5CT7A

Braf in complex with raf265
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
273
structure length
257
Chain Sequence
DWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHIIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLAGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLFPQILASIELLARSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Serine/threonine-protein kinase B-raf
publication title Discovery of RAF265: A Potent mut-B-RAF Inhibitor for the Treatment of Metastatic Melanoma.
pubmed doi rcsb
source organism Homo sapiens
total genus 78
structure length 257
sequence length 273
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2015-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5ct7A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5ct7A01
3HV6A 2R3IA 1J7UA 5DRBA 2J0KA 3QWKA 5JRQA 5J5SA 1U5QA 3MSSA 3OOGA 3KC3A 2ITUA 4AA0A 5EDRA 2XNBA 3FMNA 3CQEA 3EMGA 1WVYA 3TZ7A 4GUEA 4O0XA 2BR1A 2G9XA 2W05A 2C5VA 4PX6A 5LMAA 4DH7A 3Q3BA 2DS1A 3P1AA 4S34A 3R2BA 4UZHA 5EHYA 5IISA 4M67A 3GFEA 3H10A 3D5UA 4XJ0A 4PP9A 2ZAZA 4ZEGA 3UMWA 4D0XA 3ZRKA 4PMPA 2CGUA 3EB0A 4OBOA 5C27A 2RF9A 3V5LA 5AEPA 4MXCA 3MFRA 3F3UA 3QHWA 3G2FA 4KIOA 2WMWA 5CSXA 3RK7A 3PDTA 3KXHA 4S33A 2X9FA 4CZUA 5DNRA 3UC3A 4NWMA 2W9FB 5IA4A 2WTCA 2JAVA 2Y6MA 3P4KA 2XIRA 3VBXA 3MPAA 5ICPA 3U6JA 5IQBA 1ZWSA 3R02A 3VQUA 3VUGA 2WHBA 2IW9A 1A9UA 3W1FA 2C0TA 4AW0A 4JIKA 2Q0BA 4MVFA 5C9CA 4DCAA 2BILB 3ZBXA 5IA2A 2HW6A 4ZTRA 3R7UA 2B9HA 2UW8A 2XB7A 4RIYB 4HCTA 3FI3A 4EOIA 4EWHA 5CEMA 3GOKA 3OWKA 4NK9A 4FZAB 4IWQA 4Y5QA 4NTTA 1Y91A 2BPMA 2YIYA 3FI4A 3MH2A 4WD5A 5EKOA 3A7FA 4I20A 3SW4A 3SXSA 3R1NA 2IVTA 3KXZA 5J8IA 3TN8A 4YJRA 3E64A 2WMUA 4FSYA 2QVSE 4PDOA 3AOXA 3MY5A 4QMOA 3PJ2A 1IR3A 4C3RA 4BHNA 5L6OA 3GT8A 4D4YA 3WBLA 4EQMA 4DA5A 1NY3A 1UNHA 3AC2A 3LOKA 4O91A 4FI1A 4BDDA 4DEGA 1Q97A 2UZNA 5AV0A 1KE6A 5CEPA 5KMNA 3DKFA 4YTFA 3VS1A 3BYMA 3BU5A 4QP2A 4Z9LA 4F0GA 3SX9A 4RWKA 1Z57A 5G1XA 3NAYA 2EB3A 5FBNC 2Z02A 4RGJA 3LXNA 4IMYA 4UMQA 1W83A 2A1AB 4IDVA 2WEVA 3EQIA 1Y8YA 3DFCB 5L2IA 4WNPA 2IVSA 3PSDA 2UZBA 1JKSA 4WNOA 2XK7A 2W06A 4BCIA 1DAWA 1M14A 2O64A 2PVHA 3MFTA 3D7TA 4ALVA 3N9XA 4ANNA 2GHGA 2FSTX 4FTQA 4DG2E 3MPTA 2VZ6A 1SVGA 2YJRA 3S1HA 3FHRA 2HWPA 3ALOA 4AUAA 5DPVA 2PTKA 4J8NA 2CNUA 3FEGA 5IQGA 3JYAA 3ZRLA 2IW6A 5L2WA 3EQFA 3QALE 5DFPA 5DN3A 3RP9A 5CQUA 4DGLC 3SDJA 4NJ3A 4Y83A 4CG8A 1OUKA 4JG7A 3VBVA 2C3JA 2XM8A 3R8ZA 5HIBA 3ZFXA 3UO6A 5A3XA 3LKMA 4I3ZA 5HLPA 3IW4A 5KMMA 3VS7A 4X21A 3ZHPC 4IXPA 4MXZA 3D7ZA 4IW0A 3RAHA 2RFNA 3F5PA 1PHKA 3OBGA 4FKOA 2PUNA 3CQUA 3NYOA 3SOCA 4M97A 2FO0A 2YWPA 4QP6A 4YLKA 4AU8A 4BI2A 5AAEA 4Q9ZA 4JBOA 3EL7A 4IM2A 2Z60A 3L8PA 1Y57A 3R8VA 3C5UA 1STCE 5HNIX 5HE2A 5JGDA 5BQ0A 3GI3A 3REPA 3UODA 4ANLA 4BDHA 4P5QA 3VS0A 5CSHA 4XLIA 3HGKA 3VUKA 3WZUA 4ZY5A 4FUYA 2JD5A 3OT8A 5HNGA 4A4LA 5AP2A 2NO3A 4JDJA 4FEQA 2XJ0A 4ZY4A 5FDXA 2PVNA 3C4WA 4UV0A 4FGBA 4CZTA 2W1ZA 4F0FA 1VR2A 1JSUA 5LWNA 3LVPA 4QPSA 3MH0A 3HNGA 2JKKA 2CGXA 5DT0A 3DAJA 4FTUA 4R3RA 2FSMX 2XZSA 4X6RA 4CCBA 4GW8A 3AD4A 5AV3A 4NW5A 3EQRA 2BDWA 3DNEA 4FIIA 3RPOA 2X4FA 2R3QA 3QZGA 5TF9A 3QQKA 1NVRA 3R7VA 1XHAA 4Z7HA 4LL5A 2YM3A 2VWUA 4P4CA 4ASZA 3SQQA 3GXLA 2YACA 2R7BA 5H8GA 5B2LA 4FE2A 4QMZA 3EN5A 4FV1A 1PMVA 5FDPA 4FOBA 4DLJA 4GCJA 3ZRMA 1NVQA 4N57A 4C59A 3JUHA 4MD8E 4DFZE 3WILA 2CJMA 4W4WA 4EZ3A 1XH7A 4D2RA 4EHGA 4U97A 3TNWA 2PE2A 3H0ZA 2ZOQA 3GENA 2HK5A 4WUNA 5CY3A 2P2HA 2YEXA 2YM5A 3TZ9A 1RW8A 4FV0A 2VTHA 3LFNA 2SRCA 4OTPA 5DRDA 3S0OA 4DITA 5JSMA 1J7LA 2XNMA 4DFUA 4QMVA 4TT7A 4XHKB 4FV3A 3KQ7A 1OKVA 3TKHA 3N4UA 2IPXA 4BKZA 2J7TA 4AN3A 4DH1A 2I0EA 3JXWA 2X7GA 5AAGA 1BMKA 1K9AA 5CSPA 3QXPA 2R4BA 4JRNA 2GTNA 1BYGA 3GGFA 4UY9A 5H2UA 1NXKA 2W1CA 3P7AA 5DE2A 5EYKA 5GZAA 3VS2A 4YZCA 5FEEA 3VS3A 4AOTA 4X2KA 2ACXA 2C68A 2XVDA 3LCDA 3UZRA 4GRBA 2QQ7A 2XYNA 2YLFA 4FV6A 2C6EA 1WBSA 4I0SA 4KBKA 1MRVA 4NJDA 4E5AX 4HNIA 5M4IA 4JI9A 1H8FA 2XJ1A 1O6YA 3DA6A 3FZSA 4JR7A 1OECA 1WCCA 3IDCA 4TRLA 4ERKA 3CS9A 4M15A 3TV6A 3HECA 3NUPA 3NLBA 5HVYA 4CYIA 4EOLA 2A2AA 5HTIA 2YA9A 1GZKA 3LFBA 4MK0A 5L6WL 2VUWA 4D1SA 3W8LA 4XH6A 2WIHA 5DA3A 2W9ZB 5ETIA 4ACDA 3D5WA 4IB1A 4DF3A 2YCQA 3IGOA 4PPAA 1V0PA 3HEGA 4DN5A 2JEDA 5AJQA 4AGCA 2G1TA 5C8KA 4ZS0A 3CP9A 4JDHA 2UW6A 1MQBA 4EBWA 5KBRA 4D9TA 2DWBA 1ZOGA 3ZOSA 5EM6A 3BWFA 1YXVA 4TNBA 4AP7A 4FK3A 3UQGA 4FTLA 1OZ1A 4X0MA 3DFAA 2X2MA 4PDYA 4WRSA 4IX3A 1REKA 2PUIA 3IOKA 4L00A 5EQYA 4IVAA 3ZEWA 3SOAA 3GC7A 4CFNA 4HGTA 4PWNA 3RALA 4DGOA 5IH4A 3NDMA 3ETAA 2HYYA 4FTKA 4ORKA 1FVRA 3IECA 1H00A 4YTCA 4DYMA 3NYXA 3R00A 4HNFA 3BELA 5A14A 5AUTA 1ERKA 1OIRA 4FSQA 5HCYA 3QZHA 3VIDA 1OBGA 4CEGA 1M2QA 4LRKA 2YHVA 4RIXA 2WQNA 1H26A 2FYSA 2WTKB 4TTHB 4BR3A 5JEBA 5TT7A 5AADA 2V7AA 3FMDA 2NRUA 5J1WA 4IM0A 2BRMA 4NM5A 1NT2A 3VW6A 4TWOA 5AM6A 3ZSHA 4L8MA 3IGGA 2UZVA 4GIIA 4USDA 3SGCA 3F3ZA 1IG1A 2V55A 4C4FA 5BMMA 1E1XA 2VWWA 4HYHA 3S3IA 4F7SA 4GKIA 3FYKX 1BL6A 4FGRA 1UWJA 4NT4A 2R3JA 4HYUA 4CKIA 4EORA 4NM7A 3O23A 2QHNA 3OROA 4LRJA 3I0OA 3KVXA 4ENYA 3PE1A 1FINA 3IW7A 4M7IA 3P9JA 1CMKE 2J90A 3O8UA 5HNBA 2GNHA 