IA 3G0FA 3SG9A 1IA8A 1G3NA 3LVPA 4USDA 1BYGA 3KCKA 2GPHA 4BI2A 5IEYA 4U3YA 4PL5A 2ZAZA 2XH5A 4I1ZA 5GHVA 4YUQA 4TKSA 3PRFA 3B2TA 3FI4A 4D2VA 3F9NA 4L3JA 1UNHA 3EFKA 4HNIA 3SXSA 3MB7A 4E5BA 3FBVA 3EQHA 3FQHA 3UPZA 1M52A 5I9VA 3CTJA 4RLKA 2AC3A 5KMLA 5IQIA 1YKRA 2BZJA 3Q4UA 2ZM4A 4F99A 2C6EA 3BBWA 3KXXA 2WTIA 3DY7A 4YMJA 3R8ZA 3CC6A 3OY3A 4U3ZA 5GZAA 3MY1A 3C4CA 4EOMA 3U55A 3CTQA 4K77A 4MQ1A 3EFWA 4ZTQA 3NUYA 5GJGA 4MXYA 4HYHA 5C8NA 3IGGA 3PWDA 5BVFA 5IQCA 4I0SA 3VF8A 3BEGA 3DXQA 3PJ2A 4ZSEA 3JVRA 3EYGA 3I1AA 4OGRA 1J1CA 1IRKA 4CFVA 4U8ZA 4PMSA 3FEGA 3LFNA 1UKIA 3W0QA 4K33A 4QP1A 4JDIA 3I7CA 1RQQA 2PVLA 5KCVA 4JQ8A 3DXPA 5H8GA 2C6OA 4FTQA 5ANGA 3N4UA 1YWRA 4TYEA 5HZNA 2F9GA 3Q9ZA 4W9WA 2XANA 1F5QA 1TQPA 2OICA 4TWPA 5BQ0A 4R3CA 4G3GA 4JDKA 2VX0A 4JQ7A 4MX9A 4USEA 5GIPE 2Z60A 5IA2A 4USFA 2YDKA 2YISA 3GC8A 2EB2A 3PSCA 5C8KA 1OBGA 4BTMA 3E64A 4P90A 5JN2A 2OJ9A 2X4ZA 3TNQB 4QMMA 3KEXA 5AR5A 5L2QA 5E9EA 5H8EA 2ONLA 3D5VA 3CSVA 3FL5A 1SVHA 3BLQA 4TPTA 1CKJA 4D1XA 4UX9A 2C5YA 2W05A 2VTJA 3OCTA 4RIXA 4XV9A 4ACCA 3L9PA 3A62A 3MY5A 1X8BA 3LM0A 4FTTA 4JJRA 4S30A 3SAYA 2ITXA 2REIA 3D7TB 4PX6A 4MD8E 1UU7A 3L9MA 4U97A 3V8WA 3H9OA 3LFQA 4C4FA 4E5AX 3MPAA 4Q9ZA 2OO8X 4Y5HA 2HZNA 1YWNA 3FHIA 3ORXA 4KKHA 1YWVA 3DBQA 4ENXA 2P2HA 5A3XA 1XMMA 5C27A 5AR8A 4C4HA 3L1SA 4QDEA 5JGAA 3EQGA 2YCFA 1PXJA 3I6UA 3FC2A 2VAGA 1J7IA 1XH9A 1YDRE 2OI4X 3U54A 4W8EA 5K4IA 4WG4A 2CJMA 4DH1A 1ST4A 4RWIA 3LW0A 2W1CA 2C47A 2UVYA 2X7OA 5M4FA 3VW6A 5C8MA 3UVRA 4L9IA