5CT7A

Braf in complex with raf265
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
273
structure length
257
Chain Sequence
DWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHIIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLAGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLFPQILASIELLARSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Serine/threonine-protein kinase B-raf
publication title Discovery of RAF265: A Potent mut-B-RAF Inhibitor for the Treatment of Metastatic Melanoma.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 78
structure length 257
sequence length 273
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2015-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5ct7A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5ct7A01
4ZTQA 4GL9A 3ZO4A 5BPYA 3UQCA 1CKPA 3FL5A 4OTGA 5CU4A 3R8PA 2OLCA 3LHJA 3E3BX 3MTFA 4EL9A 4M12A 3U55A 4GVJA 3P4KA 3FPQA 2OIBA 2PZPA 2V7OA 5C8MA 4BDAA 3O7LB 1Q41A 4I92A 2WU6A 4USDA 5C27A 2WAJA 4RX7A 4C62A 3ZU7A 3RHKA 1ZMVA 3NEWA 5T3QA 2DQ7X 5DR6A 5C03A 3QTWA 3ZLXA 4CKJA 2B54A 4AG8A 3WI6A 5GINE 3MA3A 3AQVA 3BV2A 5H8GA 3U8WA 3MESA 2IWIA 3HVCA 4FTIA 5E8TA 4DFYA 4R6VA 2PY3A 2GU8A 5CTPA 3UG1A 4FUXA 2C4GA 4JXFA 3ULZA 1YDTE 4FTLA 4PL3A 3C4WA 5EM8A 4M97A 3G51A 1JAMA 5CS6A 4YZNA 3DB6A 4FICA 4LOPA 1FVRA 2ITTA 5FD2A 3ZHPC 2OJJA 1O6YA 4MD9E 5EW8A 4BI1A 4EBWA 4DEAA 5BVNA 4XNEA 2QG7A 4K6ZA 4O84A 4E4XA 1NVSA 3FZSA 2X9EA 4GW8A 4RLLA 4GG5A 4AGDA 4H36A 4PPBA 5HX8A 3KU2A 4Q9SA 1PHKA 3KFAA 3VHKA 1NT2A 1XBCA 2PMNX 4F9CA 3NGAA 3UP7A 4AGCA 2WXVA 3MJ1A 4AT5A 4KIKB 3R0TA 1MQ4A 1WBTA 3M1SA 4MBIA 3GB2A 5DI1A 4X21A 1MRVA 2VTHA 2PE2A 3CD8A 3D0EA 4AX8A 4RJ6A 3CD3A 5L8JA 2IVUA 4QTDA 4FYOA 4NKSA 2QU5A 3U9CA 4BTKA 3FC1X 3LFAA 3GUBA 4V04A 3NUPA 3K5VA 4K77A 4ALWA 5EQEA 4DBXA 1OIUA 2C1BA 2GNIA 4PP9A 5EH0A 4BGGA 2G9XA 4ANBA 1SVGA 1J7LA 2YJRA 3QZFA 4ZZNA 2IZTA 3SLSA 4UMPA 2QI8A 5IA3A 3RP9A 3KRXA 3FI3A 3IS5A 1H4LA 2ONLA 3BHYA 5AR5A 2YM6A 3V8SA 3FQSA 3D83A 3I81A 3ACKA 1NVRA 2IO6A 4FX3A 3JY0A 1ZMUA 4C4GA 2BIYA 4FMQA 4IAYA 4JAIA 4BCJA 4CFFA 5CEPA 2QNJA 4ZZOA 1H1SA 2B52A 4DE4A 3UVQA 2IVSA 1H26A 2XK3A 3L8PA 4U80A 3VS6A 2H96A 3CQUA 4LQMA 4MTAA 2Y4PA 4WSQA 3C50A 4HCVA 4HW7A 3JR1A 3RAHA 4MYGA 2ZYBA 5DE2A 4JX7A 4GJ3A 1J7IA 5EQPA 4HYHA 4RRVA 4QMWA 3EMGA 3QGYA 4CSVA 3GT8A 3MA6A 1DAWA 4K11A 4XRLA 3W55A 4XP3A 3NNWA 4EONA 2PZ5A 3PA5A 5ANOA 4E73A 3RPRA 2ZM1A 4EK8A 4DG2E 3W2SA 4JRVA 5KHWA 5IG1A 3OEZA 4PTCA 5I5ZA 3BE9A 5DT0A 4BY9E 4RQKA 3V51A 3C4XA 4HPUE 3OBGA 4FIIA 3C0IA 4XJ0A 1PMNA 3VBWA 5IZFA 3W8LA 2ZV2A 4O7ZA 2CLQA 4XLVA 3WZJA 5CI6A 1GNGA 3LPBA 3E63A 4K18A 2HY0A 3BWFA 4PPAA 4A06A 1E1VA 2OJ9A 4C4EA 2IW6A 5K9IA 4AWIA 3QCSA 4PP7A 4ORKA 3QC9A 2OF4A 2CNVA 5LVPA 3BYVA 1YWNA 3W2RA 2ZVAA 5DIAA 4XP2A 4U3YA 1H07A 2JD5A 5A3XA 5JSMA 1Q8ZA 2R3PA 2Z60A 1MUOA 4GT5A 2QOKA 5TF9A 4EK3A 3NRMA 2V5QA 5E9EA 4EH4A 5DN3A 2AYPA 4CYJA 2J7TA 5AMNA 2BTRA 5J9ZA 3KXZA 3MYGA 3DU8A 5DHJA 4CCBA 4WBBB 2YZAA 5IDNA 3CGOA 4L6QA 3EL8A 3AMAA 5AR2A 5H2UA 4EC8A 1OKVA 4GKIA 3PSBA 2A1AB 3BZ3A 2YISA 3HZTA 2Y7JA 4ZMFA 4M69B 4ZSGA 5ANJA 2UW8A 4FTJA 1F0QA 4IFGA 1YOLA 3RKBA 4X2FA 4KNBA 3UVPA 3G15A 4CKRA 5J7HA 3DS6A 3EOCA 1M17A 4KS8A 2VV9A 4MXZA 3R28A 1U46A 3SXFA 3DGKA 3MY5A 3A7JA 2XNPA 2BRBA 5E8SA 4U6RA 3I5NA 1UVRA 5AUVA 3LXNA 4MWIA 4FKTA 5GJGA 4HGEA 2XBJA 3QA0A 4ALUA 1OL7A 4FEVA 2VTLA 4IZYA 3FHIA 3I0OA 3WE4A 2HELA 2O64A 5CAUA 4GIIA 5CU6A 3UYTA 2QQ7A 2XH5A 2HXLA 1XH9A 2W06A 3E5AA 2BMCA 4PTGA 4QMPA 2OIQA 3F61A 3MH0A 3QFVA 5DRBA 4C4IA 3FSKA 4IW0A 5IH6A 4QMOA 4TWOA 3KN5A 5HIBA 2XJ0A 5EYKA 4FE2A 3PY3A 3NUXA 2CGXA 4G31A 3RAIA 3Q53A 2UW0A 2GDOA 2CKOA 2XUUA 4KD1A 5EYMA 4CNHA 1Q8WA 2IZRA 2OO8X 1WFCA 3A2CA 5D10A 4ZEGA 4RWKA 3W16A 4DGMA 3UO5A 4UMUA 3WIKA 2YHVA 3CKWA 5CT0A 2XEYA 5IEYA 4D0XA 4BIBA 4BL1A 5G1XA 4IVBA 5IQDA 4BRXA 4CV9A 1O6KA 4FEUA 4E6DA 3O7LD 1JOWB 3VRYA 2VWUA 3LOKA 4I5MA 3RHXA 3R7UA 4DFXE 4TT7A 3E8EA 5AWMA 2O8YA 3FMHA 4EWQA 1W7HA 2YIWA 2R3NA 4FIEA 4V0GB 3PRIA 2IJMA 4X7QA 4L00A 4XBRA 3OD6X 5DRDA 3R83A 4X2JA 2HYYA 3ALOA 2G01A 1WCCA 4TYGA 1ZZLA 2WIHA 1RW8A 2W1CA 3R8VA 4F9WA 4CT1A 4QTCA 4QYGA 4YSMA 3UYSA 4CRLA 4Y5QA 2EXMA 1DS5A 2X7FA 3HMPA 3IOPA 4RG0A 5CAVA 2B9IA 3GC8A 2XNEA 1V0PA 3IGGA 5CEIA 2VTPA 4F0IA 3OXTA 5AAFA 2HXQA 4IB5A 3GC0A 4EQUA 5C8NA 5I9WA 3ORIA 1H24A 3H9OA 4RIYA 3UODA 3LM5A 1VZOA 3QKKA 3F82A 4JDIA 3DJ5A 3CIKA 3IW5A 4DG0E 1Y57A 2QCSA 2UVYA 1WBOA 5D7VA 1OKYA 3GBZA 4AZFA 5M4IA 3R2BA 2WTWA 3ORPA 3DAEA 3WF5A 1Q99A 2P2HA 3AC1A 4FNXA 2QO7A 3NW7A 5AUWA 4RBLA 3KMWA 3DK6A 3D2KA 3R9DA 4F09A 1G8SA 4EOSA 4RX9A 3R1SA 4DLIA 3TNWA 3NUSA 1M2RA 5KNJA 4CMOA 1ZAOA 5IUGA 3KF4A 2GTMA 3C4ZA 3AT3A 2BROA 3PG3A 4H39A 3FSFA 2GQGA 1YXUA 3WOWA 4OAUC 5M09A 4NEUA 2V62A 1KOAA 3UNZA 3P86A 5IISA 4YC6A 4MXOA 3ZEPA 3GU4A 4BCIA 4PMPA 3PDTA 2C6MA 1ZOEA 4C61A 4DEDA 2CN5A 4E7WA 3K3IA 4FT7A 4I21A 2XK9A 3OY3A 4I23A 1YI6A 2GQRA 2A0CX 3QQKA 4ANLA 5HQ0A 5I4NA 3BU3A 1Q8TA 2CGWA 5DNRA 3RINA 2XIKA 2W1HA 2YN8A 5CAQA 4UXLA 2XBAA 3LCTA 2NPQA 3EQHA 4FTKA 5KMKA 3UQFA 2I7QA 4DITA 2ITNA 2JFLA 2ZV8A 4FT5A 5A6OA 2UZWE 1BYGA 2Q0NA 3KK8A 