1ZYJA

Human p38 map kinase in complex with inhibitor 1a
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
348
structure length
331
Chain Sequence
b'RPTFYRQELNKTIWEVPERYQNLSPVGGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLTRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 14
publication title Two classes of p38alpha MAP kinase inhibitors having a common diphenylether core but exhibiting divergent binding modes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 104
structure length 331
sequence length 348
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2005-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1zyjA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1zyjA01
3IOPA 4PDPA 2Y4PA 1GOLA 5T6KA 5M4UA 1MRUA 2B9IA 2BVAA 4BVUA 2QI8A 3NX8A 4UX9A 2J2IB 4BCNA 4WSQA 2WTIA 1XH8A 4RIWA 5CSXA 4FE2A 3NRMA 5IISA 4IACA 4I4EA 4QMMA 4KIQA 3LJ0A 3UOJA 5KMIA 4FL3A 4BY9E 4IVBA 3ZO2A 3GT8A 5M53A 4LOQA 5CEIA 2UZDA 3PP0A 2YCSA 5CT7A 2UVZA 3UMXA 1FQ1B 4MK0A 4FOCA 4UWYA 3JY9A 3V5PA 3UE4A 5CVFA 5IQHA 3EQDA 3T3VA 3BLQA 3MB6A 4DGLC 4DH1A 5CXZA 3QRUA 3UC4A 1ZOGA 1QCFA 4JDIA 1OKWA 2WHBA 2UZNA 3S0OA 3DOGA 3RVGA 5DHJA 4A4XA 2X2KA 5A46A 5FG8A 5DR6A 2W1DA 3B8RA 3R7UA 5BNJA 2WGJA 3GB2A 2W99B 3DDPA 4QYYA 1JWHA 2NP8A 2R3IA 1M52A 4X3JA 3Q6WA 5L6WL 2XM9A 3ZSHA 1PMEA 1LEZA 4M84A 5J8IA 3ZONA 3ZZEA 4F7NA 4C34A 4RRVA 2X4ZA 1OL1A 4IAAA 4C3PA 1H1WA 4JG6A 1Q8ZA 4KNBA 3JXWA 5E91A 5DA3A 2YWPA 1H8FA 3NYNA 4O2PA 4EUUA 5J5TA 4MF0A 1ZMVA 3MY1A 4Y8DA 4FTJA 3L9NA 4YR8A 3KGAA 3UG1A 1Y6BA 4XV3A 3RAIA 3CS9A 3G15A 3DAJA 1SZMA 2YDJA 3U6IA 5HVKA 3I81A 5CZHA 5JZJA 4PL3A 4I6FA 4S33A 2JKKA 4WD5A 3VRYA 2CGWA 4RZVA 4YJOA 2IW8A 3VWAA 1XH9A 3ZEPA 2QG5A 4D1XA 2X2LA 4GW8A 1BI7A 2VZ6A 3B8QA 3KMUA 3W33A 4V0GB 1MQBA 2R3FA 3W18A 4DFUA 3DB6A 1BMKA 2WQEA 3E3BX 4UWBA 3MV5A 2P33A 1Q99A 4NUSA 3P08A 4I93A 4OW8A 3F3ZA 4EYMA 3IOKA 3QTZA 4AZVA 1GZOA 3DV3A 4I0TA 3ETAA 4QP6A 4M15A 3ZM4A 2JFMA 5I9UA 1XBBA 5KZ0A 2UW7A 3A60A 2P0CA 4WG5A 4BWKA 4GJ3A 4GG5A 2HCKA 2Y4IB 3FSKA 3G90X 4RJ8A 4W9XA 1NVQA 4PUZA 4GS6A 2G01A 4Y85A 3HV6A 2BROA 1IA9A 4ZS4A 4FZ6A 4IAFA 4KUJA 5FEDA 4JVGA 4YJNA 3ORZA 2WIHA 3VAPA 3DA6A 4P4CA 2G2HA 3KRRA 4FR4A 3UIUA 