1ZYJA

Human p38 map kinase in complex with inhibitor 1a
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
348
structure length
331
Chain Sequence
RPTFYRQELNKTIWEVPERYQNLSPVGGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLTRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 14
publication title Two classes of p38alpha MAP kinase inhibitors having a common diphenylether core but exhibiting divergent binding modes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 104
structure length 331
sequence length 348
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2005-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1zyjA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1zyjA01
5IA0A 2C6TA 2NP8A 3FC2A 4XUFA 3UIMA 1ZYSA 4EK8A 3MTLA 3QTRA 1H25A 4M84A 4OTQA 3R83A 1PXOA 4JG6A 3RK7A 2F2UA 4FV7A 3MJ2A 4P4CA 1URCA 1KOAA 1Y6BA 2CMWA 4FSRA 4EOOA 5KKRC 4X2FA 2ZM3A 3KL8A 4LI5A 4AA4A 3W2CA 3PDTA 2DQ7X 3QXPA 3BQCA 1J1BA 1F0QA 5B0XA 5BVNA 3UVRA 4O0UA 3OZ6A 3BRBA 4XV2A 2CCHA 2X4ZA 4MBJA 2YM4A 4IQ6A 3Q6WA 5BVFA 4LRMA 1DM2A 1RQQA 2QO9A 2UZUE 3NSZA 5DWRA 2EXMA 4OT5A 4CV9A 3DCVA 3D94A 4OAUC 3L9LA 4X3FC 4RIYB 1Y8YA 4FZAB 5TE0A 4CFXA 4F7LA 1DAYA 3BGZA 5L6WL 4G17A 4JIKA 1OMWA 4WSQA 5E92A 5FEQA 5HCXA 3U9CA 3ZOSA 4RJ3A 3RZBA 4FZFB 2CGXA 4BDBA 5E7RA 4Z3VA 3QHWA 4U79A 3GOKA 4B0GA 4V0GA 4K6ZA 4JAJA 4AP7A 3UQFA 5EOBA 1PMUA 1PXPA 4EQMA 1UNHA 4IAKA 2JDRA 5J79A 4U43A 3LJ2A 2ITQA 5K0KA 5BVDA 3ZUTA 1EH4A 1K9AA 2Q0NA 4BWPA 2XF0A 5K5XA 5M55A 4KRDA 5EM8A 3EZRA 3KRRA 1JWHA 2Z7LA 4C0TA 4MBIA 5J87A 4CNHA 4F1MA 4G6OA 3OWPA 3WZDA 3PUPA 3VHKA 2J4ZA 4TYGA 3GC7A 5A6NA 4MHAA 5L4QA 4O0VA 4EKKA 3D14A 4J97A 4PL4A 5CSHA 5CANA 1YXTA 3AD4A 1ZXEA 4HVSA 4D4SA 5AP5A 3NUAA 2HWOA 3LLAA 1H08A 2VWYA 1WCCA 3HEGA 4F0IA 1GOLA 1H1PA 1XH5A 2R3LA 3VS5A 3MB7A 1CMKE 2R3IA 3PLSA 3SRVB 4JQ8A 2PE0A 2UZDA 2YDIA 4GG7A 3SKCA 3VO3A 3MVHA 4FX3A 5A4LA 4YHTA 4XS2A 4O0YA 4LUDA 4UZDA 3W2PA 5TR6A 2OF4A 1KSWA 4MYGA 1H07A 1YVJA 3QKMA 4PTEA 2X7GA 3TNHA 4O86A 1WBSA 1NVRA 3C4XA 5T6KA 4OLIA 2OBJA 1JKTA 4QTBA 3EJ1A 4WG3A 1T46A 3KXNA 4DN5A 3VWAA 3FKLA 5JZNA 1UWHA 3ODYX 3NS9A 3OWJA 4ERWA 2VU3A 3VF8A 4RJ5A 4WA9A 4JBOA 2Y7JA 3B2TA 2E9NA 3MIYA 3KY2A 3NW5A 4TYIA 4M15A 4YTFA 1Q62A 4ANQA 2C5NA 4O7TA 1ND4A 5ICPA 3IW6A 1U4DA 4O6LA 5FWKK 3Q2JA 1H1RA 4OR5A 4RLLA 3R7VA 5FTQA 5IDPA 4DH3A 4E4LA 5GINE 2GS7A 4G6NA 3JR1A 1ZMVA 3AGMA 3W2SA 3LPBA 3H9OA 2C6EA 3PP0A 4Y73A 3UPXA 3OCGA 1U46A 1M7NA 5EK7A 1KUTA 5CU3A 3IG7A 4E8AA 3UOJA 3QCXA 5E8WA 3RPYA 4BIEA 4DEAA 2J0KA 3QZGA 1Q61A 2YIQA 3O2MA 4GMYA 2AC3A 2F4JA 3IDPA 4QMTA 3OBJA 4R7IA 3NIZA 3ORTA 3P23A 5E1EA 4FA2A 3CSVA 3QYZA 4E5AX 4EHZA 1W8CA 3QLFA 1IASA 4ACMA 3Q5IA 4HYHA 5DHJA 5E91A 5LMAA 4AAAA 3NWWA 4KIOA 4GH2A 4R5SA 2EU9A 2WQOA 5CT0A 4LMNA 3UMXA 4FEUA 3IO7A 2ZDTA 4UN0C 2DUVA 4H3PA 1XBAA 3CPBA 5IDNA 3AC5A 1GZ8A 2HZNA 4YJSA 3DLZA 4C4HA 5FP6A 5AAEA 3IS5A 4EK4A 3NVMB 2WMAA 4ANSA 3RWQA 5EG3A 3KFAA 4ZSAA 5EKNA 1XHAA 5HCYA 1IA9A 3HV7A 3RM7A 3KQ7A 3NYXA 4YJNA 4UMRA 3U9NA 3FZTA 5IMEA 1P2AA 1Q41A 4GU6A 4RA4A 3WF9A 2ITYA 4DFUA 4GEOA 5C4KA 1OUKA 3UDBA 3ZM9A 1IEPA 5DT0A 3TDVA 5CEIA 2X9EA 4TNDA 3FMNA 1ATPE 4AA0A 4D5KA 2YCFA 3R30A 3UNZA 5K5NA 5KO1A 4IX6A 3DAEA 4CRSA 2YFXA 3BYSA 3EHAA 4KS7A 4ACCA 4GK2A 3R7OA 3V8TA 5AAFA 4M69B 4P2KA 3PSCA 5LWNA 2QOFA 2XIRA 4IAFA 2J50A 1KOBA 2C0TA 5HLWA 3VQHA 3MA6A 2ZMDA 2BKZA 2C0IA 1SMHA 2W17A 5TKDA 3QTSA 3ZZWA 5LXMA 5M56A 4AOTA 4IDVA 4BDGA 4BDEA 4G3FA 5J9YA 4D9TA 4Y46A 5F94A 3NUYA 5M07A 4AZWA 3AC3A 4FT0A 1OB3A 5LOHA 5IQAA 2VD5A 5IQEA 2ETMA 3PXQA 4DFBA 4F63A 4NIFA 3ZS5A 4NT4A 3UTOA 3WF5A 4IWOA 2BILB 4OTWA 4CQEA 3UP2A 4UMPA 4J53A 4I20A 2C3JA 3F2RA 4QMYA 4RGJA 5FUTA 2WFYA 2X8DA 3JS2A 4J7BA 1KE5A 3OROA 4BKYA 2Y6OA 2UW9A 3QTZA 4BBEA 3CQWA 5CEKA 4AF3A 3QD3A 3I6UA 3SX9A 1OGUA 2C6MA 5E8UA 4YJQA 5JGBA 4FI1A 3C4FA 2WTVA 4WRSA 4L7FA 5JSMA 5IQCA 4ZJVA 4YSMA 3PIYA 2PZ5A 4M8TA 5CS6A 5IQBA 1OKYA 3R9OA 3E8DA 1DI8A 2C69A 4CG9A 3KVWA 3UQGA 3ZDIA 4E3CA 5DI1A 2LAVA 4E5BA 2F57A 1YRPA 4FTOA 5CXHA 4YZBA 5CSXA 2OJJA 3D5XA 4EH4A 4EOMA 2W99B 3OBGA 2PZIA 5TT7A 4MCVA 4A7CA 4BHNA 4IX3A 5EQPA 4HPUE 4OTPA 4NM5A 4AGDA 5IUGA 2VTPA 2YM7A 5AR7A 2Y8OA 5F20A 2NNWB 1GZNA 3MFSA 4DEHA 4EZ3A 4O7SA 4DT9A 4Y5QA 3NW7A 4BY9E 1JSVA 5KMNA 1S9IA 3FLZA 4D2VA 3OW3A 4EONA 5HG8A 3DAKA 4FKPA 4ZTNA 4KBCA 2R7BA 2XKEA 3MPTA 1IAJA 3SGCA 5HIEA 2UW6A 4P5QA 3AD6A 4PNIA 2E9PA 2FVDA 1F3MC 5B2KA 5KKRB 5CF5A 3VULA 5I3RA 4FL2A 4DHFA 3C4ZA 5ANJA 3QKKA 3VUMA 5FXSA 1YI6A 4R3CA 5HO7A 1XH4A 3UNJA 1UKHA 3O8TA 5J1WA 2GU8A 4YZNA 3U8WA 4XV3A 1OKVA 2I40A 2JKMA 2W96B 3LXNA 2PTKA 5CASA 5CF8A 5JGDA 3ZEWA 3AT2A 2OZAA 4R1YA 3TKIA 4FSMA 3BLQA 3QCQA 3JXWA 2KTYA 4RIWB 3SG9A 3O96A 2OSCA 5CVFA 3A4PA 4OBPA 1Q3WA 3EN6A 2VO7A 5HESA 3QD0A 4G5PA 2C5XA 3VUDA 3JYAA 1GJOA 4YZMA 3HRBA 3S3IA 2YISA 4QRCA 2YDJA 3DXQA 4C2VA 3IQ7A 3VUGA 4EOIA 3C5IA 5JRQA 2IG7A 4U80A 4G3EA 3CQEA 3Q9ZA 4FTRA 4XG8A 2VZ6A 4KD1A 1S9JA 4MBLA 2Q83A 5D7VA 3PWYA 4FG8A 2YITA 3PXFA 3UJGA 3N4TA 2XNGA 1GIIA 3QF9A 4AZVA 4DBNA 4FYNA 3QWJA 3H9RA 3PP1A 1ZAOA 4HGTA 4RX9A 3N4UA 1Q24A 2I0EA 4D58A 