2BZJA 4MD7E 1Z5MA 3JY9A 4BY9E 3GC8A 2V5QA 3FLWA 5HLWA 3TACA 4B99A 1VYWA 4TN6A 5GJDA 5M55A 3NR9A 1ZAOA 4FSMA 4CFVA 3LFSA 4WHZA 3NUSA 2ZJWA 4CNHA 4EH9A 2OW3A 3AC1A 3QKKA 3W2SA 2C0OA 3ZYAA 2NPQA 1ZY4A 4QP9A 4DFNA 3AD6A 2CLQA 5EM7A 3SRVA 5HU9A 3QD2B 1KV2A 2VRXA 4I41A 4KAOA 4JRVA 4YHJA 3BU6A 2UZWE 4EL9A 4EOPA 5E8YA 4UMTA 3OTVA 3BGQA 5FXQA 3LMGA 4FR4A 2IZRA 4JBQA 3HV4A 4I22A 5EQPA 5AUWA 4ALUA 2R0IA 1KE7A 4PPCA 4NL0A 1FPUA 2JBPA 4ZOGA 2HOGA 4MBIA 5AR7A 4TKSA 3LPBA 4IH8A 4MWHA 3ORKA 2OFUA 3LCOA 4I93A 5F94A 5M56A 5IUHA 4IZAA 5JZJA 3SD0A 2XRWA 4F9AA 4YU2A 4ASDA 4OTHA 4EWQA 5EW9A 2F7XE 4LFIA 3SA0A 3AMAA 2QOKA 5C26A 2VO3A 3DXQA 2C5NA 3MVLA 3KF4A 4FTOA 4L7FA 4C61A 2RSVA 3WYYA 4CFFA 5FXRA 2BZHB 4H1JA 5BMSA 4JJRA 3S2PA 3C7QA 2RFSA 3Q4CA 2CNQA 2WQMA 3LJ2A 4M3QA 1GIJA 4D1ZA 1IEPA 4I6HA 4JLCA 2R3OA 3LIJA 5EW8A 4YC3A 1WBOA 3FXWA 4OTGA 4FTTA 3JY0A 4DEAA 5KX8A 4K0YA 4RA5A 2CGVA 4RLKA 4X3FB 4ZZMA 4NFNA 4Q2AA 3A61A 4F1TA 1YWVA 3LLTA 3U87A 4FNWA 3C0IA 1XQZA 1GZ8A 4QTEA 3PFQA 1W0XC 2FVDA 4ZAUA 3ZSIA 2GCDA 1PXNA 2WU7A 3CGOA 5CSWA 3DGKA 5HX6A 3Q4UA 4IBMA 4EK3A 1F5QA 4L01A 4FV8A 5HBEA 4AZSA 4XBUA 2CNVA 3FZRA 5FEQA 5ETAA 2JLDA 5I0BA 4IM3A 5HE3A 5LVOA 1PKDA 4CFMA 4AW2A 2HELA 4ANSA 3Q9YA 2OGVA 5A54A 1SZMA 3BEGA 4HGSA 5EW3A 4CT2A 4DEIA 4R78A 5AP5A 2WTJA 3CQWA 1T45A 3R04A 3LM0A 2VNWA 4FT5A 3ZZEA 4R7BA 1M2RA 3B2TA 3MI9A 2A27A 5EG3A 1OB3A 4DT8A 3RNIA 2JIVA 4IAFA 1O6KA 2QO2A 3Q9XA 5DIAA 5GJFA 1NA7A 3DCVA 2GSFA 2Z7QA 5JH6A 1KE9A 3C4CA 4FVPA 4BIDA 3F9NA 1X8BA 4M13A 1W82A 5E8XA 2QONA 3DTCA 4AW5A 5CT7A 2BZKB 5CEQA 3QTXA 4LRMA 4BCGA 3G0FA 3EJ1A 4IIRA 1RQQA 4QOXA 4IAZA 4FKRA 5AMNA 4L45A 4R3PA 1F3MC 4GT3A 2BCJA 4YJUA 2R3LA 2UZOA 2B55A 3UIXA 4OR5A 4R7HA 3W2RA 4C0TA 2BRHA 2PK9A 2Q83A 3GB2A 4FL1A 3HZTA 3CTHA 3CJGA 3EYHA 3IKAA 1XKKA 3DT1A 3FZTA 2BROA 4MF1A 3QHRA 2G2HA 1SMHA 2IO6A 2Y7JA 3UNJA 3ZU7A 4BCNA 3RZFA 2E9OA 2YZLA 4EUUA 1PXMA 1DI8A 1GAGA 1Y6BA 4C33A 4Z55A 3HUCA 3UOHA 3ZDUA 3GCPA 2XBAA 4DGMA 3CD3A 2C6KA 4MF0A 4BZOA 4D2PA 4QTCA 4O84A 1SNXA 1L3RE 4RIYA 4E6CA 1Q3WA 1Q99A 1H4LA 2GFCA 2O2UA 2QD9A 4GT4A 4IADA 4BCQA 3JPVA 3OXZA 4GIHA 4KS8A 3HMPA 3VBWA 1BI8A 4PY1A 1H1PA 3KK9A 4EHEA 2Z7SA 1R0PA 4IZ5A 1B6CB 3UE4A 3TNPC 1EH4A 3A2CA 3OS3A 3QD3A 4A07A 2C1BA 4GJ3A 2XCHA 4GG5A 3G9NA 3C4FA 5IQDA 4ZJIA 2V22A 4JBVA 2W5HA 2WMRA 3FHIA 2VWYA 4CRLA 1BUHA 4WNMA 3MH1A 5CAUA 4FVQA 3D5VA 4AA4A 5FD2A 3PUPA 5GIOE 4XG2A 5KMOA 2CKQA 5CI7A 5E92A 2X7FA 4MCVA 4WSYA 5T3QA 3SC1A 2BRGA 2CCIA 4MNFA 1MUOA 2B1PA 4O0UA 3UVQA 4S2ZA 1JLUE 5CTPA 2QU5A 4XP2A 5EOBA 4EOKA 4GK4A 4CMOA 3R22A 3I81A 3LCKA 2VWBA 5D10A 2BKZA 5KKRB 2BIYA 1YWRA 3MJ2A 2W1EA 2ITQA 4UXLA 5M4UA 3FI8A 4M14A 2AUHA 4UXQA 3PPZA 4QP4A 4D9UA 5E8WA 2VX1A 4IX4A 4OUCA 4DC2A 4BCOA 1IA9A 1UV5A 1YOLA 1W84A 3PJCA 3MYGA 4JT3A 5KMKA 3DV3A 4KSQA 4PL4A 4C2VA 2OH0E 3WF9A 1M52A 3I4BA 4AF3A 3D5XA 4R3CA 2J5EA 3FLQA 4Y46A 1YQJA 1BI7A 1A48A 4LYNA 5A4LA 4RJ4A 2ITPA 1Y8GA 3OD6X 4FKTA 3C4ZA 4DE4A 4WRGA 2YM7A 3C50A 4R5YA 2R2PA 2PZPA 3SW7A 4G6NA 3ZLSA 4LMNA 3I6WA 3F2AA 3FKNA 4YSMA 3RAWA 5DBXA 5CVGA 3ZH8A 2XM9A 4EK6A 5BUIA 4ZJJA 4CLJA 1UNGA 2JDOA 3D9VA 5CYIA 2OBJA 1PXLA 2WELA 3IOPA 4G1WA 2YZAA 1XH9A 2BAKA 3DBQA 4JAIA 3DXPA 1DS5A 3QQHA 3UOJA 2GU8A 4QMWA 3KULB 4LMUA 3VQHA 4DEDA 2X2LA 3ZM4A 3I79A 5L3AA 2FSLX 5KMIA 3HDNA 2C4GA 2ETRA 1DAYA 2RG5A 5FP5A 5HICA 4FNZA 2VTQA 4KBCA 3ZXTA 4BCPA 2QG5A 5HG7A 4RZVA 4E6QA 1LEZA 3GQLA 4BBEA 1R39A 4OAVB 5CWZA 4BB4A 4EUTA 4NU1A 2RGPA 2X2KA 4RIWB 1YOJA 4X3JA 5IKWA 3EIDA 4BDEA 4BWXA 5HVJA 3KA0A 3VVHA 2XMYA 4P7EA 3HKOA 4ANOA 5K4JA 2VWVA 3LCTA 4YHFA 3V5QA 4MYGA 4UN0C 1UNLA 4DT9A 5IQFA 4BGGA 4BGQA 2EB2A 3DK3A 2QNJA 3BYUA 5IPJA 4CVAA 3F7WA 3KB7A 4TXCA 3R9RA 1FGIA 5BYYA 5ACKA 5CEKA 1GNGA 3RBWA 5CNOA 3IDBA 2ZMDA 3PSBA 4EH5A 5DEYA 4V04A 3N51A 4AACA 4H05A 4ZLOA 5CANA 4I4EA 2R3GA 3CPBA 1W8CA 4FG9A 2PMIA 2C5OA 3UIMA 2PVMA 4FIJA 4JX7A 4XCUA 4B7TA 4IVDA 4E5WA 2VGOA 4ACGA 3LMHA 3TG1A 2CDZA 3DY7A 1YXXA 2YERA 3NIEA 4HVSA 3AT3A 3QLGA 3WE4A 4RPVA 5A46A 4LV5A 2WAJA 3QUEA 2WTKC 4ZTLA 4C37A 1J1CA 3HV5A 3H30A 4FODA 2OWBA 2J0LA 4ACMA 4G6LA 4EK4A 3C4EA 2W7XA 2QOCA 3F7ZA 4OTWA 4XG4A 5HE0A 4CV9A 5E91A 3VN9A 2JC6A 1JKLA 1YI3A 4MHAA 4NEUA 3ATTA 2ZMCA 2ITNA 3I1AA 4FF8A 2LGCA 4FL3A 1FMOE 2WQBA 1Q4LA 3RM6A 2P4IA 4UYAA 3DS6A 1XBCA 2WMTA 4G34A 1PMEA 2PZIA 3QGWA 3R2YA 5AR2A 4APCA 2OF4A 5JFVA 4AQCA 4BDBA 4YR8A 1OKYA 2ERZE 4FV2A 3POOA 2R3MA 4V01A 3EL8A 1BKXA 1MRYA 3OFMA 3PZHA 3TDVA 4F9YA 3H9FA 4GK3A 4TWPA 5J79A 1O9UA 5LVNA 1G5SA 3PSCA 1M17A 4ZTHA 3GVUA 3QD4A 4MKCA 5IH5A 4FTAA 4DTKA 3BWJA 4PDPA 3CKXA 3CR0A 3P78A 5IQAA 4L68A 2XS0A 4FSZA 3W55A 4XP0A 4QYGA 2CPKE 5JT2A 4RVLA 4BHZA 4IVCA 3AMBA 4YP8A 3EHAA 3S95A 5HBJA 3T9TA 3O51A 3U51A 4NIFB 3HDMA 4X7QA 1L8TA 4AOIA 3UIUA 3VO3A 4GVAA 3TWJA 4C4EA 3ANRA 4EH2A 4K2RA 4M0YA 4JL9A 3BRBA 5ETCA 5CVFA 4EHZA 3FLNC 2BHHA 1YHWA 2J51A 3EQPA 1CKJA 3KF7A 1ZRZA 3R9DA 4S31A 4HYIA 4FKWA 1R78A 2GNLA 4EJNA 3BV2A 1TVOA 4XYFA 3PLAE 4O0WA 3F3TA 3ENMA 3QRTA 1URCA 3QTSA 4AX8A 5AUUA 1RJBA 4JX3A 4PMTA 4QYHA 4ZY6A 3GU6A 3I6UA 4X3FC 3Q4TA 5IUIA 1ZZLA 2GHMA 4HZRA 1JOWB 4GMYA 2UUEA 5FM3A 3PXQA 3FV8A 