2PE1A 4BDAA 4I6QA 4IEBA 4LL0A 2R3PA 2ZV8A 4GYIA 5HG8A 3VRZA 3WF5A 5HLWA 5HTBA 2W1EA 5EHOA 1RE8A 1ZZ2A 4HVSA 5EW9A 3MFRA 1O9UA 3QUPA 4O27B 4EOMA 1OB3A 1YWVA 5LWNA 3E7OA 4UYNA 4TYGA 4O38A 3SX9A 4EUTA 4MNEB 4XRJA 1H25A 4FIJA 4FKRA 4JRNA 4UXLA 3ZZWA 4RFMA 2Y6MA 5HNBA 3UJGA 4YTCA 2XJ2A 1FVRA 3MPMA 3KF7A 2IPXA 2WOUA 2YFXA 3RHKA 2XNEA 3LJ2A 4EH9A 5ITAA 4TWCA 3MDYA 3NZ0A 4H3BA 3CQEA 4I4FA 4K77A 1OKVA 4RZWA 3MESA 4M13A 4XH6A 3ZYAA 4JG8A 3EL7A 3PYYA 5CI6A 3VF9A 4L53A 2UW4A 4NH1A 2EU9A 3OF0A 3I7BA 2FUMA 1GY3A 2AC5A 1ZAOA 2B9HA 3P4KA 2IVUA 2C5XA 1Q5KA 3W2PA 5IQAA 2C1AA 1OL6A 4UMQA 2WEVA 3SAYA 3D5VA 1YKRA 3C4XA 3POOA 4IWDA 4BCQA 4BKYA 4D9UA 4DEIA 3CE3A 3D7TA 5GZAA 3H0ZA 5FTQA 4XLIA 5HX6A 3QTUA 2I0EA 2QU5A 4AW0A 2PK9A 3PVUA 1JQHA 5CENA 3PDTA 2C6LA 3UNJA 3V5TA 1TQIA 2EB2A 3B2TA 4K0YA 4XRLA 5DT0A 2Q0BA 4L68A 5JQ5A 5L8KA 3QWJA 3ZFYA 3VC4A 4YJPA 2ZM4A 4X2GA 5FUTA 3W2OA 4ZJIA 4FZDB 5AM7A 4BR3A 4X2KA 4YZMA 4HVIA 5L8LA 4CQEA 3R9RA 4FIEA 2AC3A 3ZO1A 3RTPA 3SXRA 4KIKA 4M67A 2PL0A 3LKMA 4RFYA 3TNWA 2O63A 4I0SA 3GC0A 1Q97A 5LCJA 2W0JA 3SOCA 4LUDA 2UW5A 2OSCA 3WOWA 4AXAA 1PJKA 2JDTA 2OJIA 3CY3A 2CKQA 3AD5A 1ZLTA 2YM5A 5GJGA 1FINA 4MXZA 3H3CA 1FPUA 3DTCA 1PMUA 1ZXEA 2A27A 5HIEA 3DBFA 3NW6A 4FNZA 4JDHA 3MIAA 1FBNA 3B2WA 4J98A 4NYEA 2FA2A 2PVLA 4QT1A 1J7UA 4DFBA 4GFMA 1TQPA 2C30A 3UOHA 4LM5A 3ZLYA 2PUPA 3LFBA 3N51A 3C51A 4HCTA 3ZSGA 3TZMA 3DK3A 4I5HA 1Y57A 4C33A 1KE6A 2OJJA 3DJ5A 4FI1A 3P9JA 3R02A 4L00A 2CGVA 5KZIA 2PVRA 3UZTA 4Q9ZA 3ORLA 3QQGA 3W55A 5K3YA 5HO7A 2HELA 3PTGA 4XEYA 4E6CA 5KHWA 2YACA 5KUPA 5HE0A 3BGQA 3PJCA 3FAAA 4LMUA 4O0VA 4X21A 4I92A 1V0OA 3TNHA 4F6UA 3H0YA 4C37A 4MNEA 3OW3A 4G3DA 3AGMA 3OT8A 2BFXA 5TE0A 4ZMEA 3QHRA 3DT1A 2C5YA 4JIAA 2C3LA 4H36A 4GK4A 4KRCA 4C4FA 4YJUA 3R1QA 3PIXA 3PZHA 4HCUA 5I9YA 3MH1A 3PXKA 4FYNA 1Q8TA 4EOPA 3BGPA 3MFTA 4XG8A 3LQ3A 1U5QA 2OJ9A 2OFUA 3BWFA 5C8KA 3NVKI 4Q9SA 4EK5A 4QYGA 4TRLA 3BQCA 5T3QA 3BYVA 3RK5A 4NK9A 1JSTA 3C0HA 3P23A 3Q4CA 1NT2A 1SNUA 3K3JA 3LXNA 5AA9A 2JKQA 4YZNA 3HGKA 2ZDUA 3VBWA 3FI2A 2PYWA 4QRCA 2UZUE 4L8MA 1FGIA 2ZOQA 4L43A 5C4KA 3IPHA 4RQVA 4GFGA 3FEGA 3KXMA 4AUAA 2RG5A 3C0GA 5KMKA 2H6DA 2W9ZB 2YIRA 2JIVA 4FZ7A 3G51A 3LIJA 2OBJA 3HKOA 4P90A 5H8BA 2W1HA 