1ZYJA

Human p38 map kinase in complex with inhibitor 1a
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
348
structure length
331
Chain Sequence
RPTFYRQELNKTIWEVPERYQNLSPVGGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLTRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 14
publication title Two classes of p38alpha MAP kinase inhibitors having a common diphenylether core but exhibiting divergent binding modes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 104
structure length 331
sequence length 348
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2005-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1zyjA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1zyjA01
4O7SA 2C69A 5JRQA 2PZPA 4YC6A 4D1SA 5FTGA 1P2AA 1QL6A 3RCDA 3E8NA 5KCVA 5C4KA 3JVRA 3ZO4A 3NNUA 3FZPA 4H3QA 4FTNA 4IVAA 4L45A 4XBRA 2ZB1A 4IHPA 3CCNA 3N4TA 4FV4A 3W55A 1ZZ2A 2JEDA 3KXGA 4NU1A 1S9IA 4UB7A 2IW9A 2WTIA 5A14A 3COHA 3B8QA 3CPBA 3T9TA 4QRCA 3ERKA 4DLIA 3RAIA 5BVEA 3QWJA 4I93A 2F2UA 3D9VA 4A9TA 3HL7A 3NIZA 1XJDA 3Q4UA 3VS3A 2PE2A 5L6WL 3W2QA 4TYGA 4RIWB 4U7ZA 3WARA 5T68A 2OFUA 4DHFA 4EI4A 1UU7A 4JR3A 3W8LA 5EI2A 3K5UA 2KULA 5EYDA 5BYLA 3NS9A 2HYYA 1YHWA 1P14A 4YJNA 4MTAA 5L2TA 2P2IA 2EUFB 1U59A 3HRFA 3ZTXA 1Q4LA 3BYOA 3E62A 4A9SA 1DS5A 2VO0A 2OBJA 2UW9A 4FKUA 4I5PA 5FGKA 4G9CA 1V0BA 4DA5A 1ZOHA 4OUCA 4AG8A 4ZZOA 4TYHA 2X0GA 3HECA 2JAVA 4J1RA 2C1AA 2ZV8A 2ZJWA 4FKIA 1A48A 5AJQA 1CM8A 2X6DA 4E73A 2ITOA 5DG5A 5L8JA 1O6YA 2GHLA 5C27A 4BDKA 3PP0A 4GS6A 3NMUF 2C6DA 3QRTA 3FLWA 4PMMA 3VQHA 4E1ZA 4GH2A 2J7TA 2C30A 2YCRA 4RC4A 5HIEA 3UQFA 4EOLA 4ERWA 3EFKA 4PWNA 1PXKA 4I92A 3V5WA 2QLUA 4YZ9A 5D12A 1H25A 4ZTRA 3RKBA 1RW8A 3ZFXA 4UXLA 4QQTA 2XCHA 3GC7A 1OUKA 3KU2A 4HOKA 4MD7E 2C68A 5EQPA 3GB2A 1VEBA 2WMWA 4FKRA 4O0XA 3BPRA 5HHWA 5DEYA 3TKIA 1FQ1B 5EYMA 2QO7A 3FSKA 1WMKA 1JSTA 3OFMA 2V7OA 4DH7A 2QOLA 4J7BA 3TTJA 5CVHA 3MV5A 4WIHA 2C6TA 1W8CA 3R7IA 1OL5A 3IONA 2H9VA 5AUXA 3ZCLA 4E5WA 5EDPA 4XJ0A 2PZRA 2Z7SA 3CR0A 5E1SA 3R2BA 4BHZA 1DI8A 4ORKA 5F4NA 1QMZA 2HZIA 4FTUA 4ZK5A 4DC2A 4O6EA 2YIQA 3NW6A 4PMTA 3PG1A 3ZEWA 4Y73A 1M2RA 3LE6A 3OCTA 3OVVA 4ZEGA 1OITA 3O8UA 2F49A 3FL5A 3NIEA 3PE2A 2FB8A 2QOHA 2OJFE 4LM5A 3TN8A 5FG8A 5B2MA 3G2FA 4OTWA 3W2PA 4M0YA 4R77A 1SNXA 3TV4A 4U0IA 3QU0A 2LAVA 3I1AA 4DG3E 3FLYA 5CSVA 4KABA 2CNUA 5DNRA 1JBPE 3DJ6A 4F9CA 3O23A 3AC2A 3UBDA 1Y8GA 3QF9A 5BYYA 3LFSA 2PHKA 4Y8DA 4ONAA 4YJUA 3ZFYA 4BKZA 1O6KA 2GNFA 4AGWA 4PL3A 4BHNA 2YISA 2XJ1A 3F5GA 3R2YA 3MBLA 4G34A 5B2LA 4C4FA 3R8ZA 4BWXA 3VVHA 2Y9QA 4X2GA 3EFJA 4JG6A 4M0ZA 4F63A 4DBXA 3SHEA 5KHWA 3I6WA 3RHXA 4IB3A 4TPTA 4AW5A 4JQ7A 4ERKA 5TE0A 4E5AX 3OOGA 5CVGA 4Y72A 5A4EA 3ZM9A 4BL1A 2J9MA 1YI3A 4YNOA 2CCIA 3KGAA 2ERKA 4YJOA 5KMJA 1I09A 4FNWA 1Q62A 2IVVA 1H1PA 4WUAA 4XV1A 1PXIA 4QMQA 2VO6A 5EH0A 4FTKA 3TI1A 3DXPA 4G31A 2UW0A 3RPSA 1PJKA 3RK7A 4RIWA 2OF4A 2BAQA 2GS2A 2OJJA 1J7UA 1XH4A 3ANRA 3LXNA 1XH7A 3GBZA 5HE3A 1KE9A 2O0UA 4M12A 2C3KA 4YGAA 3TNWA 5CNNA 2YITA 2BKKA 3F3ZA 4O83A 5LJJA 2Z02A 1OKVA 5E8TA 3FMHA 5HCZA 4ANSA 3OEFX 5ETFA 4DTAA 4F9WA 2CGVA 5E8ZA 4QP7A 3OMVA 4RJ4A 2UUEA 4E6CA 1JVPP 2ZV2A 3FKOA 3OTVA 1M7QA 5DWRA 2HENA 3LZBA 4U81A 5CENA 1PXPA 3WZUA 4C2VA 1BKXA 4IX3A 4O2PA 4PQNA 5CU6A 3F82A 3Q5IA 4FSNA 4UZHA 4W4VA 4WD5A 2HXLA 2VTLA 1R3CA 4YSJA 5AMNA 4OBPA 3V5LA 3VUMA 3MS9A 2RSVA 3EZVA 1L8TA 3RNYA 2VD5A 3TJDA 5DT3A 4IZAA 2OG8A 2WIHA 2OJGA 5EKOA 5DRDA 3OC1A 3PXZA 2NRYA 4C02A 3F7WA 4XYFA 5EDRA 4F7JA 3VBYA 5DN3A 1BUHA 3DQXA 1CTPE 4IX6A 3K54A 4IAAA 5ANOA 5M57A 4WNMA 3OROA 3P7BA 1XH9A 3HP5A 1VJYA 2QKRA 4JBQA 5FM3A 5IUIA 4DGMA 2XKFA 5IH6A 5D41A 4GFMA 1WBPA 4X21A 4AE9A 3Q4CA 3B8RA 2PMOX 5KMIA 2I0VA 4NCTC 4X2NA 1P4OA 4QMOA 1J91A 4WG3A 4DEDA 4KINA 3QQFA 4BBEA 2QONA 3IQ7A 4CCUA 4CYIA 5IUHA 4I1ZA 5E90A 1DAWA 5EW3A 4O81A 3QXOA 3R0TA 3NPCA 2QO9A 5AX3A 3TJCA 5B2KA 4USFA 3QUEA 4FTOA 2O63A 3SLSA 3KXNA 4FTMA 3TNIA 2BZIB 3C13A 4O7VA 3DB8A 3VS4A 1XBBA 3E63A 4KB8A 1K3AA 1OGUA 4J96A 4GK2A 4EH5A 3H0YA 2WMAA 4I6HA 3AGMA 2AC5A 4TWNA 2PZYA 2GNHA 4PMPA 5JSMA 1SZMA 2X8EA 4H3BA 2NP8A 2VTOA 5FM2A 4DFZE 4FEXA 3EN6A 3IS5A 4F6WA 2J6MA 3HV3A 4CZUA 3NWWA 3ID6C 2RIOA 2QVSE 4WKQA 4IX4A 3S4QA 4U9AA 3ZRMA 3S1HA 4V0GB 3ORLA 4JIAA 4QMSA 4L3LA 4RWJA 3FQHA 5L3AA 4EC9A 1FVRA 4XG3A 3Q32A 1L3RE 3H9OA 3K5VA 3QZGA 4R7IA 3TIYA 5DMZA 1KV1A 3JXWA 3ZLYA 3U87A 1OPKA 5AR3A 5HNBA 1GZOA 1A9UA 3MYGA 5ITAA 3F3WA 3ROYA 3MN3A 1UWJA 2FSOX 3EQBA 4UX9A 4LMUA 3UYSA 3FEGA 2J4ZA 3B2TA 3PJ3A 2GQRA 4W9WA 3TZ9A 2WZJA 2W1GA 2XYUA 3QRIA 4XH6A 4H1JA 1FGIA 1ZARA 3R73A 4QMTA 4UXQA 3DT1A 4BB4A 2W05A 2R7IA 5HG5A 3OBGA 4BYIA 2UZTA 2DUVA 4OT6A 5CVFA 5JK3A 2ZV9A 2PVJA 4ZS4A 3Q9XA 4FT9A 3DFCB 4AZSA 2OI4X 1FBNA 4RC2A 4AFEA 2OKRA 4NZWB 4RX8A 5E8YA 5CAOA 2JC6A 4K18A 3NW7A 4X3FB 3D7TA 2B55A 3F5PA 4WG4A 5BUJA 3R01A 5KNJA 4LGHA 4Z55A 4U79A 2OIBA 3UYTA 4GK3A 4I22A 4HYUA 4D4SA 4MF1A 2XKEA 4EWQA 4DEBA 1R39A 5J9ZA 4R7BA 5HD7A 3O2MA 4RQVA 2X7OA 1H28A 4KIPA 1OPJA 3UNJA 4CCBA 4TYJA 5HLPA 2J51A 4MCVA 3NUSA 4IAYA 3NVKI 2Z2WA 4IAZA 4KBKA 4EL9A 2J0MB 1FGKA 3N51A 2OXXA 4WRGA 