3E62A 2FB8A 4D9UA 4XG9A 1Q97A 4IIRA 2X7FA 1YOLA 4JNWA 4QYEA 2WTWA 5TOZA 4Q9SA 4USEA 4BRXA 4TN6A 4IC8A 3PE1A 4EH3A 3O23A 2GQRA 5EI6A 3ZH8A 4AG8A 4YZDA 5HBHA 4Q2AA 4YO4A 1HCLA 4PP7A 4HJOA 5DMZA 3NUSA 4JBPA 4L43A 1JAMA 4M97A 5D1JA 2OJGA 1WBOA 2VN9A 4F64A 5B7VA 4R7BA 3HMNA 3VIDA 3DK7A 3ORXA 3K5UA 1OKWA 4HPTE 4L8MA 3ACKA 4APPA 4NUSA 3GXLA 2RSVA 3NIEA 1AQ1A 4NM3A 2FYSA 4RIYA 3TNIA 2UZNA 3IGOA 4A9TA 3IDBA 4QP3A 4C61A 3QQFA 3HDNA 3VS4A 2B9FA 4GUBA 1A48A 5EQEA 5E9EA 1M52A 4A4XA 4O6EA 3P1AA 3RK9A 3MVLA 4EZ7A 4MXCA 4YMJA 5CXZA 2P2IA 4ACHA 4F9BA 5KBRA 2PVFA 2E9VA 1T45A 1WBTA 2ITNA 3UYTA 4I6HA 4GU9A 2Y4IC 1NA7A 4MD9E 4NZWB 4NTSA 3QYWA 3ZBXA 3QRTA 5IUIA 4CTBA 2ITTA 1OL7A 5AUXA 4QP6A 3QZIA 3Q9WA 4QMPA 5FM2A 5HNBA 3R7UA 4CD0A 3MY0A 4WBBB 2VTQA 2QNJA 2V62A 4K0YA 4MXYA 3RPOA 4DGMA 2BFYA 5AADA 5IEVA 5AUTA 3E92A 4IX4A 4DT8A 3OMVA 2XNMA 4DITA 5CAQA 1OVEA 5CI7A 5FXRA 1H1SA 1DAWA 3KXHA 3PVWA 3TACA 4FUXA 4D0XA 2VTIA 4F6SA 1ZMWA 5DA3A 2YABA 5IQDA 3A7GA 4L46A 3G2FA 4N4SA 1UNGA 2V55A 4J52A 5F9EA 4JQ7A 3OCTA 4ANMA 4HNIA 4MF1A 3LHJA 4OTIA 3F9NA 1Y8GA 5I9UA 5JH6A 4QP9A 4FTMA 2YIYA 3LJ1A 1J91A 2XYUA 2P55A 2RG5A 3SXRA 1KV2A 4OGRA 5LVOA 2RIOA 2UZVA 2PMIA 4WG5A 5AJQA 4FE2A 1Q8TA 3CGOA 3L1SA 3NDMA 4I6BA 4MD8E 4JQEA 4ASDA 3CS9A 3BYUA 3DXNA 3N51A 4NEUA 3WZKA 4K1BA 1W84A 5D10A 4D4YA 3FMDA 3TIYA 3OY3A 4DYMA 5AV4A 3FI8A 2WMUA 1UWJA 4S31A 4XBRA 5BMMA 1ZY5A 5CVHA 2E9UA 5CEQA 3GBZA 5DR2A 1Q8ZA 3PVUA 4Z16A 1F5QA 4KIQA 5DT3A 1YWNA 4UX9A 5HE3A 4LUEA 1Q5KA 5JT2A 3KREA 5FQDC 3DY7A 5AUWA 5AV2A 3I5NA 4BCPA 3O8UA 1R78A 3MIAA 5H9BA 4BB4A 1OBGA 3Q4UA 3SQQA 3MSSA 4HCVA 3HZTA 4FT9A 4TXCA 2PY3A 1OITA 4WD5A 3ZONA 3UZTA 4FC0A 2IJMA 4C3FA 4F0GA 2GQGA 3B8QA 4JS8A 2GTNA 3U6JA 4DTBA 2C4GA 1URWA 2B9IA 3DBCA 4GT3A 1FVRA 2VTLA 1M2RA 3ZBFA 4ENYA 5BYLA 2OGVA 3LFFA 3F3VA 3H9FA 3HP5A 5CENA 4BF2A 4GV1A 3DDPA 2R5TA 3UE4A 4H3BA 1BKXA 2V5QA 3LM5A 4CFNA 2OZOA 5E8YA 3GU6A 5D12A 2VTTA 4D4RA 4IZ5A 4A9SA 4R8QA 4RWKA 3CP9A 5BQ0A 3A7FA 4H58A 3QD2B 4FOCA 2C68A 3QRJA 4GYGA 4P90A 3TXOA 1PKGA 2WB8A 4NTTA 4TRLA 2VTJA 3ZO4A 4AW1A 2CN5A 4JDJA 3ZMMA 2WEVA 3A7HA 4QYHA 5EFQA 3V5JA 4C59A 4EOPA 4J95A 4XYFA 4W8EA 2W05A 1FGIA 1ZYJA 2HW6A 1ZZ2A 4FK3A 2OFVA 1CM8A 3ORKA 3CD3A 3NR9A 5CT7A 3QUDA 3PA4A 5HEZA 2BRBA 2E2BA 2QG5A 4X3JA 3GU7A 3PG1A 2OXDA 3RVGA 3GC9A 3OEFX 3ZC5A 3Q2MA 4WT6A 4C35A 2IZSA 3ELJA 4D55A 5B2MA 2B9JA 3PLAE 1O6KA 3ZSGA 4AN9A 4EL9A 4FV3A 3R22A 1UVRA 4IVCA 3NYVA 3UG1A 3OEZA 4FEVA 2WIHA 4OTDA 3WIKA 4S2ZA 3LKMA 2W4JA 3FMHA 4N0SA 3EOCA 3W10A 3TN8A 4EH8A 5L8KA 4O22A 3TNPC 4B8LA 4AGCA 3PXYA 3F3UA 1L8TA 3FQEA 4XBUA 2XH5A 2BDWA 5KUPA 3TV7A 3KVXA 3DB6A 3E63A 1WBNA 4BYJA 4TYJA 4ARKA 4F7JA 5AAGA 4B6LA 4BDJA 5CAUA 3HNGA 3OVVA 4AX8A 2BAKA 2UW7A 4M13A 2JGZA 3CGFA 2F49A 5DEWA 3KC3A 2YM6A 2G2HA 4MNEB 4EBVA 3BE9A 2J0LA 5HBJA 4K18A 4O7RA 4DGLC 2XIZA 3OXZA 4R3RA 4DLIA 1QPCA 4W9XA 4EQUA 4S30A 4YTIA 1HOWA 4FR4A 2G9XA 2WZJA 5DRDA 1M2QA 5HNIX 4O81A 2WMXA 3QQLA 3RP9A 4YC6A 4L3LA 4W8DA 5AP4A 4BDAA 4F9YA 4RFYA 4FNXA 1PF8A 1TQPA 3LFDA 4C33A 5LCJA 1PXKA 3EMGA 4NW6A 3EQGA 5GJFA 2HAKA 3W2OA 3KMMA 4ANOA 1R0EA 4CT1A 4EUUA 1KE9A 3FAAA 4MQ2A 5CNOA 5F1ZA 3GC0A 4PPBA 4D1XA 4RPVA 1J7UA 4MVFA 4MK0A 3FXZA 4O0RA 1XKKA 5AUZA 4OTGA 3OF0A 1R39A 3B8RA 4JRVA 3LIJA 4O38A 4C7TA 4HCUA 2VTRA 3PPKA 3G9NA 3WARA 5M4FA 2JDVA 2ERZE 4JR3A 2XIXA 4F1TA 3Q4TA 4JDHA 1JSUA 5ANIA 4EH9A 2QG7A 2FUMA 3ITZA 4QTAA 5JQ8A 2O3PA 4TTHB 3T9IA 2BFXA 3EYHA 2Z7QA 3NLBA 4G1WA 5KE0A 3P79A 4USFA 5IQFA 2CDZA 1OZ1A 2YM3A 3EKNA 3ERKA 3NGAA 2GCDA 4FSQA 4PP9A 3EQIA 4FKWA 3ZFMA 2FO0A 3F69A 4A07A 4C4IA 2JIIA 5A3XA 5BUEA 3R8PA 1I09A 2XNEA 3LFSA 2FSOX 3QA8A 4PWNA 4QO9A 5AFVA 3GCQA 4M7IA 4RJ4A 5M57A 1GY3A 1UU7A 3C7QA 5EW8A 5L8JA 5M08A 4CFMA 4NWMA 2WO6A 4KIPA 2QU6A 4O2ZA 3NNUA 3DS6A 3VS1A 3D7ZA 4FKRA 4X3FA 2QLQA 4PDPA 4QMNA 5IEXA 1XBCA 2XKCA 2HXQA 4KSPA 4IDTA 4U7ZA 3ZLXA 2ZV9A 3DKOA 1O6YA 1YXVA 2PVJA 1PXNA 3P7BA 3KXZA 3QD4A 3U87A 2B1PA 4CZYB 1XH7A 3WZUA 3DBFA 4EYMA 5H2UA 2JC6A 2JKQA 2O0UA 4CFUA 4CCBA 3S1HA 4FL3A 3MDYA 2OJ9A 4ZIMA 2EVAA 4UY9A 3DXPA 3VS6A 2BROA 3DQWA 4XEYA 2ITOA 5DH3A 2XNPA 4Y5HA 5HE1A 5HIDA 3ZO3A 4MD7E 3S2PA 2C5YA 4IM3A 3NNXA 3WYYA 4IX5A 4DTKA 3SC1A 2HY81 3FZPA 3PJ3A 3FSKA 3GQIA 2J5FA 1PKDA 2B7AA 3P0MA 3TV6A 2X7OA 3HUCA 5HICA 3BE2A 2ZOQA 3P86A 3GU4A 4HNFA 4G6LA 3HP2A 4U6RA 4DEDA 5CU4A 4KKHA 4CZUA 2WAJA 3GUBA 1H27A 3B2WA 3IK3A 4KINA 1BMKA 3FLSA 3FYKX 4DF3A 2XZSA 3R1SA 5IA5A 4XMOA 1TQIA 3K3JA 4DFZE 4E4XA 1WVWA 2XEYA 2ETRA 4AOIA 4FTKA 1XH9A 3BCEA 3BV2A 4BZDA 1B38A 3FL4A 4FTNA 4IAIA 4D2PA 1OL6A 4D1SA 3NCZA 4EQCA 2I7QA 3LOKA 3KCKA 4O0SA 2WMBA 3GC8A 4F99A 1JQHA 2IZTA 2X81A 4MNFA 2ERKA 4L7SA 4ZOGA 3TT0A 4N57A 3TZ8A 4MAOA 3SD0A 4FSUA 3EQHA 2FH9A 4RWIA 4NM0A 5FEEA 3CBLA 1UKIA 5AUVA 5HZNA 5DFPA 4QYGA 5AP3A 2OJIA 5BNJA 2YJRA 1SVGA 3BBTB 3UODA 5E8XA 2QR8A 5DEYA 3BPRA 4GFMA 2F2CB 4W4VA 2Z2WA 2YLEA 2JBOA 4JR7A 2CKQA 5A46A 3M11A 4YJPA 5K3YA 1PYXA 3PSBA 4H36A 5CQWA 4IE9A 1P14A 1U54B 3UOKA 5BPYA 4X2GA 3SVVA 3C0HA 1P5EA 1B6CB 3DPKA 1JLUE 4UMQA 4CMOA 3PFQA 2I0HA 5E1SA 5J8IA 4C37A 3FSFA 4F1OA 3GNIB 4BBFA 3ORLA 1QPJA 