5BYZA 3VUIA 4EOKA 4HYIA 4E8AA 3PUPA 5JGBA 2B53A 5LOHA 3F7WA 4GUEA 5CASA 2HZIA 4CZTA 3DK6A 1YWRA 4FV2A 4A9SA 5TKDA 3T8OA 3RNIA 3LXPA 2PU8A 1K9AA 1ATPE 1BL7A 4RVMA 2OGVA 1PXMA 5CALA 2WTJA 5I3RA 3VNTA 3FZ1A 2YEXA 4M66A 2BDFA 3HV3A 4EC9A 3KFAA 2PMNX 4NSTA 4FX3A 4BRXA 3RPYA 2FSLX 3BEGA 4RX9A 4ACDA 2XKEA 3HAMA 3PJ1A 5M51A 1UWHA 4X2JA 4QMUA 3EQBA 1PXJA 1R0EA 3VULA 4W8EA 2Y8OA 2YN8A 4H39A 3ULZA 1VYWA 3CTJA 4XBUA 5C9CA 5CSPA 4G6OA 4DEAA 3DK7A 5EI8A 2YIXA 2QOBA 4CGAA 4D2PA 5C4LA 3OMVA 1XH6A 4FV3A 1PXNA 3QTSA 5ETCA 1IRKA 4HGTA 3ZRKA 4E26A 4ANQA 3KREA 4CKJA 4GH2A 2HOGA 2X2MA 3W8QA 3SC1A 4BCMA 5J9ZA 4ZOGA 5HLPA 4LGHA 4IJPA 3HAVA 1XJDA 1ZZLA 5HI2A 2PSQA 2HZ0A 2NPQA 3TV7A 3KVWA 2WMWA 3E64A 4IWOA 2G9XA 4F1TA 3TUDA 2ACXA 5IA2A 2C4GA 4A4OA 3PWDA 2BKKA 3EQIA 2JIUA 4BCIA 5BVOA 4FV5A 3IG7A 4FODA 3QX4A 3KKVA 1WBNA 5ANGA 3BQRA 1DAWA 2GNIA 2GHLA 3FMNA 5E90A 3ZXTA 1PMVA 4EQMA 4CZYB 5M08A 3CTQA 3OXTA 2OH4A 4C36A 5IDNA 4NWMA 3HRBA 3UQFA 2GNGA 1W82A 4JQ7A 4UMTA 4W4YA 3H9RA 5KMOA 1Z9XA 2WTCA 3SHEA 2VX3A 2BDJA 1OPLA 2FYSA 4MBJA 4F9BA 5A14A 5LVNA 4L46A 2QO2A 3A62A 4CMUA 5CAUA 2CLXA 2ETKA 3U55A 2R3NA 1PKGA 2XNPA 4EOJA 2QLQA 4BTKA 1QPDA 2WTDA 1IG1A 2XNOA 4DAWA 4FEXA 3BYSA 3ZXZA 1EH4A 4F9YA 4DC2A 1OM1A 2Z7LA 4MVFA 4NKSA 2J90A 4RFZA 5B2MA 4FEQA 1UU3A 1FOTA 4AE6A 2IZUA 5FXRA 4AX8A 4E4XA 4X6RA 3R9HA 2ITPA 5IMXA 3GCVA 5D7VA 4DCAA 2BHHA 4U97A 5CS6A 2Y9QA 4YC3A 3FI3A 5AP4A 3DBEA 4EK4A 1X8BA 2QODA 3EKNA 3TUCA 3EL8A 3PWYA 4JDJA 3PA3A 2HK5A 4FTOA 3SOAA 2Q83A 5CWZA 3G5DA 3QD3A 2YITA 4ZTSA 4ZIMA 3UMWA 2WAJA 4FKSA 3BV3A 3RAWA 5C8NA 3VW8A 4K8AA 4UV0A 5T68A 2XP2A 3F3TA 5FLFA 3PPKA 3UQGA 5J7BA 3IDCA 5HLNA 4CNHA 4DEHA 2CNQA 5E8XA 1NXKA 1LEWA 2B0QA 4TWNA 3QA8A 2B52A 2W4KA 4JG7A 4FK3A 1PF8A 3NUXA 5A3XA 3FYJX 2KULA 5EHLA 3GQIA 2UUEA 3PLSA 1OL2A 4PPBA 2IVTA 3KRJA 1H1PA 3DNDA 4FIFA 4OUCA 2XEYA 4GVJA 5DR2A 4G31A 4ERKA 3FMHA 3SRVB 5AUVA 2GTMA 3R8PA 3VUMA 3ZUVA 4GU6A 5AX3A 4CV9A 3DPKA 4XV1A 4BZOA 4CD0A 5CF6A 4LRKA 1XH4A 4BTFA 4FT0A 2WMSA 2C5OA 4P2KA 1IR3A 3SXSA 3Q4ZA 3R28A 1Y91A 4ZTNA 5ANOA 4O7SA 3FE3A 2X6EA 4AZSA 3IS5A 3V5JA 1WBVA 4RT7A 3DKGA 5DIAA 5EOLA 4FSQA 4BDFA 3E62A 3GOPA 4F1MA 2PPQA 2UW3A 5H8GA 1G5SA 4ANLA 2QHNA 4QNAA 2E9OA 1JPAA 