4O1PA 3Q2JA 4J53A 4W4XA 3TDVA 2VTOA 4J8NA 2UW3A 4XV3A 4CTBA 4GEOA 3HV6A 1IEPA 4QP6A 4WUAA 2JBOA 2PTKA 5FEEA 3UMXA 5AEPA 5FRIA 3OUNB 3QHWA 4MEDA 1UV5A 3KREA 1KE9A 2QO9A 3KQ7A 3FLNC 3LMIA 5EQYA 2YCSA 4IC7A 1YDSE 3QQGA 3G6HA 2XF0A 2VO3A 3NX8A 4QMLA 2EVAA 2ITUA 2W96B 4JDKA 3S0OA 3ORXA 1B6CB 3WBLA 3EFWA 4ZJJA 4MNEB 2C6TA 5ETAA 5FG8A 3V5JA 1OB3A 3I7CA 3V5LA 5AP1A 3BEAA 5CVFA 3UG2A 4EUUA 2NO3A 4ALVA 4BI0A 2IN6A 3O8TA 3D94A 4J98A 2GS2A 4FKUA 5AP3A 2IW9A 5HIEA 2NNWB 5EFQA 4YZ9A 4F63A 4YJOA 4ENXA 5IA0A 4BCKA 5JZNA 5LWNA 3BU6A 4PL5A 5ANKA 4KSQA 5EW3A 1AQ1A 3FMJA 3P78A 3QALE 2V7AA 2PVMA 2VWVA 3QTUA 4TRLA 2IW8A 4BDCA 4H58A 2DS1A 5AV3A 5TT7A 3RZFA 4DTKA 1YWRA 5DA3A 1U59A 4UWCA 4XG2A 2BHHA 5A14A 2HZIA 2W1IA 3DBEA 2BZJA 3FBVA 4G6LA 4FIHA 3QZIA 4MBLA 4CFXA 4DEIA 4LRKA 3UPZA 4YO4A 1E1XA 4FV5A 2HW7A 1H08A 3LLAA 3HV3A 2E2BA 3MS9A 3VIDA 3EH9A 2ITWA 2JIIA 3MV5A 4LRMA 4EKKA 3D7ZA 3DBDA 4YZBA 4BYIA 3BYSA 3UC3A 2JKOA 4NU1A 1TQPA 2JKMA 2CJMA 3ODZX 4GU6A 1MP8A 4OBQA 1GIJA 4HNFA 1DM2A 2G15A 3UIUA 2H6DA 3GXLA 5CZHA 5CVGA 2C68A 3LW0A 1OL2A 4QOXA 5HNBA 4OTDA 4FZ7A 4GFGA 4BYJA 3CGFA 4UB7A 2VNYA 2Z7LA 5B7VA 4EH2A 3DXPA 3BEGA 1J7UA 4UV0A 4FKQA 1Q3DA 4EK6A 5LVMA 5B0XA 1KE6A 3SHEA 5I9XA 5J79A 4JDJA 3LQ3A 1A9UA 3SAYA 4BCFA 3WF8A 3LFCA 2NRUA 3EWHA 1NVQA 3FMLA 3OC1A 4D5KA 5LWMA 5E8WA 1FOTA 3BRBA 1ZWSA 1JQHA 2ZJWA 1B38A 3ANQA 3F5UA 3VF9A 4AE9A 3KMUA 4E4MA 5HORA 4HPTE 2UZEA 5CAOA 2PVFA 1ZZ2A 1WVWA 3NUYA 3QU0A 3BQCA 2O0UA 4RWJA 5CSHA 4AFJA 4FSRA 2H8HA 3D5WA 3BYMA 3ZO1A 3ZXTA 3DNDA 4NKAA 3UVRA 2WTVA 3JVRA 5EI8A 4ZJVA 4G3EA 3A7FA 4Z7HA 2XMYA 4DAWA 2VUWA 2C0OA 3GGFA 3FY2A 5B2LA 3GENA 4WG5A 5LCJA 3Q9XA 3RM7A 5HGIA 4I0TA 4O7VA 3HMMA 3ZBFA 3NCZA 2ZDUA 1U54A 4GUBA 4C38A 2OICA 5ACBC 2C6OA 4LV8A 2X4FA 5HE1A 4WNMA 2PPQA 4M14A 4AA5A 4M15A 2VTAA 4BDBA 4PRJA 1OUKA 3GC9A 4XHKB 4MHAA 2C3JA 2QD9A 5A4EA 5HU9A 3A8WA 5LVLA 4EYMA 4O7SA 4WOVA 3MBLA 4PUZA 3QCQA 2OF2A 2UVXA 2RIOA 1GZOA 2R9SA 3M11A 3H4JA 3O50A 3QC4A 3TUBA 2CCHA 4QNAA 4I20A 1XBAA 5JQ8A 4MH7A 4JOAA 2W1FA 4BC6A 4G9RA 3GU6A 2QC6A 3LJ0A 4L53A 3UMWA 5HLNA 1A48A 1OIQA 3ZEWA 1OPKA 1PW2A 5BUIA 5F4NA 3DV3A 4FG9A 3P5KA 2QOLA 3DNEA 3TN8A 5ICPA 4BR3A 2CNQA 3C51A 4XEYA 2QURA 2W9FB 4F64A 5KMLA 4FTUA 4RGJA 3UQGA 4ZOGA 4ZJIA 3MDYA 4OAVB 2XEZA 1PXOA 3G9NA 3W2QA 4RFZA 1CKIA 2OI4X 2V22A 3R8LA 4GV1A 4EORA 4YU2A 2QOOA 2P2IA 3BWJA 3ELJA 5DEWA 3ZFMA 4BHNA 3LXLA 4C3PA 4E20A 4S34A 3GCVA 3EQFA 4C4JA 3L9PA 3D15A 3JUHA 5EHYA 4WA9A 1S9JA 3TV4A 4ZS0A 3E3PA 4RIYB 2UW6A 1JWHA 4XV9A 4WRGA 2EB3A 4BGQA 3SRVB 2YCRA 3UE4A 4ANQA 3BLRA 4CFMA 4QTEA 2PUPA 3R9HA 3ETAA 4QP2A 5EYDA 4J8MA 2PWLA 3S95A 1F5QA 3EJ1A 3U4WA 3NUNA 3NAXA 3E8DA 5FDXA 4DINA 1OIYA 4BFMA 4EK5A 3I7BA 3BLQA 5A6NA 4PTEA 2OXXA 2VTMA 3MH3A 1H01A 4ITIA 5AUTA 1L3RE 2X7OA 4FSYA 4Y73A 4M13A 5H9BA 2VX3A 4ZSJA 4CTCA 1PMVA 1ZARA 4DFZE 4I93A 3ZO2A 3VBVA 1PY5A 3HLLA 5CU0A 1U5QA 4A9YA 3QRUA 3VBYA 2UZBA 2JDRA 4I5PA 2BHEA 1ZXEA 2OG8A 3RGFA 3AGLA 1YOJA 3EFJA 1J3HA 1OITA 4BKJA 2Y6MA 1J91A 5CXHA 1H1WA 5GJDA 5CT7A 5J1VA 2QU6A 1PXNA 3PY1A 3R7GA 2YCFA 3COIA 3WARA 3ZMMA 2UW4A 3DK7A 4R3PA 1NA7A 4L7FA 3Q96A 4UMRA 2O5KA 3QTXA 4QTAA 2A2AA 3PIZA 3LMGA 3KF7A 4ACHA 4W8DA 2YDJA 2UZLA 2XKEA 3V3VA 4FV9A 3ZCLA 2XYUA 2X9FA 3LCSA 4F1TA 4AW5A 1HCLA 4FSUA 3MH1A 4UALA 4UY9A 2BZHB 5HG5A 2ETMA 2QR8A 3I0QA 2X8EA 3VAPA 4XOYA 5IU2A 3HUCA 4AP7A 1YXVA 2W17A 3LCKA 3F2NA 3Q9YA 4FI1A 5HCZA 3VHEA 1SM2A 5AP0A 1ERKA 3Q9ZA 3OMVA 1G3NA 2QLQA 5EG3A 4FKWA 3VW6A 4D1XA 4LL0A 2C5VA 4OTWA 4E8AA 2CLXA 4IVAA 2WMSA 4FTAA 3EN5A 4MQ2A 1YXTA 4NM0A 3PZEA 2YIRA 4FTOA 4QMTA 3KXNA 4FEXA 4H3BA 4F6UA 4EI4A 2VAGA 5AUXA 3GFEA 3N4TA 3CCNA 3QTZA 5EOBA 2PUIA 3HA8A 3NNVA 3MB7A 2B55A 5E8UA 1W0XC 4ZTRA 5EW9A 4NH1A 2E9VA 3G5DA 2GPHA 2BAQA 2GNHA 3NYXA 5LJJA 4G16A 2QHNA 1OBGA 3OG7A 2CPKE 4NW5A 3ZLYA 4LM5A 4UZDA 4IZ5A 4USFA 5KX8A 2Z2WA 3KRWA 3PE2A 5BVKA 3TKHA 4DF3A 5IQGA 4QT1A 3NNUA 4M66A 3ZZWA 5HLWA 5HU3A 4FTNA 2UW9A 2XCHA 1JPAA 3K54A 3L9NA 4WNOA 3FE3A 4MD8E 1T46A 5AM7A 5JGAA 5ANGA 3DKGA 4YJRA 3TNHA 2FSOX 4EQCA 3A61A 4OLIA 2YAKA 2WMWA 3A62A 1OL6A 4NW6A 4LOOA 2GFCA 2VTRA 4ACGA 5JQ5A 2PHKA 4DG3E 5HBJA 2BCJA 3SGCA 2Y8OA 4GH2A 3C5IA 1XH7A 3L8SA 3D2IA 3KMMA 2YABA 5ACKA 4UEUA 5HNIX 2YIXA 4F9BA 5M57A 1SVEA 4IM3A 3FUPA 4IANA 4L43A 3RPYA 4YBJA 2GNGA 3P79A 2WEVA 4RMZA 3RWPA 5CSVA 2C5XA 2Y0AA 3SG9A 4A9UA 4JQ8A 2PUUA 4FKJA 4RC2A 4TN6A 4XG6A 1REKA 1UU3A 2W0JA 4C33A 4MAOA 2OZOA 2YACA 5E7RA 3C13A 4OBPA 2WTCA 4KBCA 3DDQA 3C0GA 4S33A 4BTMA 5BMMA 2UZOA 3JVSA 3N4UA 5J9LA 4P5QA 4ERKA 4MXCA 3HX4A 5EDRA 5FUTA 4EEVA 4WNKA 1VR2A 1WBSA 2HW6A 4HYUA 4N6ZA 2BRMA 3BBTB 3IO7A 3DCVA 4ZXTA 4I24A 3RI1A 5C1QB 4ZLYA 1PXIA 2JBPA 3OBJA 4AW0A 1JKSA 3LJ1A 3UOLA 4CFNA 1W83A 5EKOA 4ZSLA 2GNLA 5HD7A 3QCYA 3NSZA 4AA0A 4GT3A 3BPRA 3ERKA 3QWKA 4FOBA 2IPXA 4LI5A 2XK7A 3LVPA 5AP5A 2JEDA 3TZ7A 2XK8A 3O17A 3UP2A 5DFPA 1CKJA 3ZSGA 2WOUA 1FVTA 3VO3A 4A9RA 4CZTA 3HEGA 3D9VA 1QPCA 1U54B 4UWBA 1XO2B 5H3QA 3NIEA 4NUSA 3DAJA 2R3JA 4KINA 1K3AA 2PSQA 3CTJA 3IPHA 4BTFA 3E7VA 2X4ZA 3LJ2A 4CFUA 3NYVA 3DAKA 1YXXA 4XS2A 5D9HA 1QMZA 2CKQA 4WUNA 3ORLA 3FJQE 2PUNA 4ITJA 3VQHA 5KBQA 