4BWPA 5IU2A 3C4FA 4EZ3A 3WF9A 2IPXA 3ATSA 1LUFA 2CGWA 1H8FA 4D55A 2OXDA 1YVJA 2UZEA 3W1FA 5EG3A 2PVFA 2NO3A 2VN9A 5FEEA 4A9UA 4AACA 3BGQA 4KRDA 3W16A 4C35A 4IMYA 3DCVA 3NZ0A 3QGYA 4CZYB 4EQCA 1JKTA 3DXQA 4LGDA 3TZMA 1M52A 5HIBA 2C5XA 3FMMA 3FY0A 5HI2A 4FGBA 4K0YA 4CVAA 3U9CA 4FZAB 5K0KA 2BFYA 5FRIA 4OT5A 2UZDA 4BRXA 4D4YA 5D10A 4ZIMA 4R5SA 4UMQA 4YLLA 3NYNA 1GIJA 1WFCA 2O2UA 4EOJA 4Z3VA 5AUTA 2YZLA 3WYXA 4EHGA 3KULB 5M08A 1IRKA 1Q61A 4GT3A 4QYGA 5LMKC 1KE6A 4QP9A 3QCXA 4ACGA 3A7IA 3LFCA 2BDFA 3LFAA 2WPAA 4L46A 1IAHA 3IKAA 2R0IA 2YEXA 2X4FA 4E4NA 4YTHA 3MFUA 4FT3A 3A7JA 4GW8A 4YTCA 5EQEA 4RFYA 3VNTA 1W98A 3MDYA 3GCUA 3DBCA 4H58A 3U4UA 1Z57A 4NH1A 3SV0A 3D5VA 3V51A 3GCVA 2W1HA 3F88A 2AUHA 3A2CA 3FZRA 4I20A 2PULA 5EQYA 1PMVA 2PK9A 4PY1A 4ZJVA 3K3IA 4I21A 3LJ2A 5H8EA 5CALA 4X2FA 2C5YA 3KFAA 1M2PA 2W9ZB 3KVXA 1CMKE 3WE4A 5JQ5A 4V0GA 2FSMX 2GQGA 4FT7A 4HVGA 3AC8A 5HVYA 2Y6OA 5AA9A 4HGSA 2VV9A 5D9HA 1XQZA 3AXWA 4EOSA 1T45A 3HMNA 3W2RA 5KZIA 3FBVA 5IH5A 4DN5A 3ZSHA 5CI7A 3KY2A 4Z7GA 3U8WA 2VTAA 2WEVA 3MFRA 4L43A 4O0WA 5KMLA 1H0VA 4IFCA 4ZOGA 2YJSA 4O86A 4OBQA 4BDIA 1OZ1A 3KMMA 2VTQA 5D7VA 4WT6A 3UOJA 4ZXTA 3BBWA 5BVOA 3ZUUA 3JS2A 3QHRA 4E20A 1ZMVA 4MWHA 2VTJA 4P5ZA 2C47A 3ORIA 3IW5A 4JOAA 1U5QA 4JAJA 2UW7A 3SD0A 3ENMA 4ID7A 1QPCA 3BBTB 5JKGA 4BCGA 2XCKA 2BRMA 4RVLA 3U9NA 4PV0A 4DFLA 3EQFA 4YBKA 4AOTA 5IA3A 1GIHA 2WU7A 4GYGA 4QP6A 1Z9XA 3GU4A 1OVEA 2JDVA 2FO0A 3EYGA 4DBNA 5A4TA 2JKOA 4AW1A 5I3RA 2VZ6A 2ZMCA 3L8XA 3M42A 4S33A 1OBDA 5CZHA 3VUIA 2B52A 4FGRA 5HE2A 2ITWA 4KKGA 3FDNA 1Y6BA 2WMBA 1KUTA 3F66A 4TNBA 1OMWA 5JFSA 4IADA 5KHXA 3ATTA 1I44A 4NM5A 4AU8A 5LARA 2BDJA 2VUWA 3DAJA 4GG5A 2ITZA 2YDJA 2PZIA 2GHGA 3C51A 2GTNA 5DRBA 2BVAA 2VTMA 2QC6A 5L8KA 3LFNA 4DT9A 5IA2A 3N4VA 5BVNA 3UZPA 2QG5A 3R1QA 3OBJA 2C0IA 4BZDA 4C4GA 4D1ZA 4EH9A 3H9RA 4PP7A 4Q9SA 1UNHA 3COIA 3ZBXA 4PNKA 5J1VA 4U40A 3NNVA 4Z7HA 2ZM1A 5E8XA 4AGUA 3MFSA 2FGIA 3ZONA 5J5SA 4Y5QA 3U6HA 4XHKB 1OIQA 4AZFA 3RPRA 4N57A 3OXZA 4BCIA 1FVVA 3C7QA 4M3QA 1BX6A 2JLDA 3HRCA 3W2CA 5HNIX 2C6OA 5F94A 1R1WA 4C0TA 1Q8ZA 1IAJA 4O7LA 4CG8A 5K9IA 3JY0A 4IEBA 4I6BA 3DAEA 3EFLA 4IE9A 3LFFA 5AR5A 3FC2A 3ORKA 2QOKA 3R9RA 2FUMA 4ARKA 1IA8A 2ZV7A 4FC0A 5FEDA 3G0FA 3RBWA 3ODZX 3VJOA 4LQMA 4DFBA 2HW6A 3EJ1A 4KRCA 3QALE 3SRVB 5LVMA 3QKLA 4GL9A 2W4OA 2YZAA 3G6HA 4CG9A 4FG8A 4BC6A 3BGPA 3MY0A 1FMOE 4JDIA 2B1PA 3BEGA 1ZXEA 3C0IA 5FD2A 3ORTA 3RCJA 5BMSA 2V55A 3DAKA 4RPVA 4BICA 4D2TA 4F0IA 3SW7A 3FZ1A 3OD6X 3WF5A 3GNIB 3MVLA 4FTTA 4HPTE 4MXZA 3SA0A 3VS2A 2PUNA 4MYGA 1OL6A 3HP2A 5EKNA 3QLGA 3NRMA 5AP1A 1STCE 1OIYA 3HV7A 3D5WA 3EQDA 5DR6A 2JKQA 3W33A 4DG0E 4FKWA 4MKCA 4QYEA 4CGAA 5CAQA 4Q5EA 3SC1A 2O3PA 1YWNA 3PA4A 4CKIA 4CTCA 4F7NA 3OEZA 4D9UA 1B6CB 3AC1A 3QAME 1UU3A 5LQFA 4YTFA 3RK5A 2HWOA 3O96A 2YA9A 4NKSA 3UOHA 4GUBA 4CTBA 4OBOA 3V04A 3R7OA 3BYUA 4G17A 3EN4A 3NUYA 4UMRA 3CP9A 4ZY6A 4KIOA 4L42A 4V05A 2Q0BA 1M17A 4FTCA 5CT0A 2JIIA 2XP2A 5AP0A 5I4NA 4O7NA 3RM6A 4NUSA 3REPA 2O64A 4RLLA 3ZFMA 4D5KA 3EMGA 4G3CA 5J95A 5KE0A 2XVDA 4G3EA 1U5RA 4K33A 3R7VA 2GU8A 3VW8A 1GY3A 4RJ8A 1OL2A 5CQWA 4O38A 1XR1A 5GJGA 3HAVA 1JAMA 4FBXA 3QC4A 1ZMWA 4IANA 5CU2A 5CASA 2PPQA 4NM3A 5CZIA 5E7RA 2CKEA 5GJFA 3LQ3A 2R3PA 2RG5A 2YJRA 2HCKA 4OTFA 2CHLA 2BFXA 3FI4A 3KK8A 5TR6A 3EKKA 1QPEA 2ETRA 3U6JA 2X2MA 3UGCA 5J9LA 2QOIA 2YHVA 4M66A 3U54A 3TKUA 3LMGA 3NUPA 3V8TA 2I1MA 2F57A 3UIBA 1JLUE 4O6LA 4AGDA 3S2PA 3MVHA 3HAMA 3V5JA 3VBQA 4D2SA 5L6PA 4FV1A 4BKYA 4C57A 4UN0C 3C1XA 4FK6A 4EHVA 3FMNA 3DZOA 3G0EA 3HUCA 3QC9A 3QKKA 4RRVA 2OU7A 3LCSA 4HZSA 5I9WA 3ORZA 3EFWA 5IUGA 4NTTA 4MNFA 3V01A 3GENA 2E9PA 2XRUA 3POZA 3RVGA 3E3BX 3GP0A 4M13A 4YZMA 5HGIA 4QTAA 3PLSA 3EQIA 5I9VA 2W5AA 5FEQA 1W83A 4D2RA 4BI1A 1K9AA 1OBGA 5A46A 4XV3A 2WNTA 4KAOA 1PYXA 4FR4A 3R8MA 3KXHA 3NGAA 2VGOA 3QRKA 4EOQA 2ITVA 1IEPA 2XUUA 1KV2A 3OW3A 4X2JA 3C0HA 2A19B 2BILB 4J71A 1MP8A 5C4LA 5AR7A 3QZFA 4QTDA 2W0JA 2OH4A 2JFMA 2X39A 4XV9A 2IZTA 5I9UA 3EL8A 1DI9A 1H1SA 3JPVA 1YXXA 4N70A 2VWWA 1XH6A 3HVCA 4F9BA 3EH9A 4EYJA 3NNWA 4IB5A 4C3RA 3ET7A 5CF4A 3LFEA 2R3IA 4I41A 5AP6A 3VULA 1HCKA 2JDTA 2RFDA 2A27A 3ZLWA 4FZDB 5LCJA 5EM6A 4AP7A 4FUYA 4QYYA 4G6OA 1H4LA 3R8LA 4IVDA 4D1XA 2B54A 5AUWA 3SG9A 5LVPA 2QOBA 3DB6A 3FQEA 2YCFA 4E7WA 4CT1A 1WBVA 5CYIA 4OLIA 3IW4A 3V3VA 4EH2A 4O0SA 5K4JA 4QT1A 4EK5A 4XOYA 3FAAA 2F7XE 4O0UA 4C3PA 1YWVA 2QD9A 3GU8A 4AX8A 4CQEA 3KCFA 1YXUA 4M84A 2C4GA 4F09A 2NNWB 2X8IA 4F7SA 1UWHA 5FDXA 2QU5A 3PE1A 4MEDA 4KS8A 3WYYA 3FZSA 4IZ7A 1WBTA 4EOPA 2QHMA 3HV5A 5AUUA 3TDWA 2VTNA 2R4BA 4LRKA 3SKCA 4D9TA 4CFXA 1Q41A 3RINA 4FNXA 2ITTA 4JS8A 2WMTA 3DBQA 2WTWA 4I94A 4H05A 2BROA 2PTKA 3TG1A 4K9YA 5LMAA 3DBFA 2R7BA 4C36A 3DBEA 2HXQA 3F7ZA 2XNGA 4OTPA 4GU9A 4DYMA 2CJMA 3I7CA 2R3OA 2IZRA 5M4FA 2Z8CA 1BLXA 3ETAA 4IAIA 1JOWB 5IDPA 3SAYA 3DOGA 5HU9A 2Z60A 4N6YA 5A6NA 4DCEA 4PMSA 2P3GX 2XIKA 3BYVA 2WKMA 4C58A 4HZRA 3OXTA 4XMOA 4JIKA 4LOPA 5G6VA 3UIUA 4RJ5A 4RVKA 4YP8A 3RPOA 5IQFA 3QD2B 5ANEA 2OO8X 3GU7A 2QR8A 3MVJA 3ODYX 4TXCA 3VC4A 4OAVB 2HZNA 1PXOA 4XLIA 3D14A 3MWUA 2PUIA 5C9CA 5IQDA 4PRJA 3R9DA 