2PE2A 5GZ8A 3V8WA 3HL7A 5HO6A 3VQHA 3ORKA 3SDJA 2ITXA 5IA3A 5J7HA 4U42A 3QTRA 3C13A 2PY3A 2ZYBA 3R83A 3KC3A 1UNGA 1P14A 4FNWA 4TPTA 4XP0A 4IB3A 3AT2A 5AV2A 1XBAA 2BZJA 5FXSA 4ERWA 3OXIA 2EB3A 4ZSAA 5J9YA 3KXXA 2UZLA 3K5UA 1S9JA 1Q8WA 3ZRMA 4BGGA 3EOCA 3DBDA 2XKCA 5BPYA 3E88A 3GNIB 4BDKA 4D55A 3CEKA 2YHVA 3OP5A 4UB7A 1Y8GA 3DZOA 2GU8A 4K33A 4GU9A 4KINA 2EVAA 3D0EA 2OXXA 3UIBA 4MCVA 4CSVA 4ENYA 4CZUA 5CAOA 3HP5A 3IONA 3RGFA 5KMJA 4Z7HA 3A7HA 5AP2A 2XEZA 4GT5A 2WQNA 5ANKA 3MWUA 3ZFMA 2GCDA 4C57A 4YSJA 2VWXA 3FZOA 3GU8A 4XOZA 4BN1A 3C9WA 3GQLA 1VJYA 2QG7A 3A8WA 5CEPA 5IH5A 3PXQA 3DB8A 4P5QA 3IW7A 4IAIA 4UXQA 5HBEA 4USFA 2X6DA 4GSBA 5K4JA 3VS4A 3ZUUA 4L3LA 3D83A 4QP1A 4FTUA 1GZKA 4QMSA 4O82A 3UIMA 2C0TA 4K11A 4RBLA 1J1BA 3LAUA 4X0MA 3O50A 3ULIA 4NFMA 1XO2B 3HDNA 4UZDA 4ZS0A 2XJ1A 4MWHA 4DF3A 2QOCA 4GKHA 2J0KA 4DBXA 2ZVAA 1YQJA 2Y6OA 1JKTA 4FKTA 5E8TA 3QRIA 4JL9A 4J97A 1UA2A 5LQFA 4QP3A 3R8VA 4N4SA 3DLSA 3TACA 4QMTA 2X9EA 3F3UA 3QZHA 3OTUA 5HIDA 3DXPA 5HU9A 2ZB0A 3MVHA 4EH5A 4NM3A 1KV1A 3V5QA 4EZ3A 3R04A 4IAKA 3FKLA 3G6HA 5A9UA 1DS5A 3OBJA 1O6KA 2VTSA 3EQHA 4ZY4A 3D9VA 5BX0A 2JGZA 3UP2A 3GC9A 3PIYA 5L2WA 3BWJA 4I6BA 5DNRA 4O6EA 1MRYA 4KIOA 3QCSA 3UZRA 1YI6A 3REPA 4MBLA 2VTIA 4KKEA 4KBCA 3TDWA 2REIA 4NZWB 3TEIA 5E4HA 3QL8A 4HYSA 5AV1A 4GMYA 2OK1A 4FGBA 4PTEA 4UYAA 5HCXA 4BGHA 3Q52A 3BEAA 3G0FA 1WBPA 4J71A 4MH7A 5JFSA 4O7TA 4I41A 2I7QA 3W32A 3RKBA 2R7BA 3F66A 5IG1A 3SG8A 1H07A 2X7GA 3FLZA 3PSCA 4WUNA 4CT1A 4ACCA 3VS0A 3KRXA 1QMZA 3PXYA 4BKJA 4GV1A 4QO9A 3VN9A 4LRJA 1P5EA 3M2WA 3BHYA 2I0VA 4R1YA 2YIYA 3H9OA 2JBPA 3FQEA 4IZAA 4K1BA 1TKIA 2OLCA 3ZCLA 1QPJA 5G6VA 3VQUA 3BELA 2VWWA 3BGZA 4TNDA 4NJ3A 4J95A 4FSWA 4TNBA 2QR7A 3EQGA 5EQEA 5FDPA 1OUYA 2C6KA 3OG7A 5I9ZA 4IFGA 3ZEWA 4ZEGA 3MW1A 4JI9A 4C35A 3MFSA 2F4JA 1A48A 1REJA 4IVDA 4AN3A 4MHAA 5BUJA 5E92A 4M69A 3QQUA 4QPAA 2F7ZE 2WD1A 3DAEA 3O71A 2GQSA 4O84A 5M09A 2YERA 2W1GA 2OXYA 3P7CA 4JOAA 5BVNA 5L2SA 2ZMCA 4O0WA 3VJNA 4IZ7A 3HNGA 4TY1A 5C1QB 1FVTA 2ETMA 3BX5A 4X7QA 4AT3A 4IWPA 1MRVA 2IW6A 2OZAA 4LOPA 3AMAA 1JKLA 4Q5HA 3C4ZA 4BDEA 4BZDA 3LFQA 4FV0A 2GDOA 4YPSA 5FDXA 1SVHA 4PDOA 3BHHA 4G3CA 5HO8A 4M0ZA 4BICA 3BYUA 4L3JA 3KU2A 5ICPA 2Z7QA 3NSZA 