4U0IA 5CSPA 3HMOA 3PXKA 2PVLA 4UEUA 3A99A 5ACBC 3C0GA 1KV1A 3KRJA 4XLVA 1FOTA 4Q5HA 3RWPA 1LP4A 3I0QA 5EW3A 3HMPA 3TIZA 4FZ6A 3SHEA 1HCKA 1OKZA 3V5WA 3VS7A 3MESA 1MRVA 1UA2A 3DT1A 4H05A 2X6EA 4BCIA 2B54A 3A8XA 5KMLA 2CSNA 2VNWA 3F5PA 3LCOA 3CTJA 4TYEA 4BC6A 4O83A 3O51A 3DNEA 2W5HA 2XK9A 3HV3A 3A62A 5CLPA 1OL5A 3DA6A 1ZYDA 3AT3A 1VZOA 3PA3A 4PQNA 3LCTA 4RZWA 1RE8A 3MFTA 4XG2A 5A4TA 4ERKA 4DEIA 4QQJA 4JDKA 4GT5A 3D2KA 4FKUA 5DLSA 3DQXA 4D4VA 2PPQA 2OH4A 1OL2A 3AT4A 2UUEA 3AC2A 2C5OA 3LFNA 4BCHA 3PXRA 2WQNA 4W9WA 4BTJA 5FDXA 3NAXA 4C3RA 4DGGA 4YJOA 1PW2A 2A27A 3PPJA 4HCTA 4KIKB 3V8WA 2P3GX 4FNYA 1RW8A 1XJDA 3V04A 4PX6A 5C27A 3VW8A 4FV4A 2YIWA 4I0RA 2W0JA 4BKJA 3WILA 3QL8A 5HVJA 5LVPA 4NKAA 2C6DA 4BDDA 4O21A 3IW7A 2LGCA 3FQHA 3R2YA 4I6FA 3FBVA 1XR1A 4IC7A 4RLKA 2O2UA 4L67A 4ANBA 3FE3A 2W1GA 4FKJA 3LFBA 5M51A 3FUPA 4PDYA 4U44A 2XMYA 2VWXA 3P5KA 3P78A 2J90A 4GVAA 4ZZMA 5A4QA 3BU3A 4E73A 5AP6A 1DI9A 2XA4A 3LFQA 2YDKA 4F6UA 2IVUA 1JSTA 4FV1A 3PTGA 4DE4A 5LMKC 4O96A 1ZWSA 4I5MA 5J7BA 3L8VA 3VS2A 4A4LA 4ZS4A 4JL9A 5L6OA 3LAUA 5EHLA 2UZBA 4BWXA 2A2AA 4Q5EA 2UW3A 1MRYA 3BLRA 1NVSA 2XCHA 3LXPA 5FG8A 2IVTA 3WOWA 4A06A 3U6IA 4XOYA 5M4UA 4O7WA 2QC6A 4FOBA 2B4SB 3MV5A 3KF7A 1G8AA 2HW7A 5JMSA 5FTGA 3W55A 3HUBA 1QL6A 5IG1A 2GS6A 3CTHA 4R3PA 5A14A 3GGFA 2BRNA 2V22A 4OBQA 4L9IA 4IM2A 4M67A 3FEGA 4E4MA 1WVXA 4TNBA 5FBOA 5BX0A 4G9RA 2J2IB 2OJFE 4MWIA 2W4OA 3KMUA 3SDJA 3PXZA 5FXQA 3BHHA 3A4OX 4EI4A 5LMBA 2WQMA 4RX7A 4F9CA 4EOJA 2OXXA 2WMVA 3DKCA 3T9TA 3TNQB 1VJYA 4NFMA 4EOKA 2I6LA 5L2TA 1FVVA 4FSTA 4L6QA 4AFJA 3FMKA 1B39A 2XUUA 2QCSA 3DTCA 4AT3A 5CNNA 5CSWA 4DFLA 2R0IA 3RBWA 4PMSA 4EK6A 3FXWA 4IW0A 2P33A 3H3CA 5E8VA 3C4WA 3WBLA 5EM6A 4AACA 4P5ZA 2G1TA 4BDCA 3N9XA 4LL0A 5EI8A 3VUKA 4XRJA 5ETAA 4FL1A 1Q3DA 1PY5A 4FKQA 3REPA 3HYHA 2VTMA 3WF7A 2XKDA 3ORPA 5LQFA 2GHMA 4TYHA 1Y6AA 2PHKA 4F4PA 3D9VA 4J8MA 3EQFA 3QRUA 3THBA 4BZOA 5I9XA 3SAYA 3CJFA 3FHRA 2W1FA 3PJ1A 5CQUA 5EYCA 4ZTSA 3TL8A 3QRIA 1OIRA 2FSMX 4BFMA 3MI9A 2C3IB 3CQUA 4BCFA 4NFNA 2ZB1A 3TTIA 3EZVA 3QRKA 3VRYA 3W2RA 2OO8X 3RK5A 2V7OA 3LLTA 3F5GA 3COMA 3QAME 4JX3A 4N70A 3VBTA 2WTCA 2X6DA 2V7AA 3Q4ZA 5DRBA 3ROYA 3DJ5A 2YLFA 4WRGA 3G51A 4NCTC 3VHEA 3HMIA 3PYYA 5L2SA 3BEGA 3QQKA 4E5WA 1PXLA 4B4LA 4UZHA 2Z7RA 4WUAA 5C01A 3H4JA 2XNBA 4RJ7A 4ASXA 5AA8A 3R1QA 5A4CA 5KBQA 4FEWA 3NEWA 4IVDA 2CGWA 3ZEPA 1ZYLA 3OP5A 5AV0A 3KN5A 3GI3A 4J98A 5HVYA 4YPDA 2FA2A 3RHKA 4LFIA 4XLIA 4CKIA 2OK1A 2Z02A 4FYOA 1ZARA 4GRBA 3ZUUA 4CFWA 4ZJJA 4OW8A 2WOTA 2Y9QA 4RT7A 3TJDA 3ID6C 3DOGA 3OT3A 2UZWE 1GZOA 4FT5A 3A61A 5GZAA 3TZ7A 5IQIA 3C0IA 4PMTA 4RG0A 5BVWA 5KMJA 2RGPA 1JNKA 3EIDA 4BCNA 4D2RA 4EYJA 3IDCA 3IKAA 3EH9A 1E9HA 4L3JA 5AIRA 5JFSA 4ZMFA 3FPMA 4UMUA 4IBMA 4MX9A 4DG0E 4TW9A 2RFEA 2ZV8A 4ZP5A 1UNLA 5C9CA 4BCOA 2GFCA 3O17A 2J0JA 4ZLYA 3HAMA 4DH7A 2J5EA 4YJVA 3ANQA 3U4UA 3G15A 1YW2A 4UB7A 4RIOA 4QMZA 3QTIA 1SNXA 4RZVA 3G0FA 4R6VA 2ZB0A 3FY2A 5KMIA 4I41A 1AD5A 5HI2A 4QMLA 5CAPA 2BR1A 4I4EA 5TO8A 2R3FA 5AP0A 3NUNA 5A6OA 4AZSA 2PZYA 3BIZA 5EYMA 4GUEA 2RFSA 5JFVA 4FZ7A 3Q9YA 5KMKA 2QOKA 3D7TA 4J1RA 2JITA 2PMLX 2WMRA 1YDRE 2A0CX 3TM0A 4IAAA 2VO0A 5IKWA 4DBXA 4CTCA 4EH2A 2PUNA 4O7NA 2AC5A 4XH6A 2IO6A 3ZO1A 1CKIA 3P7CA 3KULB 1APME 4RVKA 3HV6A 2I0YA 4U5JA 3LCSA 4WBOA 2YHVA 3R21A 3ROCA 4M66A 2OG8A 2WGJA 4QT1A 4CGAA 4AS0A 3GQLA 4FKLA 5CF6A 1H01A 2YM8A 3KB7A 2BHHA 2Y0AA 5G6VA 4FEXA 5IA3A 3KXXA 3GCPA 4C2WA 4I6QA 2J51A 3BGPA 4N6YA 1BUHA 3R02A 4TWNA 3NCGA 2QI8A 4F6WA 3F3ZA 4UYNA 5L2IA 5J7HA 2VX0A 4UV0A 3BYMA 2BMCA 3ODZX 4FTIA 1LR4A 3SV0A 4NJDA 2X8EA 4FTCA 4BYIA 3LVPA 5DN3A 4XHKB 1IRKA 4ZXTA 5CY3A 2BTSA 4WO5A 2PVNA 4EJNA 3FJQE 3RALA 5J5SA 3QQJA 3R73A 4QQ5A 4RIXB 5L2WA 1XQZA 3MPMA 2BPMA 3VNTA 3R71A 4O7ZA 2YERA 1KE7A 3MH1A 4QP4A 5I5ZA 4ORKA 1PHKA 3N4VA 4ANNA 3ALNA 2E9OA 2SRCA 5ETIA 4EZ5A 4EWQA 4WUNA 5J1VA 1YKRA 5I3OA 3ATTA 4H39A 3JPVA 4G3GA 2WEIA 4YHJA 5AMNA 3RAIA 5AA9A 3QZHA 3MPAA 4L53A 3E8EA 4G3CA 3TUDA 3WZEA 2XVDA 2WIPA 3G0EA 3FHIA 5CZIA 4O82A 3PG3A 2CGVA 1WMKA 2HIWA 2XK7A 5CSVA 5EH0A 4K77A 2PWLA 5FEDA 1FBNA 2PVMA 3ANRA 4E4NA 3AMYA 3QX2A 2R3HA 3D2IA 2BZJA 4ZSLA 4LM5A 2W5AA 3QBNA 3E93A 4NSTA 4ALVA 5D41A 3DJ7A 1PXMA 2WMQA 4AT4A 3AC8A 4OT6A 5IMXA 5LVMA 3G90X 4MQ1A 1REJA 1JKSA 2YA9A 5EOLA 1DS5A 4EKLA 4H1MA 3LXKA 4BIBA 1IG1A 2XP2A 5AP1A 2O64A 5A9UA 1P4OA 4IAZA 3UQCA 1H0WA 1ZLTA 4YBJA 3ZFXA 4C62A 3PVGA 3DZOA 3OW4A 3EFKA 4H1JA 4LRJA 2F9GA 3FMJA 4U9AA 2G15A 3TI1A 2C6OA 3H0ZA 3SXFA 3I7CA 3EFWA 1YDSE 3POOA 2UW0A 4AUAA 4CMTA 2QODA 3SRVA 3CJGA 5HCZA 4MTAA 1Q8UA 4AU8A 2HYYA 3AOXA 2H34A 2JFLA 3GP0A 4BL1A 5CU0A 1RDQE 1GNGA 4YLJA 2OIQA 4FVQA 4Y83A 1R1WA 3CPCA 4NJ3A 2IW8A 4QYYA 4AZTA 2QOQA 4YP8A 4F0FA 5CEMA 4U97A 2WPAA 4G5JA 2CPKE 3NYNA 2FSTX 4BI2A 2B52A 4DFYA 4DINA 3OWKA 4JX7A 5H8GA 3RCJA 3W8LA 2ZV7A 3NRMA 4C02A 2BZHB 3UPZA 4JLCA 2ZMCA 4DGOA 5HQ0A 3V5QA 1FGKA 2WD1A 3HDMA 4FGBA 4IWQA 4QQCA 2JDSA 1OM1A 5HTBA 3PSDA 4QD6A 4PTGA 4QP7A 3S0OA 4L44A 4C34A 4CYIA 4Y95A 4C4GA 3CE3A 3PIXA 4QTEA 3HECA 1XH8A 2GFSA 4KBKA 4E7WA 3PY0A 4KABA 4G3DA 1J7LA 3WI6A 4ZMEA 5H8EA 3II5A 3GEQA 1M7QA 