2ITQA 2R3QA 4CT2A 5I3OA 3R9OA 4RLKA 3R21A 1FINA 2I0YA 4JG6A 3DZQA 5BVEA 2XK6A 4BZNA 5LOHA 4R78A 2X8IA 4MXYA 4V01A 4OT5A 4IIRA 3QXPA 3PVWA 4R5SA 5BYYA 3TKIA 3ID6C 4UYAA 3Q52A 3MFRA 1MRYA 3HUBA 4ZLZA 2WMAA 3BX5A 4R77A 5KZ0A 4UWYA 2C3KA 4IX4A 4FKOA 2Y6OA 4RWLA 4FT0A 5EK7A 1L8TA 4RPVA 4AUAA 5AUZA 2VGPA 4I6QA 3ACJA 1Q5KA 5J87A 4MNEA 4DH8A 4YZCA 1U5RA 3LFSA 2C5NA 3AMYA 3FI8A 4M68A 5J1WA 3CY3A 4ZAUA 1AD5A 1KV2A 4AZTA 4NM5A 4BIDA 3VUMA 4DN5A 4EJ7A 1P2AA 1WVYA 1UKIA 5L4QA 1H00A 3ET7A 1PMEA 3F3ZA 4EH5A 3V5PA 1BX6A 4TYIA 1G8AA 2C1AA 3DBFA 2X8DA 4I41A 2HCKA 4M0YA 3CQEA 4FGBA 3R7VA 4YJQA 4DA5A 1JSUA 5K5NA 4S31A 4KWPA 2BFYA 3F7ZA 2GTNA 4TWCA 5DYJA 5L2SA 4W4YA 3TWJA 4AZSA 3N4VA 3POOA 2UZUE 2O65A 3UZPA 4LMUA 1H0VA 2BILB 1LUFA 3RBWA 3BV3A 4ACMA 2ZMDA 4EH7A 1ZLTA 3G33A 5E1SA 1PJKA 3PPJA 3CSVA 5IQIA 4YUQA 2VX0A 3AC8A 4BDHA 5LARA 4BDIA 3ZM4A 3PIYA 4EWHA 1ZYDA 3SG8A 5BYLA 1QPJA 2VRXA 3MVMA 4S30A 2B1PA 3BGZA 4XYFA 3S3IA 1PXKA 1WAKA 2B9JA 2XKFA 5HI2A 2R3HA 2VWXA 3MIAA 3VBTA 1XJDA 5L6PA 3RPOA 2A19B 2WNTA 3EN4A 4CXAA 3QLFA 4WG4A 1STCE 1UNHA 5GJFA 3BKBA 1DI9A 4RJ8A 4AN2A 4E5BA 2F7EE 4E5AX 3DKCA 4DFBA 2PVJA 2WD1A 3ALNA 1G5SA 2W5BA 4L8MA 3HNGA 1UU8A 4E6QA 3DXQA 2UZDA 3CLYA 4WHZA 3PLAE 3ZFXA 3F3VA 3QCXA 4JBOA 2YWPA 4WO5A 5JFWA 4TYHA 5IQBA 3W10A 2G2FA 4BCPA 3SW4A 2C30A 4QMXA 4N4SA 5JK3A 5AR4A 2YFXA 3DBCA 2ERZE 4CG8A 4FUYA 4NJDA 4FIGA 4IWDA 3FKLA 2EXEA 2B9HA 3V5TA 4FV0A 2QKRA 2RGPA 3LQ5A 4O21A 5TR6A 3TJDA 3A7IA 5KMJA 2XJ1A 4FSZA 3QBNA 4C2WA 2JAVA 4YPDA 2BDWA 1PXPA 3D5VA 1IASA 1RQQA 3REPA 2F7XE 1XHAA 3BHVA 4L01A 2YDIA 1BI7A 4BDDA 2WMVA 4ONAA 3CY2A 1FPUA 3F3TA 4O0XA 4TNBA 2R3RA 4UXQA 4LFIA 3R9NA 2C0IA 2HY81 3PSCA 1OL5A 3PVGA 4EHVA 3QL8A 3KRRA 3QHRA 5AV2A 4OTPA 4PMSA 3TIZA 3VJNA 5AP2A 5CANA 4DH7A 5FEDA 1PRYA 4KKEA 2OWBA 2J6MA 4IHPA 3PY0A 4L44A 4LYNA 3QQHA 5J8IA 4KA3A 3NVMB 4IB3A 2J5EA 2JDTA 3VUHA 2XNGA 5IF1A 2FO0A 4PNKA 1Q61A 4KB8A 2AC3A 1PMUA 3F9NA 1UWJA 3HDNA 3O0GA 3PJ3A 2YLFA 3QKLA 4P7EA 4XV2A 1SNUA 3RPVA 2R7BA 2O63A 3PJ2A 2HIWA 4QYYA 1CMKE 5DEYA 5EDPA 2W05A 1H27A 2Y9QA 4JT3A 3MJ2A 4O0UA 3U4UA 5CI7A 3TV6A 2Z7SA 5C9CA 5KO1A 2OGVA 3QTQA 4FSMA 2R7IA 2FSMX 2ITPA 3Q60A 3TL8A 4QPSA 4YJSA 3ZRKA 2IZUA 4ERWA 3Q5ZA 4JG8A 3DXNA 5AP4A 4BKZA 2WHBA 3PXRA 4D2TA 1CTPE 5DT3A 3QX4A 2P55A 1OZ1A 1VJYA 3NYOA 2F9GA 3L8XA 1OUYA 4G17A 3QD3A 4I5HA 4L42A 5ANEA 4GYGA 4BBEA 4DGLC 1OKWA 2XNBA 3NYNA 2CSNA 2PVRA 3OCSA 4OBOA 3ZZEA 5I0BA 4BWXA 3FMNA 3OT3A 4F0FA 2FYSA 1Y8YA 3IOKA 1NW1A 4CG9A 3GCQA 4Z16A 3JY9A 4GFOA 3RK9A 3SRVA 3ZYAA 4H1JA 4U81A 3VUGA 1PKGA 4KSPA 1Y6AA 4QTBA 3QXOA 2CKPA 4YHFA 1LPUA 3KXMA 4IACA 4EOKA 5HICA 1KWPA 4O7YA 2WFYA 1V1KA 3FHRA 4FZFB 3QRTA 2WEIA 3CJFA 3NLBA 3VUIA 4F65A 1REJA 2W4KA 4C8BA 3FAAA 5M4CA 4KABA 5HG7A 4EOOA 3PP0A 3M42A 4W9XA 5JEBA 2R64A 5K5XA 5HO8A 4KAOA 1R0PA 3H9RA 4KIPA 2CGVA 4NM7A 4U44A 3RK5A 4D1ZA 4EUTA 2DWBA 3NVKI 2RKUA 4NT4A 5F95A 4CMUA 5JGDA 1GIHA 3CC6A 1FGKA 5BVWA 5CF8A 1YHVA 3SW7A 4RWIA 4PQNA 4JS8A 2VTNA 3DBQA 2OK1A 2GS6A 3E8CA 3PA4A 3N9XA 4EH6A 4AZEA 3COHA 3EYGA 4KS7A 2WOTA 3QX2A 4FV7A 3M2WA 5E91A 3ZDIA 5GZ9A 2EUFB 5EI2A 5IMXA 1IAJA 4FTQA 4AT4A 4EKLA 4FV6A 5FGKA 2E9PA 4FV8A 1V0OA 2OJIA 3PVUA 4MVFA 1YW2A 4BN1A 1KV1A 2W99B 3DZOA 4X2NA 4YURA 5M4FA 4DHFA 2LGCA 2QO2A 1XH8A 4EOJA 3NIZA 3HRFA 4UN0C 4LOQA 4O83A 2R3LA 3QZHA 5A4LA 3P9JA 3QD4A 3R2YA 4L7SA 4QP7A 2LAVA 4P5ZA 4X0MA 2W5AA 2XKCA 1K9AA 3PXQA 4RQVA 2UW7A 4PV0A 2GS7A 5E92A 4EH8A 3SXRA 4L67A 3AOXA 5IKWA 2CGUA 4FSTA 4HOKA 3UO4A 4QYHA 4DYMA 5IQAA 4FT3A 5HE3A 4HGSA 4U40A 1URWA 2ITYA 2R0IA 1M14A 4HVHA 5CALA 4YTFA 3HAMA 4TNDA 3FDNA 2C6KA 4FSWA 4I6FA 3TUCA 1W82A 3QQLA 3OOGA 4RA4A 3ZO3A 1UU7A 4YJUA 5HCYA 1NXKA 4EZ7A 4I1ZA 4G3FA 1YKRA 3TKUA 2ZV7A 4A4LA 3FXXA 3PLSA 4RJ7A 5AAGA 5E1EA 4EH9A 2YCQA 3NUAA 4QP3A 2ITZA 4X3FB 4FODA 4U0IA 3DB8A 2F2UA 4FSNA 3GI3A 4O27B 3LKMA 4Y5HA 5EKNA 2I1MA 2XZSA 4TKSA 3A7GA 5JT2A 3S00A 3U87A 3BGPA 5KMOA 3L8VA 2HENA 2UV2A 3PXZA 2R2PA 3NWWA 3EQDA 4Q5HA 5LXMA 3KL8A 4D9TA 4DT8A 4U9AA 4C36A 4E93A 5HD4A 5HE0A 4CQEA 3HMIA 3QKMA 4GK3A 4KUJA 1P4OA 5EM7A 5KMIA 3DLZA 3R9RA 5JH6A 1B39A 2ACXA 4K1BA 5DH3A 2PVKA 4AS0A 4O0WA 3R00A 3U6IA 2C6DA 5EM5A 5CEQA 3MY0A 4U45A 3AD6A 3LFDA 1M7QA 3QUDA 1CM8A 3AD5A 4FZDB 5HCXA 2BDFA 4FK6A 3JS2A 4HCTA 3UOKA 1WBVA 3HECA 4APCA 2O3PA 2RF9A 4HVSA 2BZIB 2GSFA 3IW7A 4QMVA 1APME 4GVAA 2Z7RA 5J95A 3MWUA 4IFCA 5JRSA 4G9CA 3BLHA 4QNYA 3UIMA 4YTCA 5GZ8A 5HBEA 5ITAA 2UW5A 4ZMEA 5L6WL 2J9MA 2WU7A 3QUPA 3FZPA 4RVTA 4L3LA 3QUEA 1IR3A 2PZIA 1UKHA 2VZ6A 4TYEA 3FLWA 3KVXA 4M7IA 2HAKA 4OTHA 3BIZA 2W9ZB 5J5TA 4GK2A 4PY1A 4J99A 4YTHA 4AOJA 4D2SA 3OWJA 1ZRZA 2XJ2A 3HA6A 4IX5A 1HCKA 3A4OX 4MXAA 2JFMA 4TYHB 3W18A 3O23A 1H28A 4RFYA 4AQCA 1XQZA 5D7AA 4ANNA 5K3YA 4M8TA 1R0EA 1BKXA 2W1EA 3PXFA 3LIJA 3KCKA 3V6RA 4FV1A 5A9UA 4TYJA 4DT9A 4XRJA 1PKDA 2YEXA 4D2VA 3OF0A 4U42A 4R5YA 3F2AA 1UWHA 3QTIA 4QO9A 4M3QA 4F6SA 4DCAA 4XG9A 3K5UA 3IKAA 5AR8A 4IADA 2IVVA 3OW3A 4HGLA 3OCBA 2VO7A 3H10A 3FLSA 3QD2B 4H05A 4BCQA 2V0DA 3P7AA 1GAGA 2W1ZA 4BVUA 1GJOA 1R78A 3AG9A 5IPJA 1FMKA 2JIUA 2X1NA 3ENHA 5E8ZA 5FXSA 3VUTA 2R3FA 1DI8A 4J1RA 4AGUA 1RJBA 