1H01A 3HYHA 1SNUA 3DNEA 4K1BA 4L01A 5GJDA 2Y4IB 1GIIA 3Q2MA 2DWBA 2CN8A 3LJ0A 3AGLA 2IJMA 5LWMA 4TYIA 1WVWA 3BX5A 4FE2A 4QO9A 3E8DA 4LUDA 2BTSA 4NK9A 5KMMA 3FKLA 3PFQA 2PYWA 4NYEA 1OL1A 3QTZA 4UYAA 2EB2A 2C6KA 3CBLA 2W06A 2OIDA 2WD1A 3Q52A 4QP3A 1WBWA 3QTIA 2W17A 4PP9A 3VHEA 4GJ3A 5IA5A 4B0GA 5HBJA 4L67A 4K11A 2PVYA 4EYMA 4FKLA 3QWKA 4JX3A 5C8NA 1OKYA 3PXQA 3GVUA 3DJ7A 1DAYA 1PHKA 3ZC6A 4KIKB 2BZHB 2UZOA 4YHTA 3KF7A 3EN9A 4AN2A 4O0VA 5AADA 2B7AA 1F5QA 5CQUA 2E9VA 2WMVA 4FIJA 2C5OA 3PPJA 4C62A 2PMLX 3R02A 3S95A 4XP0A 4MNEB 2VTTA 4DLJA 3MVMA 3RPYA 4R3RA 5AV2A 4FSWA 1XBCA 3R7GA 1Z5MA 3KXXA 1OL7A 3ZEPA 3NLBA 2RF9A 3BCEA 2GNLA 4HCTA 5JGBA 2IO6A 4RG0A 3VBWA 4O2ZA 1J1CA 3FPQA 3Q9ZA 3BIZA 3QX2A 2J2IB 4FIHA 3MJ2A 1JKSA 3OS3A 3GEQA 3OWKA 5HBEA 2J0IA 4RIXA 1PXJA 2EU9A 3NAYA 4F08A 4L44A 1ND4A 1ZY4A 3DDQA 3NAXA 3ORMA 3LXLA 4LL5A 4O7YA 5TOZA 3EN5A 1J1BA 2BZKB 1SVEA 2V7AA 4NIFB 4WSQA 5AP5A 4M67A 4RX5A 4ZY5A 3MY5A 1HCLA 2QOFA 5ANKA 5TO8A 5J79A 3ELJA 5FP5A 2VO7A 2PVMA 5ACBC 1FINA 5HEZA 4CD0A 2VX1A 5JRSA 3T9IA 3AD5A 4HNFA 3OXIA 4IW0A 3EQRA 4B6LA 4E5BA 3EB0A 2J5FA 2VTHA 4BTKA 5EOBA 5ANIA 3TT0A 3F3TA 3RM7A 4M8TA 4BKJA 5HCXA 3ZO1A 3FPMA 4E3CA 3PA5A 2C5NA 3RZFA 3UODA 4BVUA 5AUYA 2V5QA 3E3PA 3GFEA 1ZYJA 1RJBA 3QRUA 3TUBA 1YHVA 4ZTNA 1JSUA 3L9NA 3AT4A 4EUTA 4QMZA 5TF9A 2Z7QA 1R0EA 3PDTA 2WQBA 4ZZNA 4GSBA 2DS1A 2XK7A 3FLZA 3KMUA 3ZBFA 4BR3A 4RSSA 4EOMA 1JSVA 2UW4A 2YDIA 3VUGA 5L2WA 2XEYA 3PA3A 4FZ6A 2XB7A 1P5EA 2XYNA 5A4QA 3L9MA 4B8MA 4GT5A 3A60A 3IO7A 4HVIA 3RNIA 4E4LA 2GS6A 4C7TA 4FT0A 3I5NA 5DH3A 3KF4A 1WVYA 1LEZA 3R1SA 3BKBA 4FEQA 4RX9A 4ZSLA 3TCPA 5AV4A 5LXMA 1SVHA 1SM2A 4XNEA 4PF4A 2XBAA 3EIDA 3NYVA 4MQ2A 4EHEA 3RJCA 2CKPA 5CF5A 4FKGA 4ZAUA 3VN9A 5L2SA 2X7GA 4BBFA 4DINA 5IQCA 3SXSA 3BE9A 4YU2A 4WSYA 4NW6A 2HOGA 4C61A 5KZ0A 4YJQA 2I40A 4ZZMA 5ANGA 3P78A 4BYJA 4CMUA 2XIZA 4AA5A 4BGGA 3MB7A 3TEIA 4S30A 4AW2A 3N9XA 1J3HA 4IC8A 4ZMEA 2ERZE 2WTKC 5A4LA 4XX9A 4GFOA 4YZCA 3MW1A 3K2LA 4HNIA 2I0HA 5EYCA 4RZVA 3RHKA 4JDJA 5ANJA 3WZDA 4FSZA 2GMXA 1CKPA 3E8CA 4GMYA 4K77A 2VWUA 1H1WA 3KVWA 3DKOA 4WBBB 3KCKA 5TT7A 3HLLA 3LCKA 1MUOA 4ANOA 3ULZA 2VX3A 3PWYA 3JVSA 2VNYA 2ZM4A 3PPKA 2HW7A 3HZTA 4FTJA 3IW6A 5DI1A 3VBTA 1O9UA 4R3PA 5EDQA 5HLWA 4RQKA 1E9HA 4MNEA 3UDBA 4DAWA 1UNGA 2LGCA 3BEAA 1OPLA 2XNMA 3LCTA 4HGEA 2VAGA 3CEKA 4C4JA 1URCA 4GYIA 5BX0A 3UVPA 4MHAA 1A06A 3CKXA 3C0GA 2YLFA 1BI7A 4YC3A 3TM0A 3BZ3A 2WO6A 3KRWA 4FV8A 3H9FA 4JQEA 5LVOA 1LR4A 3CC6A 3LLTA 3SXFA 4GK4A 4UWYA 2ZDUA 4JRNA 3VUHA 2H96A 3UMWA 4UBAA 2OF2A 4XG8A 4D4RA 3WOWA 4O7WA 3LIJA 3A7FA 4BDEA 3H0ZA 4RJ6A 5C8MA 2Y8OA 1WBNA 4GV1A 3SW4A 4BDJA 2G2HA 1MRUA 3TACA 4A4XA 4BFMA 4C33A 4QYFA 4BCHA 2OGVA 1XH5A 3ZHPC 3ANQA 3P1AA 4QP1A 4TRLA 4P2KA 2JITA 5CSHA 4FNZA 2WMSA 3NX8A 3PVBA 3ZS5A 3EN7A 1Q3WA 4J99A 4AQCA 3PIYA 4EOIA 2IN6A 2YCQA 3Q4ZA 5ANDA 2G2FA 3K3JA 2KTYA 3PJCA 3HDMA 3UMXA 4G3FA 3P5KA 1GOLA 4LUEA 4DGOA 4F9AA 1W7HA 2YIRA 3T8OA 4I0RA 2UVXA 3FLSA 3MY1A 4CRLA 4U8ZA 2W1ZA 4FIIA 2G15A 3AMAA 3AQVA 1AGWA 2EVAA 2O8YA 2VTIA 3F5UA 3MB6A 3QQHA 4S31A 3IDBA 4RLKA 3SOAA 2VWIA 5EW9A 4XLVA 5B0XA 5CXHA 1P4FA 4F6UA 4PX6A 2W1DA 3EZRA 4RC3A 3AG9A 3DBDA 5IH4A 5KX8A 4YPDA 2XNBA 4PTEA 5GZAA 2JFLA 2B53A 5DVRA 2J0KA 4CT2A 4RJ7A 5DIAA 1CKIA 4YJRA 3HA8A 4L53A 4QPSA 4UWBA 3CS9A 3R30A 5BVKA 5JZJA 4H1MA 4AT4A 5GIPE 1RE8A 5EYKA 4L3PA 4CFUA 1Y57A 5I9YA 4PDOA 5HKMA 3C4XA 4CSVA 5JN2A 2YM5A 4UMUA 3COKA 3C4CA 3CQWA 4KBAA 4ZTMA 3VAPA 4I23A 3RP9A 3BQRA 4BIDA 2V22A 2R5TA 2R2PA 1YI4A 3OUNB 2W4JA 4M69B 1U4DA 1MQBA 1U46A 2BHHA 4FYNA 5BMMA 3ALOA 4II5A 3A62A 2HY81 4LV5A 1H07A 3EQGA 4DFXE 3R8UA 3ORPA 1UVRA 4ASZA 3MTLA 3GU6A 2WTJA 2BHEA 2XK6A 4F99A 3FE3A 3TWJA 5IQGA 3QYWA 3ENHA 4NT4A 5F1ZA 2GFCA 3HEGA 3HRBA 4V04A 2GTMA 1G5SA 4XG2A 1HOWA 4S2ZA 5IF1A 3MGYA 3R1NA 5J7BA 3VIDA 2HK5A 1XWSA 4CMOA 4O84A 1PF8A 3PRIA 4ANLA 3QTWA 3BLRA 3W2OA 5BVWA 2P4IA 4E26A 2VNWA 4NWMA 2UZNA 3OY3A 3D5XA 4IFGA 5DA3A 2QU6A 2DYLA 2QODA 4C37A 2W4KA 4I5HA 3FMEA 4IZ5A 3V6SA 4EOOA 4ASXA 2NRUA 3D7ZA 3FC1X 3HUBA 4HCUA 4PTCA 4RIYB 1G3NA 5CEOA 5M4CA 4EHZA 5FXQA 3JUHA 5DLSA 1V0PA 2FSLX 3UPZA 3H10A 2XMYA 2W9FB 2E9NA 4K2RA 1TQIA 4PDPA 5DE2A 3FY2A 2X9EA 5M4IA 3FYJX 4KSQA 4JDHA 4BDBA 3KC3A 2OW3A 3PY0A 1BYGA 3LLAA 3KEXA 5M44A 3PXRA 2Z7LA 3R1YA 4QMWA 4YSMA 4CKJA 3VF9A 5HG8A 4YTIA 5E8WA 5AAFA 3U4WA 4RA5A 2BCJA 3L9PA 2YWVA 3V5TA 3BQCA 3D4QA 5IMXA 5IMEA 3I4BA 1NVRA 2R3FA 3LFDA 5JT2A 2WOUA 3FQSA 4YO6A 3GCSA 5CAVA 3GT8A 4F9YA 5DR2A 4FV6A 4QP2A 3FL4A 4DFYA 3CTQA 1IA9A 5LVNA 4NSTA 4IJ9A 3QA8A 3O8TA 4FOBA 3D2KA 3EHAA 3PSDA 3FZTA 3IW7A 3PJ8A 1Q3DA 4M15A 2OSCA 3QZHA 3AC3A 2WMUA 3O7LB 5DOSA 2P33A 3KXMA 4XG7A 3TKHA 2XS0A 1RQQA 1ZLTA 1PXLA 4DGLC 2YCSA 2JGZA 4L9IA 4IACA 4CFNA 2I0YA 4P90A 5EFQA 4DTKA 3WBLA 2UVYA 1AD5A 3BE2A 4AW0A 4BDGA 1PKDA 5A3XA 3S3IA 2CSNA 3ZZEA 5GNKA 3CTHA 1CSNA 4EK8A 5IEYA 3AC4A 4ZJJA 3MH3A 2W5HA 3SVVA 2QR7A 3HMPA 4UALA 5BQ0A 5CTPA 3IW8A 3L8SA 4X3FA 3BYMA 4ITIA 2REIA 5K3YA 3GU5A 3I0OA 3BU5A 4JR7A 2VO3A 2VWBA 4GJ2A 4QTCA 5EHOA 5FXSA 4ZLYA 5I9ZA 3IGOA 2QOCA 3MESA 3TUDA 5DPVA 4FK3A 4J8MA 4CYJA 5C01A 3MIYA 