4TWCA 4E73A 3OC1A 4GYGA 2OJIA 3CD8A 3E8NA 4MH7A 3QA0A 5DHJA 4KUJA 1U54B 1QMZA 2X4ZA 4FTCA 5AX3A 4O0VA 3KMUA 1WBNA 4FSRA 4Y95A 4CZYB 4I4FA 2BKKA 2ITTA 3Q53A 5BYLA 3AMYA 1U4DA 3VC4A 2P2IA 3LMIA 4YO6A 4YJNA 4BCJA 3T3VA 3BLRA 3CC6A 3UVPA 1ZYLA 4F65A 2WXVA 2I0VA 2X0GA 3A7JA 3BHYA 3LXPA 3ORXA 3M1SA 4Q5EA 1YRPA 4TNDA 4O27B 5EK7A 5GHVA 3TIZA 3OBJA 1OKZA 2OU7A 2P3GX 1QCFA 1Z9XA 4FZ6A 2GS2A 4G2FA 3QX4A 4C4HA 4YTHA 3LZBA 5HZNA 1OVEA 1VZOA 2XNOA 3ZO2A 5CT0A 3E8DA 2PYWA 1OM1A 3AQVA 4QQ5A 2IVUA 3PVBA 1Q8TA 1H1QA 3FY2A 3KREA 4X2FA 4YJTA 3LFFA 2VV9A 2YIRA 3BE9A 5F1ZA 3KN6A 4GH2A 4PQNA 3DU8A 4DH3A 4XV3A 2GFSA 3IG7A 4CQGA 4PPBA 3LW0A 4C57A 1IRKA 3ORMA 4BDGA 3DNDA 2IWIA 4RWIA 4RBLA 4BTJA 4D2WA 2OG8A 3P7CA 1KSWA 1PXPA 3RTPA 3VS6A 2HIWA 1GIIA 2XKDA 4X3FA 4XRJA 2QKWB 5J7HA 2BUJA 4GU6A 4W4XA 2OZAB 2YIXA 3Q04A 4KS7A 4NCTC 4EC8A 4FK6A 5E4HA 5C01A 3EN9A 1YXUA 4JXFA 2ERKA 4J53A 1ATPE 1H1SA 2OXDA 2P33A 4QTAA 2X8IA 4UWCA 5A4CA 3C5IA 1QPCA 2GDOA 4ZZOA 4PL5A 4RG0A 5D9HA 3G15A 1TQPA 2C6LA 2C47A 4O0YA 1Q8YA 5AV2A 2UW7A 4N6YA 4HZSA 4YZNA 4ZTSA 1B39A 3LQ3A 5E7RA 3CKWA 4QP1A 3UBDA 2UVXA 5CX9A 4HVHA 4RX9A 5L2TA 2H8HA 4FKSA 4F9WA 4DTAA 3GUBA 4EOQA 2I0HA 4RQVA 5DR2A 5AUYA 3MVJA 4I6FA 4BDKA 2ZB0A 4U44A 4FEWA 5I9XA 2EU9A 4ALWA 3II5A 4C8BA 2EUFB 4F7JA 3EN6A 1PXOA 4O0RA 5AA8A 4EBVA 2O63A 1XH6A 4AGWA 3PZEA 4V05A 2GQSA 3R1QA 3VAPA 4U8ZA 2R3PA 5G6VA 5M57A 4YZMA 4IAYA 4QMLA 4FKGA 1H01A 5L6PA 2V7OA 4DG3E 3UJGA 2FUMA 4QNAA 4J96A 4YZ9A 4PDSA 5EHLA 5M44A 4CTCA 2ZM3A 5GINE 1NVSA 4LUEA 3ZUVA 3P5KA 4ZSAA 4M84A 2WTDA 5FEDA 4B4LA 2O8YA 4YO4A 3GC9A 4O21A 3V5TA 5GZ8A 2W1FA 5EI2A 3QUDA 2ZYBA 4FTRA 1RE8A 1QPEA 3H9RA 3K3JA 4X2JA 4EH4A 1CTPE 3RPSA 4BYIA 4OAUC 1E1VA 2UW4A 4GJ2A 3ITZA 2QO9A 3UNKA 2VTJA 3R1YA 4XMOA 2C6TA 4DFXE 2GPHA 3NEWA 3OY1A 4FIEA 3VUMA 2VAGA 5JQ8A 4B9DA 4NCTA 3FQEA 2IVVA 2FB8A 2B9IA 3ZO4A 3B8RA 2HZIA 5JKGA 2HZNA 4F64A 3QQJA 1UU7A 2F7ZE 5KKRC 3FMLA 5AX9A 2YN8A 3AC4A 3O8PA 3V6RA 1I44A 1P4FA 5K5XA 4PL3A 2IZTA 3MW1A 3LXKA 1LR4A 3UGCA 4M0ZA 3QF9A 3V5PA 5KHWA 1KE8A 5H3QA 5EH0A 3FAAA 3D14A 2UW5A 4WIHA 5EM5A 5T6KA 5JFWA 2J50A 3BCEA 4HVIA 3PWYA 2QOOA 2AC5A 3O96A 4I0RA 4PV0A 4WKQA 1J7IA 3FLYA 2J6MA 5K9IA 2WMXA 1OPJA 4RIOA 4C2WA 1OPKA 5EKNA 1B38A 1U5RA 3KK8A 4C34A 4GK2A 4Y5HA 5FRIA 4HVGA 5JFXA 5HD4A 4QMXA 3A99A 2WNTA 3MTLA 3CY2A 2XKCA 1APME 1OUYA 3COIA 3NIZA 4FKUA 3DKGA 1ZOEA 4PTCA 4RWJA 3KRJA 4RJ6A 4YUQA 5CU3A 1UKHA 5EFQA 4A9YA 3ULZA 1ZYCA 1MRUA 3WOWA 2WU6A 3Q60A 5E9EA 3PA5A 3ZS5A 3QAME 2OICA 2QR8A 3NW7A 4FKVA 3PY0A 4KIQA 3FKOA 4CTBA 4UWYA 4BF2A 4L44A 4OW8A 4BDCA 4EYJA 2IG7A 3QQUA 3SG9A 4V0GA 3UVRA 1QPDA 3R01A 4G5JA 4TZRA 4U7ZA 2H96A 4YZBA 3PE2A 3CY3A 3BGPA 3HP2A 4F6UA 3QQFA 2EXMA 3MESA 4EQUA 3GU5A 2VX0A 3IQ7A 1PY5A 1U59A 5C1QB 3EOCA 1YW2A 4APPA 5IF1A 2X8EA 3R6XA 1JSVA 1J91A 3ERKA 2QURA 2W1IA 4FZ7A 1CDKA 5IQEA 4QMSA 3M11A 4XOZA 2OIBA 2ZDTA 4KRCA 4KIPA 4QP7A 5EM8A 3RK5A 3AT2A 3DB6A 3TCPA 4D2TA 2XIYA 3BBTB 2OFVA 2QOLA 4QYEA 3COMA 3W33A 1ZY5A 3MB7A 3QTWA 5AUXA 3ZLXA 4DLIA 4C35A 3RINA 3L9MA 4I23A 1OIQA 2W4OA 4R6VA 2PU8A 2JGZA 4R7IA 3NNUA 3A60A 3ORLA 5E1EA 4C3PA 3V8TA 2PVFA 3MFUA 2WKMA 3OTUA 3ZO1A 2VTTA 4YPDA 4OTFA 3L9LA 4WT6A 5CU4A 1DI9A 3K5UA 1SM2A 2H6DA 1ZXEA 3I7BA 5A4EA 2F9GA 4ZLYA 1XBBA 3RZBA 3TKIA 3HX4A 4CSVA 4CV8A 2Q0NA 3BKBA 1NW1A 3BV3A 4D2VA 3NVMB 3PJ3A 3KULA 3TZ8A 5BVOA 3JS2A 4I0TA 4IE9A 4EQCA 4AFEA 1UU9A 3EQCA 3AD5A 2BIKB 5AP7A 3TV7A 3DZQA 2V0DA 4FYNA 2BTRA 4IB5A 4YJOA 1PRYA 5BNJA 3VHEA 1PMNA 2OH4A 5I9ZA 3VRZA 4AZFA 4BKJA 4ITHA 4L46A 2GNFA 3GU7A 5BUJA 4M12A 2Y4IB 4J8MA 1YWNA 2ZV7A 4BBFA 3C0HA 5FGKA 1J3HA 3TL8A 2B0QA 3F82A 3JVSA 4DFLA 2UZDA 5JRSA 3DAKA 3FI2A 3QWJA 5I5ZA 5AWMA 1Q8WA 4EH3A 1HOWA 2VTNA 3P08A 3SKCA 1GIHA 3QFVA 5F9EA 4KIKB 5J87A 1GY3A 4LGDA 3W18A 4F0IA 1CKIA 3FL5A 4XV2A 5FG8A 3G90X 4ZTNA 1H08A 4NYEA 2EXEA 4F6WA 3S00A 4Z7GA 3KRRA 2XIKA 3VUTA 1OMWA 2ZM1A 3VS4A 3MB6A 3SHEA 5AP4A 5CENA 3EN7A 5J5TA 3QBNA 3OCSA 3UO5A 3ACKA 5HG5A 3DBFA 3KXNA 4KA3A 5KE0A 5TR6A 1FMKA 3TIYA 2BAJA 4O6EA 4RX8A 5KZIA 2VTAA 2QOQA 2UVZA 3IPHA 3ZDIA 4BWKA 5AAFA 5EI6A 4UWBA 1H07A 5HE1A 3LFCA 2XA4A 4ZK5A 3LFDA 3ZFMA 1PYEA 2VX3A 3MBLA 2ZDUA 3ANQA 4RJ5A 4C62A 3SXRA 4I5CA 4UX9A 5CU6A 3W2QA 3LLAA 2WTIA 1H24A 3M2WA 3GNIB 3QC4A 4FT3A 3KRWA 5HVKA 1JNKA 3Q5IA 3R8PA 3ORZA 3PG1A 4FV7A 2BTSA 1S9JA 2X7OA 3CCNA 3RHXA 3KN5A 3R7GA 3W10A 1YVJA 4QQCA 4YJPA 4GEOA 4FVRA 3TNIA 3V8SA 3QRUA 3R83A 3MIAA 3A4OX 5ANEA 3EFJA 3UPXA 3F3WA 3H9OA 3VUIA 4HW7A 3QX2A 1W7HA 3VUHA 2XCKA 4QMQA 2GNIA 4JVGA 3NNWA 3L9PA 4PRJA 3AT4A 3RM7A 5GZ9A 5CSVA 3ZMMA 3RPRA 3P79A 4KBAA 4E3CA 2AC3A 4W8DA 3LJ0A 2XP2A 4G3CA 4CFXA 4R1YA 2YCRA 3FUPA 4OTIA 4A9UA 3ZC6A 3O2MA 4GKHA 3WF6A 3DBDA 4CCUA 2HXQA 3FBVA 3RNYA 5AP0A 3R9HA 4L3PA 2J5FA 4MBLA 4HVDA 1YXSA 2RL5A 3PP1A 4U3YA 3F61A 5CF8A 2UW3A 4XG6A 2JIIA 3ET7A 3NS9A 3C0GA 5LARA 4EZ5A 3UMXA 4G3DA 3NPCA 3TXOA 3EH9A 1UVRA 4XV1A 4GFMA 5EDPA 4DTBA 3G0EA 4IDTA 3HAMA 5K0XA 4NIFA 5J1VA 4NSTA 2JFMA 4PMSA 3F6XA 3V6SA 2E9UA 2YFXA 5KUPA 4KKEA 2UZLA 3P0MA 4RQKA 4UMPA 3ORIA 4G3EA 3E8EA 4KINA 5J9YA 2PULA 5CEIA 3LQ8A 1YXTA 3BLHA 3PIYA 3U54A 4R8QA 3BX5A 4EZ7A 