2RFDA 4GT4A 4NSTA 4O91A 1R3CA 2VD5A 4U3ZA 3EKNA 4TY1A 5DT4A 5AP7A 4CKIA 3E62A 4FK3A 5DR2A 2GQSA 5M44A 4CCUA 1OPLA 4RIWB 3EQGA 3PUPA 4C59A 4CV8A 5CF4A 3OW4A 3MN3A 2QG5A 4JBVA 4AZVA 3Q4ZA 4MK0A 4HVGA 4AOIA 3TDWA 4AF3A 1V0BA 2R3KA 3HV4A 3DPKA 2J4ZA 3V04A 3OT8A 1GZ8A 1ZMWA 2XB7A 2XIYA 3PVBA 3CTHA 3H3CA 3WYXA 1VYZA 3CKXA 4XV1A 3GU8A 5FXQA 4Y8DA 3SXSA 3OP5A 1YHWA 3FXZA 5AV4A 4D4SA 2XS0A 1P4FA 1KE7A 5FQDC 3R73A 4QD6A 4KBAA 4GUEA 3VS0A 5K0XA 4DTBA 4YLKA 3R30A 5JZJA 5ETCA 3RAKA 3ZRMA 3SVVA 2WQMA 3R1NA 5EYCA 5TOZA 4GFMA 5FM2A 3PPKA 1OL1A 3ZONA 4IDTA 3FY0A 4YHJA 5HEZA 3T9TA 3U6JA 2FA2A 4L3JA 2Q83A 2WQOA 4X3FC 2AUHA 4D4RA 2BDJA 2X2LA 2BKKA 2WQNA 4FTRA 3HMOA 5AUUA 1GZKA 3CBLA 3ZDUA 2QKWB 3ROYA 3UZTA 2YWVA 4FR4A 1MQBA 2P0CA 3E92A 5LMKC 2CHLA 3JXWA 3MPMA 4S32A 5F20A 2JLDA 4FV3A 2DYLA 4LUEA 3F6XA 3GP0A 4O96A 4BDKA 3KC3A 5K0KA 4ZLOA 5CYIA 1QPDA 4TTHB 4MWHA 4M84A 3ZUVA 3ZOSA 3LFNA 3PZHA 2RSVA 5BUEA 2WTIA 4IQ6A 3C1XA 2R3IA 4IXPA 3ATSA 3W32A 2ITVA 4D58A 4Z3VA 1WVXA 2FGIA 1IG1A 4WG3A 5C8KA 4O22A 4O0SA 3LCDA 2RG6A 3R8UA 3UJGA 1JNKA 5CX9A 5HIDA 4YC3A 3ZRLA 3PE1A 4EBVA 3KRJA 4FYNA 4X3JA 4I0SA 4B4LA 3FZOA 5ETFA 4ZZMA 4K2RA 5HHWA 4AOTA 4ZK5A 4F0GA 4O7LA 2PZRA 2PVNA 5A54A 3QZGA 2YITA 3B2WA 3EQPA 3Q6UA 4TXCA 3U54A 3ORKA 2QR7A 4G34A 5C01A 1O6LA 2A27A 4RIOA 2GMXA 3RNYA 5I9UA 3PWDA 2ZB0A 5HX6A 3K3JA 1OVEA 4B7TA 1A06A 1OIRA 4A07A 5A4QA 3IW8A 1H1RA 5HVKA 5CY3A 5JKGA 4HVIA 1RDQE 5AR7A 4BDEA 2GHGA 5CXZA 4JVGA 1H25A 1Y6BA 3G90X 1JVPP 2PMIA 1R39A 2J51A 4ID7A 4QMNA 4DTAA 2JAMA 4FL1A 3OXZA 2OJFE 3DJ7A 3G9LX 2BAJA 3N51A 3QRIA 3QRKA 4LMNA 5CASA 3UNJA 2F49A 4F7JA 3ATTA 1UA2A 2Z8CA 2JC6A 4OUCA 4QP4A 3RNIA 3JYAA 4O6LA 4RIXB 4L9IA 5M56A 2B9FA 4OTRA 2ZM4A 1BMKA 4PMTA 3UPXA 2Q0BA 2XRWA 1KSWA 4AA4A 2GNFA 3ENMA 2OH4A 4F9AA 4FTCA 2W5HA 3VS3A 3MTLA 4DEBA 3BYUA 4F7NA 4YC8A 3JPVA 1I44A 3KEXA 4O7WA 5AV0A 1JBPE 4EHZA 3NZ0A 3ZS5A 3QLGA 5J5SA 4TW9A 4LRJA 4YJPA 4FKRA 2WB8A 5CU2A 4ZY6A 3COKA 1SMHA 2JDVA 2PZYA 3Q5IA 5CSWA 2CMWA 2IG7A 3CXWA 3R7YA 5BX0A 3RCDA 2XVDA 3F7WA 5K4IA 5CWZA 1YI4A 4XG3A 3F3UA 4BIEA 2BPMA 4CMTA 4FL3A 3FI2A 5IMEA 5C4KA 4D1SA 3O2MA 3PRFA 4MBJA 4RFMA 4TZRA 5TE0A 4DFNA 2QOIA 4F6WA 4C4FA 4Q9ZA 4DFUA 4CQGA 5L8KA 3ZH8A 3HL7A 2J50A 4TWPA 3WYYA 4AGWA 4C02A 3KCFA 1EH4A 2HZ0A 3MY1A 4E4LA 3LMHA 5M06A 4BWPA 5EHOA 1PXLA 4LUDA 4J7BA 3BI6A 3WZDA 3P23A 3FMKA 4RVKA 2UUEA 3CQWA 5I9VA 1OMWA 2X2MA 3IONA 2QHMA 3PPZA 4Y46A 3RM6A 4O86A 5GNKA 4MX9A 1XH4A 4FEQA 2G1TA 4IVDA 3THBA 5KBRA 4QP9A 3WF9A 2RFEA 4W4WA 1QL6A 3QD0A 3GQLA 4NJ3A 2I0HA 3OWKA 4AAAA 1Y91A 3RK7A 4BBFA 5AFVA 2BKZA 3CPBA 3MPAA 4G3GA 3SQQA 5GIPE 2C6EA 3TNIA 4YPSA 1SNXA 1M2QA 2OZAB 4QPMA 3VWAA 4C4HA 4O7RA 2P4IA 3BE2A 1JLUE 5HG8A 3R22A 4K9YA 4GCJA 2ESMA 4EOPA 1FQ1B 1OKZA 2A4LA 5M55A 3A60A 2OBJA 2YJSA 4G5JA 3UOJA 2X6EA 3IDPA 4ZY4A 3SOAA 3FEGA 4QPAA 4HNIA 3IW4A 3DY7A 2X2KA 3H30A 4GK4A 4W4VA 3KXXA 3TIYA 4ARKA 2CNUA 2XNNA 2XCKA 5DG5A 4M0ZA 5B2MA 4IMYA 4QP8A 4YP8A 4R7HA 4FA2A 3KK9A 3H0ZA 5IQEA 3EFLA 3EQIA 3VVHA 3SD0A 2G2HA 3Q2MA 3COMA 3FLZA 4I22A 4Q2AA 4BICA 5D11A 3FMDA 5I9ZA 3OEFX 3E7OA 4ACDA 4PDSA 2B0QA 4FG7A 4U41A 3FI4A 4D2PA 3TV7A 4Z7GA 5C26A 4MQ1A 4O38A 3MVHA 5E90A 3DTWA 4U97A 1Q8UA 1UNLA 3TTJA 4A9TA 2W4JA 2X39A 4QMQA 4OR5A 5IEVA 2J0IA 5EOLA 4FZAB 2XNMA 4CLIA 1PYXA 2ZOQA 4KRDA 3AGMA 5IUHA 4B9DA 3LXKA 3II5A 4IDVA 1SYKA 1WMKA 2YM7A 3T9IA 4EC9A 4UYNA 5FTQA 4CYIA 2B7AA 2BRGA 4RT7A 4JX3A 4JIKA 4D0WA 4EOMA 4I5CA 4J95A 1PXJA 4L45A 3LQ8A 5AADA 2P33A 1PYEA 3ZM9A 3SA0A 2WTDA 3B2TA 3MH2A 4C0TA 1JSVA 2EU9A 3W2CA 3WF7A 2XP2A 2OKRA 4R1YA 3W2PA 4FTMA 4WSYA 4YTIA 4QQJA 3DTCA 1K2PA 5AR3A 3VRZA 3OS3A 4YZDA 4NIFB 4L3PA 3E64A 4AU8A 4YBKA 3TJCA 2QOFA 4AW1A 3DOGA 1Z57A 4KIQA 1OPJA 2J0KA 3B8RA 3HP5A 3P1AA 4EZ5A 3Q6WA 3F69A 3TACA 3DQXA 3FPMA 4RVLA 4JRNA 3U6HA 5AIKA 3ZXZA 4FKSA 3F5PA 3OUKA 5C4LA 3VC4A 4A4OA 5FP5A 3UDBA 4D28A 4O7TA 4XP0A 2SRCA 3W2OA 2KTYA 4X3FA 3WE8A 1DAYA 3NDMA 3G2FA 4NCTC 3BGQA 3OROA 4ZTHA 3F5GA 4QQCA 3TEIA 3R02A 5CZIA 5IH4A 2VX1A 1YDRE 5KKRC 4LGGA 3UOHA 2C3LA 5LMKA 2ITXA 4A7CA 3ORZA 1U4DA 4II5A 4UZHA 3R6XA 4YNEA 4OGRA 2J0LA 4FZ6A 4QMSA 5FWKK 3MFSA 4ENYA 3LCOA 1LR4A 1ZOGA 3Q4UA 3CP9A 5BVDA 5M4UA 4EOLA 4TPTA 4U8ZA 5GIOE 2XIRA 2WMUA 3C0HA 1FGIA 3GOPA 5J7BA 4ASZA 4HZRA 2UZNA 2NRYA 3PIXA 4PF4A 4E4NA 4O81A 2R3OA 3EQBA 2J0MB 4O1OA 1TVOA 3R01A 2YLEA 1OECA 3E88A 4IZAA 3R8MA 2WTKC 4DEHA 1ZY4A 3MFUA 4O6EA 4BKYA 5ETIA 4MF1A 4UX9A 5AV1A 5BYZA 2P3GX 3LFEA 3NW6A 4KIOA 3VW8A 5HG9A 4D4YA 4IVCA 2C3IB 2BR1A 3BBWA 4FIJA 4IAZA 4JDHA 4HYIA 5JFVA 5KHXA 4YJVA 5D1JA 2VTJA 2CN8A 4EH3A 5EI6A 5I3RA 3QQFA 5AA8A 3CR0A 2HWOA 3C4EA 3RWQA 2C5YA 5M08A 3DT1A 3P7CA 3VBQA 4DBNA 4ANOA 1MRUA 4DEGA 3HDMA 4J97A 1R1WA 3OTVA 4LGHA 5JRQA 5L2WA 3BHHA 4S2ZA 3I79A 1HOWA 4IC8A 4BZOA 4U43A 5DWRA 3VJOA 3CS9A 3PSDA 4C3RA 3HRCA 5D41A 3S1HA 1VYWA 2BFXA 4FG8A 1JSTA 3QAME 4C37A 1Q24A 1M7NA 2YA9A 3PYYA 3PXKA 4WIHA 4O0YA 4YSJA 3F5XA 4I0RA 5GZAA 2WZJA 3Q9WA 4IAIA 3RTPA 2PU8A 4RA5A 3ZSHA 3HKOA 3LLTA 5E4HA 2HWPA 3MVJA 4DH5A 3QYWA 4WKQA 5BVFA 3VS2A 1YRPA 5T6KA 2BIKB 2Z7QA 4NTTA 2VTTA 2HOGA 3SOCA 4B6LA 5AX3A 4C34A 4XMOA 1IAHA 4AN3A 