4JG7A 4AT5A 3LMIA 4YURA 2YM6A 3MPAA 3EQPA 4FSYA 5AP2A 5HESA 1W84A 3GC9A 3ACJA 2VGPA 4BF2A 5KMNA 3PLAE 4HPUE 5BYZA 4O7TA 4A06A 4C4HA 3S00A 4O1PA 3SX9A 5CEMA 5L6OA 3I7BA 2BR1A 1JWHA 3ZUVA 4FTAA 4W9XA 5FBNC 4IIRA 3TV7A 1BI8A 2ITUA 4G16A 2BRNA 4AAAA 4ASEA 4AXAA 4RJ3A 3GI3A 4M69A 4WRSA 1NXKA 4HVSA 4ENYA 1Y8YA 2RFSA 1JPAA 5E8UA 3LPBA 4A7CA 3Q2JA 3VRZA 5DGZA 4LL0A 4FL3A 4TNDA 4AS0A 2IVSA 2BAKA 3HKOA 2GCDA 2HELA 2B9HA 4MXYA 2ITYA 1MQ4A 2WTDA 3A8XA 3OWJA 3CJGA 1URWA 5M06A 2JD5A 5ETCA 4IH8A 4Q2AA 5ETIA 5HO7A 5KMOA 4EWHA 2W1CA 2G1TA 1CKJA 3ZOSA 3F2RA 2YABA 1OI9A 3G15A 3KULA 3QD0A 5BPYA 2Q0NA 3COMA 1ZZLA 2ESMA 4XCUA 4L00A 4Z9LA 1KOAA 3PG3A 4H36A 5E1EA 4F70A 3ZXZA 4FZ7A 4C34A 4WNKA 5CX9A 2XK4A 2IVUA 5J87A 3FWQA 4RWIA 4XG4A 5A9UA 4FIFA 5DBXA 3D94A 3RALA 4X2KA 4FKPA 3GCQA 4IC7A 4AGCA 3UZTA 2JKMA 4MXAA 1R78A 4EONA 5KKRC 1REJA 2OICA 3FLNC 4BCJA 2JIVA 2ZMDA 5M53A 5GIOE 4IJPA 4IZYA 2A1AB 1M7NA 3G90X 4WHZA 1AQ1A 3F6XA 2YM3A 3BELA 4QMNA 4IQ6A 3TL8A 2PVHA 4L52A 3VWAA 5HX6A 2XBJA 3FXXA 4R8QA 3FKNA 3AD6A 4BTFA 2J5EA 3GUBA 5IA0A 3W10A 3D5UA 4JDKA 4TYEA 3DS6A 3KN6A 4W8EA 4A07A 2P2HA 3UTOA 2RKUA 3I6UA 2UZBA 4QP4A 2I6LA 3UG1A 3ZUTA 5J7HA 3PVUA 4IDVA 4EK4A 3I81A 4BCQA 2B9IA 5AA8A 3OCGA 3T3UA 3R00A 4FEWA 1UV5A 3QGWA 3WI6A 3JR1A 1WBOA 4QQ5A 2VRXA 5AIRA 4EKLA 2ZDTA 3LM5A 1SVGA 4BI0A 3QXPA 4O1OA 5E92A 5DYJA 4XP3A 4NM0A 1ZWSA 3QKMA 3F2NA 1REKA 3GOKA 4FKQA 5JH6A 4AN3A 4BI2A 1YXVA 5DR9A 3UQGA 4P4CA 4O22A 1H26A 4IVBA 4GIHA 4X7QA 1K2PA 2E9UA 4PL4A 5ICPA 5IEVA 2NPQA 3Q5ZA 1JQHA 4FTIA 3Q9YA 3F3VA 2CN5A 4FICA 4C3FA 2PY3A 3VUDA 5L4QA 3NUAA 4BZNA 1YOLA 2QLQA 4XV2A 3V8SA 4QPAA 2BUJA 2XNNA 2CMWA 3HV4A 4X0MA 2UZWE 3KA0A 3LHJA 4ANQA 3QTUA 4DH5A 4PDYA 1FPUA 4RFMA 4UZDA 3UVRA 3O0GA 3RZBA 3MIAA 3C50A 1MRYA 4B8LA 3BHUA 2RFEA 3HMIA 3AT2A 3PWDA 4HYHA 3A99A 3IG7A 4WNPA 2IW8A 4YJVA 2C3JA 4UY9A 3VBXA 4BY9E 3DV3A 3NEWA 4IWDA 4EZ7A 3Q04A 1VR2A 2X9FA 3DTCA 4R78A 4L7SA 3MH2A 4AZTA 2PWLA 3PZHA 4KWPA 4M14A 1Y91A 2PU8A 2JBOA 4GEOA 2A0CX 4P5QA 4F0FA 4U45A 1M14A 4QP8A 3I79A 2P55A 3TZ8A 4F1OA 4IX5A 3QHWA 4GVAA 3DKGA 2YIXA 3DA6A 4KKHA 3BWFA 2I7QA 2VWYA 3A8WA 3IDPA 1PXNA 3VS0A 2WOTA 3A7GA 4BDCA 3FHIA 4FNYA 3W8QA 4FUXA 3R63A 2ETMA 5CI6A 3R83A 4AE6A 2WQMA 5JQ8A 1GNGA 2WTCA 3GC0A 5E4HA 5E8VA 4FX3A 4PL5A 2X6EA 3PJ1A 4RBLA 2G2IA 3D2IA 5AAGA 5IA1A 5JFXA 4G3DA 3OG7A 4DTBA 5CEIA 4TL0A 4EH8A 5T6KA 3Q4TA 4FT5A 4DH8A 4GCJA 2ONLA 2XEZA 4WA9A 5HCYA 5L8LA 4R3CA 3MA6A 2X2LA 4BGQA 5M09A 5D11A 1VZOA 4LMNA 2WTVA 3ALNA 3SRVA 2FA2A 4FKTA 4J97A 4TN6A 4RWLA 2R64A 3Q60A 1ZOGA 3SGCA 2FVDA 4F65A 3PPZA 3EL7A 4JLCA 4D0XA 3W18A 2QNJA 2Y6MA 3NUNA 3C4WA 4DF3A 1YDTE 4B7TA 2C0OA 4IXPA 3KREA 3TDVA 4UMPA 2CGUA 4C4EA 4D2PA 3CD3A 3T3VA 3MJ1A 2CLXA 4LFIA 4MXXA 2HWPA 2JAMA 3PY1A 4R5YA 3HMMA 2WAJA 3HV6A 2QG7A 5D1JA 5F9EA 1F0QA 1WZYA 2XF0A 5HNGA 3CE3A 4C2WA 4XOZA 2YAKA 4I3ZA 3R8VA 2J50A 3PVWA 1GZNA 4FIEA 2BPMA 4IBMA 4KNBA 2PE1A 3UO6A 1MRVA 2ZYBA 3V5PA 4AFJA 3DNDA 3SG8A 1RDQE 5HBHA 4JG8A 1NVQA 3QD4A 5HVKA 1YXSA 4NFMA 1NA7A 4EH6A 5IQIA 1O6LA 2C6IA 4WO5A 5EK7A 2ZB0A 1ATPE 4EH7A 2JDRA 5AR4A 4ZLOA 4DEIA 2WQOA 4BWKA 2Y4IC 2CDZA 2WHBA 2W99B 2WMXA 2HIWA 5CU4A 3VUTA 4QD6A 3DK7A 4WNOA 3NVMB 4AA0A 4I4EA 1SYKA 3ZYAA 3FI2A 3QX4A 3UO5A 2O65A 5HTCA 5M51A 3C5IA 3RTPA 4W4WA 4WOVA 3PSCA 1H08A 4EUUA 2GS7A 2QO2A 4Y5HA 1QPJA 2WIPA 2HY0A 3CD8A 3OF0A 3OCSA 3G6GA 4Y95A 4YNEA 5HIDA 2IZUA 3PVGA 3EKNA 3V6RA 4AN9A 4EORA 4TWCA 4J98A 4LRJA 4FSRA 3VS6A 3B2WA 3R6XA 3HX4A 2GNJA 3S0OA 4G6LA 3KN5A 4CRSA 5IDNA 3DU8A 3G5DA 3NUUA 4PUZA 3ZDIA 3DY7A 4LOOA 2OK1A 1M2QA 3PUPA 4CQGA 4AA4A 4IWPA 3P9JA 4NJ3A 4OTQA 3O8PA 5AUVA 4F1TA 5M07A 5JEBA 2XIYA 5IA4A 2HAKA 2BIKB 3PSBA 4O91A 3M11A 3UPXA 3R7EA 2QURA 2XNPA 3RAKA 5KUPA 5H8BA 2X1NA 2FH9A 4R7HA 5BUIA 5HX8A 4CFFA 4CFVA 5CF6A 4USDA 4DEGA 3KRLA 2GPHA 3A61A 3UP2A 4FOCA 1YDSE 5K5XA 2EXCX 5AUZA 5I9XA 4ACDA 3AMYA 1H00A 2OFVA 2PVNA 4UMTA 4USEA 4FV2A 3UQCA 2IVTA 4ALVA 4O7ZA 2CCHA 2WMRA 2E2BA 3E87A 5CS6A 3QQJA 3NR9A 4AT3A 1W0XC 4DCAA 5HO6A 3CTJA 4U42A 3HGKA 3LW0A 5G1XA 4ALUA 5IG1A 2BDWA 1BMKA 1U54B 4MK0A 5LCKA 5IQEA 2IZSA 4PNIA 4FKJA 4IVCA 5JGAA 1GZKA 1PMNA 3OTUA 3OUKA 4FMQA 5IPJA 5IZFA 3DZQA 4F1MA 3AOXA 4FZFB 4O21A 3UZRA 4I6QA 4CV9A 4GIIA 4X3JA 5HOAA 2FSTX 3F9NA 5EW8A 2EXEA 3A4PA 2BMCA 1TQPA 2EB3A 5CANA 2ACXA 2BTRA 5HTBA 4ANNA 3CPCA 3RGFA 2WELA 2YIYA 3VF8A 1QPDA 3PTGA 3PY3A 4XEYA 3ZSGA 1S9JA 2UW5A 1XO2B 3CKWA 3KK9A 2R3HA 2B4SB 3D0EA 3CGOA 2CKQA 2YFXA 2WEIA 2GNGA 1OIUA 3WZJA 1Q5KA 3O17A 3R9NA 4FVRA 4G5JA 4BCOA 2OJIA 4XRLA 5EHYA 4LV8A 3QYZA 1PKGA 2GDOA 1OECA 3E88A 3ORNA 4FSTA 4HGLA 1ZYDA 4TW9A 1KE8A 4XG9A 5C26A 3M1SA 4JL9A 4AOIA 2ITQA 2WQNA 4HVHA 4YHFA 2F2CB 4JX7A 4LYNA 3UG2A 4K8AA 3DFAA 1OB3A 2WQEA 1PYEA 3QTQA 1V0OA 2BRGA 4TTHB 3DGKA 4G1WA 2BRBA 2OIQA 4G9RA 4NFNA 5AIKA 3ZLXA 4EK6A 1Q97A 4YJSA 3DTWA 5FTOA 1ERKA 1LEWA 1YRPA 2QOOA 4BIEA 5AX9A 1VYZA 2GHMA 4O0YA 3HA6A 2X81A 5HVJA 4IWOA 4FV0A 5CWZA 2OWBA 3AC5A 3C4EA 3O50A 4ZSAA 5A4CA 3UC3A 4FEVA 4KA3A 4ZTQA 4ASDA 4CNHA 2RGPA 3OP5A 1WCCA 4JT3A 4UV0A 4AF3A 4OTRA 4F7LA 2FYSA 4DH1A 2QOQA 2YM7A 3QRJA 4FL1A 4BCPA 5EM5A 