2BZIB 4IEBA 3TNHA 4HOKA 1OIYA 4ENXA 4ZSGA 4MXAA 4TY1A 2HWOA 5DI1A 3I0QA 4GS6A 5BVEA 3ZLYA 3BHTA 5IEVA 4TYEA 4XP3A 4H1MA 4BGHA 3UG2A 5LQFA 3EZVA 2PUUA 3OCBA 3V5JA 5DWRA 4EK8A 1FOTA 3A4PA 5KZ0A 2QODA 3PLSA 2CKOA 2CCHA 2VO7A 3LE6A 4PUZA 5AP1A 1IASA 2C5YA 3QD0A 2JBOA 4F4PA 5M4FA 4RC3A 3LCSA 2C5XA 3D15A 1Q8UA 3MDYA 3OHTA 4EK5A 4F1MA 1G8AA 1WVXA 2REIA 3HP5A 1U54A 4TPTA 4TYJA 4YC8A 3RI1A 4EKKA 3VW8A 4CG9A 5HI2A 5EI8A 5ETFA 3DLSA 5A4TA 3E62A 3FL4A 4I6QA 2YDKA 4H58A 2YISA 3MA6A 3U4WA 3DKCA 1JBPE 5E1SA 5CXZA 2A0CX 2BVAA 3DK7A 4GT5A 3KCKA 2ITYA 2XIZA 4BZDA 5CU0A 2C30A 3C1XA 3OMVA 3VF8A 3R7IA 1PMUA 1P5EA 4M68A 4USFA 3Q6UA 4FX3A 5CI6A 3I5ZA 5GNKA 4TYHB 4CMTA 2WMAA 3UTOA 2PVKA 4YPSA 4EI4A 5IQIA 3LJ1A 1P2AA 2QU6A 5HD7A 1JSTA 4JQ8A 3A8WA 3DZOA 1YI6A 3LQ5A 5FLFA 4ZTQA 4O7SA 5CNNA 3CXWA 2WMBA 2OXXA 2QI8A 3HMIA 4QMYA 3KFAA 4I5HA 3A7GA 5IEYA 2QOHA 5I9WA 3A7HA 4E7WA 4M69B 3QXOA 4O81A 5H8EA 4QD6A 2FA2A 4UB7A 2GQGA 4XS2A 4Y85A 5IH6A 3O71A 1PW2A 4QPAA 2WQOA 1CM8A 1YDTE 4CGAA 3IDPA 4QMMA 2VNYA 4IB0A 4AG8A 2B7AA 1U46A 3DKOA 1UWHA 2W1HA 3FPMA 4M66A 1FQ1B 2F4JA 2WD1A 4CFUA 1OL6A 1CKPA 2OZAA 5FBOA 1SVHA 3OXIA 1H28A 2FH9A 1GJOA 4XUFA 4YBJA 1PJKA 4RIXB 5IMXA 3KVWA 5DVRA 3VWAA 2YM6A 3FJQE 3FSFA 3SAYA 3VULA 3PG3A 3H3CA 3WF5A 3TUCA 4ZP5A 3DDPA 3VRYA 3FKLA 2XNGA 3QZIA 3L8VA 3QTZA 4BTMA 3DBEA 3O17A 4N4SA 4X2GA 3BPRA 2PVRA 2G01A 4GFOA 4I92A 4ZSLA 3WIGA 5GIPE 4Y73A 4FG8A 3WI6A 4C4GA 4UMUA 4IFGA 3OEZA 4EOJA 3JR1A 5TO8A 3ALNA 2DUVA 4FEXA 2VTOA 3EFLA 3NNVA 4WBBB 4QRCA 4TW9A 4WOVA 1KUTA 2IJMA 2J0IA 4C58A 4IX6A 4U41A 2VN9A 4BL1A 2Z2WA 1XH8A 1YDRE 4AAAA 4IAKA 1KV1A 2PVJA 2QLQA 4IWDA 3FXZA 3W8QA 4J95A 4L9IA 4MNEB 4UBAA 4CQEA 3C4XA 3MPMA 4RX7A 3RKBA 3HRCA 3OCTA 4UEUA 1R1WA 4FSTA 2VU3A 4U80A 4W8EA 3UZPA 3CJFA 4ZSEA 5LMBA 3VJOA 3VUDA 3PPJA 4MTAA 4FKQA 3VBTA 5IDNA 5AIRA 4G31A 4O83A 4BCFA 1OKWA 2W17A 3ZC5A 5HO6A 5M4CA 4WG3A 2PSQA 3QYWA 5CZHA 2PPQA 4CMUA 1W98A 4MWIA 4D4SA 3FZOA 2XK8A 4K11A 2C0IA 4A06A 2E2BA 2OO8X 3LFAA 5B0XA 3U9NA 2R3HA 4ACCA 5A9UA 3SV0A 1AGWA 4RFZA 4RRVA 3WZKA 4HYSA 3NGAA 4XV9A 4AZVA 4DBXA 3MTFA 4CKRA 5AR3A 4A9RA 1ZMUA 3OWJA 3PY3A 5DH3A 5A6NA 3AGMA 2YDIA 3ZFYA 4O7VA 3KRLA 5D1JA 5BYZA 1DM2A 2A4LA 2F57A 3QCSA 4QPMA 4U5JA 4EOOA 4L42A 2R3KA 4M8TA 1YHVA 1E9HA 2OIDA 4A7CA 4WUAA 1J1BA 4FIFA 2OKRA 3C51A 4JG8A 5DGZA 5TKDA 1QL6A 3BYVA 5EOLA 3R9NA 4AZEA 5K5NA 5EQEA 4WG5A 2A19B 3QGYA 3ZUTA 4EOMA 3NVKI 3GOPA 3U6HA 3F66A 3OZ6A 3FLZA 3DJ6A 3BI6A 3FMMA 4FT0A 4B8MA 3EQBA 5HIDA 3OXTA 3LM5A 2J0MB 3R1SA 5M08A 2ITVA 2BRNA 4U43A 3R21A 3K2LA 1V1KA 1JAMA 2QCSA 2C1AA 4JDKA 3FQSA 4FYOA 3I7CA 2W5AA 4RFYA 3FYJX 4QMTA 3I5NA 4I94A 5IMEA 2RFEA 4IACA 4K33A 2B9JA 5HO8A 4PMMA 1R0EA 4ZSJA 4J52A 4F09A 2ITXA 1P4OA 3KRXA 4GL9A 3Q5ZA 2X9EA 4II5A 3DQWA 3PTGA 4GV1A 1PXJA 4E20A 2VTLA 2J2IB 2QC6A 3RHKA 4R1VA 4DAWA 2B9FA 5KMJA 4EC9A 5JQ5A 3HRBA 3PA3A 4WG4A 2W99B 2C3LA 2H34A 4HCUA 4ITJA 4LUDA 4D5HA 4FV9A 4NKAA 3V51A 3F2RA 2ZV9A 5HCZA 3HA8A 2HXLA 4F08A 2E9VA 1V0BA 3E7VA 3G6HA 4AT4A 4MXOA 4EH8A 4O7ZA 4W9XA 3K3IA 3U55A 4I1ZA 5CF4A 4DEHA 5EYMA 3ZUUA 2PZRA 3E92A 5ACBC 2YCFA 3CSVA 5B2KA 3VNTA 3PXKA 2UZTA 2GMXA 2ONLC 2GS6A 3QA8A 1ZZ2A 4O2PA 4Y72A 5EYCA 4AA5A 3UQCA 3OUNB 1UA2A 4IC7A 2Y4IC 5JFSA 3UPZA 3PVWA 1URWA 4L43A 4F63A 3BIZA 5FUTA 2ETMA 3D83A 5I9UA 3Q52A 2Z7RA 3PY1A 2JFLA 2R9SA 4RZWA 1XH5A 3BHUA 3QRIA 3PRFA 4KNBA 4RSSA 5A4QA 3HMNA 5AR5A 3RPVA 4DFYA 5AA9A 4QTBA 4G6OA 4L7SA 5KO1A 3ZCLA 4EH7A 2HZ0A 2PMNX 5ANDA 1XWSA 4I6BA 1WMKA 2I1MA 2R7IA 4OGRA 4U9AA 5D7AA 4XG9A 5E8VA 4FNXA 5FQDC 3DB8A 3E63A 3ROYA 3O0GA 3IW8A 4A4XA 4F70A 4L52A 1H1WA 1TQMA 5E90A 4J97A 5C4KA 3MVHA 3WZEA 1O6LA 5CAQA 3MFSA 4W4VA 4HPTE 1JWHA 2IN6A 3BQRA 3MA3A 4FC0A 2B54A 4XX9A 4O1PA 1WBVA 3KGAA 4RC4A 5CU2A 3HVCA 2UV2A 4RJ7A 3QCQA 4BCHA 3EQDA 4F7LA 4OTDA 4QTDA 3PVGA 4QQTA 5AUVA 2BDFA 4RVMA 3TJCA 5E8UA 3QZFA 2PVYA 2XEZA 1A06A 4H39A 4OTRA 2UZEA 5LVLA 3RAKA 3QC9A 3EKNA 3TKUA 3NUYA 4CRSA 5M06A 4BVUA 4IAIA 3PWDA 2ZV2A 2YABA 4RLLA 2HENA 5AUZA 1WAKA 2XKEA 4QMUA 1Q41A 3UOKA 1WFCA 2X1NA 3UO4A 4ZS4A 4IHPA 5HKMA 2KTYA 5LMKC 2QOBA 3BZ3A 4FSNA 5AP3A 2H9VA 2F7EE 4KKHA 4G5PA 4WSQA 2YITA 4U6RA 2ONLA 4JQ7A 5CVHA 4A9SA 4K6ZA 2PMLX 3QU0A 3HMOA 3EYGA 4YJQA 4BYJA 4FKLA 5KHXA 2DQ7X 3V3VA 1M7QA 4DEEA 3DJ7A 5CLPA 1TKIA 3EFKA 5DOSA 4GUBA 2XK3A 1BX6A 5LXMA 2OLCA 4HGEA 5FXSA 3QRKA 3BLQA 4IX5A 3R8LA 5IG1A 3ELJA 2WTWA 3C13A 2F2CB 2J9MA 2W0JA 1OBDA 2RFDA 4GU9A 2WOTA 4KIKA 3HMMA 3NUUA 4AZTA 3BGZA 3Q6WA 3VBQA 2E9PA 3CLYA 4PTEA 4ASXA 4DHFA 5JGBA 3DXNA 2AYPA 2O0UA 4FKPA 4FIGA 5HO7A 1LPUA 4XRLA 3OEFX 3GEQA 4KABA 3QL8A 4PF4A 5C03A 4LGHA 1RDQE 3PJ1A 3SLSA 2YJSA 3MH3A 2PL0A 1YHSA 2R3FA 4W4YA 2XK9A 1XJDA 3C9WA 3GCVA 4LGGA 3WIKA 4Z16A 4E1ZA 3G51A 4F1OA 2OJ9A 4D1XA 3CE3A 4FTMA 1ZMVA 4DBNA 4N6ZA 4EH6A 4P2KA 4MD9E 5BVFA 5HTCA 5LJJA 1Y6AA 4ACHA 4YLJA 3POZA 4G17A 4QP8A 3AC8A 3O50A 4MAOA 4BWPA 3W16A 3PRIA 2QHMA 3I60A 2I7QA 5D41A 2Y0AA 2OSCA 1KE5A 3CGFA 4TYIA 2WMQA 4LOPA 4YGAA 4ERWA 4C4JA 1MP8A 5HIEA 3UP2A 4FTNA 4IWPA 4RWLA 5AR4A 3NWWA 4RMZA 2OF2A 4L67A 5LMKA 5BVNA 3FE3A 2OXYA 2W4JA 4Q9SA 4ZTMA 2YAKA 2BDJA 4BZNA 4F9BA 2XK6A 3LHJA 