3DTWA 3Q53A 4NW5A 2YZLA 4MXAA 4WHZA 3QCQA 4TL0A 4WBOA 5HE1A 5I0BA 2XYUA 2VO6A 4FSRA 3AGLA 1OIQA 4B4LA 3UVRA 5EW8A 4CKRA 2QC6A 1MP8A 1WVXA 4U3ZA 3V5LA 3RALA 4PDYA 4XG3A 5EKOA 3R2YA 4ZLOA 3PPZA 2JIIA 5KNJA 3O51A 5BYYA 1KE9A 4YC6A 4DGMA 4YHJA 3PXRA 4I1ZA 3A7GA 4PMSA 2Q0NA 3R7IA 3OWLA 5BVDA 4MF1A 5IA1A 2RIOA 3ID6C 3K5VA 4HGEA 4QOXA 5JFXA 5DEWA 1DI9A 4HNIA 4FTQA 2C6TA 3BBWA 1M2PA 3HV7A 3M42A 4OR5A 5F4NA 4F7SA 5F20A 2XK8A 3RJCA 4F64A 2AYPA 3V8SA 2ITWA 4KD1A 5GJFA 2FVDA 1P2AA 4G5JA 4XP3A 1UU7A 4OTRA 3F5XA 4FTRA 4BDHA 4ZXTA 2VWZA 2WEIA 3U8WA 3ZSIA 3EQFA 5F94A 3MGYA 3GCQA 1OBGA 3THBA 3FLYA 4DGOA 3FSFA 4U9AA 2XVDA 3E8EA 4G17A 3RPOA 2CLQA 3DJ6A 5HHWA 3MJ2A 1URCA 5LARA 4ZJVA 5K0XA 3MH3A 2GS6A 4E4LA 4R7IA 2GMXA 5HCYA 2W1FA 4R5YA 1Y8YA 3TN8A 3EZVA 3UVQA 3WI6A 4YP8A 3ENMA 2Y7JA 3QC4A 4XUFA 2JLDA 3RI1A 4F9WA 5FEEA 2IN6A 4YU2A 1CKJA 3VBVA 4AU8A 3F7ZA 5AP6A 4FIIA 2BHEA 3UPZA 5A54A 4F09A 2QU6A 1KV2A 4C3RA 2BILB 5J95A 1JBPE 4IBMA 3SW7A 2ITQA 2VTPA 2XNGA 4QP8A 3ZTXA 4DH8A 5CLPA 5AUUA 5EM8A 3UP7A 3D7TB 1Z5MA 4MQ2A 3DAKA 4S30A 3RAKA 2XBJA 2BRBA 4DINA 3DFAA 4IANA 4M12A 4O1OA 3TIZA 1Q4LA 4C2VA 4BDJA 2C3IB 2PZPA 2R3GA 4XV9A 5EM7A 3RMFA 4F65A 3F6XA 3NNWA 5E8SA 3GP0A 4I6HA 5CTPA 2QOLA 2XCHA 5AA8A 3OEFX 5HD4A 3CLYA 2ETRA 5AV3A 3UGCA 3EHAA 3F3VA 4U3YA 2PUIA 2YDKA 2WU6A 3ELJA 4FT7A 4BCJA 4R7HA 2YAAA 3EYHA 4EC8A 4BTJA 3RCDA 2BALA 4KIKB 3HEGA 4R3PA 4XG6A 3MTLA 4OT5A 4E3CA 2CMWA 4A06A 4D2WA 1OPJA 3ZH8A 3VW6A 3PP1A 3W2QA 2IG7A 4ZSJA 3BU5A 5DOSA 4XV2A 4PPAA 3AMYA 5EQPA 4HNFA 4V05A 5AR4A 3ZU7A 3BZ3A 4JX3A 3VBQA 4AA0A 1XR1A 4AGUA 1CTPE 4QP9A 3D2IA 4BCFA 3MS9A 1FGKA 4EWHA 2OXDA 4XG9A 3TI1A 4IHPA 5HNGA 3DXNA 3PZEA 5DMZA 4O7VA 1PMNA 5JMSA 1WZYA 1PKDA 3NLBA 4XCUA 3CD8A 3ZLWA 4CFMA 4WT6A 4BBEA 2GNJA 4QMNA 4BCGA 4J8MA 3QTWA 3DXQA 2GTNA 3AC5A 3O96A 3LQ5A 4AGWA 1BKXA 3PY1A 4RVKA 1U54A 1URWA 3EKKA 3CBLA 3MTFA 3CC6A 3G9NA 3TT0A 4EHEA 2UV2A 4E1ZA 5E8WA 3OOMA 4KBKA 4H1MA 3GUBA 4DH7A 5LMBA 2W05A 2OICA 4OBQA 1A06A 2DQ7X 5LXMA 4Y95A 1NVSA 4FV4A 3GOKA 3L8SA 5ANEA 4AZFA 2W9FB 3BBTB 3NNUA 2WQMA 3IKAA 3OCTA 3A4OX 2PVKA 2VTOA 3R7GA 4LMNA 4LFIA 3R73A 4YLLA 3IECA 2BFYA 3VUTA 3LCKA 4C0TA 1YXTA 1PXLA 2NRUA 4PNIA 4BF2A 5CNOA 4JBOA 4DYMA 3ACJA 