2GQSA 5DVRA 1OIQA 4TWCA 2B9HA 4I93A 5HORA 4O1PA 4GFGA 3NZ0A 4I21A 2WMTA 4DEGA 3NVKI 3C1XA 2WELA 3Q96A 1ZY4A 2CN8A 4K9YA 4Y72A 4LGDA 1PMEA 2JEDA 5E8TA 3UO4A 2UW8A 3ALOA 3F7WA 3K3IA 4XG4A 4C4JA 4D5HA 3U51A 4PDSA 3V3VA 4R78A 4DCAA 4AN2A 3MVMA 5JEBA 3ZUVA 3SOCA 2DWBA 3MGYA 2OFUA 3DGKA 2QOHA 4IADA 3NAYA 5DGZA 2YAKA 4BDIA 4II5A 5EHYA 4IJ9A 2QHMA 1V1KA 3OHTA 3PJ2A 1WBPA 2UZEA 4UMTA 3FPQA 3RTPA 1OECA 3DDQA 3KXMA 1U5RA 4EK5A 3R00A 4L00A 3GCSA 2C30A 4KKEA 4K11A 3RCDA 3VBWA 4ACDA 4DGNA 3HA6A 3QU0A 2QOIA 4CSVA 5HX8A 3MBLA 3JY0A 3BHUA 4ALWA 2ESMA 3KGAA 3NPCA 4ZS0A 4ZSJA 4WSYA 3UIBA 2NO3A 3CD8A 4CVAA 4BGHA 4ITHA 3VN9A 3R7GA 4EORA 4O0WA 1J3HA 4Q9ZA 2ITXA 4EHEA 5IQHA 5JGAA 2PE1A 4XV9A 4Z55A 2VWVA 4M69A 3HL7A 5FM3A 2OIDA 2B53A 4OBOA 4AGWA 4EEVA 3VF9A 3U4WA 2YZLA 4F9WA 1MRUA 3FDNA 4X6QC 3R9RA 1G8SA 5HNGA 2BIYA 4JG8A 4XX9A 5AP2A 3FV8A 4DH5A 1VEBA 3TWJA 1H24A 3NYOA 5KZIA 1PJKA 4ASZA 1YXUA 4MH7A 4ONAA 2ZYBA 3BLHA 5DR9A 3F61A 3ZU7A 4YHFA 1BL6A 2GTMA 2PUIA 2JKOA 3BGQA 1BL7A 3QTWA 4FGRA 3ORNA 2XK3A 2PMNX 2GHGA 3MH2A 4D28A 5ANKA 1NY3A 3DKFA 2JAMA 3ACJA 4WIHA 5HG5A 3TZ9A 3VRZA 3ZXTA 3JVSA 5M53A 4NYEA 3C13A 3Q6UA 3LFCA 4ZAUA 4FTLA 2DYLA 5C1QB 2CKOA 2R3PA 3FLNC 3DBQA 3CCNA 4LG4A 2DS1A 3U55A 3CR0A 3GU5A 4CFFA 4A9RA 1O6LA 1YXXA 4I23A 4AW0A 3LJ0A 4WHZA 3SW7A 4AE6A 4OTRA 3AMBA 1IA8A 4ZEGA 3R7IA 4KUJA 3T8OA 5L6PA 4BI1A 2QO2A 3LFAA 4NIFB 4YURA 4PTCA 4R77A 3FC1X 4I94A 4E20A 3E7OA 2GNHA 4HOKA 4YLKA 3KRLA 1JPAA 3HGKA 2RG6A 4UBAA 3BELA 3HV5A 3HRCA 2IVSA 2VGPA 1O9UA 3QTQA 4F08A 1W0XC 1U5QA 4JT3A 2AYPA 4LMUA 4ASEA 2HENA 4CQGA 3NUXA 1NT2A 2R3MA 4PY1A 3LXLA 5M44A 1OPLA 5EDRA 3BYOA 4QPAA 1WBWA 2RFDA 4GG5A 2X8IA 4CV8A 5I9VA 3CKXA 3OC1A 5DIAA 4DFNA 3R8VA 3A7IA 3OUKA 4IJPA 1U59A 4HVGA 1CTPE 3UVQA 2GNIA 3FQSA 4U41A 4EK3A 3E88A 4Z7GA 2ZVAA 2C1BA 2XB7A 2GNLA 1WAKA 4M12A 5IH6A 3ZSHA 1NXKA 1G3NA 2R0UA 4ACGA 2REIA 2XJ1A 2Z60A 4UWCA 3Q9XA 3O8PA 4ITJA 2XYNA 1PXIA 2R4BA 4GJ2A 2BZIB 4FTUA 1H8FA 2ITVA 3FL5A 5LARA 5IZFA 5L8LA 2W1EA 4AE9A 4YPSA 3DV3A 2BCJA 2G2FA 5E4HA 4TKSA 4RVTA 3GVUA 4QP8A 4JBVA 1ZRZA 2F7XE 3R9HA 3F88A 1Z9XA 4K33A 4CXAA 1JKKA 3MH0A 4RJ6A 4IEBA 2EB3A 4GL9A 4J8NA 4S32A 5ITAA 1BX6A 3FMEA 4RIWA 3PY3A 5A4EA 3JUHA 4FV2A 4IB1A 3OD6X 4DC2A 2O5KA 4FV8A 3VS3A 3RNYA 4FVRA 2UV2A 5C8NA 3IOPA 2CNQA 2JIVA 3EKKA 5AX3A 5HE0A 4O7VA 3BKBA 3G33A 5KCVA 3BI6A 2WQEA 2GDOA 3RPSA 5H3QA 3TKHA 3UG2A 3FKNA 4I5HA 2UW4A 2VO3A 2G01A 2OWBA 3E8NA 4HVHA 4U3ZA 4ZZOA 3SLSA 2HK5A 4XG7A 4D2SA 2VTNA 5LCKA 4QTDA 2HWPA 2OZAB 2ITWA 5A54A 5I9ZA 3FWQA 3F5UA 4CFVA 1PYEA 2GNGA 1LPUA 1V0PA 5DG5A 2PYWA 4JG7A 2CKPA 2VTHA 3DAJA 5IA2A 1FPUA 4M0ZA 4QTCA 3E3BX 4YO6A 3TNWA 5EW9A 4GS6A 5BYZA 2X0GA 4IANA 1Q99A 5ANEA 2PULA 3R8MA 3D0EA 4XCUA 1TVOA 2QO7A 1WBVA 4BDHA 5ACKA 5IU2A 1R3CA 4LRKA 4YNOA 5FP5A 4BN1A 3OXTA 3UIXA 1YOMA 3TTJA 4V01A 2OH0E 1W82A 5J5TA 2P2HA 4XG6A 3V8SA 4KBAA 1XH6A 4GCJA 1YQJA 3S00A 1OI9A 2ZAZA 3QC9A 1M17A 4BWKA 5M4IA 3FMLA 3POZA 4HYUA 4MEDA 4F70A 5GHVA 2QOCA 2CHLA 4GIIA 4PL3A 3G5DA 5AIKA 4PMPA 5HLNA 3VJOA 4HYIA 1K2PA 3H10A 4XP0A 4E6AA 3W33A 4U3YA 5IF1A 1LEWA 4LOPA 3GENA 2OXYA 4C57A 2HZ4A 2QLUA 2CGUA 1IR3A 4FSYA 3VBXA 3FI3A 3MB6A 2A1AB 2BVAA 4OAVB 4YSJA 4FVPA 5EDQA 2EB2A 3O0GA 2BRMA 4L3PA 2RL5A 3ETAA 3C5UA 3FMMA 4TWOA 1BI8A 2H9VA 3I1AA 3IW4A 5B2LA 1KWPA 4KAOA 2WTKB 3W8QA 3R2BA 4YGAA 3DZQA 4RA5A 4H3QA 3D5VA 3VBQA 4GJ3A 2JAVA 4GW8A 5D7AA 5KMOA 2ONLC 3R8ZA 3MH3A 5AR2A 3MS9A 4P7EA 1QPEA 4QP2A 5CF4A 5C8KA 2YACA 4TPTA 2QKRA 2WU7A 2EWAA 3QALE 1BI7A 5HE2A 4J71A 4EBWA 3LM0A 4OTFA 3LE6A 2VWZA 5LMKA 4YNEA 3ZCLA 5CALA 5IQGA 3RNIA 3VUTA 2CJMA 2C3KA 2X2LA 3ENMA 2XBJA 3HMMA 3IPHA 2PE2A 4HYSA 5M09A 1OIYA 4UXLA 2YWVA 4DCEA 2XM8A 4GSBA 2Q0BA 4E6QA 2JKKA 5FRIA 1IAHA 4FTTA 3E7VA 4M68A 4CEGA 3KRXA 3QQGA 1FQ1B 5IA1A 4FICA 4AT5A 4OUCA 2UVYA 5HU3A 3FKOA 4FIFA 4IAYA 5AV1A 3S95A 3I0OA 3VS0A 4CCUA 4ZTMA 2PU8A 3AGLA 5LWMA 4GK4A 2BAJA 2WNTA 3COKA 3NW6A 3PWDA 3SW4A 3UOLA 3V51A 4ZY5A 5KHWA 4C58A 3MWUA 3KF4A 3F7ZA 1REKA 1YHSA 3OTUA 4MWHA 4GKHA 5J9ZA 4CZTA 2HCKA 4LYNA 2QU5A 3ZLSA 5GIPE 1XWSA 1ZYCA 4ZTQA 1Y57A 3HAVA 3LFEA 4EUTA 4ZY6A 4C4FA 3Q32A 5AUUA 3FLWA 2JFMA 2YWPA 4AZEA 3UGCA 3NUUA 1ZOEA 4ZJIA 1TKIA 3QTUA 3V5PA 3T3UA 1ZOHA 3TEIA 4KWPA 5T3QA 4Z9LA 3DK3A 4QP1A 3BQRA 2JDTA 5LVNA 4O91A 1QCFA 2CKEA 2GSFA 5HO6A 4C4EA 4E26A 2XK6A 5BMSA 5AM7A 3W1FA 2W1CA 4DLJA 3E87A 1STCE 3CIKA 4FSNA 5FGKA 1YHVA 4DH1A 2R3KA 3FZRA 2EXCX 4R7HA 4JJRA 3LW0A 4XOZA 4KA3A 4YLLA 4AOJA 4CT2A 3O7LB 2X2KA 3PE2A 5DPVA 4EC8A 4FIIA 2H6DA 4X0MA 3EFJA 3VUIA 4QPSA 2C3LA 4HGLA 5JFWA 2UZLA 4IMYA 4RX8A 4E6DA 5T68A 3ATSA 2JD5A 2RKUA 3KEXA 5K0XA 4RC2A 1ZOGA 2C6LA 4WG4A 2ZDUA 2FGIA 4QMMA 5GJDA 3ZFYA 3WYXA 1Y91A 1H00A 3UC3A 1OL1A 4FIHA 2R3GA 2WMWA 4FSWA 5HG7A 3QCYA 3ZXZA 4ALUA 2P4IA 3RAWA 1Q4LA 4U45A 3NNWA 2JBPA 5KZ0A 3QLGA 4B9DA 3LMIA 4BTKA 4QYFA 2X1NA 5K9IA 2YIRA 3KN6A 4RQVA 4V05A 3E5AA 3UC4A 3R9NA 4PUZA 4ITIA 3MTFA 2YCRA 3OWLA 4I4FA 4NCTA 3UO5A 4YJUA 5CI6A 3TZMA 3DFAA 4F9AA 3DJ6A 3G9LX 4KRCA 4QMXA 5C26A 3JY9A 4FTAA 3P08A 3A2CA 4EH5A 3RPVA 3OCBA 3DBDA 1QMZA 3LQ5A 3Q60A 2G2IA 4PF4A 5ETFA 1FMKA 4S33A 