3GQIA 4ASXA 3AMBA 4JR3A 4FNYA 5LCKA 4IJPA 2B53A 1F3MC 3AT4A 1YXSA 4MF0A 3OOMA 3ZUUA 4Z9LA 1GZNA 3ODYX 1WBWA 5IA4A 2PMLX 4DGNA 1I09A 3WIGA 3UBDA 4O2PA 4RIWA 5AA9A 2YIQA 2EWAA 2YZLA 3VUDA 4IB0A 4FGRA 3GCSA 1VEBA 4PX6A 4RZVA 3AC4A 3WZEA 4JL9A 4AACA 4AW2A 4XOZA 2I0EA 3R63A 1LP4A 4EHGA 4HVDA 3VF8A 4B8LA 4BCOA 3PJCA 3VUKA 5CSPA 4BI2A 4WT6A 5DBXA 2R0UA 4FEWA 2YM3A 4IWPA 5FTOA 3TXOA 3C7QA 4HYSA 3GEQA 4QYEA 1YHSA 3GCUA 4PWNA 1RE8A 3AT2A 3UGCA 4IWQA 4ZP5A 1YVJA 3BQRA 1PF8A 4QQ5A 2BVAA 2J0JA 3I60A 5IUIA 1WBNA 5HKMA 3KXGA 3Q4TA 2BALA 3E93A 3RCJA 3LXPA 2EXCX 4D2WA 3IDCA 5KZIA 1H1PA 4MCVA 4K0YA 4R8QA 4G2FA 4NZWB 4QMMA 3R7EA 5K4JA 3VULA 5LQFA 3F2RA 3G0EA 5CEMA 2HZNA 4FC0A 2O2UA 5KE0A 2WPAA 4RZWA 3ZBXA 1E9HA 1UNGA 2ITOA 3TCPA 4IB1A 2PYWA 4BZDA 4M67A 4JR7A 4DEEA 3AC5A 3GVUA 1ATPE 4L68A 2IVTA 3HV7A 4V05A 3RPSA 1P5EA 3V8WA 4JQ7A 2VWYA 3D7TA 3LM0A 3MVLA 4FV4A 4LV5A 1XWSA 5DGZA 1AGWA 3GNIB 3LFBA 3E87A 4BBMA 3TNQB 2PL0A 4G1WA 2PE0A 4W9WA 2PULA 5H8BA 4OW8A 4BDFA 3VS4A 4JJRA 5L2QA 5LVOA 4O0VA 4F7SA 3PXYA 4MKCA 3ZSIA 4U79A 2C0TA 4ZY5A 2F2CB 5KMNA 2XA4A 4J71A 3ORNA 3VBXA 1XBBA 3O51A 1IRKA 2VO6A 4ASDA 3ZUTA 4ZTLA 4DH3A 4AT3A 2OSCA 4D4VA 1XR1A 4GG7A 3TZ9A 3EQRA 1H8FA 4BCHA 5AAEA 2VGOA 1J1BA 5BMSA 3FMMA 5FEQA 4CVAA 3EFKA 4K33A 4IWOA 3RVGA 1XH5A 5L3AA 3KULA 4N6YA 4N57A 4FT9A 4I4EA 4BB4A 3LFFA 3T3UA 2OFUA 3O96A 5JMSA 4E26A 3NW5A 1ZOHA 4ZTSA 4EYJA 3DKFA 2RG5A 4FKPA 3QQJA 4HGTA 1BL6A 1OM1A 4GSBA 2YIYA 3D4QA 4R3CA 5G6VA 3RZBA 2J90A 4ZSEA 4P4CA 2VWIA 4N0SA 2R4BA 3OXIA 3R71A 5IA1A 1BL7A 4ITHA 3SC1A 4Y85A 3I4BA 2EB2A 2R3GA 2GFSA 4FTTA 4JI9A 2VWBA 3OCTA 5FBOA 5FM3A 5TO8A 4C57A 3PFQA 2BRNA 3IQ7A 3OY1A 5JFSA 3G6GA 1TQMA 3BYOA 3FWQA 1LEZA 4NTSA 4ZTNA 4C35A 3QGWA 2ZB1A 4NWMA 4CZUA 2BZKB 3QTSA 3OTUA 4YO6A 3LAUA 5AP6A 4YMJA 3NCGA 2AC5A 2W1GA 4NM3A 4XUFA 4XX9A 3HV5A 3Q04A 4RIXA 1M52A 2OJGA 4A9SA 4E5WA 5A46A 4MNFA 3LZBA 1NY3A 3NAYA 4OTFA 3W8QA 2WQEA 3V8TA 5BQ0A 3R8ZA 2PK9A 5CQUA 3AXWA 3AD4A 4Y83A 2WELA 4CRSA 4ZIMA 3NNXA 2FUMA 3IW6A 1X8BA 2F7ZE 5FBNC 5T68A 3RMFA 1Q8YA 4F1MA 1YI3A 3I6WA 2W4OA 2ZDTA 4NCTA 3UC4A 2DUVA 2QODA 3KA0A 3KGAA 2VO0A 4QMUA 4WRSA 4PPCA 5DMZA 5LMBA 4RC3A 1W8CA 3A4PA 3EN7A 4IM0A 4O0RA 2OXYA 5F9EA 2X6DA 1GOLA 4KRCA 4ANSA 4BCNA 5M51A 3MFTA 1Z5MA 2HK5A 3BHTA 2BTSA 3OFMA 3RAWA 3TZ8A 2ETKA 4BHZA 4DLJA 4K8AA 4OT6A 4EHEA 5AUYA 2XKDA 3Q4CA 4XLIA 3SX9A 5A4TA 1Q4LA 1BUHA 3OZ6A 4IH8A 5H8EA 3DK3A 3TT0A 3KY2A 3UZRA 4CFWA 3UIBA 4L46A 5HBHA 4AN9A 3FXWA 4PMMA 3V01A 4G3CA 1XKKA 1IA8A 3IK3A 5JN2A 4D55A 4HZSA 4EQMA 1OI9A 3CEKA 5LMAA 4ASEA 3E8NA 5L6OA 2YERA 4O82A 1ZYJA 4RX5A 3QQUA 4FNWA 5IA5A 3NPCA 3C5UA 2JKQA 1XH6A 2KULA 2VWZA 3DFCB 2PVLA 3TM0A 1O9UA 2ZAZA 3FL4A 1FVVA 2BRHA 4GMYA 3F88A 4A4XA 1URCA 2XM9A 2E9OA 4GU9A 3PJ8A 5IA2A 2UZTA 3HYHA 4Y72A 3ROCA 5HOAA 3DLSA 5CNNA 5DR9A 4AFEA 2WMBA 2OZAA 4R7IA 3PG1A 4F7LA 2ZM3A 2HZ4A 3EL7A 4P2KA 4U5JA 1Q62A 5FDPA 4BTJA 3VS1A 3CPCA 3SV0A 1TQIA 3FYKX 4DCEA 4YJNA 3FKOA 2VTSA 3PP1A 4JG7A 4N70A 4F9YA 2F57A 2W1DA 5HTIA 4J96A 4KKHA 5KUPA 1LEWA 2REIA 1KE5A 4I94A 3D5XA 2ETRA 4QQTA 4E1ZA 2WMRA 2QOBA 1JKKA 4NFNA 4F4PA 2GHMA 4JBQA 4XCUA 4RVMA 2OH0E 3FYJX 3P0MA 4G6OA 5HLPA 4EOIA 1ND4A 2CDZA 5KCVA 4F99A 4I3ZA 4LL5A 5CVHA 5AJQA 3DJ6A 4FSQA 1FBNA 3UIXA 3G0FA 4WBOA 2C6LA 3GOKA 3POZA 3QA8A 3RJCA 4CD0A 5JFXA 3MGYA 2OFVA 4EJNA 4NL0A 3DQWA 3FLYA 4YR8A 5LVNA 1Y8GA 5AM6A 3R04A 4FKLA 4O2ZA 3EZRA 2X81A 4ZSAA 4AE6A 4B99A 3IG7A 4OTQA 1BI8A 2XIXA 4IE9A 3VS7A 2GCDA 2C6IA 3MIYA 5GHVA 3ZLWA 4OTIA 3VNTA 3KKVA 4IBMA 4JAJA 4PDOA 3C4FA 2GHLA 3KB7A 3MSSA 4G5PA 3QTRA 3BHUA 4J52A 4EZ3A 4ZTMA 3FV8A 4FVRA 5FP6A 2FSLX 2OW3A 5M53A 3GFWA 3O8UA 3R7IA 4XG4A 5A4CA 4X6QC 4KBKA 5AIRA 2YM5A 3ZC6A 3ZTXA 2PMOX 4IEBA 3IDBA 4BCGA 5JGBA 3EZVA 5CAPA 3ITZA 5HTBA 5E8YA 2X0GA 2ZV9A 4I4FA 4FV2A 2QONA 2WMTA 2Y4IB 2YM8A 4IAFA 4Q5EA 4B8MA 5EDQA 2OIDA 3EN9A 5HZNA 4NIFA 3NUUA 1KOBA 2JGZA 3GU7A 3F66A 5AX9A 2GNJA 3QYZA 3WZKA 3D14A 5BVOA 3K2LA 4Z55A 5CEKA 4GJ2A 5CENA 1SZMA 3ZC5A 4PL4A 2E9NA 4ZS4A 4I6HA 2FH9A 2RL5A 3O8PA 4F70A 1GY3A 1H0WA 3UNKA 4GIHA 4BGHA 3FQEA 2JITA 2VTIA 3B8QA 3F3WA 3H9FA 1FMOE 5DPVA 5F94A 3ZFYA 4AZWA 4KIKA 1Q3WA 3U51A 2IZSA 4PDYA 3U9NA 4QP1A 4IM2A 3P08A 2ERKA 1TKIA 4FL2A 2R3MA 2NP8A 4G3DA 4E3CA 3DA6A 4UMTA 3FZRA 4GRBA 2B4SB 2E9UA 4I6BA 3IGOA 1T45A 3EB0A 4JLCA 4YLJA 5L2IA 2QOCA 3EHAA 4BDJA 1KE8A 5L8LA 3OWPA 3OHTA 4W8EA 3D7TB 3TG1A 3V6SA 2G2IA 4EK4A 5HNGA 5F1ZA 3V5WA 2JIVA 5L2TA 5IDPA 3H0YA 3TUDA 3MB6A 3FLQA 3AC2A 3P7BA 3FZTA 4YJTA 5CF5A 2WO6A 2YAAA 2YM4A 3R1YA 2XIZA 3TNPC 4DC2A 2H34A 1GIIA 4RX8A 4C7TA 5IH5A 3KVWA 4H1MA 5D12A 4L52A 1ZYCA 2ONLC 4FKIA 2QOQA 4O0TA 2QVSE 5HESA 4LG4A 3W33A 3L9LA 1PXMA 5CNOA 3WF6A 2C69A 1WBPA 4JIAA 3LE6A 4X2KA 1CSNA 3EKKA 3KRLA 4PDPA 4GYIA 3OWLA 3KULB 4JQEA 1W84A 1YWVA 5I9YA 3R1QA 4P90A 5IQHA 2VTQA 2OU7A 3T3VA 4LGDA 4WNPA 5HO6A 3S4QA 2Z02A 1YQJA 4TWNA 4C2VA 3ANRA 5IQFA 3GU5A 1JKTA 2VWWA 2XNOA 3O71A 3ORTA 3KXHA 1OBDA 5DLSA 4H3PA 1ZYSA 3BU5A 4ACCA 4C3FA 3WZUA 2W7XA 5B2KA 4MD7E 1JKLA 2H9VA 2VNWA 4X2GA 4XBUA 4YHTA 1Q97A 4CFVA 3VN9A 3QRJA 4DGGA 4O7NA 1M2PA 2RFSA 5CSXA 3ULIA 2I6LA 1QPEA 5CF6A 4GKHA 