5HBHA 3FC2A 3BBWA 3KXXA 5TE0A 3ROCA 2PUPA 5D12A 5ANJA 2EWAA 1JKKA 2QOIA 2UW9A 5FM2A 2XYUA 3DLZA 4OT5A 4O7YA 3HA6A 4BDJA 3VF9A 3PIZA 2RKUA 2B53A 5DT3A 1AD5A 4LL0A 5J9ZA 4RFMA 5HESA 4FTIA 2HZ4A 4KD1A 3EN4A 3LFEA 2LAVA 4LI5A 1BLXA 3NX8A 3THBA 4O7NA 4D5KA 4TWNA 4YJSA 4HJOA 1VJYA 2YM4A 4CD0A 2XH5A 1Q8ZA 3GFWA 4FZFB 4FSUA 2HCKA 1JVPP 4IAAA 4O7RA 3L1SA 1PXIA 4MXYA 3QKMA 5K3YA 3TNQB 5FP6A 4JNWA 5DR6A 3AC3A 3ZM9A 3W2PA 1FBNA 4E93A 3TI1A 4GG7A 3KXGA 1V0OA 3OUKA 3OWLA 2ZV8A 2VWIA 1M7NA 3COKA 5IA5A 1WBWA 5AV1A 4U79A 3RCJA 2JKMA 4ANBA 3IS5A 3N4TA 3SVVA 4OBPA 4O7WA 4IC8A 3MIYA 2CN8A 3CTQA 4U0IA 5DG5A 2OJJA 5D11A 2UVYA 3OY3A 2Y4PA 4AWIA 1H27A 3QQLA 4YJVA 1JQHA 3TTIA 3E93A 2JDVA 4UZDA 3MV5A 5I9VA 3RPYA 4QMNA 3W32A 2ZB1A 3NW5A 2DYLA 2X8DA 2CKEA 4BI0A 2IZSA 3S4QA 3O8TA 5GJGA 3FMHA 3UG1A 3E5AA 4MXXA 3OOMA 2CMWA 3R73A 4O22A 3HV7A 4BICA 1ZYJA 4E4XA 4KKGA 3QUPA 3E3PA 3NUXA 2BRBA 4JR3A 4FICA 4K8AA 3GC0A 3QYZA 5HORA 3OCGA 4NM3A 2I6LA 2C6OA 5IUGA 3R71A 2PHKA 4BRXA 4PNKA 4LOOA 4B8LA 3E8CA 5IQCA 1SNUA 5IA1A 2XRUA 3AGLA 3DQXA 1WBTA 4NZWB 3U8WA 1CSNA 4F6SA 5KBQA 5L8KA 1HCLA 3KL8A 3GU8A 1GOLA 1OGUA 2PY3A 3DAEA 3PXFA 3NYVA 4DH5A 2WMVA 3LAUA 4YBKA 3N4VA 4O7TA 1YKRA 3ULIA 2IZUA 1JKTA 4O1OA 4U45A 1ZARA 5I3OA 2GQRA 3RVGA 1HCKA 5DEWA 1G3NA 4EKLA 4LOQA 5FTOA 5M09A 5JN2A 3RWQA 3UYTA 3ZLWA 2C69A 1Q24A 2YIWA 3L9NA 4TYHA 5CXHA 5KCVA 1KOBA 2YDJA 4R77A 3FDNA 2WMSA 2ESMA 4LV8A 2VO6A 4IFCA 4F7NA 4IQ6A 2VGPA 1PYXA 5J95A 3PXZA 3RGFA 4AN9A 3RCDA 1KWPA 4M69A 4QP3A 3OW3A 4G3FA 5IZFA 5M53A 4QYYA 2QKRA 2QLUA 4ZLZA 4YURA 4JIAA 2JDSA 2PWLA 3Q4ZA 2C3KA 2BHEA 4K18A 4D0WA 2EVAA 3ORNA 4FV4A 4MEDA 4ZJVA 4C02A 4GYIA 3ORPA 4BDAA 5BVWA 2E9NA 3NAXA 1WZYA 2Z8CA 3WF7A 4AOJA 2O65A 1PKGA 5BVDA 3TM0A 4C38A 4QQJA 4XLVA 4JBPA 4L3LA 3BHVA 3DOGA 3NUNA 2JDTA 4JQEA 3ZTXA 2WZJA 2X81A 4N70A 1GZOA 4H36A 4HCVA 4P5ZA 3NUAA 4L6QA 4FT9A 3Q2MA 2NRYA 4KSPA 4W9WA 3ACJA 4RX5A 5IDPA 2VWXA 1WBPA 3MY0A 3RAIA 3UYSA 2YCSA 5LVPA 4IZ7A 3DTWA 4NW6A 4EOSA 4QNYA 2W96B 1XH4A 3CBLA 4KRDA 4J71A 1H0VA 4ZMEA 4TYGA 5DR9A 3QTQA 4YZDA 4Z3VA 2I0YA 4XG8A 4D55A 2WGJA 3G5DA 4JG6A 4MNEA 3RJCA 5CALA 3P23A 3GCUA 4UYNA 4CXAA 4PP7A 2P0CA 5CAVA 4EYMA 1G8SA 3V5WA 3NW6A 3D0EA 3WZJA 4BI1A 2WFYA 3CPCA 3ZSGA 1LP4A 5HQ0A 2JDRA 4RIWA 1ND4A 1ZYDA 3F2NA 2CLXA 3QRJA 5I3RA 3VJNA 4F99A 2YLEA 3OG7A 3NZ0A 4RA4A 1QPJA 3E7OA 2WIPA 4A9TA 3BEAA 3KCFA 4AFJA 2ITZA 3ZONA 1KOAA 3DJ5A 3D7TB 1SVEA 3OVVA 3TDWA 3GBZA 1H25A 5HU3A 3GCQA 4BKYA 2G2FA 3ATSA 3OP5A 3JVRA 4XG7A 5DT4A 1IAJA 3ID6C 4S30A 5JZNA 4F9CA 3IK3A 4O38A 5AFVA 3R8UA 3HRFA 3DDQA 5AV4A 3G6GA 2XUUA 4DGGA 2B4SB 1XR1A 2C3IB 3O7LB 4YNOA 3NYNA 5EYDA 1ZMWA 4HPUE 1F0QA 5CS6A 2YAAA 3A7IA 3WARA 4JDIA 5F20A 5B2MA 3E88A 3PA4A 5HG8A 3R7EA 1LUFA 3D4QA 2HY0A 3KEXA 5FTGA 2W4KA 3TEIA 5E8ZA 4C3FA 3RWPA 2HY81 4AN2A 1OL7A 2XNEA 4E4LA 5IU2A 4FBXA 5M07A 5HOAA 3A8XA 3PYYA 4J98A 4AT3A 4YC6A 4D58A 3F5GA 4G9CA 1UKIA 3BYSA 2W1GA 3MWUA 4K77A 4UALA 2J0JA 3QCXA 2FSOX 4GSBA 5E8TA 5HCXA 3T3UA 3UDBA 2W1DA 2ITWA 5ITAA 4RT7A 4WBOA 4J7BA 2KULA 4AT5A 4UMRA 2J4ZA 2JKQA 2IW8A 4IJPA 5ANIA 3G33A 5EHOA 2XJ2A 3D2IA 5HGIA 3RK9A 3FMJA 1PF8A 4EHVA 4FEUA 3P7BA 3QQGA 5IQHA 4USEA 4O82A 5T68A 5AM7A 5FWKK 5LWMA 2R5TA 3UP7A 4HGLA 5L8JA 4I21A 4AXAA 1P14A 4K1BA 4QYFA 2QO7A 2VTIA 2XNNA 3IW6A 4H3BA 4U81A 4E6AA 2Y9QA 3H4JA 4I24A 3LFQA 3Q9WA 4MBJA 4TL0A 3FMEA 3TUBA 2PZ5A 3AG9A 4O2ZA 1FVTA 3V01A 4ARKA 2X6DA 1OL5A 2GHLA 3ZZWA 2R3RA 2VTMA 1UU3A 3FY0A 2R0UA 3O7LD 4JAJA 3CTJA 4RC2A 5IA0A 3MN3A 2VTSA 2GS7A 4NH1A 5HX8A 5M51A 4YTIA 4ANQA 4B0GA 3U6IA 3GP0A 2XKFA 1TQIA 5HHWA 4YLLA 3ORTA 1REJA 5J7BA 3Q2JA 3UQFA 2NNWB 3R30A 2EXCX 4LM5A 3TTJA 4D2SA 4FEVA 3EKKA 3RMFA 2NP8A 3CIKA 3TV4A 2F2UA 3ODYX 3HYHA 3ODZX 4AGDA 4RVTA 5C8NA 4P90A 5CEOA 3UOLA 4IZYA 3DBCA 3FXXA 3NMUF 4AS0A 3PIXA 2FGIA 2PE1A 3F69A 3CEKA 3IONA 4BCMA 5A6OA 5BPYA 1T46A 2OJGA 3TT0A 4L3JA 3MS9A 5ANKA 5KMLA 3OF0A 3QTRA 4IWOA 3PPKA 3EWHA 4PTGA 2WOUA 4AE9A 4WNKA 2PMOX 4FV5A 1OI9A 3QCYA 2XBJA 3R8MA 1PXKA 2C6DA 1UU8A 2OI4X 3KY2A 3DK6A 3R63A 1OITA 2BAQA 3F5XA 4XBRA 1OL1A 1Q61A 4FKJA 3MY1A 4YSJA 1OL2A 3D94A 3V04A 4D4RA 4FOCA 4R5SA 4MQ1A 1MQ4A 3HV3A 2B52A 5AR8A 3R7YA 4ZZNA 3EZRA 4YHTA 4ONAA 4WO5A 4O6LA 3A62A 2YWVA 2O5KA 3KU2A 2CN5A 2BMCA 3BU3A 5L2QA 3R7OA 3BE2A 1H1RA 3R0TA 4MX9A 1VEBA 5EDQA 4L53A 2RIOA 4A4OA 5HG9A 2RG6A 4RJ8A 3OW4A 4KB8A 5ANGA 4BTFA 4EEVA 3QKLA 5BVKA 1YOMA 2F49A 3BQCA 3GCSA 3NSZA 2ETKA 4C4IA 3FZPA 4E5BA 2R3NA 3Q9ZA 4KWPA 3HAVA 2OIQA 2XNPA 5LCJA 4IANA 3NCGA 4BTKA 4NTSA 5HTBA 3MJ1A 4CFWA 2JITA 4GFGA 3PJ8A 5CAPA 2PVLA 2WEIA 3FPQA 2JKOA 2W5BA 1ZOHA 4FTJA 4NUSA 3PXRA 3ZO3A 3MGYA 2Z7LA 5L8LA 3NNXA 4OLIA 5CASA 2I40A 4V0GB 3ZBFA 4ZMFA 4FUXA 1JPAA 3P86A 4PNIA 1FGKA 1GZNA 2WTVA 3D2KA 3Q96A 2Y8OA 4E8AA 3TUDA 4ANMA 2PZYA 1AQ1A 4U3ZA 3VBYA 3NRMA 3F88A 4BDIA 4CYJA 1I09A 4O96A 2G15A 3KKVA 4H3PA 3ZXZA 4DG0E 5I4NA 4BFMA 3WE8A 2HAKA 5LOHA 2CHLA 3K54A 2JIUA 1H0WA 1Q62A 2R64A 3G9LX 5K4IA 3EQHA 3QTUA 2OZOA 3GU4A 4BIBA 4DGNA 2ITOA 4IVBA 4O0SA 5DYJA 1K2PA 4ID7A 3T8OA 3COHA 4XOYA 3R9OA 5ANOA 4FIHA 3UZTA 3E87A 4BN1A 4U40A 3QTIA 1IAHA 2VTRA 5CZIA 3ENHA 4K9YA 3UNZA 