2W1IA 4LI5A 3QZIA 4D5HA 2BZJA 2XNEA 3WILA 3WF8A 2EWAA 5EM8A 1Q24A 4ZTHA 2XH5A 4X6RA 1B38A 3EOCA 4I0SA 3BI6A 4AOJA 3LVPA 3BGZA 4U41A 1UKIA 3G51A 3JYAA 5F95A 2OJ9A 3IOKA 3ZMMA 1OM1A 4TWPA 3LAUA 3ORXA 2H6DA 4CMTA 3IK3A 4DFUA 3QUDA 3ZXTA 3FSFA 3Q53A 3D7TB 1NVSA 4JRVA 4RWKA 4BN1A 2PVRA 2YIWA 1WAKA 3BV2A 4I4FA 4TY1A 3FMLA 3KKVA 5CSXA 4D2VA 1Y6AA 4U97A 4YUQA 3QTXA 3R7UA 4L6QA 1PXMA 4XS2A 3QCQA 4GU6A 3TNPC 4AZWA 4QMYA 1APME 5BVFA 5H9BA 2PUUA 4EBWA 2WXVA 3ACKA 3KXZA 3ZU7A 5CSPA 5CY3A 2XA4A 3VS7A 4EJNA 4QQJA 3R8PA 5CEQA 5K0XA 3QQGA 2XM9A 4CZTA 4PDSA 2B9FA 5AP4A 5EI8A 4IM2A 3II5A 2PMIA 4F64A 3KRXA 4FTLA 2RL5A 3DLSA 3BLQA 4FKSA 4HYSA 4OW8A 3QD3A 5EOLA 1FMKA 3L9LA 4O27B 3O51A 2C6MA 1H27A 5FP6A 3OT8A 4J53A 1YW2A 1W82A 4RFZA 3GFWA 3QA0A 3FI3A 1U54A 4KIKA 4QTBA 3KMWA 5CAUA 2A4LA 1H0WA 3DJ5A 1YXTA 3FMDA 2W96B 2JBPA 3MI9A 3IPHA 3R71A 3VO3A 4LRMA 3VRYA 2B0QA 3CXWA 2HZ4A 3NCZA 2CGXA 1UU8A 3BHHA 5HO8A 1JKLA 3VUKA 3G9LX 3R22A 3WZEA 3MH1A 5LMBA 5ETAA 4AWIA 1ZY5A 3Q3BA 3H3CA 4S32A 5CT7A 3E92A 4ITHA 3NNXA 1ZMUA 4D0WA 2PE0A 4EH4A 2YACA 5FUTA 4OAUC 1CDKA 5HE1A 3ZO3A 4FV3A 1Q8WA 4FV5A 4BBMA 4O0RA 4U6RA 4DFNA 4NL0A 4ZSEA 2G9XA 2JKKA 3AD4A 3TNHA 4ACCA 1FOTA 5B7VA 2YDKA 5HQ0A 4Y46A 4QMXA 4GFGA 2WB8A 4QNYA 4X3FC 2XRWA 5I5ZA 2XKDA 2E9OA 4NIFA 5LVLA 3GXLA 2VTSA 3LCDA 4R1VA 3QLFA 4BZOA 2C0TA 3LMHA 4DE4A 5HE0A 4F0GA 2OH0E 4MBIA 2XZSA 3U55A 4FV7A 2WTKB 3NYXA 2OLCA 4PPAA 1J7LA 3LKMA 2C6EA 3ZRLA 1OKZA 5AEPA 4ZMFA 3FV8A 5AP3A 3RK9A 4ZP5A 1TQMA 3VJNA 3AMBA 1PMEA 3G9NA 3E8EA 4ZSGA 1OUYA 4ACHA 3P0MA 4Q9ZA 3OCBA 4UWCA 3RAHA 3R04A 1GZ8A 4E8AA 3R21A 5AM7A 4KSPA 5HZNA 4YZDA 3LFQA 5TKDA 3E64A 2PMNX 4N6ZA 2PUPA 2VWZA 4FSMA 1KE7A 4I6FA 3Q6UA 4G6NA 2QHNA 3IDCA 3F69A 4IB1A 3DDPA 4O96A 3ZH8A 3M2WA 5FQDC 1KE5A 2XIRA 4A9YA 4MD9E 4JVGA 2WFYA 5DFPA 2I0EA 4W8DA 3P86A 1XHAA 3C5UA 4OTGA 4E6QA 3UNZA 3CLYA 3ULIA 4GVJA 4GKIA 3UIXA 4FI1A 3PYYA 4IWQA 1LPUA 2Q83A 3QBNA 3PXFA 2R3LA 4XRJA 2JDOA 5CLPA 5J8IA 3CJFA 4L3JA 4WUNA 4XBUA 4BGHA 4EQUA 3O7LD 3L8PA 3W2SA 2VWXA 3CQEA 3MH0A 1UU9A 4FSQA 3DQWA 1LP4A 2SRCA 2UW8A 4FTRA 1E1VA 4JQ8A 4OTIA 4RVMA 2ZOQA 2VX0A 2AC3A 5IQAA 4YMJA 1H1RA 3WF6A 2C6LA 4MQ1A 3ZO2A 4B9DA 4RT7A 4CLIA 5A6OA 4RIOA 5AR2A 1Q99A 2IG7A 4KD1A 3FI8A 4TKSA 3D83A 1Q8TA 3ZC5A 4IAFA 3AT3A 5KBRA 3E7OA 1YWRA 3BV3A 4GG7A 4JJRA 2WMQA 3I5ZA 3GC8A 3QUPA 4EZ5A 4Y85A 2QKWB 5J9YA 4H39A 4L68A 5AFVA 5AWMA 1WBSA 2YM8A 3Q9WA 3QQKA 4L8MA 5E8SA 5ACKA 3RMFA 4CFWA 4FG9A 4MBLA 5FLFA 2ITXA 4DGGA 3HNGA 4PTGA 4FEUA 4CV8A 2CNVA 4QMVA 3Q6WA 4HGTA 2Y7JA 2G01A 3PIZA 3FLQA 3LXPA 5FDPA 3QL8A 3TXOA 3WIKA 4JBPA 3DKCA 4BIBA 3PP1A 4EOKA 4MAOA 4E4MA 3PJ2A 1V1KA 3F3UA 3LOKA 3PZEA 4CXAA 3OOMA 3P79A 3C9WA 4YHJA 4JBOA 3WF7A 4DEAA 5IISA 3UVQA 2YN8A 4U80A 4BCFA 3TV6A 3F61A 3DK3A 4KBCA 4AZVA 2YAAA 3FXWA 3WE8A 1ZYLA 4UEUA 3LFBA 2J90A 4RX7A 3VS5A 4D4VA 4EJ7A 5EHLA 5IQBA 1OKWA 2X8DA 2ZAZA 4ITJA 1PY5A 4M97A 4XG6A 3E5AA 3GGFA 4QMMA 3DK6A 1ZYSA 4GRBA 4TWOA 4ZTLA 4E93A 3FHRA 5K5NA 5KO1A 3UOLA 2RFNA 1SMHA 3R7YA 3MPTA 3QTSA 1PW2A 3P7AA 4DGNA 3LCOA 4BDFA 3V5QA 1ZOEA 3KL8A 4MXOA 4YZBA 2W1FA 3DPKA 2C3IB 3FJQE 3P23A 3BU3A 4E6DA 4CFMA 2X2KA 4JBVA 4MD8E 5AR8A 4BCNA 3F2AA 4J95A 3THBA 1Q8UA 5AP7A 2HZ0A 3OY1A 4FA2A 3BHTA 4ZTSA 3ROCA 3TZ7A 5HG7A 5C03A 2R3GA 3D15A 3DLZA 4XP2A 5BVDA 3VW6A 4JXFA 3NUXA 2W5BA 5CEPA 5EM7A 2R3QA 4HYIA 4NCTA 5JMSA 3RI1A 2DQ7X 4QMPA 2YERA 4R1YA 2IWIA 4IB0A 3UJGA 1UNLA 4E4XA 4FIGA 4N4SA 2ITNA 3C4ZA 3VS1A 2V62A 2UW6A 3I60A 3LJ1A 4YR8A 4I0TA 3MPMA 4X6QC 4WBOA 4OR5A 5FWKK 1BL7A 3EYHA 4MXCA 4ZJIA 4YLJA 1R0PA 1JNKA 5H8GA 2Z7RA 4MWIA 3A4OX 3I0QA 3GQLA 2YM4A 4FVPA 1XBAA 2C5VA 5HLNA 2PZ5A 3BYSA 1XH8A 1GAGA 3VQUA 5AM6A 4CKRA 4LGGA 5J5TA 4DH3A 5HORA 4RA4A 5LOHA 3QTRA 4ANBA 3FMJA 5GZ9A 4W4YA 3WZKA 3WIGA 2EXMA 3TTIA 3G33A 4ANMA 4ZSJA 4CLJA 2ETKA 3U6IA 2O5KA 4DEHA 3OWLA 5DEWA 5AV3A 1H24A 2UW3A 3MSSA 4GUEA 4BCKA 4JAIA 4YC8A 1G8AA 4IM3A 4FG7A 3SOCA 4IAKA 4HW7A 5DHJA 1YKRA 2OZOA 3BWJA 3H30A 4QYHA 2ONLC 2RG6A 2H34A 2PSQA 4FF8A 4GT4A 2GNIA 4D58A 2ITPA 1PRYA 3HDNA 3QCSA 3CQUA 5FBOA 3SQQA 1FVTA 2R3JA 3ITZA 5L2IA 4ZS0A 1DM2A 4BTMA 1ZAOA 5EI6A 4GKHA 2W7XA 3ZRKA 1OIRA 1B39A 1YI6A 3ZDUA 3L1SA 3NDMA 5M55A 3NYOA 5CSWA 3EQCA 5DT0A 5F20A 5CF8A 1KWPA 3L8VA 3LQ5A 5FXRA 3CIKA 2R3NA 4EH3A 2F9GA 5KBQA 3TUCA 4BDAA 5CU0A 2H8HA 2V0DA 4DT8A 4E6AA 2QCSA 3BLHA 4G5PA 5AV0A 3RPVA 5IEXA 4U43A 4MBJA 4V01A 4Q5HA 1IR3A 3IGGA 4FKOA 3MFTA 4M7IA 4NJDA 5IKWA 4ZLZA 5CEKA 4YBJA 2OXYA 4PPBA 5DT4A 2F7ZE 3FXZA 2XM8A 3DKFA 3FMKA 4O0TA 3MTFA 2IW6A 4NW5A 4RIYA 5KMKA 4FSUA 2OZAB 4FODA 4F4PA 4U5JA 4DEEA 1GJOA 5FTQA 2R3KA 3NCGA 1YQJA 4YPSA 4MVFA 2AYPA 3P08A 4A9RA 3KQ7A 4BDDA 2VTRA 2J0LA 4AZEA 1F3MC 5CNOA 4MX9A 3E93A 4H3PA 4LG4A 1T46A 2R9SA 3RAWA 2CKOA 1EH4A 4MH7A 2BAJA 3OWPA 3PXKA 3IECA 3RWQA 3UO4A 5J1WA 2WU6A 3CY3A 3UC4A 3A7HA 3PXYA 3NSZA 1IG1A 2PVLA 3FUPA 5JZNA 4CEGA 4YJTA 2UZUE 2ZM3A 2XJ0A 3FYKX 4PPCA 4C4IA 4NEUA 2PVKA 4NTSA 4HVDA 5JFWA 4TZRA 4B99A 4EKKA 4M68A 4JI9A 3OT3A 5LWNA 2C3LA 1TVOA 3VHKA 5C1QB 5JGDA 5I3OA 4ZY4A 5K4IA 4EQMA 3E7VA 4K6ZA 3N4UA 1KSWA 2BRHA 3JY9A 3MA3A 3GCPA 2VU3A 4U3YA 5AV1A 