4C3PA 3BWFA 4QQTA 3GCUA 4NKSA 1MUOA 4UYAA 3QUEA 2B0QA 3F82A 5M06A 5GNKA 2IZRA 4R1VA 3LMGA 3MFRA 1GAGA 3KMWA 4TZRA 4YUQA 3NNVA 4ZK5A 1H4LA 5DBXA 5JQ5A 4BTMA 3HV4A 4ZTRA 4W4XA 2XS0A 4FEQA 3IONA 2W9ZB 1YHWA 3VBVA 2NPQA 4E93A 4WNPA 4EOSA 2QOBA 2W06A 2J6MA 3TG1A 3O50A 3UIUA 3OCSA 5DNRA 3R28A 3A8WA 4BICA 2ITUA 1TQMA 2JIUA 4ZLZA 2BDFA 2HZIA 2XCKA 2XK4A 3MFUA 3QZFA 4M14A 2JDOA 3GOPA 4NK9A 5HD4A 4U81A 5JKGA 4JOAA 4QPMA 3L8PA 4BCJA 3QC4A 4FT3A 2QVSE 2QHNA 5CVGA 4X2NA 4NW5A 5AR3A 2XNNA 3KU2A 3BHVA 3UVPA 5E90A 4MNEA 4DEEA 3NUPA 4PNKA 3CEKA 5FD2A 3CTQA 3L9PA 1WVYA 3AG9A 3R7EA 4KSQA 5HTIA 3IGGA 4RQKA 3C50A 2A19B 2QD9A 2VX1A 3F6XA 4HZRA 4L42A 3M2WA 4LL5A 3RMFA 3WF6A 4I24A 4DA5A 3DLSA 1W83A 4BVUA 4A9UA 4D2WA 3NMUF 3EN9A 2BRHA 3G6GA 4MKCA 4GIHA 4XV1A 5H8BA 5DYJA 5DR6A 1XBBA 2J0IA 4U40A 1NW1A 3ORMA 4HGSA 2R3NA 3CY3A 3DBEA 3QUPA 3R1YA 3GFEA 5GIOE 5CYIA 4JVGA 2VWBA 4BDKA 2J0MB 2IW6A 2JLDA 4LOQA 3Q3BA 2PL0A 4IB3A 3G6HA 4IWDA 4C8BA 3QGYA 3TUBA 2R3JA 3KK8A 5EYKA 2YJSA 4LGGA 4IM0A 4FG9A 4FKSA 4RJ8A 4CLJA 3MW1A 3ORIA 5EHOA 2VRXA 3ZTXA 5JRSA 4JRNA 4RC4A 5CZHA 3Q53A 2R3RA 4ANLA 4YBKA 1GIJA 1SVEA 3IW5A 1M14A 4YU2A 2BKKA 3IOKA 5HGIA 2R64A 1PXJA 2X39A 2WU6A 3KA0A 3BU6A 2VAGA 3I5ZA 3KCFA 5ANOA 2WTDA 3I4BA 3QXOA 3P7AA 4WNKA 3AC4A 3MYGA 4I92A 3EWHA 5D9HA 2CNUA 5HBEA 5ANGA 4A4OA 2IW9A 2BTRA 5EQYA 2RF9A 3DTWA 2W1IA 4BDFA 1MQBA 2BZKB 2UZTA 4XNEA 3W32A 3DFCB 5KX8A 5C4LA 4FTQA 4BCGA 3OT8A 3PZEA 5AR8A 2A4LA 3S4QA 1YDTE 2VWIA 2HZ0A 3MA3A 4G9CA 2HELA 2PVHA 2PVKA 3MN3A 4RC3A 2UZOA 4AA5A 5IH5A 3GCVA 4BCQA 3UO6A 4MXXA 4BBMA 3QX4A 2CCIA 4I1ZA 4L68A 3SOAA 4F7NA 4TL0A 3BEAA 4QOXA 4Z7HA 4NM7A 3COHA 2WTIA 4QMUA 5L2QA 5AEPA 3ZC6A 3PIZA 4L45A 5FBNC 3FI2A 3KRWA 2Z7SA 3SXSA 3C9WA 4YJTA 4QMQA 2GS2A 1Z5MA 3WIGA 4X3FB 2ETKA 3R0TA 2VNYA 2YN8A 3BHTA 4IVAA 1OPKA 5KHXA 4HGEA 2XKFA 1SNUA 4GT4A 4AXAA 4B7TA 5ETCA 4JBQA 3UZRA 2QQ7A 3DNDA 4BGQA 3OS3A 3BX5A 5F4NA 1H1QA 2PUUA 3PJ8A 4BCKA 3IW8A 4I22A 5AR4A 3E3PA 4BGGA 2ITPA 2BRGA 3AQVA 4AGUA 3ZDUA 3U6HA 4KKGA 3LCKA 5KNJA 4F09A 3Q04A 5K4IA 2XNOA 4YJRA 4D1ZA 3RZFA 4TT7A 4RFMA 4AW5A 4EHGA 4CYJA 5GZ8A 5IEYA 4FUYA 2XK8A 2QR7A 1H1WA 2OIBA 4ZSEA 2XJ2A 3FZSA 3OFMA 4N6ZA 4FV0A 5I9YA 1YOJA 2QURA 3V6SA 4X7QA 3FXXA 4C38A 5CAOA 4BIDA 2PVYA 5FLFA 4FKVA 1WZYA 2ZV2A 3UBDA 3I7BA 4IH8A 2GNFA 4UALA 4A9YA 2ITZA 4I3ZA 3ZLWA 3H0YA 2HXLA 3OG7A 4QMWA 4GYIA 5DE2A 3QHRA 4ZZNA 2OLCA 1SYKA 1FMOE 1FVTA 3H30A 3K54A 3RGFA 3PRIA 3T3VA 3VVHA 4DG3E 1H0VA 2J7TA 2XRUA 1YXSA 4ZTHA 3V5LA 4F7SA 3EQPA 2PVRA 3EN4A 2QOLA 4B99A 4U8ZA 4G31A 3KKVA 4YTCA 5AR5A 2VV9A 4YR8A 3PVBA 1Q8WA 1U54A 1H26A 3ZZEA 5CTPA 4YTHA 1JKLA 3F2AA 3AXWA 5M4CA 3F2NA 3QQHA 3DB8A 5HOAA 3R8LA 5IH4A 1G5SA 2PMOX 3CY2A 3EQCA 3GT8A 3V01A 5I9WA 3UMWA 5JK3A 5I4NA 4I5CA 3PRFA 4GVJA 4KS8A 3U54A 2C47A 4ZTLA 3KXGA 1VYWA 4V0GB 3BU5A 3D4QA 2YZAA 4FV6A 3ULZA 4DTAA 3ZRKA 3L8XA 4HVIA 5C03A 3RAHA 3OUNB 2VWUA 2GHLA 2O63A 4HW7A 4IZ7A 4CRLA 4BHZA 5EDPA 2VO6A 4JIAA 5HX6A 4IZAA 2OW3A 4ID7A 3O7LD 2NRYA 4NL0A 5I0BA 3ZRMA 1NVQA 3PJCA 4O7YA 4WNOA 3ZM4A 2QOOA 5LVLA 2XRWA 3CC6A 3FY0A 1SM2A 1JBPE 1LEZA 5HO8A 4X6RA 2X4FA 2B55A 3AD5A 3TJCA 4CMUA 1YI3A 3ENHA 5BVEA 4M0YA 5JFXA 4I5PA 5EI2A 2QONA 4EH6A 2VGOA 4J99A 4Y85A 1GZKA 3ZRLA 1R0PA 3EN5A 4OTHA 3QKLA 5BUJA 3NX8A 3I79A 2PZRA 3M42A 3C4CA 4FF8A 5AP7A 4IHPA 2ZM1A 5AUYA 3PPZA 4O0XA 3C51A 3C4EA 4JI9A 5IUHA 4KIKA 2BALA 5JN2A 1PRYA 3DKGA 1ERKA 2KULA 1PMVA 2R3QA 2UW5A 4FSZA 4K2RA 4LV8A 4D2TA 2XIYA 1W7HA 2J9MA 3F66A 1M2PA 1QPDA 3I60A 3K5VA 1UU8A 2R9SA 2W9FB 4RX5A 5L3AA 2QKWB 2R7IA 3EQBA 4PMMA 4FNZA 4FT7A 1PMNA 2WTKC 2VX3A 3E8CA 2R2PA 5HLPA 1VYZA 1Q8YA 3D15A 4RFZA 3OOMA 1LUFA 4G34A 5HVKA 2VUWA 3BBWA 3QTXA 4IB0A 3LCDA 4RWLA 5CU2A 2PUPA 1GIHA 1AGWA 3SA0A 4YC3A 3W2QA 3UYSA 4B8MA 4O0TA 4MXOA 2BHEA 3F3WA 2W5BA 3HRFA 2IPXA 1YWRA 4HZSA 5CEPA 2YEXA 3QCSA 2WQBA 4TY1A 3WF8A 1OIUA 4AN3A 1E1VA 3R9DA 4MXZA 3Q4CA 4FIJA 3ZHPC 4RVMA 4G16A 1OPJA 2F7EE 2XJ0A 3EFLA 4YC8A 4DEBA 4EOQA 4EWHA 4I0TA 5DOSA 2XIKA 3UOHA 3O71A 4O1OA 2WMSA 4RRVA 4LV5A 2O65A 2C6IA 3ZO2A 4EJ7A 4YZ9A 1CKPA 3M1SA 3RHXA 3L9NA 1OUYA 2HY0A 4LOOA 3ET7A 3VJNA 4FG7A 2C6KA 3LMHA 3PZHA 5CX9A 3IECA 5FTOA 2WTJA 3W18A 3LZBA 1CDKA 4YZCA 5AWMA 2FSLX 3D5WA 4EHVA 2CLQA 4ZLOA 2UVXA 4LQMA 3R63A 4FKOA 4E1ZA 3RINA 4FK6A 3RM6A 1P4FA 2XBAA 2NRUA 1J7IA 4IFCA 4WNMA 3EQDA 4JAIA 4BZNA 5K4JA 4PDOA 3EL7A 4FTJA 4RWJA 4APCA 2OICA 2ZJWA 4UWYA 3ZLYA 4R5YA 5HTCA 1MQ4A 4GFOA 4EH7A 5F95A 3VAPA 2YIXA 3MY5A 3R1NA 4FV5A 4FNWA 5AM6A 2YCQA 3BWJA 5E8SA 4DAWA 4ENXA 3RI1A 2XM9A 4GKIA 5EM5A 3TV4A 3I6WA 2O8YA 4CKJA 3QFVA 5JZJA 1X8BA 1YI4A 3F3TA 4FKIA 4IB5A 4XRLA 5AV3A 4JDIA 3V5TA 3EYGA 4ZSGA 4XP2A 3LQ3A 2UVZA 2IZUA 1UV5A 2VTAA 2BUJA 4EC9A 3WZJA 4BTFA 2GNJA 2YCSA 3ZSIA 2W4KA 3D83A 3FYJX 4AW2A 5CAVA 4Y8DA 4FIEA 3EQRA 3RJCA 4KB8A 2IN6A 4X2KA 5HIBA 5HU9A 3HKOA 4CG8A 3E64A 2V0DA 3OY1A 3UZPA 4DFXE 3K2LA 2EUFB 4BCMA 4J96A 3FZOA 5J9LA 3A60A 4EOLA 4AFEA 1CSNA 5ANDA 5C8MA 4PPCA 3WE8A 4RSSA 4QMSA 5AX9A 4W4WA 5IISA 3WE4A 3OXIA 2WHBA 1JOWB 3W16A 1XO2B 2PK9A 3L9MA 2RFNA 2WXVA 4S34A 4UWBA 5HKMA 4O27B 2W1HA 1MP8A 4FZDB 3AC1A 1K3AA 