4C7TA 4AE6A 4J99A 3HL7A 5D7VA 4OBQA 4B6LA 5C4LA 4EONA 3OWPA 5HLNA 3W2OA 1ZLTA 4JS8A 5F95A 4FSWA 4H3QA 1OIUA 1XBAA 4G16A 4BC6A 1SYKA 3FLSA 3U9CA 3IO7A 4C36A 2C6IA 4RJ3A 3SG8A 4GVJA 3AXWA 4ASEA 5DMZA 3OT3A 2O3PA 4D28A 3T9IA 4FG7A 1BL7A 4Y8DA 2UW0A 3HLLA 4QMPA 3FZ1A 2V62A 4EJ7A 3SRVB 2Y6OA 3TJDA 4FL2A 4JOAA 4NKSA 2VTPA 3IW5A 3PVUA 2JAMA 2ZM4A 3F3VA 1XO2B 3LXLA 4IB3A 1K3AA 5IA3A 1M2PA 5L2SA 2C6MA 4OTQA 3VHKA 4BCKA 4CT1A 4ZIMA 5TOZA 3TZMA 2GTMA 2GNGA 3KMMA 3L8XA 4DH8A 2YIQA 4FZDB 4XEYA 5JGAA 4ZXTA 3K5VA 4AGUA 4YMJA 3WF8A 2BFYA 3WYXA 2ZVAA 3HUBA 4J1RA 5L4QA 4NFMA 2VD5A 3VS5A 4AW1A 2QG7A 3F5UA 5F4NA 2HW7A 3W2CA 4DFBA 3E3BX 4MQ2A 3FSKA 3PXYA 3KXMA 4O0TA 4RVKA 4ITIA 2WPAA 3NCZA 4XNEA 4Q5HA 2XK4A 1IA8A 5CQWA 4E26A 4LQMA 4NM0A 5LVMA 2P55A 2VWZA 1S9IA 4BIEA 5IEXA 4FNYA 5JK3A 4E4NA 2CGWA 1OPLA 1YDSE 4QO9A 5BUEA 4DEBA 4FKIA 4DCEA 3FMKA 4X6QC 5HEZA 3B2WA 3R28A 3U4UA 2OJFE 4BBMA 2CKPA 5KNJA 5AIKA 2YM8A 3SXFA 4OT6A 5E8SA 3L8SA 4O7LA 2WQEA 1WVWA 2BALA 3WZDA 3Q32A 4G9RA 5I9YA 2G2IA 3B8QA 4I5PA 3ZEPA 3BYOA 3UC4A 5B7VA 4CKJA 5CF5A 3AC5A 1LEWA 4X2NA 4O86A 1FVVA 2PE0A 2BFXA 2WB8A 3H0YA 3UIBA 3PP0A 4IJ9A 3QLFA 4QT1A 3EQGA 3GQIA 5J9LA 4FMQA 5LCKA 5BX0A 5FTQA 5H9BA 4E4MA 1YI4A 5H8BA 5K0KA 4FA2A 3KMWA 4BDFA 4G3GA 3EFWA 3FQHA 4CLIA 3FWQA 1Q3DA 4E6DA 3BHHA 1Q5KA 4XG3A 2XIXA 5DLSA 4DINA 4N0SA 2CSNA 2VO0A 3DPKA 4S32A 2OK1A 2GNJA 5JMSA 3MVMA 4D4VA 5AP6A 4LG4A 4I5MA 2X39A 2WO6A 2XF0A 2QOFA 5CF6A 3M42A 4YNEA 3FC1X 5CAOA 2X6EA 1VYZA 2UZUE 2QR7A 4U42A 4AZWA 1ZYSA 2XEYA 5C8MA 3V8WA 4FT7A 4WA9A 1R3CA
chains in the Genus database with same CATH superfamily
3HV6A 2R3IA 1J7UA 5DRBA 2J0KA 3QWKA 5JRQA 5J5SA 1U5QA 3MSSA 3OOGA 3KC3A 2ITUA 4AA0A 5EDRA 3PFYA 2XNBA 3FMNA 2A98A 3CQEA 3EMGA 1TFFA 1WVYA 3TZ7A 4GUEA 4O0XA 2BR1A 2G9XA 2W05A 2C5VA 4PX6A 5LMAA 4DH7A 3Q3BA 2DS1A 3P1AA 4S34A 3R2BA 4UZHA 5EHYA 5IISA 4M67A 3GFEA 3H10A 3D5UA 4XJ0A 4PP9A 2ZAZA 4ZEGA 3UMWA 4D0XA 3ZRKA 4PMPA 2CGUA 3EB0A 4OBOA 5C27A 2RF9A 3V5LA 5AEPA 4MXCA 3MFRA 3F3UA 3QHWA 3G2FA 4KIOA 2WMWA 5CSXA 3RK7A 3PDTA 3KXHA 3W0PA 4S33A 2X9FA 4CZUA 5DNRA 3UC3A 4NWMA 2W9FB 4DDIA 5IA4A 2WTCA 2JAVA 2Y6MA 3P4KA 2XIRA 3VBXA 3MPAA 5ICPA 3U6JA 5IQBA 1ZWSA 3R02A 3VQUA 3VUGA 2WHBA 2IW9A 1A9UA 3W1FA 2C0TA 4AW0A 4JIKA 2Q0BA 4MVFA 5C9CA 4DCAA 2BILB 3ZBXA 5IA2A 2HW6A 4ZTRA 3R7UA 2B9HA 2UW8A 2XB7A 4RIYB 4HCTA 3FI3A 4EOIA 4EWHA 5CEMA 3GOKA 3OWKA 4NK9A 4FZAB 4IWQA 4Y5QA 4NTTA 1Y91A 2BPMA 2YIYA 3FI4A 3MH2A 4WD5A 5EKOA 3A7FA 4I20A 3SW4A 3SXSA 3R1NA 2IVTA 3KXZA 5J8IA 3TN8A 4YJRA 3E64A 2WMUA 4FSYA 2QVSE 4PDOA 3AOXA 3MY5A 4QMOA 3PJ2A 1IR3A 4C3RA 4BHNA 5L6OA 3GT8A 4D4YA 3WBLA 4EQMA 4DA5A 1NY3A 1UNHA 3AC2A 3LOKA 4O91A 4FI1A 4BDDA 4DEGA 1Q97A 2UZNA 5AV0A 1KE6A 5CEPA 5KMNA 3DKFA 4YTFA 3VS1A 3BYMA 3BU5A 4QP2A 4Z9LA 4F0GA 3SX9A 4RWKA 1Z57A 5G1XA 3NAYA 2EB3A 5FBNC 2Z02A 4RGJA 3LXNA 4IMYA 4UMQA 1W83A 2A1AB 4IDVA 2WEVA 3EQIA 1Y8YA 3DFCB 5L2IA 4WNPA 2IVSA 3PSDA 2UZBA 2X0OA 1JKSA 4WNOA 2XK7A 2W06A 4BCIA 1DAWA 1M14A 2O64A 2PVHA 3MFTA 3D7TA 4ALVA 3N9XA 4ANNA 2GHGA 2FSTX 4FTQA 4DG2E 3MPTA 2VZ6A 1SVGA 2YJRA 3S1HA 2AQXA 2HWPA 3ALOA 3FHRA 5DPVA 2PTKA 4J8NA 4AUAA 2CNUA 3FEGA 5IQGA 3JYAA 3ZRLA 2IW6A 5L2WA 3EQFA 3QALE 5DFPA 5DN3A 3RP9A 5CQUA 4DGLC 3SDJA 4NJ3A 4Y83A 4CG8A 1OUKA 4JG7A 3VBVA 2C3JA 2XM8A 3R8ZA 5HIBA 3ZFXA 3UO6A 5A3XA 3LKMA 4I3ZA 5HLPA 3IW4A 5KMMA 3VS7A 4X21A 3ZHPC 4IXPA 4MXZA 3D7ZA 4IW0A 3RAHA 2RFNA 3F5PA 1PHKA 3OBGA 4FKOA 2PUNA 3CQUA 3NYOA 3SOCA 4M97A 3PUFC 2FO0A 2YWPA 4QP6A 4YLKA 4AU8A 4BI2A 5AAEA 4Q9ZA 4JBOA 3EL7A 4IM2A 2Z60A 3L8PA 1Y57A 3R8VA 3C5UA 1STCE 5HNIX 5HE2A 5JGDA 5BQ0A 3GI3A 3REPA 4LV7A 3UODA 4ANLA 4BDHA 4P5QA 3VS0A 5CSHA 4XLIA 3HGKA 3VUKA 3WZUA 4ZY5A 4FUYA 2JD5A 3OT8A 5HNGA 4A4LA 5AP2A 2NO3A 4JDJA 4FEQA 2XJ0A 4ZY4A 5FDXA 2PVNA 3C4WA 4UV0A 4FGBA 4CZTA 2W1ZA 4F0FA 1VR2A 1JSUA 5LWNA 3LVPA 4QPSA 3MH0A 3HNGA 2JKKA 2CGXA 5DT0A 3DAJA 4FTUA 4R3RA 2FSMX 2XZSA 4X6RA 4CCBA 4GW8A 3AD4A 5AV3A 4NW5A 3EQRA 2BDWA 3DNEA 4FIIA 3RPOA 2X4FA 2R3QA 3QZGA 5TF9A 3QQKA 1NVRA 3R7VA 1XHAA 4Z7HA 4LL5A 2YM3A 2VWUA 4P4CA 4ASZA 3SQQA 3GXLA 2YACA 2R7BA 5H8GA 5B2LA 4FE2A 4BJJB 4QMZA 3EN5A 4FV1A 1PMVA 5FDPA 4FOBA 4DLJA 4GCJA 3ZRMA 1NVQA 4N57A 4C59A 3JUHA 4MD8E 4DFZE 3WILA 2CJMA 4W4WA 4EZ3A 1XH7A 4D2RA 4EHGA 4U97A 3TNWA 2PE2A 3H0ZA 2ZOQA 3GENA 2HK5A 4WUNA 5CY3A 2P2HA 2YEXA 2YM5A 3TZ9A 1RW8A 4FV0A 2VTHA 3LFNA 2SRCA 4OTPA 5DRDA 3S0OA 4DITA 5JSMA 1J7LA 2XNMA 4DFUA 4QMVA 4TT7A 4XHKB 4FV3A 3KQ7A 1OKVA 3TKHA 3N4UA 2IPXA 4BKZA 2J7TA 4AN3A 4DH1A 2I0EA 1ST0A 3JXWA 2X7GA 5AAGA 1BMKA 1K9AA 5CSPA 3QXPA 2R4BA 4JRNA 2GTNA 1BYGA 3GGFA 4UY9A 5H2UA 1NXKA 2W1CA 3P7AA 5DE2A 5EYKA 5GZAA 3VS2A 4YZCA 5FEEA 3VS3A 4AOTA 4X2KA 2ACXA 2C68A 2XVDA 3LCDA 3UZRA 4GRBA 2QQ7A 2XYNA 2YLFA 4FV6A 2C6EA 1WBSA 4I0SA 4KBKA 1MRVA 4NJDA 4E5AX 4HNIA 5M4IA 4JI9A 1H8FA 2XJ1A 1O6YA 3DA6A 3FZSA 4JR7A 1OECA 1WCCA 3IDCA 4TRLA 4ERKA 3CS9A 4M15A 3TV6A 3HECA 3NUPA 3NLBA 5HVYA 3NFFB 4CYIA 4EOLA 2A2AA 5HTIA 2YA9A 1GZKA 3LFBA 4MK0A 5L6WL 2VUWA 4D1SA 3W8LA 4XH6A 2WIHA 5DA3A 2W9ZB 5ETIA 4ACDA 3D5WA 4IB1A 4DF3A 2YCQA 3IGOA 4PPAA 1V0PA 3HEGA 4DN5A 2JEDA 5AJQA 