3UZPA 4C4EA 3P0MA 3O23A 1OKYA 4EOSA 4CLIA 3VUDA 5I9XA 4DE4A 2OJFE 3IQ7A 4BIDA 4D0WA 3SVVA 2CGUA 2QKWB 4RWJA 3S1HA 5J5SA 1W0XC 1W98A 3FY2A 2OIQA 4AA5A 3NW7A 2XK4A 3HYHA 4FTKA 4N6YA 3CP9A 1M2RA 2J5EA 3TTJA 4TYEA 2ZV2A 3FC1X 4ITIA 4WSYA 4FTTA 4BI1A 4ZLYA 4IB0A 3AG9A 3QWKA 2VNWA 2XRUA 5DEYA 2NNWB 2IVSA 4YZDA 2E9UA 4JQ8A 4O22A 5JFVA 4WA9A 2W5HA 2HZNA 3R1SA 4I24A 4JBPA 5FP6A 3IGOA 4E6AA 2QOHA 5KBRA 3R00A 3FMEA 1O6LA 1CM8A 1SYKA 2HW7A 3ZMMA 1HCKA 3EN5A 3U87A 3UVPA 4ZTHA 4OAVB 3AOXA 4V01A 2JKOA 3Q9ZA 4JS8A 3QALE 3COHA 1A9UA 3C4EA 3FDNA 4UBAA 5CF4A 2ITYA 2CKOA 2CN8A 2VGPA 3NVMB 2OG8A 2VTHA 5D10A 5AAEA 1W84A 4E7WA 2FSMX 2RSVA 3LZBA 4H58A 5CAVA 2X4FA 4XHKB 1Q3DA 4OTGA 4QMWA 5CT0A 4R5SA 1OKZA 2OI4X 4J8NA 2ZV7A 3ODYX 4DGNA 1B38A 1Q3WA 4ZAUA 4RJ4A 3KXZA 5EI6A 1H08A 2QURA 2C6EA 2OF4A 4EKKA 5GHVA 4ID7A 4PY1A 3W2RA 3P7BA 5BVFA 5CU0A 5ANJA 3Q5ZA 4FKUA 2OJGA 4QP2A 3VS3A 1R3CA 2C6DA 2CCIA 1I09A 4JAIA 3W2SA 3GU4A 2X8DA 3PPJA 4QMXA 2QQ7A 4DLIA 3MN3A 3R1NA 3KMMA 2WB8A 5A4EA 5DI1A 1V0BA 5LMKC 3QD2B 2J6MA 3ANQA 2ZM1A 2GNLA 2PE0A 2BAQA 2O65A 3EN9A 4R3CA 4XNEA 2F2UA 2WMUA 3FMDA 4O0UA 5G1XA 4PMPA 2R3QA 5L8JA 4PTGA 2JBOA 4B99A 5ETIA 2X8EA 2UZOA 3WILA 1DAYA 3EFJA 5CYIA 1YWNA 2IW9A 5HCZA 5JZNA 2GNFA 3TM0A 4UMPA 2PVHA 2GNHA 5J79A 1JAMA 3KEXA 1CSNA 4FT3A 4RJ6A 5A4CA 4FICA 5ANDA 3MFUA 2BZIB 2ONLC 4RQKA 5EM5A 5HKMA 4EL9A 5IEYA 4RG0A 5LMKA 4CG9A 3OW4A 3WF8A 4D1SA 4CLJA 5JN2A 4Z7GA 4BCOA 3C4CA 4USDA 1U59A 4FNXA 3ACKA 3UPXA 2PULA 3FPQA 5EYMA 3FHIA 4MX9A 3V3VA 3VS5A 2YIQA 5CXHA 3HUBA 2NRYA 3BYMA 1R1WA 1XWSA 5EYCA 3TZ9A 4NL0A 4AWIA 5EFQA 5DVRA 1YXXA 4ENXA 4LGDA 5AUXA 3HZTA 3OCSA 4HGLA 3R8ZA 3LMIA 1WAKA 3BLHA 2UW6A 3FLSA 4U44A 3HV4A 3L8VA 2PVYA 3FMJA 2C3JA 2JC6A 2ONLA 3A99A 3JS2A 5EHYA 4EQCA 2UVXA 4D5HA 4UN0C 4E20A 5CU6A 5HG9A 1PXOA 3L9PA 3TXOA 5HTIA 3GC8A 2XRWA 3Q4TA 5D11A 4DG0E 1WBOA 1M2QA 3R2BA 4PL5A 3WIGA 2PHKA 2BAJA 4OTPA 5F1ZA 1AQ1A 3Q60A 3QZIA 4DFZE 3ZRLA 3COIA 4TXCA 4JX7A 3D2KA 4Y73A 4MKCA 3UBDA 1ZOHA 4DN5A 4U79A 3TCPA 4EH6A 5EH0A 5B2LA 4IQ6A 3R7EA 3EFWA 4QTDA 5DN3A 4MEDA 4QMQA 4FKVA 4BIBA 2EXMA 4MXYA 3FV8A 4FV1A 3ET7A 1R39A 4UWCA 2CHLA 1GZNA 2V62A 4NJDA 3C0IA 3D5XA 4DITA 5TR6A 3DY7A 4ALWA 2UZWE 3EH9A 3LW0A 3TJCA 