2W7XA 2BIKB 1Z57A 1YWVA 3P9JA 3HVCA 1JVPP 5GZ9A 3FI4A 2ACXA 4FKTA 4WOVA 4PPAA 2CLXA 1J1CA 3EL8A 2Y6MA 3MY1A 1W98A 4TYHB 3QGWA 1A06A 2P0CA 4IZYA 3OTVA 5IA4A 1OBDA 4O84A 3SG8A 2F7ZE 3VC4A 4QMVA 2PZPA 4CKRA 1UU3A 1I44A 4BKZA 5BUIA 1CKJA 4D0WA 2CNVA 1VR2A 3P4KA 3VQUA 3CKWA 4G2FA 5EM7A 5J95A 1BYGA 3V6RA 3PY1A 2XEZA 4USDA 1V0OA 2X2MA 2WKMA 3R6XA 4PRJA 4U42A 5DT4A 4AWIA 3EB0A 1E1XA 3BYVA 2BAQA 3LQ8A 3I81A 4F65A 4XJ0A 3TUCA 4MXAA 1WFCA 3A7JA 2OU7A 3HLLA 3QQUA 5TF9A 3UNKA 4TWPA 4X21A 3TDWA 3RPRA 1ZZLA 4IWPA 4BI0A 1L3RE 3CLYA 3RKBA 1SVHA 3ZYAA 1RJBA 4FBXA 4AQCA 4PV0A 1H28A 4W4YA 5BVKA 2AUHA 2I1MA 3VUHA 4E6CA 4L01A 4DG2E 2HOGA 3EN7A 4QNAA 5G1XA 3R8UA 4HVDA 5BVOA 1ZMUA 5IPJA 4FODA 5HHWA 5HD7A 2OF2A 3MVJA 4GK3A 4FV9A 4KNBA 4BR3A 4PL5A 3DU8A 2GPHA 4AZFA 4I0SA 3VBYA 3R01A 4UXQA 4RBLA 3Q5ZA 2BDJA 2EXEA 2ZM4A 4DH8A 3GB2A 3F5XA 4L52A 4XP3A 4QMOA 5CEOA 4O7LA 2C5VA 2C0OA 3COIA 3QWKA 4LGHA 5D11A 3TKUA 5EKOA 2VTSA 5KMMA 4QNYA 4M3QA 1SZMA 3FZ1A 2OI4X 4FIGA 3R7YA 3TCPA 2C1AA 4V04A 3HA8A 3D5UA 3OOGA 2H96A 2VTOA 4IVBA 5EYDA 2ONLA 4IXPA 4MF0A 4O2PA 5CWZA 3DK6A 4WKQA 3KULA 3UP7A 4ZY4A 2YM5A 2IWIA 3Q52A 3KK9A 2GMXA 1BLXA 3VW6A 5BYYA 3FLQA 4IACA 2IVVA 4IFGA 5LJJA 2W1DA 3L8SA 4FMQA 4RMZA 3PA5A 2I0VA 3BV3A 3AMAA 3HX4A 2Z8CA 1UU9A 3JVRA 2H8HA 3FLYA 4X2JA 2WOUA 2OKRA 1KE6A 2Y4IB 3ORZA 4JXFA 3GFWA 3RAKA 5E8ZA 3BZ3A 3D7TB 3QA0A 4RVLA 1FINA 4FKGA 5FDPA 3R04A 2R3OA 3ULIA 3GU8A 2Y4PA 4XG3A 5CU6A 4C36A 2X9FA 3MJ1A 4K8AA 4NH1A 5HG9A 1A9UA 1KE8A 2PSQA 2YAAA 4NU1A 1V0BA 3BHYA 3CXWA 4RIXA 4CLIA 2W1ZA 5GJGA 2VWWA
chains in the Genus database with same CATH superfamily
5IA0A 2C6TA 2NP8A 3FC2A 4XUFA 3VONA 3UIMA 1ZYSA 4EK8A 3MTLA 3QTRA 1H25A 4M84A 4OTQA 3R83A 1PXOA 4JG6A 3RK7A 2F2UA 4FV7A 3MJ2A 4P4CA 1URCA 1KOAA 1Y6BA 2CMWA 4FSRA 4EOOA 5KKRC 4X2FA 2ZM3A 3KL8A 4LI5A 4AA4A 3W2CA 3PDTA 2DQ7X 3QXPA 3BQCA 1J1BA 1F0QA 5B0XA 5BVNA 3UVRA 4O0UA 3OZ6A 3BRBA 4XV2A 2CCHA 2X4ZA 4MBJA 2YM4A 4IQ6A 3Q6WA 5BVFA 4LRMA 1DM2A 1RQQA 2QO9A 2UZUE 3NSZA 5DWRA 2EXMA 4OT5A 4CV9A 3DCVA 3D94A 4OAUC 3L9LA 4X3FC 4RIYB 1Y8YA 4FZAB 5TE0A 4CFXA 4F7LA 1DAYA 3BGZA 5L6WL 4G17A 4JIKA 1OMWA 4WSQA 5E92A 5FEQA 5HCXA 3U9CA 3ZOSA 4RJ3A 3RZBA 4FZFB 2CGXA 4BDBA 5E7RA 4Z3VA 3QHWA 4U79A 3GOKA 4B0GA 4V0GA 4K6ZA 4JAJA 4AP7A 3UQFA 5EOBA 1PMUA 1PXPA 4EQMA 1UNHA 4IAKA 2JDRA 5J79A 4U43A 3LJ2A 2ITQA 5K0KA 5BVDA 3ZUTA 1EH4A 1K9AA 2Q0NA 4BWPA 2XF0A 5K5XA 5M55A 4KRDA 5EM8A 3EZRA 3KRRA 1JWHA 2Z7LA 4C0TA 3AKJA 4MBIA 5J87A 4CNHA 4F1MA 4G6OA 3OWPA 3WZDA 3PUPA 3VHKA 2J4ZA 4TYGA 3GC7A 5A6NA 4MHAA 5L4QA 4O0VA 4EKKA 3D14A 4J97A 4PL4A 5CSHA 5CANA 1YXTA 3AD4A 1ZXEA 4HVSA 4D4SA 5AP5A 3NUAA 2HWOA 3LLAA 1H08A 2VWYA 1WCCA 3HEGA 4F0IA 1GOLA 3TYKA 3W0QA 1H1PA 1XH5A 2R3LA 3VS5A 3MB7A 1CMKE 2R3IA 3PLSA 3SRVB 4JQ8A 2PE0A 2UZDA 2YDIA 4GG7A 3SKCA 3VO3A 3MVHA 4FX3A 5A4LA 4YHTA 4XS2A 3W0NA 4O0YA 4LUDA 4UZDA 3W2PA 5TR6A 2OF4A 1KSWA 4MYGA 1H07A 1YVJA 3QKMA 4PTEA 2X7GA 3TNHA 4O86A 1WBSA 1NVRA 2XAOA 3C4XA 5T6KA 4OLIA 2OBJA 1JKTA 4QTBA 3EJ1A 4WG3A 1T46A 3KXNA 4DN5A 3VWAA 3FKLA 5JZNA 1UWHA 3ODYX 3NS9A 3OWJA 3W0MA 4ERWA 2VU3A 3VF8A 4RJ5A 4WA9A 4JBOA 2Y7JA 3B2TA 2E9NA 3MIYA 3KY2A 3NW5A 4TYIA 4M15A 4YTFA 1Q62A 4ANQA 2C5NA 4O7TA 1ND4A 5ICPA 3IW6A 1U4DA 4O6LA 5FWKK 3Q2JA 1H1RA 4OR5A 4RLLA 3R7VA 5FTQA 5IDPA 4DH3A 4E4LA 5GINE 2GS7A 4G6NA 3JR1A 1ZMVA 3AGMA 3W2SA 3LPBA 3H9OA 2C6EA 3PP0A 4Y73A 3UPXA 3OCGA 1U46A 1M7NA 5EK7A 1KUTA 5CU3A 3IG7A 4E8AA 3UOJA 3QCXA 5E8WA 3RPYA 4BIEA 4DEAA 2J0KA 3QZGA 1Q61A 2YIQA 3O2MA 4GMYA 2AC3A 2F4JA 3IDPA 4QMTA 3OBJA 4R7IA 3NIZA 3ORTA 3P23A 5E1EA 4FA2A 3CSVA 3QYZA 4E5AX 4EHZA 1W8CA 3QLFA 1IASA 4ACMA 3Q5IA 4HYHA 5DHJA 5E91A 5LMAA 4AAAA 3NWWA 4KIOA 4GH2A 4R5SA 2EU9A 2WQOA 5CT0A 4LMNA 3UMXA 4FEUA 3IO7A 2ZDTA 4UN0C 2DUVA 4H3PA 1XBAA 3CPBA 5IDNA 3AC5A 1GZ8A 2HZNA 4YJSA 3DLZA 4C4HA 5FP6A 5AAEA 3IS5A 4EK4A 3NVMB 2WMAA 4ANSA 3RWQA 5EG3A 3KFAA 4ZSAA 5EKNA 1XHAA 5HCYA 1IA9A 2X0OA 3HV7A 3RM7A 3KQ7A 3NYXA 4YJNA 4UMRA 3U9NA 3FZTA 5IMEA 1P2AA 1Q41A 4GU6A 4RA4A 3WF9A 2ITYA 4DFUA 4GEOA 5C4KA 1OUKA 3UDBA 3ZM9A 1IEPA 5DT0A 3TDVA 5CEIA 2X9EA 4TNDA 3FMNA 1ATPE 4AA0A 4D5KA 2YCFA 3R30A 3UNZA 5K5NA 5KO1A 4IX6A 3DAEA 4CRSA 2YFXA 3BYSA 3EHAA 4KS7A 4ACCA 4GK2A 3R7OA 3V8TA 5AAFA 4M69B 4P2KA 3PSCA 5LWNA 2QOFA 2XIRA 4IAFA 2J50A 1KOBA 2C0TA 5HLWA 3VQHA 3MA6A 2ZMDA 2BKZA 2C0IA 1SMHA 2W17A 5TKDA 3QTSA 3ZZWA 5LXMA 5M56A 4AOTA 4IDVA 4BDGA 4BDEA 4G3FA 5J9YA 4D9TA 4Y46A 5F94A 3PFYA 3NUYA 5M07A 4AZWA 3AC3A 4FT0A 1OB3A 5LOHA 5IQAA 2VD5A 5IQEA 2ETMA 3PXQA 4DFBA 4F63A 4NIFA 3ZS5A 4NT4A 3UTOA 3WF5A 4IWOA 2BILB 4OTWA 4CQEA 3UP2A 4UMPA 4J53A 4I20A 2C3JA 3F2RA 4QMYA 4RGJA 5FUTA 2WFYA 2X8DA 3JS2A 4J7BA 1KE5A 3OROA 4BKYA 2Y6OA 2UW9A 3QTZA 4BBEA 3CQWA 5CEKA 4AF3A 3QD3A 3I6UA 3SX9A 1OGUA 2C6MA 5E8UA 4YJQA 5JGBA 4FI1A 3C4FA 2WTVA 4WRSA 4L7FA 5JSMA 5IQCA 4ZJVA 4YSMA 3PIYA 2PZ5A 4M8TA 5CS6A 5IQBA 1OKYA 3R9OA 3E8DA 1DI8A 2C69A 4CG9A 3KVWA 3UQGA 3ZDIA 4E3CA 5DI1A 2LAVA 4E5BA 2F57A 1YRPA 4FTOA 5CXHA 4YZBA 5CSXA 2OJJA 3D5XA 4EH4A 4EOMA 2W99B 3OBGA 2PZIA 5TT7A 3O5AA 4MCVA 4A7CA 4BHNA 4IX3A 5EQPA 4HPUE 4OTPA 