4AGCA 2G1TA 5C8KA 4ZS0A 3CP9A 4AQKA 4JDHA 2UW6A 1MQBA 4EBWA 5KBRA 4D9TA 2DWBA 1ZOGA 3ZOSA 5EM6A 3BWFA 1YXVA 4TNBA 4AP7A 4FK3A 3UQGA 4FTLA 1OZ1A 4X0MA 3DFAA 2X2MA 4PDYA 4WRSA 4IX3A 3UDZA 1REKA 2PUIA 3IOKA 4L00A 5EQYA 4IVAA 3ZEWA 3SOAA 3GC7A 4CFNA 4HGTA 4PWNA 3RALA 4DGOA 5IH4A 3NDMA 3ETAA 3W0NA 2HYYA 4FTKA 4ORKA 1FVRA 3IECA 1H00A 4YTCA 4DYMA 3NYXA 3R00A 4HNFA 3BELA 5A14A 5AUTA 1ERKA 1OIRA 4FSQA 5HCYA 3QZHA 3VIDA 1OBGA 4CEGA 1M2QA 4LRKA 2YHVA 4RIXA 2WQNA 1H26A 2FYSA 2WTKB 4TTHB 4BR3A 5JEBA 5TT7A 5AADA 2V7AA 3FMDA 2NRUA 5J1WA 4IM0A 2BRMA 4NM5A 1NT2A 3VW6A 4TWOA 5AM6A 3ZSHA 4L8MA 3IGGA 2UZVA 4GIIA 4USDA 3SGCA 3F3ZA 1IG1A 2V55A 4C4FA 5BMMA 1E1XA 2VWWA 4HYHA 3S3IA 4F7SA 4GKIA 3FYKX 1BL6A 4FGRA 1UWJA 4NT4A 2R3JA 4HYUA 4CKIA 4EORA 4NM7A 3O23A 2QHNA 3OROA 4LRJA 3I0OA 3KVXA 4ENYA 3PE1A 1FINA 3IW7A 4M7IA 3P9JA 1CMKE 2J90A 3O8UA 5HNBA 2GNHA 2BZJA 4MD7E 1Z5MA 3JY9A 4BY9E 3GC8A 2V5QA 3FLWA 5HLWA 3TACA 4B99A 1VYWA 4TN6A 5GJDA 5M55A 3NR9A 1ZAOA 4FSMA 4CFVA 3LFSA 4WHZA 3NUSA 2ZJWA 4CNHA 4EH9A 2OW3A 3AC1A 3QKKA 3W2SA 2C0OA 3ZYAA 2NPQA 1ZY4A 4QP9A 4DFNA 3AD6A 2CLQA 5EM7A 3SRVA 5HU9A 3QD2B 1KV2A 2VRXA 4I41A 4KAOA 4JRVA 4YHJA 3BU6A 2UZWE 4EL9A 4EOPA 5E8YA 4UMTA 3OTVA 3BGQA 5FXQA 3LMGA 4FR4A 2IZRA 4JBQA 3HV4A 4I22A 5EQPA 5AUWA 4ALUA 2R0IA 1KE7A 4PPCA 4NL0A 1FPUA 2JBPA 4ZOGA 2HOGA 4MBIA 5AR7A 4TKSA 3LPBA 4IH8A 4MWHA 3ORKA 2OFUA 3LCOA 4I93A 5F94A 5M56A 5IUHA 4IZAA 5JZJA 3SD0A 2XRWA 4F9AA 4YU2A 4ASDA 4OTHA 4EWQA 5EW9A 2F7XE 4LFIA 3SA0A 3AMAA 2QOKA 5C26A 2VO3A 3DXQA 2C5NA 3MVLA 3KF4A 4FTOA 4L7FA 4C61A 2RSVA 3WYYA 4CFFA 5FXRA 2BZHB 4H1JA 5BMSA 4JJRA 3S2PA 3C7QA 2RFSA 3Q4CA 2CNQA 2WQMA 3LJ2A 4M3QA 1GIJA 4D1ZA 1IEPA 4I6HA 4JLCA 2R3OA 3LIJA 5EW8A 4YC3A 1WBOA 3FXWA 4OTGA 4FTTA 3JY0A 4DEAA 5KX8A 4K0YA 4RA5A 2CGVA 4RLKA 4X3FB 4ZZMA 4NFNA 4Q2AA 3A61A 4F1TA 1YWVA 3LLTA 3U87A 4FNWA 3C0IA 1XQZA 1GZ8A 1G8JA 4QTEA 3PFQA 1W0XC 2FVDA 4ZAUA 3ZSIA 2GCDA 1PXNA 2WU7A 3CGOA 5CSWA 3DGKA 5HX6A 3Q4UA 4IBMA 4EK3A 1F5QA 4L01A 4FV8A 5HBEA 4AZSA 4XBUA 2CNVA 3FZRA 5FEQA 5ETAA 2JLDA 5I0BA 4IM3A 5HE3A 5LVOA 1PKDA 4CFMA 4AW2A 2HELA 4ANSA 3Q9YA 2OGVA 5A54A 1SZMA 3BEGA 4HGSA 5EW3A 4CT2A 4DEIA 4R78A 5AP5A 2WTJA 3CQWA 1T45A 2XAMA 3R04A 3LM0A 2VNWA 4FT5A 3ZZEA 4R7BA 1M2RA 3B2TA 3MI9A 2A27A 5EG3A 1OB3A 4DT8A 3RNIA 2JIVA 4IAFA 1O6KA 2QO2A 3Q9XA 5DIAA 5GJFA 1NA7A 3DCVA 2GSFA 2Z7QA 5JH6A 1KE9A 4MUQA 3C4CA 4FVPA 4BIDA 3F9NA 1X8BA 4M13A 1W82A 5E8XA 2QONA 3DTCA 4AW5A 5CT7A 2BZKB 5CEQA 3QTXA 4LRMA 4BCGA 4O4EA 3G0FA 3EJ1A 4IIRA 1RQQA 4QOXA 4IAZA 4FKRA 2NYAA 5AMNA 4L45A 4R3PA 1F3MC 4GT3A 2BCJA 4YJUA 2R3LA 2UZOA 2B55A 3UIXA 4OR5A 4R7HA 3W2RA 4C0TA 2BRHA 2PK9A 2Q83A 3GB2A 4FL1A 3HZTA 3CTHA 3CJGA 3EYHA 3IKAA 1XKKA 3DT1A 3FZTA 2BROA 4MF1A 3QHRA 2G2HA 1SMHA 2IO6A 2Y7JA 3UNJA 3ZU7A 4BCNA 3RZFA 2E9OA 2YZLA 4EUUA 1PXMA 1DI8A 1GAGA 1Y6BA 4C33A 4Z55A 3HUCA 3UOHA 3ZDUA 3GCPA 2XBAA 4DGMA 3P5JC 3CD3A 2C6KA 4MF0A 4BZOA 4D2PA 4QTCA 4O84A 1SNXA 1L3RE 4RIYA 4E6CA 1Q3WA 1Q99A 1H4LA 2GFCA 2O2UA 2QD9A 4GT4A 4IADA 4BCQA 3JPVA 3OXZA 4GIHA 4KS8A 3HMPA 3VBWA 1BI8A 4PY1A 1H1PA 3KK9A 4EHEA 3UDTA 2Z7SA 1R0PA 4IZ5A 1B6CB 3UE4A 3TNPC 1EH4A 3A2CA 3OS3A 3QD3A 4A07A 2C1BA 4GJ3A 2XCHA 4GG5A 3G9NA 3C4FA 5IQDA 4ZJIA 2V22A 4JBVA 2W5HA 2WMRA 3FHIA 2VWYA 4CRLA 1BUHA 4WNMA 3MH1A 5CAUA 4FVQA 3D5VA 4AA4A 5FD2A 3PUPA 5GIOE 4XG2A 5KMOA 2CKQA 5CI7A 5E92A 2X7FA 4MCVA 4WSYA 5T3QA 3SC1A 2BRGA 2CCIA 4MNFA 1MUOA 2B1PA 4O0UA 3UVQA 4S2ZA 1JLUE 5CTPA 2QU5A 4XP2A 5EOBA 4EOKA 4QDEA 4GK4A 4CMOA 3R22A 3I81A 3LCKA 2VWBA 5D10A 2BKZA 5KKRB 2BIYA 1YWRA 3MJ2A 2W1EA 2ITQA 4UXLA 5M4UA 3FI8A 4M14A 2AUHA 4UXQA 3PPZA 4QP4A 4D9UA 5E8WA 2VX1A 4IX4A 4OUCA 4DC2A 4BCOA 1IA9A 1UV5A 1YOLA 1W84A 3PJCA 3MYGA 4JT3A 5KMKA 3DV3A 4KSQA 4PL4A 4C2VA 2OH0E 3WF9A 1M52A 3I4BA 4AF3A 3D5XA 4R3CA 2J5EA 3FLQA 4Y46A 1YQJA 1BI7A 1A48A 4LYNA 5A4LA 4RJ4A 2ITPA 1Y8GA 3OD6X 4FKTA 3C4ZA 4DE4A 4WRGA 2YM7A 3C50A 4R5YA 2R2PA 2PZPA 3SW7A 4G6NA 3ZLSA 4LMNA 3I6WA 3F2AA 3FKNA 4YSMA 3RAWA 5DBXA 5CVGA 3ZH8A 2XM9A 4EK6A 5BUIA 4ZJJA 4CLJA 1UNGA 4DHZA 2JDOA 3D9VA 5CYIA 2OBJA 1PXLA 2WELA 3IOPA 4G1WA 2YZAA 1XH9A 2BAKA 3DBQA 4JAIA 3DXPA 1DS5A 3QQHA 3UOJA 2GU8A 4QMWA 3KULB 4LMUA 3VQHA 4DEDA 2X2LA 3ZM4A 3I79A 5L3AA 2FSLX 5KMIA 3HDNA 2C4GA 2ETRA 1DAYA 2RG5A 5FP5A 5HICA 4FNZA 2VTQA 4KBCA 3ZXTA 4BCPA 2QG5A 5HG7A 4RZVA 4E6QA 1LEZA 3GQLA 4BBEA 4BJJA 3ML1A 1R39A 4OAVB 5CWZA 4BB4A 4EUTA 4NU1A 2RGPA 2X2KA 4RIWB 1YOJA 4X3JA 5IKWA 3EIDA 4BDEA 4BWXA 5HVJA 3KA0A 3VVHA 2XMYA 3BL9A 4P7EA 3HKOA 4ANOA 5K4JA 2VWVA 3LCTA 4AAYA 4YHFA 3V5QA 4MYGA 4UN0C 1UNLA 4DT9A 5IQFA 4BGGA 4BGQA 2EB2A 3DK3A 2QNJA 3BYUA 5IPJA 4CVAA 3F7WA 3KB7A 4TXCA 3AKLA 3R9RA 1FGIA 5BYYA 5ACKA 5CEKA 1GNGA 3RBWA 5CNOA 3IDBA 2ZMDA 3PSBA 4EH5A 5DEYA 4V04A 3N51A 4AACA 4H05A 4ZLOA 5CANA 4I4EA 2R3GA 3CPBA 1W8CA 4FG9A 2PMIA 2C5OA 3UIMA 2PVMA 4FIJA 4JX7A 4XCUA 4B7TA 4IVDA 4E5WA 2VGOA 4ACGA 3LMHA 3TG1A 2CDZA 3DY7A 1YXXA 2YERA 3NIEA 4HVSA 3AT3A 3QLGA 3WE4A 4RPVA 5A46A 4LV5A 2WAJA 3QUEA 2WTKC 4ZTLA 4C37A 1J1CA 3HV5A 3H30A 4FODA 2OWBA 2J0LA 4ACMA 4G6LA 4EK4A 3C4EA 4O4BB 2W7XA 2QOCA 3F7ZA 4OTWA 4XG4A 5HE0A 