4WOVA 4PTCA 4H3QA 4E93A 2HAKA 3OUKA 3LOKA 4TW9A 3RM6A 4O0SA 3QQJA 4YBJA 4AS0A 3GCSA 4U40A 3QKLA 1GZ8A 4Y72A 4LL5A 3EN6A 3EQPA 3LJ1A 3NPCA 2R9SA 4Z3VA 3EMGA 4I20A 4ZTLA 3C7QA 4MXCA 4HOKA 2BRGA 3G0EA 4AN2A 1KE5A 4YZCA 4JJRA 3QA0A 5FQDC 2V5QA 3F5GA 4APPA 2OWBA 5AP1A 4F4PA 4H05A 5D1JA 5AFVA 2QKRA 2XIRA 2R3MA 1IA8A 4NM0A 4YZ9A 5ETAA 4EYJA 4IADA 4IX6A 1J7LA 2VTMA 4YJSA 5FWKK 3Q5IA 3CGOA 3WIKA 3FQSA 3PE2A 4V04A 5HE2A 4TYJA 3JYAA 2RFSA 2RF9A 5HBHA 2B1PA 4D0XA 3FWQA 1F5QA 5K9IA 5AX9A 3RCJA 3QUEA 3UDBA 2G1TA 3NUPA 4IC7A 4RSSA 3C50A 2JKMA 2C69A 3QXPA 3HECA 2HENA 3SV0A 5J1VA 2PMOX 2X1NA 4PRJA 5IA5A 3WE4A 5IDPA 4BHNA 5K5NA 3CD3A 5HTCA 5FTGA 4FKIA 5CAPA 3DCVA 3I0QA 5ANIA 1B39A 4DEGA 3TKUA 2WMRA 3HA6A 4UMUA 2GSFA 3QBNA 3E87A 4PP7A 3ZO4A 4ASEA 3AXWA 4RGJA 2XIXA 4G9RA 4OTQA 4RWIA 3VBTA 5JGDA 4FKPA 4HJOA 5K4IA 5AEPA 3QF9A 5DBXA 1KE7A 3PG1A 4EH7A 4NKAA 2Z02A 2BTRA 3PFQA 4FIHA 4PQNA 5AWMA 2Z60A 4CRSA 3GBZA 3L8XA 4OGRA 2VV9A 1H26A 1XH7A 4PL4A 2ZM3A 4TTHB 4EBWA 2QCSA 5IA4A 4C4HA 4QMVA 2WU7A 4BKZA 3OCGA 2OZOA 3BE2A 5IQCA 3P5KA 4J1RA 1M17A 4WG3A 3ZBXA 3V6SA 4HW7A 2Z8CA 3LHJA 5E8YA 3DS6A 4E6DA 4KB8A 1LP4A 1WCCA 3EFKA 4GUBA 5DGZA 5M57A 5DYJA 1CDKA 4W4WA 3D5WA 3WZUA 3NIEA 2V7OA 5GJDA 3SG9A 1BLXA 1WFCA 1Z57A 3ROYA 3AC8A 4ACMA 5IH6A 3G2FA 1LUFA 3MH0A 5M56A 5CU2A 5KMMA 3FZPA 1BYGA 1H01A 1STCE 4O7NA 5IF1A 3O17A 4IB5A 3FLNC 3CJGA 4LV5A 1FVVA 4ANMA 2B9JA 5C8MA 5AR7A 4F99A 5HGIA 3ORPA 2QONA 2O0UA 4QPMA 3U4WA 4F0IA 3FLQA 1JNKA 3GU6A 4Y5HA 4AOIA 4EJNA 4O0XA 4DA5A 4C4IA 4AW2A 5FGKA 4BYJA 4EORA 2YDIA 1JKKA 1W83A 2BZKB 4FSYA 2GHGA 5BUIA 3TNIA 3DQWA 1DM2A 4I5PA 5DRDA 2PTKA 2F49A 4OTIA 4JLCA 3VHKA 5HICA 2QOKA 5E8VA 3P86A 4CFUA 1KSWA 3AT3A 4S32A 3TDVA 2B7AA 2W1CA 4R1VA 3FLWA 2FH9A 2UZBA 2FGIA 5EYDA 4FYOA 5BUEA 3C4FA 3NGAA 4K2RA 2ITTA 3PE1A 5E1EA 4DFYA 4D9TA 2WMAA 1M14A 2IJMA 3MI9A 3F88A 3R7VA 5IU2A 3K54A 4CXAA 3R7YA 4G34A 2GS7A 2XCKA 1H4LA 2BR1A 2R3LA 3I7CA 3NAXA 4I21A 2O5KA 5H2UA 5B7VA 5KE0A 2CGXA 3EN7A 4O91A 2ITZA 3M11A 5IQDA 3CY2A 3JVRA 4IB1A 4LOOA 1IASA 3PVGA 3RP9A 4EHVA 2A2AA 1RJBA 5H8EA 4AZWA 4CCUA 5CNNA 3E63A 1B6CB 2HYYA 5CSWA 4C38A 4HVGA 3MJ1A 5IEVA 3QKKA 3T3UA 3TKIA 2BKZA 3MPAA 5IQFA 1Q8UA 4CFNA 3SGCA 3GI3A 2XUUA 