4NM5A 4AGDA 5IUGA 2VTPA 2YM7A 5AR7A 2Y8OA 5F20A 2NNWB 1GZNA 3MFSA 4DEHA 4EZ3A 4O7SA 4DT9A 4Y5QA 3NW7A 4BY9E 1JSVA 5KMNA 1S9IA 3FLZA 4D2VA 3OW3A 4EONA 5HG8A 3DAKA 4FKPA 4ZTNA 3BL7A 4KBCA 2R7BA 2XKEA 3MPTA 1IAJA 3SGCA 5HIEA 2UW6A 4P5QA 3AD6A 4PNIA 2E9PA 2FVDA 1F3MC 5B2KA 5KKRB 5CF5A 3VULA 5I3RA 4FL2A 3NFGB 4DHFA 3C4ZA 5ANJA 3QKKA 3VUMA 5FXSA 1YI6A 4R3CA 5HO7A 1XH4A 3UNJA 1UKHA 3O8TA 5J1WA 2GU8A 4YZNA 3U8WA 4XV3A 1OKVA 2I40A 2JKMA 2W96B 3LXNA 2PTKA 5CASA 5CF8A 5JGDA 3ZEWA 3AT2A 2OZAA 4R1YA 3TKIA 4FSMA 3BLQA 3QCQA 3JXWA 2KTYA 4RIWB 3SG9A 3O96A 2OSCA 5CVFA 3A4PA 4OBPA 1Q3WA 3EN6A 2VO7A 5HESA 3QD0A 4G5PA 2C5XA 3VUDA 3JYAA 1GJOA 1W2DA 4YZMA 3HRBA 3S3IA 2YISA 4QRCA 2YDJA 3DXQA 1XMLA 4C2VA 3IQ7A 3VUGA 4EOIA 3C5IA 5JRQA 2IG7A 4U80A 4G3EA 3CQEA 3Q9ZA 4FTRA 4XG8A 2VZ6A 4KD1A 1S9JA 4MBLA 2Q83A 2X0QA 3PWYA 4FG8A 2YITA 3PXFA 5D7VA 3UJGA 3N4TA 2XNGA 1GIIA 3QF9A 4AZVA 4DBNA 4I6LA 4FYNA 3QWJA 3H9RA 3PP1A 1ZAOA 4HGTA 4RX9A 3N4UA 1Q24A 2I0EA 4D58A 3E62A 2FB8A 4D9UA 4XG9A 1Q97A 4IIRA 2X7FA 1YOLA 4JNWA 4QYEA 2WTWA 5TOZA 4Q9SA 4USEA 4BRXA 4TN6A 4IC8A 3PE1A 4EH3A 3O23A 2GQRA 5EI6A 3ZH8A 4AG8A 1OGYA 4YZDA 5HBHA 4Q2AA 4YO4A 1HCLA 4PP7A 4HJOA 5DMZA 3NUSA 4JBPA 4L43A 1JAMA 4M97A 5D1JA 2OJGA 1WBOA 2VN9A 4F64A 5B7VA 4R7BA 3HMNA 3VIDA 3DK7A 3ORXA 3K5UA 1OKWA 4HPTE 4BJJB 4L8MA 3ACKA 4APPA 4NUSA 3GXLA 2RSVA 3NIEA 1AQ1A 4NM3A 2FYSA 4RIYA 3TNIA 2UZNA 3IGOA 4A9TA 4QEBA 3IDBA 4QP3A 4C61A 3QQFA 3HDNA 4LV7A 3VS4A 2B9FA 4GUBA 1A48A 5EQEA 5E9EA 1M52A 4A4XA 4O6EA 3P1AA 3RK9A 3MVLA 4EZ7A 4MXCA 4YMJA 5CXZA 2P2IA 4ACHA 4F9BA 5KBRA 2PVFA 2E9VA 1T45A 1WBTA 2ITNA 3UYTA 4I6HA 4GU9A 2Y4IC 1NA7A 4MD9E 4NZWB 4NTSA 3QYWA 3ZBXA 3QRTA 5IUIA 4CTBA 2ITTA 1OL7A 5AUXA 4QP6A 3QZIA 3Q9WA 4QMPA 5FM2A 5HNBA 3R7UA 5BV3A 4CD0A 3MY0A 4WBBB 2VTQA 2QNJA 2V62A 4K0YA 4MXYA 3RPOA 4DGMA 4AQKA 2BFYA 5AADA 5IEVA 5AUTA 3E92A 4IX4A 4DT8A 3OMVA 2XNMA 4DITA 5CAQA 1OVEA 5CI7A 5FXRA 1H1SA 1DAWA 3KXHA 3PVWA 3TACA 4FUXA 4D0XA 2VTIA 4F6SA 1ZMWA 5DA3A 2YABA 5IQDA 3A7GA 4L46A 3G2FA 4N4SA 1UNGA 2V55A 4J52A 5F9EA 4JQ7A 3OCTA 4ANMA 4HNIA 4MF1A 3LHJA 4OTIA 3F9NA 1Y8GA 5I9UA 5JH6A 4QP9A 4FTMA 2YIYA 3LJ1A 1J91A 2XYUA 2P55A 2RG5A 3SXRA 1KV2A 4OGRA 5LVOA 2RIOA 2UZVA 2PMIA 4WG5A 5AJQA 4FE2A 4AAYA 1Q8TA 3CGOA 3L1SA 3NDMA 4I6BA 4MD8E 4JQEA 4ASDA 3CS9A 3BYUA 3DXNA 3N51A 4NEUA 3WZKA 4K1BA 1W84A 5D10A 4D4YA 3FMDA 3TIYA 3OY3A 4DYMA 5AV4A 3FI8A 2WMUA 1UWJA 4S31A 4XBRA 5BMMA 1ZY5A 5CVHA 2E9UA 4AXDA 5CEQA 3GBZA 5DR2A 1Q8ZA 3PVUA 4Z16A 1F5QA 4KIQA 5DT3A 1YWNA 4UX9A 5HE3A 4LUEA 1Q5KA 5JT2A 3KREA 5FQDC 3DY7A 5AUWA 5AV2A 3I5NA 4BCPA 3O8UA 1R78A 3MIAA 5H9BA 4BB4A 1OBGA 3Q4UA 3SQQA 3MSSA 4HCVA 3HZTA 4FT9A 4TXCA 2PY3A 1OITA 4WD5A 3ZONA 3UZTA 4FC0A 2IJMA 4C3FA 4QDEA 2X0PA 4F0GA 2GQGA 3B8QA 4JS8A 2GTNA 3U6JA 4DTBA 2C4GA 1URWA 2B9IA 3DBCA 4GT3A 1FVRA 2VTLA 1M2RA 3ZBFA 4ENYA 5BYLA 2OGVA 3LFFA 3F3VA 3H9FA 3HP5A 5CENA 4BF2A 4GV1A 3DDPA 2R5TA 3UE4A 4H3BA 1BKXA 2V5QA 3LM5A 4CFNA 2OZOA 5E8YA 3GU6A 5D12A 2VTTA 4D4RA 4IZ5A 4A9SA 4R8QA 4RWKA 3CP9A 5BQ0A 3A7FA 4H58A 3QD2B 4FOCA 2C68A 3QRJA 4GYGA 4P90A 3TXOA 1PKGA 2WB8A 4NTTA 4TRLA 2VTJA 3ZO4A 4AW1A 2CN5A 4JDJA 3ZMMA 2WEVA 3A7HA 4QYHA 5EFQA 3V5JA 4C59A 4EOPA 4J95A 4XYFA 4W8EA 2W05A 1FGIA 1ZYJA 2HW6A 1ZZ2A 4FK3A 2OFVA 1CM8A 3ORKA 3CD3A 3NR9A 5CT7A 3QUDA 3PA4A 5HEZA 2BRBA 2E2BA 2QG5A 4X3JA 3GU7A 3PG1A 2OXDA 3RVGA 3GC9A 3OEFX 3ZC5A 3Q2MA 4WT6A 4C35A 2IF8A 2IZSA 3ELJA 4D55A 5B2MA 2B9JA 3PLAE 1O6KA 3ZSGA 4AN9A 4EL9A 4FV3A 3R22A 1UVRA 4IVCA 3NYVA 3UG1A 3OEZA 4FEVA 2WIHA 4OTDA 3WIKA 4S2ZA 3LKMA 2W4JA 3FMHA 4N0SA 3EOCA 3W10A 3TN8A 4EH8A 5L8KA 4O22A 3TNPC 4B8LA 4AGCA 3PXYA 3F3UA 4O4BB 1L8TA 3FQEA 4XBUA 2XH5A 2BDWA 5KUPA 3TV7A 3KVXA 3DB6A 3E63A 1WBNA 4BYJA 4TYJA 4ARKA 4F7JA 5AAGA 4B6LA 4BDJA 5CAUA 3HNGA 3OVVA 4DDIA 4AX8A 2BAKA 2UW7A 4M13A 2JGZA 3CGFA 2F49A 5DEWA 3KC3A 2YM6A 2G2HA 4MNEB 4EBVA 3BE9A 2J0LA 5HBJA 4K18A 4O7RA 4DGLC 2XIZA 3OXZA 4R3RA 4DLIA 1QPCA 4W9XA 4EQUA 4S30A 4YTIA 1HOWA 4FR4A 2G9XA 2WZJA 5DRDA 1M2QA 5HNIX 4O81A 2WMXA 3QQLA 3RP9A 4YC6A 4L3LA 4W8DA 5AP4A 4BDAA 4F9YA 4RFYA 4FNXA 1PF8A 1TQPA 3LFDA 4C33A 5LCJA 1PXKA 3EMGA 4NW6A 3EQGA 5GJFA 2HAKA 3W2OA 3KMMA 4ANOA 1R0EA 4CT1A 4EUUA 1KE9A 3FAAA 4MQ2A 5CNOA 5F1ZA 3GC0A 4PPBA 4D1XA 4RPVA 1J7UA 4MVFA 4MK0A 3FXZA 4O0RA 1XKKA 5AUZA 4OTGA 3OF0A 1R39A 3B8RA 4JRVA 3LIJA 4O38A 4C7TA 4HCUA 2VTRA 3PPKA 3G9NA 3WARA 5M4FA 2JDVA 2ERZE 4JR3A 2XIXA 4F1TA 3Q4TA 4JDHA 1JSUA 5ANIA 4EH9A 2QG7A 2FUMA 3ITZA 4QTAA 5JQ8A 2O3PA 2ZFYA 4TTHB 3T9IA 2BFXA 3EYHA 2Z7QA 3NLBA 4G1WA 5KE0A 3P79A 4USFA 5IQFA 2CDZA 1OZ1A 2YM3A 3EKNA 3ERKA 3NGAA 2GCDA 4FSQA 4PP9A 3EQIA 4FKWA 3ZFMA 2FO0A 3F69A 4A07A 4C4IA 2JIIA 5A3XA 5BUEA 3R8PA 1I09A 2XNEA 3LFSA 2FSOX 3QA8A 4PWNA 4QO9A 5AFVA 3GCQA 4M7IA 4RJ4A 5M57A 1GY3A 1UU7A 3C7QA 5EW8A 5L8JA 5M08A 4CFMA 4NWMA 2WO6A 4KIPA 2QU6A 4O2ZA 3NNUA 3DS6A 3VS1A 3D7ZA 4FKRA 4X3FA 2QLQA 4PDPA 4QMNA 5IEXA 1XBCA 2XKCA 2HXQA 4KSPA 4IDTA 4U7ZA 3ZLXA 2ZV9A 3DKOA 1O6YA 1YXVA 2PVJA 1PXNA 3P7BA 3KXZA 3QD4A 3U87A 2B1PA 4CZYB 1XH7A 3WZUA 3DBFA 4EYMA 5H2UA 2JC6A 4AXFA 2JKQA 2O0UA 4CFUA 4CCBA 