4CV9A 5E91A 3VN9A 2JC6A 1JKLA 1YI3A 4MHAA 4NEUA 3ATTA 2ZMCA 2ITNA 3I1AA 4FF8A 2LGCA 4FL3A 1FMOE 2WQBA 1Q4LA 3RM6A 2P4IA 4UYAA 3DS6A 1XBCA 2WMTA 4G34A 4DHJA 1PMEA 2PZIA 3QGWA 3R2YA 5AR2A 4APCA 2OF4A 5JFVA 4AQCA 4BDBA 3W0OA 4YR8A 1OKYA 2ERZE 4FV2A 3POOA 2R3MA 4V01A 3EL8A 1BKXA 1MRYA 3OFMA 3PZHA 3TDVA 4F9YA 3H9FA 4GK3A 4TWPA 5J79A 1O9UA 5LVNA 1G5SA 3PSCA 1M17A 4ZTHA 3GVUA 3QD4A 4MKCA 5IH5A 4FTAA 4DTKA 3BWJA 4PDPA 3CKXA 3CR0A 3P78A 3KIOC 5IQAA 4L68A 2XS0A 4FSZA 3W55A 4XP0A 4QYGA 2CPKE 5JT2A 4RVLA 4BHZA 2IF8A 4IVCA 3AMBA 4YP8A 3EHAA 3S95A 5HBJA 3T9TA 3O51A 3U51A 4NIFB 3HDMA 4X7QA 1L8TA 4AOIA 3UIUA 3VO3A 4GVAA 3TWJA 4C4EA 3ANRA 4EH2A 4K2RA 4FJVA 4M0YA 4JL9A 3BRBA 5ETCA 5CVFA 4EHZA 3FLNC 2BHHA 1YHWA 2J51A 3EQPA 1CKJA 3KF7A 1ZRZA 3R9DA 4S31A 4HYIA 4FKWA 1R78A 2GNLA 4EJNA 3BV2A 1TVOA 4XYFA 3PLAE 4O0WA 3F3TA 3ENMA 3QRTA 1URCA 3QTSA 4AX8A 5AUUA 1RJBA 4JX3A 4PMTA 4QYHA 4ZY6A 3GU6A 3I6UA 4X3FC 2XAOA 3Q4TA 5IUIA 1ZZLA 2GHMA 4HZRA 1JOWB 4GMYA 2UUEA 5FM3A 3PXQA 3FV8A 4TWCA 3TMOA 4E73A 3OC1A 4GYGA 2OJIA 3CD8A 3E8NA 4MH7A 3QA0A 5DHJA 4KUJA 1U54B 1QMZA 2X4ZA 4FTCA 5AX3A 4O0VA 3KMUA 1WBNA 4FSRA 4Y95A 4CZYB 4I4FA 2BKKA 2ITTA 3Q53A 5BYLA 3AMYA 1U4DA 3VC4A 2P2IA 3LMIA 4YO6A 4YJNA 4BCJA 3T3VA 3BLRA 3CC6A 3UVPA 1ZYLA 4F65A 2WXVA 2I0VA 2X0GA 3A7JA 3BHYA 3LXPA 3ORXA 3M1SA 4Q5EA 1YRPA 4TNDA 4O27B 5EK7A 2IEWA 5GHVA 1VLRA 3TIZA 3OBJA 1OKZA 2OU7A 2P3GX 1QCFA 1Z9XA 4FZ6A 2GS2A 4G2FA 3QX4A 4C4HA 4YTHA 3LZBA 5HZNA 1OVEA 1VZOA 2XNOA 1W2DA 4O4CA 3ZO2A 5CT0A 3E8DA 2PYWA 1OM1A 3AQVA 4QQ5A 2IVUA 3PVBA 1Q8TA 1H1QA 3FY2A 3KREA 4X2FA 4YJTA 3LFFA 2VV9A 2YIRA 3BE9A 5F1ZA 3KN6A 4GH2A 4PQNA 3DU8A 4DH3A 4XV3A 2GFSA 3IG7A 4CQGA 4PPBA 3LW0A 4C57A 1IRKA 3ORMA 4BDGA 3DNDA 2IWIA 4RWIA 4RBLA 4BTJA 4D2WA 2OG8A 3P7CA 1KSWA 1PXPA 3RTPA 3VS6A 2HIWA 1GIIA 2XKDA 4X3FA 4XRJA 2QKWB 5J7HA 2BUJA 4GU6A 4W4XA 2OZAB 2YIXA 3Q04A 4KS7A 4NCTC 4EC8A 4FK6A 5E4HA 5C01A 3EN9A 1YXUA 4JXFA 2ERKA 4J53A 1ATPE 1H1SA 2OXDA 2P33A 4QTAA 2X8IA 4UWCA 5A4CA 3C5IA 1QPCA 2GDOA 4ZZOA 4PL5A 4RG0A 5D9HA 3G15A 1TQPA 2C6LA 2C47A 4O0YA 1Q8YA 5AV2A 2UW7A 4N6YA 4HZSA 4YZNA 4ZTSA 1B39A 3LQ3A 5E7RA 3CKWA 4QP1A 3UBDA 2UVXA 5CX9A 4HVHA 4RX9A 5L2TA 2H8HA 4FKSA 4F9WA 4DTAA 3GUBA 4EOQA 2I0HA 4RQVA 5DR2A 5AUYA 3MVJA 4I6FA 4BDKA 2ZB0A 4U44A 4FEWA 5I9XA 2EU9A 4ALWA 3II5A 4C8BA 2EUFB 4F7JA 3EN6A 1PXOA 4O0RA 5AA8A 4EBVA 2O63A 1XH6A 4AGWA 3PZEA 4V05A 2GQSA 3R1QA 3VAPA 4U8ZA 2R3PA 5G6VA 5M57A 4YZMA 4IAYA 4QMLA 4FKGA 1H01A 5L6PA 2V7OA 3VONA 4DG3E 3UJGA 2FUMA 4QNAA 4J96A 4YZ9A 4PDSA 5EHLA 5M44A 4CTCA 2ZM3A 5GINE 1NVSA 4LUEA 3ZUVA 3P5KA 4ZSAA 4M84A 2WTDA 5FEDA 4B4LA 2O8YA 4YO4A 3GC9A 4O21A 3V5TA 5GZ8A 2W1FA 4DDGA 5EI2A 3QUDA 2ZYBA 4FTRA 1RE8A 1QPEA 3H9RA 3K3JA 4X2JA 4EH4A 1CTPE 3RPSA 4BYIA 4OAUC 1E1VA 2UW4A 4GJ2A 3ITZA 2QO9A 3UNKA 2VTJA 3R1YA 4XMOA 2C6TA 4DFXE 2GPHA 3NEWA 3OY1A 4FIEA 3VUMA 2VAGA 5JQ8A 4B9DA 4NCTA 3FQEA 2IVVA 2FB8A 2B9IA 3ZO4A 3B8RA 2HZIA 5JKGA 2HZNA 4F64A 3QQJA 1UU7A 2F7ZE 5KKRC 3FMLA 5AX9A 2YN8A 3AC4A 3O8PA 3V6RA 1I44A 1P4FA 5K5XA 4PL3A 2IZTA 3MW1A 3LXKA 1LR4A 3UGCA 4M0ZA 3QF9A 3V5PA 5KHWA 1KE8A 5H3QA 5EH0A 3FAAA 3D14A 2UW5A 4WIHA 5EM5A 5T6KA 5JFWA 2J50A 3BCEA 4HVIA 3PWYA 2QOOA 2AC5A 3O96A 4I0RA 4PV0A 4WKQA 1J7IA 3FLYA 2J6MA 5K9IA 2WMXA 1OPJA 4RIOA 4C2WA 1OPKA 5EKNA 1B38A 1U5RA 3KK8A 4C34A 4GK2A 4Y5HA 5FRIA 4HVGA 5JFXA 5HD4A 4QMXA 3A99A 2WNTA 3MTLA 3CY2A 2XKCA 1APME 1OUYA 3COIA 3NIZA 4FKUA 3DKGA 1ZOEA 4PTCA 4RWJA 3KRJA 4RJ6A 4YUQA 5CU3A 1UKHA 5EFQA 4A9YA 3ULZA 1ZYCA 1MRUA 3WOWA 2WU6A 3Q60A 5E9EA 3PA5A 3ZS5A 3QAME 2OICA 2QR8A 3NW7A 4FKVA 3PY0A 3BLAA 4KIQA 3FKOA 4CTBA 4UWYA 4BF2A 4L44A 4OW8A 4BDCA 4EYJA 2IG7A 3QQUA 3SG9A 4V0GA 3UVRA 1QPDA 3R01A 4G5JA 4TZRA 4U7ZA 2H96A 4YZBA 3PE2A 3CY3A 3BGPA 3HP2A 4F6UA 3UDSA 3QQFA 2EXMA 3MESA 4EQUA 3GU5A 2VX0A 3IQ7A 1PY5A 1U59A 5C1QB 3EOCA 1YW2A 4APPA 5IF1A 2X8EA 3R6XA 1JSVA 1J91A 3ERKA 2QURA 2W1IA 4FZ7A 1CDKA 5IQEA 4QMSA 3M11A 4XOZA 2OIBA 2ZDTA 4KRCA 4KIPA 4QP7A 5EM8A 3RK5A 3AT2A 3DB6A 3TCPA 4D2TA 3O5AA 2XIYA 3BBTB 2OFVA 2QOLA 4QYEA 3COMA 3W33A 1ZY5A 3MB7A 4JMQA 3QTWA 5AUXA 3ZLXA 4DLIA 4C35A 3RINA 3L9MA 4I23A 1OIQA 2W4OA 4R6VA 2PU8A 2JGZA 4R7IA 3NNUA 3A60A 3ORLA 5E1EA 4C3PA 3V8TA 2PVFA 3MFUA 2WKMA 3OTUA 3ZO1A 2VTTA 4YPDA 4OTFA 3L9LA 4WT6A 5CU4A 1DI9A 3K5UA 1SM2A 2H6DA 1ZXEA 3I7BA 5A4EA 2F9GA 4ZLYA 1XBBA 3RZBA 3TKIA 3HX4A 4CSVA 4CV8A 2Q0NA 3BKBA 1NW1A 3BV3A 4D2VA 3NVMB 3PJ3A 3KULA 3TZ8A 5BVOA 3JS2A 4I0TA 4IE9A 4EQCA 4AFEA 1UU9A 3EQCA 3AD5A 2BIKB 5AP7A 3TV7A 4AXEA 3DZQA 2V0DA 4FYNA 2BTRA 4IB5A 4YJOA 1PRYA 5BNJA 3VHEA 1PMNA 2OH4A 5I9ZA 3VRZA 4AZFA 4BKJA 4ITHA 4L46A 2GNFA 1OGYA 3GU7A 5BUJA 4M12A 2Y4IB 4J8MA 1YWNA 2ZV7A 4BBFA 3C0HA 5FGKA 1J3HA 3TL8A 2B0QA 3F82A 3JVSA 4DFLA 2UZDA 5JRSA 3DAKA 3FI2A 3QWJA 5I5ZA 5AWMA 1Q8WA 4EH3A 1HOWA 2VTNA 3P08A 3SKCA 1GIHA 3QFVA 5F9EA 4KIKB 5J87A 1GY3A 4LGDA 3W18A 4F0IA 1CKIA 3FL5A 4XV2A 4O4FA 5FG8A 3G90X 4ZTNA 1H08A 4NYEA 2EXEA 4F6WA 3S00A 4Z7GA 3KRRA 2XIKA 3VUTA 1OMWA 2ZM1A 3VS4A 3MB6A 3SHEA 5AP4A 5CENA 3EN7A 5J5TA 3QBNA 3OCSA 3UO5A 3ACKA 5HG5A 3DBFA 3KXNA 4KA3A 5KE0A 5TR6A 1FMKA 3TIYA 2BAJA