2CLQA 4MF0A 4O7RA 5LMKA 4QMLA 2VTPA 4KIQA 3PIXA 2XK3A 2QI8A 5H3QA 3TIZA 5HG9A 5HD4A 5JFVA 2QQ7A 4RGJA 3TNQB 2YLEA 4TT7A 5GZ8A 3DXNA 5C8KA 5BUEA 4I5CA 2R3MA 3POOA 4APCA 3Q96A 4RZWA 4D28A 2F4JA 5T3QA 4KKEA 1ZRZA 2J0JA 3QFVA 4NKAA 1UKHA 5HU3A 2C1BA 3BU6A 4C8BA 4OGRA 3OZ6A 4QNAA 3SXRA 3BHYA 5KKRB 4WG5A 1YOMA 3VBVA 2B9JA 3P4KA 2WGJA 2XIXA 4FTQA 2UVZA 1KOBA 2YWPA 2JDSA 2XJ2A 2XK9A 5I0BA 1G8SA 2CPKE 1E1XA 3U51A 4TYHB 2XNOA 4U44A 4LOQA 1NT2A 3EWHA 4QOXA 1PMUA 2ZVAA 2BKZA 2UZLA 1VYWA 2X7FA 1Q8YA 2XK8A 4QPMA 3HMOA 4G2FA 4B4LA 4EK3A 3EQHA 3UOKA 3R9OA 3UIMA 2Y0AA 3QCYA 1BL6A 3F5XA 4FYOA 4A4OA 2BALA 4ALWA 5CXZA 5M4UA 3CSVA 4YJPA 1YDRE 4J8NA 4OTHA 4U3ZA 3ZM4A 4KUJA 2VWVA 3BRBA 3QQLA 3UP7A 4EC8A 4QTEA 3PRFA 3LXKA 2Y4PA 4FV9A 4XUFA 4R6VA 5E9EA 4APPA 3KRRA 4IM0A 4I24A 4G3GA 3GOPA 5AAEA 3FZOA 4RMZA 4JNWA 4ENXA 5HTIA 3H4JA 4N0SA 4RVTA 4C38A 4IDTA 3KB7A 4BDHA 5CAPA 4O82A 2W1EA 5E91A 4UYNA 1NY3A 3CGFA 1YHSA 4YZNA 3O71A 4EBVA 5HICA 4F6SA 4EEVA 3GQIA 4QMUA 3LQ8A 2A2AA 2GFSA 4BTJA 1TKIA 1IASA 3SDJA 3ZSIA 2R3RA 1H1QA 3W32A 3R9HA 2X4ZA 3UE4A 5CU3A 2OZAA 4HJOA 3IOPA 4A4LA 2R0UA 3BHVA 4L7FA 2UZVA 3ZZWA 4C59A 4FKVA 3OW4A 3RWPA 4D2WA 2BIYA 4YLKA 4YO4A 4KS7A 1QCFA 2F7EE 4I5MA 4BCMA 4W4XA 2CNQA 2GQSA 5IQHA 5GINE 4FL2A 4NM7A 2P0CA 3LM0A 2UV2A 5GHVA 4RIXB 3CY2A 2GSFA 5L2QA 5BNJA 3UNKA 4S34A 3V8WA 1X8BA 5D7AA 4P7EA 4Z16A 1XKKA 2JIUA 2XKCA 3QQUA 4OTDA 2PL0A 3OHTA 1J7IA 1NW1A 4HCVA 4Y83A 1UA2A 5A54A 3KRJA 4FVQA 5H2UA 3NW5A 4DG2E 5M56A 4ACMA 3ZLSA 4QQCA 4AUAA 4DITA 1YOJA 1ZYCA 1JKKA 3R28A 1WVXA 3P7CA 4J52A
chains in the Genus database with same CATH superfamily
4O7SA 2C69A 5JRQA 2PZPA 4YC6A 4D1SA 5FTGA 1P2AA 1QL6A 3RCDA 3E8NA 5KCVA 5C4KA 3JVRA 3ZO4A 3NNUA 3FZPA 4H3QA 4FTNA 4IVAA 4L45A 4XBRA 2ZB1A 4IHPA 3CCNA 3N4TA 4FV4A 3W55A 1ZZ2A 2JEDA 3KXGA 4NU1A 1S9IA 4UB7A 2IW9A 2WTIA 5A14A 3PUFC 3COHA 3B8QA 3CPBA 3T9TA 4QRCA 3ERKA 4DLIA 3RAIA 5BVEA 3QWJA 4I93A 2F2UA 3D9VA 4A9TA 3HL7A 3NIZA 1XJDA 3Q4UA 3VS3A 2PE2A 5L6WL 3W2QA 4TYGA 4RIWB 4U7ZA 3WARA 5T68A 2OFUA 4DHFA 4EI4A 1UU7A 4JR3A 3W8LA 5EI2A 3K5UA 2KULA 1OGYA 5EYDA 5BYLA 3NS9A 2HYYA 1YHWA 1P14A 4YJNA 4MTAA 5L2TA 2P2IA 2EUFB 3VONA 1U59A 3HRFA 3ZTXA 1Q4LA 3BYOA 3E62A 4A9SA 1DS5A 2VO0A 2OBJA 2UW9A 4FKUA 4I5PA 5FGKA 4G9CA 1V0BA 4DA5A 1ZOHA 4OUCA 4AG8A 4ZZOA 4TYHA 2X0GA 3HECA 2JAVA 4J1RA 2C1AA 2ZV8A 2ZJWA 4FKIA 1A48A 5AJQA 1CM8A 2X6DA 4E73A 2ITOA 5DG5A 5L8JA 1O6YA 2GHLA 5C27A 4BDKA 3PP0A 4GS6A 3NMUF 2C6DA 3QRTA 3FLWA 4PMMA 3VQHA 4E1ZA 4GH2A 2J7TA 2C30A 2YCRA 4RC4A 5HIEA 3UQFA 4EOLA 4ERWA 3EFKA 4PWNA 1PXKA 4I92A 3V5WA 2QLUA 4YZ9A 5D12A 1H25A 4ZTRA 3RKBA 1RW8A 3ZFXA 4UXLA 4QQTA 2XCHA 3GC7A 1OUKA 3KU2A 4HOKA 4MD7E 2C68A 5EQPA 3GB2A 1VEBA 2WMWA 4FKRA 4O0XA 3BPRA 5HHWA 5DEYA 3TKIA 1FQ1B 5EYMA 2QO7A 3FSKA 1WMKA 1JSTA 3OFMA 2V7OA 4DH7A 2QOLA 4J7BA 3TTJA 5CVHA 3MV5A 4WIHA 2C6TA 1W8CA 3R7IA 1OL5A 3IONA 2H9VA 5AUXA 3ZCLA 4E5WA 3PFYA 5EDPA 4XJ0A 2PZRA 2Z7SA 3CR0A 5E1SA 3R2BA 4BHZA 1DI8A 4ORKA 5F4NA 1QMZA 2HZIA 4FTUA 4ZK5A 4DC2A 4O6EA 2YIQA 3NW6A 4PMTA 3PG1A 3ZEWA 4Y73A 1M2RA 3LE6A 3OCTA 3OVVA 4ZEGA 1OITA 3O8UA 2XANA 2F49A 3FL5A 3NIEA 3PE2A 2FB8A 2QOHA 2OJFE 4LM5A 3TN8A 5FG8A 5B2MA 3G2FA 4OTWA 3W2PA 4M0YA 4R77A 1SNXA 3TV4A 4U0IA 3QU0A 2LAVA 3I1AA 4DG3E 3FLYA 5CSVA 4KABA 2CNUA 5DNRA 1JBPE 3DJ6A 4F9CA 3O23A 3AC2A 3UBDA 1Y8GA 3QF9A 5BYYA 3LFSA 2PHKA 4Y8DA 4ONAA 4YJUA 3ZFYA 4BKZA 1O6KA 2GNFA 4AGWA 4PL3A 4BHNA 2YISA 2XJ1A 3F5GA 3R2YA 3MBLA 4G34A 5B2LA 4C4FA 3R8ZA 4BWXA 3VVHA 2Y9QA 4X2GA 3EFJA 4JG6A 4M0ZA 4F63A 4DBXA 3SHEA 5KHWA 3I6WA 3RHXA 4IB3A 4TPTA 4AW5A 4JQ7A 4ERKA 5TE0A 4E5AX 3OOGA 5CVGA 4Y72A 5A4EA 3ZM9A 4BL1A 2J9MA 1YI3A 4YNOA 2CCIA 3KGAA 2ERKA 4YJOA 5KMJA 1I09A 4FNWA 1Q62A 2IVVA 1H1PA 4WUAA 4XV1A 1PXIA 4QMQA 2VO6A 5EH0A 4FTKA 3TI1A 3DXPA 4G31A 2UW0A 3RPSA 1PJKA 1W2CA 3KIOC 3RK7A 4RIWA 2OF4A 2BAQA 2GS2A 2OJJA 1J7UA 1XH4A 3ANRA 3LXNA 1XH7A 3GBZA 5HE3A 1KE9A 2O0UA 4M12A 2C3KA 4YGAA 3TNWA 5CNNA 2YITA 2BKKA 3F3ZA 4O83A 5LJJA 2Z02A 1OKVA 5E8TA 3FMHA 5HCZA 4ANSA 2XARA 3OEFX 5ETFA 4DTAA 4F9WA 2CGVA 5E8ZA 4QP7A 3OMVA 4RJ4A 2UUEA 4E6CA 1JVPP 2ZV2A 3FKOA 3OTVA 1M7QA 5DWRA 2HENA 3LZBA 4U81A 5CENA 1PXPA 3WZUA 4C2VA 1BKXA 4IX3A 4O2PA 4PQNA 5CU6A 3F82A 3Q5IA 4FSNA 4UZHA 4W4VA 4WD5A 2HXLA 2VTLA 1R3CA 4YSJA 5AMNA 4OBPA 3V5LA 3VUMA 3MS9A 2RSVA 3EZVA 1L8TA 3RNYA 2VD5A 3TJDA 5DT3A 4IZAA 2OG8A 2WIHA 2OJGA 5EKOA 5DRDA 3OC1A 3PXZA 2NRYA 4C02A 3F7WA 4XYFA 5EDRA 4F7JA 3VBYA 5DN3A 1BUHA 3DQXA 1CTPE 4IX6A 3K54A 4IAAA 5ANOA 5M57A 4WNMA 3OROA 3P7BA 1XH9A 3HP5A 1VJYA 2QKRA 4JBQA 5FM3A 5IUIA 4DGMA 2XKFA 5IH6A 5D41A 4GFMA 1WBPA 4X21A 4AE9A 3Q4CA 3B8RA 2PMOX 5KMIA 2I0VA 4NCTC 4X2NA 1P4OA 4QMOA 1J91A 4WG3A 4DEDA 4KINA 3QQFA 4BBEA 2QONA 3IQ7A 4CCUA 4CYIA 5IUHA 4I1ZA 5E90A 1DAWA 5EW3A 4O81A 3QXOA 3R0TA 3NPCA 2QO9A 5AX3A 3TJCA 5B2KA 4USFA 3QUEA 4FTOA 2O63A 3SLSA 2AEGA 3KXNA 4FTMA 3TNIA 2BZIB 3C13A 4O7VA 3DB8A 3VS4A 1XBBA 3E63A 4KB8A 1K3AA 1OGUA 4J96A 4GK2A 4EH5A 3H0YA 2WMAA 4I6HA 3AGMA 2AC5A 4TWNA 2PZYA 3W0QA 2GNHA 4PMPA 5JSMA 1SZMA 2X8EA 4H3BA 2NP8A 2VTOA 5FM2A 4DFZE 4FEXA 3EN6A 3IS5A 