4YLLA 3HGKA 3A7HA 2UZVA 3MW1A 3SDJA 1H1QA 4NK9A 3IECA 4BDGA 1ZY5A 4FKGA 3BELA 1CDKA 4XG7A 5TKDA 3FKNA 3S2PA 3TI1A 3I5ZA 4HCUA 4JBPA 4UMQA 4X6RA 1UU9A 2FVDA 5EM6A 2C5OA 4CEGA 4BWKA 3VQUA 3EN6A 4D9UA 2ZMCA 4MXXA 3T8OA 4QMZA 3HMNA 3FZ1A 3I6UA 4QMYA 4C58A 3OVVA 4M69A 4DFLA 2OXDA 2PE1A 2QOHA 4FOCA 4DGOA 3A99A 3QWJA 4IAAA 3R7OA 3EQCA 5KKRB 2X7GA 3PWYA 4RC4A 5CU3A 5J9YA 2JDOA 4YGAA 2CKEA 5HVYA 5FXRA 3FC2A 3RALA 3QF9A 4IX6A 2PVYA 2UVZA 4BCMA 4RJ3A 5HO7A 4R3RA 3ZLSA 4YZMA 5DVRA 3PA3A 2FSTX 4E6CA 3EYHA 4CLJA 4YNOA 2JKKA 3UTOA 3HRBA 4JNWA 3AC3A 4H3QA 3V5QA 4FNZA 4USEA 4IAKA 3FMEA 5BUJA 3HP2A 4ANMA 4AXAA 4PNIA 1J1CA 1YOMA 2J5FA 3FQHA 3VS5A 1SVHA 3SKCA 5KMMA 2Y4IC 4CGAA 4HJOA 2XM8A 3WILA 3OCGA 2WTKB 5DOSA 2XYNA 4XH6A 2WQBA 3EIDA 4RJ5A 5CLPA 4EOQA 4FKVA 3BCEA 2WMXA 3C9WA 4FVQA 2V55A 3C4CA 4FBXA 4NFMA 1W98A 4FIFA 4D2RA 3GCPA 2PVHA 2QLUA 5M07A 2RFNA 4NYEA 5HE2A 4RJ4A 3NMUF 3L1SA 5BNJA 2WTJA 4F08A 2WMQA 3MI9A 5HVJA 2WGJA 2WIPA 3D5UA 3Q32A 3ORMA 3GC7A 4XG8A 3A8XA 5FLFA 4TL0A 2F4JA 2C47A 4E6AA 5E8VA 2J2IB 4CZYB 4G6NA 2FB8A 3CE3A 5ANIA 5IQCA 3CJGA 2I0VA 5E8XA 2BUJA 4BF2A 4F1OA 2WKMA 2YDKA 5CEOA 4D5HA 1WZYA 2I40A 3I1AA 3L9MA 4IJ9A 4V0GA 3DFAA 4Y95A 2XRUA 2VN9A 3PJ1A 1QCFA 2BAKA 2JDSA 2VU3A 4R7BA 3LFQA 3DKOA 4IX3A 3W1FA 3HAVA 5EHLA 2CCIA 1IA9A 4WD5A 3UO6A 4QRCA 5ANDA 5IEXA 4QYFA 5CQWA 4U7ZA 5FTGA 3KN6A 4FVPA 4DH1A 4UBAA 1ZYLA 3CTQA 4RSSA 3NS9A 4IZ7A 4B0GA 1P14A 1KUTA 3TTIA 3MPTA 4FF8A 1BLXA 2XK4A 3Q3BA 4APPA 1OGUA 5HTCA 4R1VA 3PTGA 1Z9XA 1S9IA 3DDPA 4KKGA 4GS6A 3NR9A 2R5TA 3TZMA
chains in the Genus database with same CATH superfamily
4ZTQA 4GL9A 3ZO4A 5BPYA 3UQCA 1CKPA 3FL5A 4OTGA 5CU4A 3R8PA 2OLCA 3LHJA 3E3BX 3MTFA 4EL9A 4M12A 3U55A 4GVJA 3P4KA 3FPQA 2OIBA 2PZPA 2V7OA 5C8MA 4BDAA 3O7LB 1Q41A 4I92A 2WU6A 4USDA 5C27A 2WAJA 4RX7A 4C62A 3ZU7A 3RHKA 1ZMVA 3NEWA 5T3QA 2DQ7X 5DR6A 5C03A 3QTWA 3ZLXA 4CKJA 2B54A 4AG8A 3WI6A 5GINE 3MA3A 3AQVA 3BV2A 5H8GA 3U8WA 3MESA 2IWIA 3HVCA 4FTIA 5E8TA 4DFYA 4R6VA 2PY3A 2GU8A 5CTPA 3UG1A 4FUXA 2C4GA 4JXFA 3ULZA 1YDTE 4FTLA 4PL3A 3C4WA 5EM8A 4M97A 3G51A 1JAMA 5CS6A 4YZNA 3DB6A 4FICA 4LOPA 1FVRA 2ITTA 5FD2A 3ZHPC 2OJJA 1O6YA 4MD9E 5EW8A 4BI1A 4EBWA 4DEAA 5BVNA 4XNEA 2QG7A 4K6ZA 4O84A 4E4XA 1NVSA 3FZSA 2X9EA 4GW8A 4RLLA 4GG5A 4AGDA 4H36A 4PPBA 5HX8A 3KU2A 4Q9SA 1PHKA 3KFAA 3VHKA 1NT2A 1XBCA 2PMNX 4F9CA 3NGAA 3UP7A 4AGCA 2WXVA 3MJ1A 4AT5A 4KIKB 3R0TA 2XANA 1MQ4A 1WBTA 3M1SA 4MBIA 4O4EA 3GB2A 5DI1A 4X21A 1MRVA 2VTHA 2PE2A 3CD8A 3D0EA 4AX8A 4RJ6A 3CD3A 5L8JA 2IVUA 4QTDA 4FYOA 4NKSA 2QU5A 3U9CA 4BTKA 3FC1X 3LFAA 3GUBA 4V04A 3NUPA 3K5VA 4K77A 4ALWA 5EQEA 3W0MA 4DBXA 1OIUA 2C1BA 2GNIA 4PP9A 5EH0A 4BGGA 2G9XA 4ANBA 1SVGA 1J7LA 2YJRA 3QZFA 4ZZNA 2IZTA 3SLSA 4UMPA 2QI8A 5IA3A 4BJJA 3RP9A 3KRXA 3FI3A 3IS5A 1H4LA 2ONLA 3BHYA 5AR5A 2YM6A 3V8SA 3FQSA 3D83A 3I81A 3ACKA 1NVRA 2IO6A 4FX3A 3JY0A 1ZMUA 4C4GA 2BIYA 4FMQA 4IAYA 4JAIA 4BCJA 4CFFA 5CEPA 4JMQA 2QNJA 4ZZOA 1H1SA 2B52A 4DE4A 3UVQA 2IVSA 1H26A 2XK3A 3L8PA 4U80A 3VS6A 2H96A 3CQUA 4LQMA 4MTAA 2Y4PA 4WSQA 3C50A 4HCVA 4HW7A 3JR1A 3RAHA 4MYGA 2ZYBA 5DE2A 4JX7A 4GJ3A 1J7IA 5EQPA 4HYHA 4RRVA 4QMWA 3EMGA 3QGYA 4CSVA 3GT8A 3MA6A 1DAWA 4K11A 4XRLA 3W55A 4XP3A 3NNWA 4EONA 2PZ5A 3PA5A 5ANOA 4E73A 3RPRA 2ZM1A 4EK8A 4DG2E 3W2SA 4JRVA 5KHWA 5IG1A 3OEZA 4PTCA 5I5ZA 3BE9A 5DT0A 4BY9E 4RQKA 3V51A 3C4XA 4HPUE 3OBGA 2A98A 4FIIA 3C0IA 4XJ0A 1PMNA 3VBWA 5IZFA 3W8LA 2ZV2A 4O7ZA 2CLQA 4XLVA 3WZJA 5CI6A 1GNGA 3LPBA 3E63A 4K18A 2HY0A 3BWFA 4PPAA 4A06A 1E1VA 2OJ9A 4C4EA 2IW6A 5K9IA 4AWIA 3QCSA 4PP7A 4ORKA 3QC9A 2OF4A 2CNVA 5LVPA 3BYVA 1YWNA 3W2RA 2ZVAA 5DIAA 4XP2A 4U3YA 1H07A 2JD5A 5A3XA 5JSMA 1Q8ZA 2R3PA 2Z60A 1MUOA 4GT5A 2QOKA 5TF9A 4EK3A 3NRMA 2V5QA 5E9EA 4EH4A 5DN3A 2AYPA 4CYJA 2J7TA 5AMNA 2BTRA 5J9ZA 3KXZA 3MYGA 3DU8A 5DHJA 4CCBA 4WBBB 2YZAA 5IDNA 3CGOA 4L6QA 3EL8A 3AMAA 5AR2A 5H2UA 4EC8A 1OKVA 4GKIA 3PSBA 2A1AB 3BZ3A 2YISA 3HZTA 2Y7JA 4ZMFA 4M69B 4ZSGA 5ANJA 2UW8A 4FTJA 1F0QA 4IFGA 1YOLA 3RKBA 4X2FA 4KNBA 3UVPA 3G15A 4CKRA 5J7HA 3DS6A 3EOCA 1M17A 4KS8A 2VV9A 4MXZA 3R28A 1U46A 3SXFA 3DGKA 3MY5A 3A7JA 2XNPA 2BRBA 5E8SA 4U6RA 3I5NA 1UVRA 5AUVA 3LXNA 4MWIA 4FKTA 5GJGA 4HGEA 2XBJA 3QA0A 4ALUA 1OL7A 4FEVA 2VTLA 4IZYA 3FHIA 3I0OA 3WE4A 2HELA 2O64A 5CAUA 4GIIA 5CU6A 3UYTA 2QQ7A 2XH5A 2HXLA 1XH9A 2W06A 3E5AA 2BMCA 4PTGA 4QMPA 2OIQA 3F61A 3MH0A 3QFVA 5DRBA 4C4IA 1G8JA 3FSKA 4IW0A 5IH6A 4QMOA 4TWOA 3KN5A 5HIBA 2XJ0A 5EYKA 4FE2A 3PY3A 3NUXA 2CGXA 4G31A 3RAIA 3Q53A 2UW0A 2GDOA 2CKOA 2XUUA 4KD1A 5EYMA 4CNHA 1Q8WA 2IZRA 2OO8X 1WFCA 3A2CA 5D10A 4ZEGA 4RWKA 3W16A 4DGMA 3UO5A 4UMUA 3WIKA 2YHVA 3CKWA 5CT0A 2XEYA 5IEYA 4D0XA 4BIBA 4BL1A 5G1XA 4IVBA 5IQDA 4BRXA 4CV9A 1O6KA 4FEUA 4E6DA 3O7LD 1JOWB 3VRYA 2VWUA 3LOKA 4I5MA 3RHXA 3R7UA 4DFXE 4TT7A 3E8EA 5AWMA 2O8YA 3FMHA 4EWQA 1W7HA 2YIWA 2R3NA 4FIEA 4V0GB 3PRIA 2IJMA 4X7QA 4L00A 4XBRA 3OD6X 5DRDA 3R83A 4X2JA 2HYYA 3ALOA 2G01A 1WCCA 4TYGA 1ZZLA 2WIHA 1RW8A 2W1CA 3R8VA 4F9WA 4CT1A 4QTCA 4QYGA 4YSMA 3UYSA 4CRLA 4Y5QA 2EXMA 1DS5A 2X7FA 3HMPA 3IOPA 4RG0A 5CAVA 2B9IA 3GC8A 2XNEA 1V0PA 3IGGA 5CEIA 2VTPA 4F0IA 3OXTA 5AAFA 