3S1HA 3W0OA 4FL3A 3MDYA 2OJ9A 4ZIMA 2EVAA 4UY9A 3DXPA 4O4CA 3VS6A 2BROA 3DQWA 4XEYA 2ITOA 5DH3A 2XNPA 4Y5HA 5HE1A 5HIDA 3ZO3A 4MD7E 3S2PA 2C5YA 4IM3A 3NNXA 3WYYA 4IX5A 4DTKA 3SC1A 2HY81 3FZPA 3PJ3A 3FSKA 3GQIA 2J5FA 1PKDA 2B7AA 3P0MA 3TV6A 2X7OA 3HUCA 5HICA 3BE2A 2ZOQA 3P86A 3GU4A 4HNFA 4G6LA 3HP2A 4U6RA 4DEDA 5CU4A 4KKHA 4CZUA 2WAJA 3GUBA 1H27A 3B2WA 3IK3A 4KINA 1BMKA 3FLSA 3FYKX 4DF3A 2XZSA 3R1SA 5IA5A 4XMOA 1TQIA 3K3JA 4DFZE 4E4XA 1WVWA 2XEYA 2ETRA 4AOIA 4FTKA 1XH9A 3BCEA 3BV2A 4BZDA 1B38A 3FL4A 4FTNA 4IAIA 4D2PA 1OL6A 4D1SA 3NCZA 4EQCA 2I7QA 3LOKA 3KCKA 4O0SA 2WMBA 3GC8A 4F99A 1JQHA 2IZTA 2X81A 4MNFA 2ERKA 2XALA 4L7SA 4ZOGA 3TT0A 4N57A 3TZ8A 4MAOA 3SD0A 4FSUA 3EQHA 4BJJA 2FH9A 4RWIA 4NM0A 5FEEA 3CBLA 1UKIA 5AUVA 5HZNA 5DFPA 4QYGA 5AP3A 2OJIA 5BNJA 2YJRA 1SVGA 3BBTB 3UODA 5E8XA 2QR8A 5DEYA 3BPRA 4GFMA 2F2CB 4W4VA 2Z2WA 2YLEA 2JBOA 4JR7A 2CKQA 5A46A 3M11A 4YJPA 5K3YA 4DHIB 1PYXA 3PSBA 4H36A 5CQWA 4IE9A 1P14A 1U54B 3UOKA 5BPYA 4X2GA 3SVVA 3C0HA 1P5EA 1B6CB 3DPKA 1JLUE 4UMQA 4CMOA 3PFQA 2I0HA 5E1SA 5J8IA 4C37A 3FSFA 4F1OA 3GNIB 4BBFA 3ORLA 1QPJA 4U0IA 5CSPA 3HMOA 3PXKA 2PVLA 4UEUA 3A99A 5ACBC 3C0GA 1KV1A 3KRJA 4XLVA 1FOTA 4Q5HA 3RWPA 1LP4A 3I0QA 5EW3A 3HMPA 3TIZA 4FZ6A 3SHEA 1HCKA 1OKZA 3V5WA 3VS7A 3MESA 1W2CA 1MRVA 1UA2A 3DT1A 4H05A 2X6EA 4BCIA 2B54A 3A8XA 5KMLA 2CSNA 2VNWA 3F5PA 3LCOA 3CTJA 4TYEA 4BC6A 4O83A 3O51A 2A98A 3DNEA 2W5HA 2XK9A 3HV3A 3A62A 5CLPA 1OL5A 3DA6A 1ST0A 1ZYDA 3AT3A 1VZOA 3PA3A 4PQNA 3LCTA 4RZWA 1RE8A 3MFTA 4XG2A 5A4TA 4ERKA 4DEIA 4QQJA 4JDKA 4GT5A 3D2KA 4FKUA 5DLSA 3DQXA 4D4VA 2PPQA 2OH4A 1OL2A 3AT4A 2UUEA 3AC2A 2C5OA 3LFNA 4BCHA 3PXRA 2WQNA 4W9WA 4BTJA 5FDXA 3NAXA 4C3RA 4DGGA 4YJOA 1PW2A 2A27A 3PPJA 4HCTA 4KIKB 3V8WA 2P3GX 4FNYA 1RW8A 1XJDA 3V04A 4PX6A 5C27A 3VW8A 4FV4A 2YIWA 4I0RA 2W0JA 4BKJA 3WILA 3QL8A 5HVJA 5LVPA 4NKAA 2C6DA 4BDDA 4O21A 3IW7A 2LGCA 3FQHA 3R2YA 4I6FA 3FBVA 1XR1A 4IC7A 4RLKA 2O2UA 4L67A 4ANBA 4DDGA 3FE3A 2W1GA 4FKJA 3LFBA 5M51A 3FUPA 4PDYA 4U44A 2XMYA 2VWXA 3P5KA 3P78A 2J90A 4GVAA 4ZZMA 5A4QA 3BU3A 4E73A 5AP6A 1DI9A 2XA4A 3LFQA 2YDKA 4F6UA 2IVUA 1JSTA 4FV1A 3PTGA 4DE4A 5LMKC 4O96A 1ZWSA 4I5MA 5J7BA 3L8VA 3VS2A 4A4LA 4ZS4A 2NYAA 4JL9A 5L6OA 3LAUA 5EHLA 2UZBA 4BWXA 2A2AA 4Q5EA 2UW3A 1MRYA 3BLRA 1NVSA 2XCHA 3LXPA 5FG8A 2IVTA 3WOWA 4A06A 3U6IA 4XOYA 5M4UA 4O7WA 2QC6A 4FOBA 2B4SB 3MV5A 3KF7A 1G8AA 2HW7A 5JMSA 5FTGA 3W55A 3HUBA 1QL6A 5IG1A 2GS6A 3CTHA 4R3PA 5A14A 3GGFA 2BRNA 2V22A 4OBQA 4L9IA 4IM2A 4M67A 3FEGA 4E4MA 1WVXA 4TNBA 5FBOA 5BX0A 4G9RA 2J2IB 2OJFE 4MWIA 2W4OA 3KMUA 3SDJA 3PXZA 5FXQA 3BHHA 3A4OX 4EI4A 5LMBA 2WQMA 4RX7A 4F9CA 4EOJA 2OXXA 2WMVA 3DKCA 3T9TA 3TNQB 1VJYA 4NFMA 4EOKA 2I6LA 5L2TA 1FVVA 4FSTA 4L6QA 4AFJA 3FMKA 1B39A 2XUUA 2QCSA 3DTCA 4AT3A 5CNNA 5CSWA 4DFLA 2R0IA 3RBWA 4PMSA 4EK6A 3FXWA 4IW0A 2P33A 3H3CA 5E8VA 3C4WA 3WBLA 5EM6A 4AACA 4P5ZA 2G1TA 4BDCA 3N9XA 4LL0A 5EI8A 3VUKA 4XRJA 5ETAA 4FL1A 1Q3DA 1PY5A 4FKQA 3REPA 3HYHA 2VTMA 3WF7A 2XKDA 3ORPA 5LQFA 2GHMA 4TYHA 1Y6AA 2PHKA 4F4PA 3D9VA 4J8MA 3EQFA 3QRUA 3THBA 4BZOA 5I9XA 3SAYA 3CJFA 3FHRA 2W1FA 3PJ1A 5CQUA 5EYCA 4ZTSA 3TL8A 3QRIA 1OIRA 2FSMX 4BFMA 3MI9A 2C3IB 3CQUA 4BCFA 4NFNA 2ZB1A 3TTIA 3EZVA 3QRKA 3VRYA 3W2RA 3AKKA 2OO8X 3RK5A 2V7OA 3LLTA 3F5GA 3COMA 3QAME 4JX3A 4N70A 3VBTA 2WTCA 2X6DA 2V7AA 3Q4ZA 5DRBA 3ROYA 3DJ5A 2YLFA 4WRGA 3G51A 4NCTC 3VHEA 3HMIA 3PYYA 5L2SA 3BEGA 3QQKA 4E5WA 1PXLA 4B4LA 4UZHA 2Z7RA 4WUAA 5C01A 3H4JA 2XNBA 4RJ7A 4ASXA 5AA8A 3R1QA 5A4CA 5KBQA 4FEWA 3NEWA 4IVDA 2CGWA 3ZEPA 1ZYLA 3OP5A 5AV0A 3KN5A 3GI3A 4J98A 5HVYA 3W0SA 4YPDA 2FA2A 3RHKA 4LFIA 4XLIA 4CKIA 2OK1A 2Z02A 4FYOA 1ZARA 4GRBA 3ZUUA 4CFWA 4ZJJA 4OW8A 2WOTA 2Y9QA 4RT7A 3TJDA 3ID6C 3DOGA 3OT3A 4MUQA 2UZWE 1GZOA 4FT5A 3A61A 5GZAA 3TZ7A 5IQIA 3C0IA 4PMTA 4RG0A 5BVWA 5KMJA 2RGPA 1JNKA 3EIDA 4BCNA 4D2RA 4EYJA 3IDCA 3IKAA 3EH9A 1E9HA 4L3JA 5AIRA 5JFSA 4ZMFA 3FPMA 4UMUA 4IBMA 4MX9A 4DG0E 4TW9A 2RFEA 2ZV8A 4ZP5A 1UNLA 5C9CA 4BCOA 2GFCA 3O17A 2J0JA 4ZLYA 3HAMA 4DH7A 2J5EA 4YJVA 3ANQA 3U4UA 3G15A 1YW2A 4UB7A 4RIOA 4QMZA 3QTIA 1SNXA 4RZVA 3G0FA 4R6VA 4AXEA 2ZB0A 3FY2A 5KMIA 4I41A 1AD5A 5HI2A 4QMLA 5CAPA 2BR1A 4I4EA 5TO8A 2R3FA 5AP0A 3NUNA 5A6OA 4AZSA 2PZYA 3BIZA 5EYMA 4GUEA 2RFSA 5JFVA 4FZ7A 3Q9YA 5KMKA 2QOKA 3P5JC 3D7TA 4J1RA 2JITA 2PMLX 2WMRA 1YDRE 2A0CX 3TM0A 4IAAA 2VO0A 5IKWA 1W2FA 4DBXA 4CTCA 4EH2A 2PUNA 4O7NA 2AC5A 3BL9A 4XH6A 2IO6A 3ZO1A 1CKIA 3P7CA 3KULB 1APME 4RVKA 3HV6A 2I0YA 4U5JA 3LCSA 4WBOA 2YHVA 3R21A 3ROCA 4M66A 2OG8A 2WGJA 4QT1A 3PUFC 4CGAA 4AS0A 3GQLA 4FKLA 5CF6A 1H01A 2YM8A 3KB7A 2BHHA 2Y0AA 5G6VA 4FEXA 5IA3A 3KXXA 3GCPA 4C2WA 4I6QA 2J51A 3BGPA 4N6YA 1BUHA 3R02A 4TWNA 3NCGA 2QI8A 4O4FA 4F6WA 3F3ZA 4UYNA 5L2IA 5J7HA 2VX0A 4UV0A 3BYMA 2BMCA 3ODZX 4FTIA 1LR4A 3SV0A 4NJDA 2X8EA 4FTCA 4BYIA 3LVPA 5DN3A 4XHKB 1IRKA 2IEWA 4ZXTA 5CY3A 2BTSA 4WO5A 2PVNA 4EJNA 3FJQE 3RALA 5J5SA 3QQJA 3R73A 4QQ5A 4RIXB 5L2WA 1XQZA 3MPMA 2BPMA 3VNTA 3R71A 4O7ZA 2YERA 1KE7A 3MH1A 4QP4A 2AEGA 5I5ZA 4ORKA 1PHKA 3N4VA 4ANNA 3ALNA 2E9OA 2SRCA 5ETIA 4EZ5A 4EWQA 4WUNA 5J1VA 1YKRA 5I3OA 3ATTA