4F6WA 2J6MA 3HV3A 4CZUA 3NWWA 3ID6C 3W0MA 2RIOA 2QVSE 4WKQA 4IX4A 3S4QA 4U9AA 3ZRMA 3S1HA 4V0GB 3ORLA 4JIAA 4QMSA 4L3LA 4RWJA 3FQHA 5L3AA 4EC9A 1FVRA 4XG3A 3Q32A 1L3RE 3H9OA 3K5VA 3QZGA 4R7IA 3TIYA 2ZFYA 5DMZA 1KV1A 3JXWA 4AAYA 3ZLYA 3U87A 1OPKA 5AR3A 5HNBA 1GZOA 1A9UA 3MYGA 5ITAA 3F3WA 3ROYA 3MN3A 1UWJA 2FSOX 3EQBA 4UX9A 4LMUA 3UYSA 3FEGA 2J4ZA 3B2TA 3PJ3A 2GQRA 4W9WA 3TZ9A 2WZJA 2W1GA 2XYUA 3QRIA 4XH6A 4H1JA 1FGIA 1ZARA 3R73A 4QMTA 4UXQA 3DT1A 4BB4A 2W05A 2R7IA 5HG5A 3OBGA 4BYIA 2UZTA 2DUVA 4OT6A 5CVFA 5JK3A 2ZV9A 2PVJA 4ZS4A 3Q9XA 4FT9A 3DFCB 4AZSA 2OI4X 1FBNA 4RC2A 4AFEA 2OKRA 4NZWB 4RX8A 5E8YA 5CAOA 2JC6A 4K18A 3NW7A 4X3FB 4QDEA 3D7TA 2B55A 3F5PA 4WG4A 5BUJA 3R01A 5KNJA 4LGHA 4Z55A 4U79A 2OIBA 3UYTA 4DDIA 4GK3A 4I22A 4HYUA 4D4SA 4MF1A 2XKEA 4EWQA 4DEBA 1R39A 3W0RA 5J9ZA 4R7BA 5HD7A 3O2MA 4RQVA 2X7OA 1H28A 4KIPA 1OPJA 3UNJA 4CCBA 4TYJA 5HLPA 2J51A 4MCVA 3NUSA 2X0OA 4IAYA 3NVKI 2Z2WA 4IAZA 4KBKA 4EL9A 2J0MB 1FGKA 3N51A 2OXXA 4WRGA 4BWPA 5IU2A 3C4FA 4EZ3A 3WF9A 2IPXA 3ATSA 1LUFA 2CGWA 1H8FA 4D55A 2OXDA 1YVJA 2UZEA 3W1FA 5EG3A 2PVFA 3BL7A 2NO3A 2VN9A 5FEEA 4A9UA 4AACA 3BGQA 4KRDA 3W16A 4C35A 4IMYA 3DCVA 3NZ0A 3QGYA 4CZYB 4EQCA 1JKTA 3DXQA 4LGDA 3TZMA 3TYKA 1M52A 5HIBA 2C5XA 3FMMA 3FY0A 5HI2A 4FGBA 4K0YA 4CVAA 3U9CA 4FZAB 5K0KA 2BFYA 5FRIA 4OT5A 2UZDA 4BRXA 4D4YA 5D10A 4ZIMA 4R5SA 4UMQA 4YLLA 3NYNA 1GIJA 1WFCA 2O2UA 4EOJA 4Z3VA 5AUTA 2YZLA 3WYXA 4EHGA 3KULB 5M08A 1IRKA 1Q61A 4GT3A 4QYGA 5LMKC 1KE6A 4QP9A 3QCXA 4ACGA 3A7IA 3LFCA 2BDFA 3LFAA 2WPAA 4L46A 1IAHA 3IKAA 2R0IA 2YEXA 2X4FA 4E4NA 4YTHA 3MFUA 4FT3A 3A7JA 4GW8A 4YTCA 5EQEA 4RFYA 3VNTA 1W98A 3MDYA 3GCUA 3DBCA 4H58A 3U4UA 1Z57A 4NH1A 3SV0A 3D5VA 3V51A 3GCVA 2W1HA 3F88A 2AUHA 3A2CA 3FZRA 4I20A 2PULA 5EQYA 1PMVA 2PK9A 4PY1A 4ZJVA 3K3IA 4I21A 3LJ2A 5H8EA 5CALA 4X2FA 2C5YA 3KFAA 1M2PA 2W9ZB 3KVXA 1CMKE 3WE4A 5JQ5A 4V0GA 2FSMX 2GQGA 4FT7A 4HVGA 3AC8A 5HVYA 2Y6OA 5AA9A 4HGSA 2VV9A 5D9HA 1XQZA 3AXWA 4EOSA 1T45A 3HMNA 3W2RA 5KZIA 3FBVA 5IH5A 4DN5A 3ZSHA 5CI7A 3KY2A 4Z7GA 3U8WA 2VTAA 2WEVA 3MFRA 4L43A 4O0WA 5KMLA 1H0VA 4IFCA 4ZOGA 2XAOA 2YJSA 4O86A 4OBQA 4BDIA 1OZ1A 3KMMA 2VTQA 5D7VA 1XMLA 4WT6A 3UOJA 4ZXTA 3BBWA 5BVOA 3ZUUA 3JS2A 3QHRA 4E20A 1ZMVA 4MWHA 2VTJA 4P5ZA 2C47A 3ORIA 3IW5A 4JOAA 1U5QA 4JAJA 2UW7A 3SD0A 3ENMA 4ID7A 1QPCA 3BBTB 5JKGA 4BCGA 2XCKA 2BRMA 4RVLA 3U9NA 4PV0A 4DFLA 3EQFA 4YBKA 4AOTA 5IA3A 1GIHA 4AXFA 2WU7A 4GYGA 4QP6A 1Z9XA 3GU4A 1OVEA 2JDVA 2FO0A 3EYGA 4DBNA 5A4TA 2JKOA 4AW1A 5I3RA 2VZ6A 2ZMCA 3L8XA 3M42A 4S33A 1OBDA 5CZHA 3VUIA 2B52A 4FGRA 5HE2A 2ITWA 3UDZA 4KKGA 3FDNA 1Y6BA 2WMBA 1KUTA 3F66A 4TNBA 1OMWA 5JFSA 4IADA 5KHXA 3ATTA 1I44A 4NM5A 4AU8A 5LARA 2BDJA 2VUWA 3DAJA 4GG5A 2ITZA 2YDJA 2PZIA 2GHGA 3C51A 2GTNA 5DRBA 2BVAA 2VTMA 2QC6A 5L8KA 3LFNA 4DT9A 5IA2A 3N4VA 5BVNA 3UZPA 2QG5A 3R1QA 3OBJA 2C0IA 4BZDA 4C4GA 4D1ZA 4EH9A 3H9RA 4PP7A 4Q9SA 1UNHA 3COIA 3ZBXA 4PNKA 5J1VA 4U40A 3NNVA 4Z7HA 2ZM1A 5E8XA 4AGUA 3MFSA 2FGIA 3ZONA 5J5SA 4Y5QA 3U6HA 4XHKB 1OIQA 4AZFA 3RPRA 4N57A 3OXZA 4BCIA 1FVVA 3C7QA 4M3QA 1BX6A 2JLDA 3HRCA 3W2CA 5HNIX 2C6OA 5F94A 1R1WA 4C0TA 1Q8ZA 1IAJA 4O7LA 4CG8A 5K9IA 3JY0A 4IEBA 4I6BA 3DAEA 3EFLA 4IE9A 3LFFA 5AR5A 3FC2A 3ORKA 2QOKA 3R9RA 2FUMA 4ARKA 1IA8A 2ZV7A 4FC0A 5FEDA 3G0FA 3RBWA 3ODZX 3VJOA 2IF8A 4LQMA 4DFBA 2HW6A 3EJ1A 4KRCA 3QALE 3SRVB 5LVMA 3QKLA 4GL9A 2W4OA 2YZAA 3G6HA 4CG9A 4FG8A 4BC6A 3BGPA 3MY0A 1FMOE 4JDIA 2B1PA 3BEGA 1ZXEA 3C0IA 5FD2A 3ORTA 3RCJA 5BMSA 2V55A 3DAKA 4RPVA 4BICA 4D2TA 4F0IA 3SW7A 3FZ1A 3OD6X 3WF5A 3GNIB 3MVLA 4FTTA 4HPTE 4MXZA 3SA0A 3VS2A 2PUNA 4MYGA 1OL6A 3HP2A 5EKNA 3QLGA 3NRMA 5AP1A 1STCE 1OIYA 3HV7A 3D5WA 3EQDA 5DR6A 2JKQA 3W33A 4DG0E 4FKWA 4FRFA 4MKCA 4BJJB 4QYEA 4CGAA 5CAQA 4Q5EA 3SC1A 2O3PA 1YWNA 3PA4A 4CKIA 4CTCA 4F7NA 3OEZA 4D9UA 1B6CB 3AC1A 3QAME 1UU3A 5LQFA 4YTFA 3RK5A 2HWOA 3O96A 2YA9A 4NKSA 3UOHA 4MUQA 4GUBA 4CTBA 4OBOA 3V04A 3R7OA 3BYUA 4G17A 3EN4A 3NUYA 4UMRA 3CP9A 4ZY6A 4KIOA 4L42A 4V05A 2Q0BA 1M17A 4FTCA 5CT0A 2JIIA 2XP2A 5AP0A 5I4NA 4O7NA 3RM6A 4NUSA 3REPA 2O64A 4RLLA 3ZFMA 4D5KA 3EMGA 4G3CA 5J95A 5KE0A 2XVDA 4G3EA 1U5RA 4K33A 3R7VA 2GU8A 3VW8A 1GY3A 4RJ8A 1OL2A 5CQWA 4O38A 1XR1A 5GJGA 3HAVA 1JAMA 4FBXA 3QC4A 1ZMWA 4IANA 5CU2A 5CASA 2PPQA 4NM3A 5CZIA 5E7RA 2CKEA 5GJFA 3LQ3A 2R3PA 2RG5A 2YJRA 2HCKA 4OTFA 2CHLA 2BFXA 3FI4A 3KK8A 5TR6A 3EKKA 1QPEA 2ETRA 3U6JA 2X2MA 3UGCA 5J9LA 2QOIA 2YHVA 4M66A 3U54A 3TKUA 3LMGA 3NUPA 3V8TA 2I1MA 2F57A 3UIBA 1JLUE 4O6LA 4AGDA 3S2PA 3MVHA 3HAMA 3V5JA 3VBQA 4D2SA 5L6PA 4FV1A 4BKYA 4C57A 4UN0C 3C1XA 4FK6A 4EHVA 3FMNA 3DZOA 3G0EA 3HUCA 3QC9A 3QKKA 4RRVA 2OU7A 3LCSA 4HZSA 5I9WA 3ORZA 3EFWA 5IUGA 4NTTA 4MNFA 3V01A 3GENA 3AKJA 2E9PA 2XRUA 3POZA 3W0PA 3RVGA 3E3BX 3GP0A 4M13A 4YZMA 5HGIA 4QTAA 3PLSA 3EQIA 5I9VA 2W5AA 5FEQA 1W83A 4D2RA 4BI1A 1K9AA 1OBGA 5A46A 4XV3A 2WNTA 4KAOA 1PYXA 4FR4A 3R8MA 3KXHA 3NGAA 2VGOA 3QRKA 4EOQA 2ITVA 1IEPA 2XUUA 1KV2A 3OW3A 4X2JA 3C0HA 2A19B 2BILB 4J71A 1MP8A 5C4LA 5AR7A 3QZFA 4QTDA 2W0JA 2OH4A 2JFMA 2X39A 4XV9A 2IZTA 1W2FA 5I9UA 3EL8A 1DI9A 1H1SA 3JPVA 1YXXA 4N70A 2VWWA 