2HXQA 4IB5A 3GC0A 4EQUA 5C8NA 5I9WA 3AKKA 3ORIA 1H24A 3H9OA 4RIYA 3UODA 3LM5A 1VZOA 3QKKA 3F82A 4JDIA 2AEGA 3DJ5A 3CIKA 3IW5A 4DG0E 1Y57A 2QCSA 2UVYA 1WBOA 5D7VA 1OKYA 3GBZA 4AZFA 5M4IA 3R2BA 2WTWA 3ORPA 3DAEA 3WF5A 1Q99A 2P2HA 3AC1A 4FNXA 2QO7A 3NW7A 5AUWA 4RBLA 2X0QA 3KMWA 3DK6A 3D2KA 3R9DA 4F09A 1G8SA 4EOSA 4RX9A 3R1SA 4DLIA 3TNWA 3NUSA 1M2RA 5KNJA 4CMOA 1ZAOA 3TMOA 5IUGA 3KF4A 2GTMA 3C4ZA 3AT3A 2BROA 3PG3A 4H39A 3FSFA 2GQGA 1YXUA 3WOWA 4OAUC 5M09A 4NEUA 2V62A 1KOAA 2IF8A 3P86A 3UNZA 4YC6A 4MXOA 3ZEPA 3GU4A 4BCIA 4PMPA 5IISA 3PDTA 2C6MA 1ZOEA 4C61A 4DEDA 2CN5A 4E7WA 3K3IA 4FT7A 4I21A 2XK9A 3OY3A 4I23A 1YI6A 2GQRA 2A0CX 3QQKA 4ANLA 5HQ0A 5I4NA 3BU3A 1Q8TA 2CGWA 5DNRA 3RINA 2XIKA 2W1HA 2YN8A 5CAQA 4UXLA 2XBAA 3LCTA 2NPQA 3EQHA 4FTKA 5KMKA 3UQFA 2I7QA 4DITA 2ITNA 2JFLA 2ZV8A 4FT5A 5A6OA 2UZWE 1BYGA 2Q0NA 3KK8A 4O1PA 3Q2JA 4J53A 4W4XA 3TDVA 2VTOA 4J8NA 2UW3A 4XV3A 4CTBA 4GEOA 3HV6A 1IEPA 4QP6A 4WUAA 2JBOA 2PTKA 5FEEA 3UMXA 5AEPA 5FRIA 3OUNB 3QHWA 4MEDA 1UV5A 3KREA 1KE9A 2QO9A 3KQ7A 3FLNC 3LMIA 5EQYA 2YCSA 4IC7A 1YDSE 3QQGA 3G6HA 2XF0A 2VO3A 3NX8A 4QMLA 2EVAA 2ITUA 2W96B 4JDKA 3S0OA 3ORXA 1B6CB 3WBLA 3EFWA 4ZJJA 4DHJA 4MNEB 2C6TA 5ETAA 5FG8A 3V5JA 1OB3A 3I7CA 3V5LA 5AP1A 3BEAA 5CVFA 3UG2A 4EUUA 2NO3A 4ALVA 4BI0A 2IN6A 3O8TA 3D94A 4J98A 2GS2A 4FKUA 5AP3A 2IW9A 5HIEA 2NNWB 5EFQA 4YZ9A 4F63A 4YJOA 4ENXA 5IA0A 4BCKA 5JZNA 5LWNA 3BU6A 4PL5A 5ANKA 4KSQA 5EW3A 1AQ1A 3FMJA 3P78A 3QALE 2V7AA 2PVMA 2VWVA 3QTUA 4TRLA 2IW8A 4BDCA 4H58A 2DS1A 5AV3A 5TT7A 3RZFA 4DTKA 1YWRA 5DA3A 1U59A 4UWCA 4XG2A 2BHHA 5A14A 2HZIA 2W1IA 3DBEA 2BZJA 3FBVA 4G6LA 4FIHA 3QZIA 4MBLA 4CFXA 4DEIA 4LRKA 3UPZA 4YO4A 1E1XA 4FV5A 2HW7A 1H08A 3LLAA 3HV3A 3NFGB 2E2BA 3MS9A 3VIDA 3EH9A 2ITWA 2JIIA 3MV5A 4LRMA 4EKKA 3D7ZA 3DBDA 4YZBA 4BYIA 3BYSA 3UC3A 2JKOA 4NU1A 1TQPA 2JKMA 2CJMA 3ODZX 4GU6A 1MP8A 4OBQA 1GIJA 4HNFA 1DM2A 2G15A 3UIUA 4AQKA 2H6DA 3GXLA 5CZHA 5CVGA 2C68A 3LW0A 1OL2A 4QOXA 5HNBA 4OTDA 4FZ7A 4GFGA 4BYJA 3CGFA 4UB7A 2VNYA 2Z7LA 5B7VA 4EH2A 3DXPA 3BEGA 1J7UA 4UV0A 4FKQA 1Q3DA 4EK6A 5LVMA 5B0XA 1KE6A 3SHEA 5I9XA 5J79A 4JDJA 3LQ3A 1A9UA 3SAYA 4BCFA 3WF8A 3LFCA 2NRUA 3EWHA 1NVQA 3FMLA 3OC1A 4D5KA 5LWMA 5E8WA 1FOTA 3BRBA 1ZWSA 3W0NA 1JQHA 2ZJWA 1B38A 3ANQA 3F5UA 3VF9A 4AE9A 3KMUA 4E4MA 5HORA 4HPTE 2UZEA 5CAOA 2PVFA 1ZZ2A 1WVWA 3NUYA 3QU0A 3BQCA 2O0UA 4RWJA 5CSHA 4AFJA 4FSRA 2H8HA 3D5WA 3BYMA 3ZO1A 3ZXTA 3DNDA 4NKAA 3UVRA 2WTVA 3JVRA 5EI8A 4ZJVA 4G3EA 2X0PA 3A7FA 2XMYA 4Z7HA 4DAWA 2VUWA 2C0OA 3GGFA 3FY2A 5B2LA 3GENA 4WG5A 5LCJA 3Q9XA 3RM7A 5HGIA 4I0TA 4O7VA 3HMMA 3ZBFA 3NCZA 2ZDUA 1U54A 4GUBA 4C38A 2OICA 5ACBC 2C6OA 4LV8A 2X4FA 5HE1A 4WNMA 2PPQA 4O4BB 4M14A 4AA5A 4M15A 2VTAA 4BDBA 4PRJA 1OUKA 3GC9A 4XHKB 4MHAA 2C3JA 2QD9A 5A4EA 5HU9A 3A8WA 5LVLA 4EYMA 4O7SA 4WOVA 3MBLA 4PUZA 3NFFB 3QCQA 2OF2A 2UVXA 2RIOA 1GZOA 2R9SA 3M11A 3H4JA 3O50A 3QC4A 3TUBA 2CCHA 4QNAA 4I20A 1XBAA 5JQ8A 4MH7A 4JOAA 2W1FA 4BC6A 4G9RA 3GU6A 2QC6A 3LJ0A 4L53A 3UMWA 5HLNA 1A48A 1OIQA 3ZEWA 1OPKA 1PW2A 5BUIA 5F4NA 3DV3A 4FG9A 3P5KA 2QOLA 3DNEA 3TN8A 5ICPA 4BR3A 2CNQA 3C51A 4XEYA 2QURA 2W9FB 4F64A 5KMLA 4FTUA 4RGJA 3UQGA 4ZOGA 4ZJIA 3MDYA 4OAVB 2XEZA 1PXOA 3G9NA 3W2QA 4RFZA 1CKIA 2OI4X 2V22A 3R8LA 4GV1A 4EORA 4YU2A 2QOOA 2P2IA 3BWJA 3ELJA 5DEWA 3ZFMA 4BHNA 3LXLA 4C3PA 4E20A 4S34A 3GCVA 3EQFA 4C4JA 3L9PA 3D15A 3JUHA 5EHYA 4WA9A 1S9JA 3TV4A 4ZS0A 3E3PA 4RIYB 2UW6A 1JWHA 4XV9A 4WRGA 2EB3A 4BGQA 3SRVB 2YCRA 3UE4A 4ANQA 3BLRA 4CFMA 4QTEA 2PUPA 3R9HA 3ETAA 4QP2A 5EYDA 4J8MA 2PWLA 3S95A 1F5QA 3EJ1A 3U4WA 3NUNA 3NAXA 3E8DA 5FDXA 4DINA 1OIYA 4BFMA 4EK5A 3I7BA 3BLQA 5A6NA 4PTEA 2OXXA 2VTMA 3MH3A 1H01A 4ITIA 5AUTA 1L3RE 2X7OA 4FSYA 4Y73A 4M13A 5H9BA 2VX3A 4ZSJA 4CTCA 1PMVA 1ZARA 4DFZE 4I93A 3ZO2A 3VBVA 1PY5A 3HLLA 5CU0A 1U5QA 4A9YA 3QRUA 3VBYA 2UZBA 2JDRA 4I5PA 2BHEA 1ZXEA 2OG8A 3RGFA 3AGLA 1YOJA 3EFJA 1J3HA 1OITA 4BKJA 2Y6MA 1J91A 5CXHA 1H1WA 5GJDA 5CT7A 5J1VA 2QU6A 1PXNA 3PY1A 3R7GA 2YCFA 3COIA 3WARA 3ZMMA 2UW4A 3DK7A 4R3PA 1NA7A 4L7FA 3Q96A 4UMRA 2O5KA 3QTXA 4QTAA 2A2AA 3PIZA 3LMGA 3KF7A 4ACHA 4W8DA 2YDJA 2UZLA 2XKEA 3V3VA 4FV9A 3ZCLA 2XYUA 2X9FA 3LCSA 4F1TA 4AW5A 1HCLA 4FSUA 3MH1A 4UALA 4UY9A 2BZHB 5HG5A 2ETMA 2QR8A 3I0QA 2X8EA 3VAPA 4XOYA 5IU2A 3HUCA 4AP7A 1YXVA 2W17A 3LCKA 3F2NA 3Q9YA 4FI1A 5HCZA 3VHEA 1SM2A 5AP0A 1ERKA 3Q9ZA 3OMVA 1G3NA 2QLQA 5EG3A 4FKWA 3VW6A 4D1XA 4LL0A 2C5VA 4OTWA 4QDEA 4E8AA 2CLXA 4IVAA 2WMSA 4FTAA 3EN5A 4MQ2A 1YXTA 4NM0A 3PZEA 2YIRA 4FTOA 4QMTA 3KXNA 4FEXA 4H3BA 4F6UA 4EI4A 2VAGA 5AUXA 3GFEA 3N4TA 3CCNA 3QTZA 5EOBA 2PUIA 3HA8A 3NNVA 3MB7A 2B55A 5E8UA 1W0XC 4ZTRA 5EW9A 4NH1A 2E9VA 3G5DA 2GPHA 2BAQA 2GNHA 3NYXA 3O5AA 5LJJA 4G16A 3PFYA 2QHNA 1OBGA 3OG7A 2CPKE 4NW5A 3ZLYA 4LM5A 4UZDA 4IZ5A 4USFA 5KX8A 2Z2WA 3KRWA 3PE2A 5BVKA 3TKHA 4DF3A 5IQGA 4QT1A 3NNUA 4M66A 3ZZWA 5HLWA 5HU3A 4FTNA 2UW9A 2XCHA 1JPAA 3K54A 3L9NA 4WNOA 3FE3A 4MD8E 1T46A 5AM7A 5JGAA 5ANGA 3DKGA 4YJRA 3TNHA 2FSOX 4EQCA 3A61A 4OLIA 2YAKA 2WMWA 3A62A 1OL6A 4NW6A 4LOOA 2GFCA 2VTRA 4ACGA 5JQ5A 2PHKA 4DG3E 5HBJA 2BCJA 3SGCA 2Y8OA 4GH2A 3C5IA 1XH7A 3L8SA 3D2IA 3KMMA 2YABA 5ACKA 4UEUA 5HNIX 2YIXA 4F9BA 5M57A 1SVEA 4IM3A 3FUPA 4IANA 4L43A 3RPYA 4YBJA 2GNGA 3P79A 2WEVA 4RMZA 3RWPA 5CSVA 2C5XA 2Y0AA 3SG9A 4A9UA 4JQ8A 2PUUA 4FKJA 4RC2A 4TN6A 4XG6A 1REKA 1UU3A 2W0JA 4C33A 4MAOA 2OZOA 2YACA 5E7RA 3C13A 4OBPA 2WTCA 4KBCA 3DDQA 3C0GA 4S33A 4BTMA 5BMMA 2UZOA 3JVSA 3N4UA 5J9LA 4P5QA 4ERKA 4MXCA 3HX4A 5EDRA 5FUTA 4EEVA 4WNKA 1VR2A 1WBSA 2HW6A 4HYUA 4N6ZA 2BRMA 3BBTB 3IO7A 3DCVA 4ZXTA 4I24A 3RI1A 5C1QB 4ZLYA 1PXIA 2JBPA 3OBJA 4AW0A 1JKSA 3LJ1A 3UOLA 4CFNA 1W83A 5EKOA 4ZSLA 2GNLA 5HD7A 3QCYA 3NSZA 4AA0A 4GT3A 3BPRA 3ERKA 3QWKA 4FOBA 2IPXA 3W0OA 4LI5A 2XK7A 3LVPA 5AP5A 2JEDA 3TZ7A 2XK8A 3O17A 3UP2A 5DFPA 1CKJA 3ZSGA 2WOUA 1FVTA 3VO3A 4A9RA 4CZTA 3HEGA 3D9VA 1QPCA 1U54B 4UWBA 1XO2B 5H3QA 3NIEA 4NUSA 2IEWA 3DAJA 2R3JA 4KINA 1K3AA 2PSQA 3CTJA 3IPHA 4BTFA 3E7VA 2X4ZA 3LJ2A 4CFUA 3NYVA 3DAKA 1YXXA 4XS2A 5D9HA 1QMZA 2CKQA 4WUNA 3ORLA 3FJQE 2PUNA 4ITJA 3VQHA 5KBQA 2ITQA 2R3QA 4CT2A 5I3OA 3R9OA 4RLKA 3R21A 1FINA 2I0YA 4JG6A 3DZQA 5BVEA 2XK6A 4BZNA 5LOHA 4R78A 2X8IA 4MXYA 4V01A 4OT5A 4IIRA 2XALA 3QXPA 3PVWA 4R5SA 5BYYA 3TKIA 3ID6C 4UYAA 3Q52A 3MFRA 1MRYA 3HUBA 4ZLZA 2WMAA 3BX5A 4R77A 5KZ0A 4UWYA 2C3KA 4IX4A 4FKOA 2Y6OA 4RWLA 4FT0A 5EK7A 1L8TA 4RPVA 4AUAA 5AUZA 2VGPA 3W0QA 4I6QA 3ACJA 1Q5KA 5J87A 4MNEA 4DH8A 4YZCA 1U5RA 3LFSA 2C5NA 3AMYA 4F78A 3FI8A 4M68A 5J1WA 3CY3A 4ZAUA 1AD5A 1VLRA 1KV2A 4AZTA 4NM5A 4BIDA 3VUMA 4DN5A 4EJ7A 1P2AA 1WVYA 1UKIA 5L4QA 1H00A 3ET7A 1PMEA 3F3ZA 4EH5A 3V5PA 1BX6A 4TYIA 1G8KA 1G8AA 2C1AA 3DBFA 2X8DA 4I41A 2HCKA 4M0YA 3CQEA 4FGBA 3R7VA 4YJQA 4DA5A 1JSUA 5K5NA 4S31A 4KWPA 2BFYA 3F7ZA 2GTNA 4TWCA 5DYJA 5L2SA 4W4YA 3TWJA 4AZSA 3N4VA 3POOA 2UZUE 1ST4A 2O65A 3UZPA 4LMUA 1H0VA 2BILB 1LUFA 3RBWA 3BV3A 4ACMA 2ZMDA 4EH7A 1ZLTA 3G33A 5E1SA 1PJKA 3PPJA 3CSVA 5IQIA 4YUQA 2VX0A 3AC8A 4BDHA 5LARA 4BDIA 3ZM4A 3PIYA 4EWHA 1ZYDA 3SG8A 5BYLA 1QPJA 2VRXA 3MVMA 4S30A 2B1PA 3BGZA 4XYFA 3S3IA 1PXKA 1WAKA 2B9JA 2XKFA 5HI2A 2R3HA 2VWXA 3MIAA 3VBTA 1XJDA 5L6PA 3RPOA 2A19B 2WNTA 3EN4A 2XAOA 4CXAA 3QLFA 4WG4A 1STCE 1UNHA 5GJFA 3BKBA 1DI9A 4RJ8A 4AN2A 4E5BA 2F7EE 4E5AX 3DKCA 4DFBA 2PVJA 2WD1A 3ALNA 1G5SA 2W5BA 4L8MA 3HNGA 1UU8A 4E6QA 3DXQA 2UZDA 3CLYA 4WHZA 3PLAE 3ZFXA 3F3VA 3QCXA 4JBOA 2YWPA 4WO5A 5JFWA 4TYHA 5IQBA 3W10A 2G2FA 4BCPA 3SW4A 2C30A 4QMXA 4N4SA 5JK3A 5AR4A 2YFXA 3DBCA 2ERZE 4CG8A 4FUYA 4NJDA 4FIGA 4LDTA 4IWDA 3FKLA 2EXEA 2B9HA 3V5TA 4FV0A 2QKRA 2RGPA 3LQ5A 4O21A 5TR6A 3TJDA 3A7IA 5KMJA 2XJ1A 4FSZA 3QBNA 4C2WA 2JAVA 4YPDA 2BDWA 1PXPA 3D5VA 1IASA 1RQQA 3REPA 2F7XE 1XHAA 3BHVA 4L01A 2YDIA 1BI7A 4BDDA 2WMVA 4ONAA 3CY2A 1FPUA 3F3TA 4O0XA 4TNBA 2R3RA 2X0OA 4LFIA 4UXQA 3R9NA 2C0IA 2HY81 3PSCA 1OL5A 3PVGA 4EHVA 3QL8A 3KRRA 3QHRA 5AV2A 4OTPA 4PMSA 3TIZA 3VJNA 5AP2A 5CANA 4DH7A 5FEDA 1PRYA 4KKEA 2OWBA 2J6MA 4IHPA 3PY0A 4L44A 4LYNA 3QQHA 5J8IA 4KA3A 3NVMB 4IB3A 2J5EA 2JDTA 3VUHA 2XNGA 5IF1A 2FO0A 4PNKA 1Q61A 4KB8A 2AC3A 1PMUA 3F9NA 1UWJA 3HDNA 3O0GA 3PJ3A 2YLFA 3QKLA 4P7EA 4XV2A 1SNUA 3RPVA 2R7BA 1ST0A 2O63A 3PJ2A 2HIWA 4QYYA 1CMKE 5DEYA 5EDPA 2W05A 1H27A 2Y9QA 4JT3A 3MJ2A 4O0UA 3U4UA 5CI7A 3TV6A 2Z7SA 5C9CA 4O4FA 5KO1A 2OGVA 3QTQA 4FSMA 2R7IA 2FSMX 2ITPA 3Q60A 3TL8A 4QPSA 4YJSA 3ZRKA 2IZUA 4ERWA 3Q5ZA 4JG8A 3DXNA 5AP4A 4BKZA 2WHBA 3PXRA 4D2TA 1CTPE 5DT3A 3QX4A 2P55A 1OZ1A 1VJYA 3NYOA 2F9GA 3L8XA 1OUYA 4G17A 3QD3A 4I5HA 4L42A 5ANEA 4GYGA 4BBEA 4DGLC 1OKWA 2XNBA 3NYNA 2CSNA 2PVRA 3OCSA 4OBOA 3ZZEA 5I0BA 4BWXA 3FMNA 3OT3A 4F0FA 2FYSA 1Y8YA 3IOKA 1NW1A 4CG9A 3GCQA 4Z16A 3JY9A 4GFOA 3RK9A 3SRVA 3ZYAA 4H1JA 4U81A 3VUGA 1PKGA 4KSPA 1Y6AA 4QTBA 3QXOA 2CKPA 4YHFA 1LPUA 3KXMA 4IACA 4EOKA 5HICA 1KWPA 4O7YA 2WFYA 1V1KA 3FHRA 4FZFB 3QRTA 2WEIA 3CJFA 3NLBA 3VUIA 4F65A 1REJA 2W4KA 4C8BA 3FAAA 5M4CA 4KABA 5HG7A 4EOOA 3PP0A 3M42A 4W9XA 5JEBA 2R64A 5K5XA 5HO8A 4KAOA 1R0PA 3H9RA 4KIPA 2CGVA 4NM7A 4U44A 3RK5A 4D1ZA 4EUTA 2DWBA 3NVKI 2RKUA 4NT4A 5F95A 4LV7A 4CMUA 5JGDA 1GIHA 3CC6A 1FGKA 5BVWA 5CF8A 1YHVA 3SW7A 4RWIA 4PQNA 4JS8A 2VTNA 3DBQA 2OK1A 1OGYA 2GS6A 3E8CA 3PA4A 3N9XA 4DDIA 4EH6A 4AZEA 3COHA 3EYGA 4KS7A 2WOTA 3QX2A 4FV7A 3M2WA 5E91A 3ZDIA 5GZ9A 2EUFB 5EI2A 5IMXA 1IAJA 2ZFYA 4FTQA 4AT4A 4EKLA 4FV6A 5FGKA 2E9PA 4FV8A 1V0OA 2OJIA 3PVUA 4MVFA 1YW2A 4BN1A 1KV1A 2W99B 3DZOA 4X2NA 4YURA 5M4FA 4DHFA 2LGCA 2QO2A 1XH8A 4EOJA 3NIZA 3HRFA 4UN0C 4LOQA 4O83A 2R3LA 3QZHA 5A4LA 3P9JA 3QD4A 3R2YA 4L7SA 4QP7A 2LAVA 4P5ZA 4X0MA 2W5AA 2XKCA 1K9AA 3PXQA 4RQVA 2UW7A 4PV0A 2GS7A 5E92A 4EH8A 3SXRA 4L67A 3AOXA 5IKWA 2CGUA 4FSTA 4HOKA 3UO4A 4QYHA 4DYMA 5IQAA 4FT3A 5HE3A 4HGSA 4U40A 1URWA 2ITYA 2R0IA 1M14A 4HVHA 5CALA 4YTFA 3HAMA 4TNDA 3FDNA 2C6KA 4FSWA 4I6FA 3TUCA 1W82A 3QQLA 3OOGA 4RA4A 3ZO3A 1UU7A 4YJUA 5HCYA 1NXKA 4EZ7A 4I1ZA 4G3FA 1YKRA 3TKUA 2ZV7A 4A4LA 3FXXA 3PLSA 4RJ7A 5AAGA 5E1EA 4EH9A 2YCQA 3NUAA 4QP3A 2ITZA 4X3FB 4FODA 4U0IA 3DB8A 2F2UA 4FSNA 3GI3A 4O27B 3LKMA 4Y5HA 5EKNA 2I1MA 2XZSA 4TKSA 3A7GA 5JT2A 3S00A 3U87A 3BGPA 5KMOA 3L8VA 2HENA 2UV2A 3PXZA 2R2PA 3NWWA 3EQDA 4Q5HA 5LXMA 3KL8A 4D9TA 4DT8A 4U9AA 4C36A 4E93A 5HD4A 5HE0A 4CQEA 3HMIA 3QKMA 4GK3A 4KUJA 1P4OA 5EM7A 5KMIA 3DLZA