1XH6A 3HVCA 4F9BA 3EH9A 4EYJA 3NNWA 4IB5A 4C3RA 3ET7A 5CF4A 3LFEA 2R3IA 4I41A 5AP6A 3VULA 1HCKA 2JDTA 2RFDA 2A27A 3ZLWA 4FZDB 5LCJA 5EM6A 4AP7A 4FUYA 4QYYA 4G6OA 1H4LA 3R8LA 4IVDA 4D1XA 2B54A 5AUWA 3SG9A 5LVPA 2QOBA 3DB6A 3FQEA 2YCFA 4E7WA 4CT1A 1TFFA 1WBVA 5CYIA 4OLIA 3IW4A 3V3VA 4EH2A 4O0SA 5K4JA 4QT1A 4EK5A 4XOYA 3FAAA 2F7XE 4O0UA 4C3PA 1YWVA 2QD9A 3GU8A 4AX8A 4CQEA 3KCFA 1YXUA 4M84A 2C4GA 4F09A 2NNWB 2X8IA 4F7SA 1UWHA 5FDXA 2QU5A 3PE1A 4MEDA 4KS8A 3WYYA 4BJJA 3FZSA 4IZ7A 1WBTA 4EOPA 2QHMA 3HV5A 5AUUA 3TDWA 2VTNA 2R4BA 4LRKA 3SKCA 4DHIB 4AQKA 4D9TA 4CFXA 1Q41A 3RINA 4FNXA 2ITTA 4JS8A 2WMTA 3DBQA 2WTWA 4I94A 4H05A 2BROA 2PTKA 3TG1A 4K9YA 5LMAA 3DBFA 2R7BA 4C36A 3DBEA 2HXQA 3F7ZA 2XNGA 4OTPA 4GU9A 4DYMA 2CJMA 3I7CA 2R3OA 2IZRA 5M4FA 2Z8CA 1BLXA 3ETAA 4IAIA 1JOWB 5IDPA 3SAYA 2XALA 3DOGA 5HU9A 2Z60A 4N6YA 5A6NA 4DCEA 4PMSA 2P3GX 2XIKA 3BYVA 2WKMA 4C58A 4HZRA 3OXTA 4XMOA 4JIKA 4LOPA 5G6VA 3UIUA 4RJ5A 4RVKA 4YP8A 3RPOA 4JMQA 5IQFA 3QD2B 5ANEA 2OO8X 3GU7A 2QR8A 3MVJA 3ODYX 4TXCA 3VC4A 4OAVB 2HZNA 1PXOA 4XLIA 3D14A 3MWUA 2PUIA 5C9CA 5IQDA 4PRJA 3R9DA 1H01A 3HYHA 1SNUA 3DNEA 4K1BA 4L01A 5GJDA 2Y4IB 1GIIA 3Q2MA 2DWBA 2CN8A 3LJ0A 3AGLA 2IJMA 5LWMA 4TYIA 1WVWA 1W2DA 3BX5A 4FE2A 4QO9A 3E8DA 4LUDA 2BTSA 4NK9A 5KMMA 3FKLA 3PFQA 2PYWA 4NYEA 1OL1A 3QTZA 4UYAA 2EB2A 2C6KA 3CBLA 2W06A 2OIDA 2WD1A 3Q52A 4QP3A 1WBWA 3QTIA 2W17A 4PP9A 3VHEA 4GJ3A 5IA5A 4B0GA 5HBJA 4L67A 4K11A 2PVYA 4EYMA 4FKLA 3QWKA 4JX3A 5C8NA 1OKYA 3PXQA 3GVUA 3DJ7A 1DAYA 1PHKA 3ZC6A 4KIKB 2BZHB 2UZOA 4LDTA 4YHTA 3KF7A 3EN9A 4AN2A 4O0VA 5AADA 2B7AA 1F5QA 5CQUA 2E9VA 2WMVA 4FIJA 2C5OA 3PPJA 4C62A 2PMLX 3R02A 3S95A 4XP0A 4MNEB 2VTTA 4DLJA 3MVMA 3RPYA 4R3RA 5AV2A 4FSWA 1XBCA 3R7GA 1Z5MA 3KXXA 1OL7A 3ZEPA 4DHJA 3NLBA 2RF9A 3BCEA 2GNLA 4HCTA 5JGBA 2IO6A 4RG0A 3VBWA 3ML1A 4O2ZA 1J1CA 3FPQA 3Q9ZA 3BIZA 3QX2A 2J2IB 4FIHA 3MJ2A 1JKSA 3OS3A 3GEQA 3OWKA 5HBEA 2J0IA 4RIXA 1PXJA 2EU9A 3NAYA 4F08A 4L44A 1ND4A 1ZY4A 3DDQA 3NAXA 3ORMA 3LXLA 4LL5A 4O7YA 5TOZA 3EN5A 1J1BA 2BZKB 1SVEA 2V7AA 4NIFB 4WSQA 5AP5A 4M67A 4RX5A 4ZY5A 3MY5A 1HCLA 2QOFA 5ANKA 5TO8A 5J79A 3ELJA 5FP5A 2VO7A 2PVMA 5ACBC 1FINA 5HEZA 4CD0A 2VX1A 5JRSA 3T9IA 3AD5A 4HNFA 3OXIA 4IW0A 3EQRA 4B6LA 4E5BA 3EB0A 2J5FA 2VTHA 4BTKA 5EOBA 5ANIA 3TT0A 3F3TA 3RM7A 4M8TA 4BKJA 5HCXA 3ZO1A 3FPMA 4E3CA 3PA5A 2C5NA 3RZFA 3UODA 4BVUA 5AUYA 2V5QA 4O4FA 3E3PA 3GFEA 1ZYJA 1RJBA 3QRUA 3TUBA 1YHVA 4ZTNA 1JSUA 3L9NA 3AT4A 4EUTA 4QMZA 5TF9A 2Z7QA 1R0EA 3PDTA 2WQBA 4ZZNA 4GSBA 2DS1A 2XK7A 3FLZA 3KMUA 3ZBFA 4BR3A 4RSSA 4EOMA 1JSVA 2UW4A 2YDIA 3VUGA 5L2WA 2XEYA 3PA3A 4FZ6A 2XB7A 1P5EA 2XYNA 5A4QA 3L9MA 4B8MA 4GT5A 3A60A 3IO7A 4HVIA 3RNIA 4E4LA 2GS6A 4C7TA 4FT0A 3I5NA 5DH3A 3KF4A 1WVYA 1LEZA 3R1SA 3BKBA 4FEQA 4RX9A 4ZSLA 3TCPA 5AV4A 5LXMA 1SVHA 1SM2A 4XNEA 4PF4A 2XBAA 3EIDA 3NYVA 4MQ2A 4EHEA 3RJCA 2CKPA 5CF5A 4FKGA 4ZAUA 3VN9A 5L2SA 2X7GA 4BBFA 4DINA 5IQCA 3SXSA 3BE9A 4YU2A 4WSYA 4NW6A 2HOGA 4C61A 5KZ0A 4YJQA 2I40A 4ZZMA 5ANGA 3P78A 4BYJA 4CMUA 2XIZA 4AA5A 4BGGA 3MB7A 3TEIA 4S30A 4AW2A 3N9XA 1J3HA 4IC8A 4ZMEA 2ERZE 2WTKC 5A4LA 4XX9A 4GFOA 4YZCA 3MW1A 3K2LA 4HNIA 2I0HA 5EYCA 4RZVA 3RHKA 4JDJA 5ANJA 3WZDA 4FSZA 2GMXA 1CKPA 3E8CA 4GMYA 4K77A 2VWUA 1H1WA 3KVWA 3DKOA 4WBBB 3KCKA 5TT7A 3HLLA 3LCKA 1MUOA 4ANOA 3ULZA 2VX3A 3PWYA 3JVSA 2VNYA 2ZM4A 3PPKA 2HW7A 3HZTA 4FTJA 3IW6A 5DI1A 3VBTA 1O9UA 4R3PA 5EDQA 5HLWA 4RQKA 1E9HA 4MNEA 3UDBA 4DAWA 1UNGA 2LGCA 3BEAA 1OPLA 2XNMA 3LCTA 4HGEA 2VAGA 3CEKA 4C4JA 1URCA 4GYIA 5BX0A 3UVPA 4MHAA 1A06A 3CKXA 3C0GA 2YLFA 1BI7A 4YC3A 3TM0A 3BZ3A 2WO6A 3KRWA 4FV8A 3H9FA 4JQEA 5LVOA 1LR4A 3CC6A 3LLTA 3SXFA 4GK4A 4UWYA 2ZDUA 4JRNA 3VUHA 2H96A 3UMWA 4UBAA 2OF2A 4XG8A 4D4RA 3WOWA 4O7WA 3LIJA 3A7FA 4BDEA 3H0ZA 4RJ6A 5C8MA 2Y8OA 1WBNA 3BL9A 4GV1A 3SW4A 4BDJA 2G2HA 1MRUA 3TACA 4A4XA 4BFMA 4C33A 3W0NA 4QYFA 4BCHA 2OGVA 1XH5A 3ZHPC 3ANQA 3P1AA 4QP1A 4TRLA 4P2KA 2JITA 5CSHA 4FNZA 2WMSA 3NX8A 3PVBA 3ZS5A 3TMOA 3EN7A 1Q3WA 4J99A 4AQCA 3PIYA 4EOIA 2A98A 2IN6A 2YCQA 3Q4ZA 5ANDA 2G2FA 3K3JA 2KTYA 3PJCA 3HDMA 3UMXA 4G3FA 3P5KA 1GOLA 4LUEA 4DGOA 4F9AA 1W7HA 2YIRA 3T8OA 4I0RA 2UVXA 3FLSA 3MY1A 4CRLA 4U8ZA 2W1ZA 4FIIA 2G15A 3AMAA 3AQVA 1AGWA 2EVAA 2O8YA 2VTIA 3F5UA 3MB6A 3QQHA 4S31A 3IDBA 4RLKA 3SOAA 2VWIA 5EW9A 4XLVA 5B0XA 5CXHA 1P4FA 4F6UA 4PX6A 2W1DA 3EZRA 4RC3A 3AG9A 3DBDA 5IH4A 5KX8A 4YPDA 2XNBA 4O4BB 4PTEA 5GZAA 2JFLA 2B53A 5DVRA 2J0KA 4CT2A 4RJ7A 5DIAA 1CKIA 4YJRA 3HA8A 4L53A 4QPSA 4UWBA 3CS9A 3R30A 5BVKA 5JZJA 4H1MA 4AT4A 5GIPE 1RE8A 5EYKA 4L3PA 4CFUA 1Y57A 5I9YA 4PDOA 5HKMA 3C4XA 4CSVA 5JN2A 2YM5A 4UMUA 3COKA 3C4CA 3CQWA 4KBAA 4ZTMA 3VAPA 4I23A 3RP9A 3BQRA 4BIDA 2V22A 2R5TA 2R2PA 1YI4A 3OUNB 2W4JA 4M69B 1U4DA 1MQBA 1U46A 2BHHA 4FYNA 5BMMA 3ALOA 4II5A 3A62A 2HY81 4LV5A 1H07A 3EQGA 4DFXE 3R8UA 3ORPA 1UVRA 4ASZA 3MTLA 3GU6A 2WTJA 2BHEA 2XK6A 4F99A 3FE3A 3TWJA 5IQGA 3QYWA 3ENHA 4NT4A 5F1ZA 2GFCA 3HEGA 3HRBA 4V04A 2GTMA 1G5SA 4XG2A 1HOWA 4S2ZA 5IF1A 3MGYA 3R1NA 5J7BA 3VIDA 2HK5A 1XWSA 4CMOA 4O84A 1PF8A 3PRIA 4ANLA 3QTWA 3BLRA 3W2OA 5BVWA 2P4IA 4E26A 2VNWA 4NWMA 2UZNA