2HWPA 3E8CA 3VS6A 3RWQA 4EH2A 1YOMA 2J5FA 4M69B 5L6OA 5AIKA 4JRVA 4BZNA 4O83A 3QLFA 4U5JA 5AP5A 4ZSEA 2QNJA 1PXIA 4RPVA 4YTIA 4CTBA 4O7ZA 3CR0A 4X2FA 2ZJWA 4L7SA 5CSVA 3MYGA 2JDVA 4GG7A 3RPVA 3A7FA 3R9DA 4O6LA 2BRHA 2OZAB 1OIYA 4KKGA 4OTHA 2BRNA 2DYLA 4LYNA 4BBFA 4HVDA 5E1SA 3NUUA 1LPUA 1K3AA 4JQEA 3O7LB 5DR9A 4M97A 4ASDA 3ZC6A 2R0IA 2JFLA 2YM4A 1L3RE 4QYEA 4M14A 4NIFB 3CQUA 5JRSA 1JKSA 2Y0AA 5AP0A 3CSVA 4EOOA 3KCKA 3GFWA 2YZAA 3F5PA 1P4OA 1BX6A 4J7BA 3COMA 2RKUA 4KIPA 4QQJA 5CZIA 2I0YA 2G2IA 3CTHA 4I0RA 3W2CA 1VYZA 3MY5A 4KS8A 4BCPA 4I5CA 2X0GA 2VTRA 5LVLA 2NO3A 4OTWA 5D41A 2GPHA 4QNYA 3UYSA 1UKIA 5GINE 4HYHA 4A4LA 3CCNA 2PZIA 2VWVA 5IZFA 3F9NA 4YURA 5KHXA 1WMKA 3FKNA 3LCTA 3PLAE 4CFFA 4QMOA 4EK3A 2DUVA 3WBLA 4ZTQA 3FZRA 5HESA 4D2SA 2BZHB 2WTWA 3OWPA 3N9XA 3TIYA 4FKGA 5J9LA 2CDZA 1MQ4A 1ZY4A 4EKLA 4G9CA 4EQUA 5M4IA 2XS0A 1R78A 5CQUA 5DG5A 4YMJA 5AUTA 1DI8A 4M68A 4PPCA 2WZJA 2V0DA 1GAGA 4FC0A 1PW2A 4OBOA 4EH3A 2WTKC 2FSTX 2W7XA 3NUSA 4FKWA 4G16A 5HG7A 3JR1A 4DLJA 2UZVA 4MTAA 4YPDA 4QMPA 3MVJA 2W5AA 4GT3A 2PZ5A 3JY0A 4OTDA 1RW8A 2VTLA 2YM6A 2WMBA 2PVJA 3MA3A 3VUHA 4R78A 3LXLA 4L7FA 3W8LA 1GJOA 1UWJA 3L8PA 3GU5A 3LVPA 2J0MB 4WKQA 4AT4A 2XJ0A 1W8CA 4O7RA 2X39A 3RNYA 4L9IA 5ACKA 4BDIA 4BGQA 4BWPA 1OMWA 1H1RA 2UW8A 1E1VA 3KF4A 5M55A 3V04A 3ZO3A 2C5NA 4Y46A 4M3QA 3FL5A 1Y6AA 4F6WA 2BTSA 3PXFA 4GRBA 4FG8A 2GHMA 5FEQA 1CMKE 3QZGA 3LE6A 3QAME 3RAHA 3UG2A 4JT3A 5IQGA 2WNTA 4ZP5A 4C62A 3OUNB 4XMOA 5AAFA 3TNQB 4UY9A 4J53A 2IO6A 2RFEA 3MY0A 2XIYA 3AQVA 2E2BA 1HOWA 4UALA 1GIIA 3KA0A 4EZ5A 5TT7A 3QU0A 5JEBA 3MVLA 4YO4A 2XNMA 4G2FA 5IQBA 5AADA 4F1OA 5AIRA 3ZDIA 1T45A 2H34A 4D2TA 3OROA 2YJSA 4RIXA 4JR3A 3PVWA 3R71A 3C5IA 1JLUE 2XNBA 3QHWA 3VS7A 1OVEA 5FM2A 3QQLA 4WIHA 3QCYA 2JDRA 5KKRC 1F3MC 1Q61A 1YI3A 5FTOA 5HX8A 4AP7A 4I94A 1YHWA 3M1SA 2XYNA 5I5ZA 2Z7SA 3KL8A 3BU3A 4NIFA 1UV5A 2CN5A 4DHFA 3WF7A 3NDMA 3LFFA 4GJ2A 5IPJA 3NCGA 4FL1A 1YXVA 3I79A 4A9YA 3ATSA 5EG3A 3CGFA 4B8MA 3II5A 3NR9A 4QYHA 5AV4A 4S31A 4YHFA 3PRFA 4PP9A 3NIZA 4YUQA 4PMMA 3E5AA 3E93A 3WYYA 5JKGA 3ORNA 3PIZA 5CEKA 1KE8A 2RFNA 2PVMA 3QLGA 4FV6A 4ALVA 3FI4A 3UTOA 2H96A 3OOGA 2CKEA 2QD9A 2LGCA 1M7NA 2VWYA 3Q2MA 4YC8A 5C27A 2JAMA 4FK6A 4IX5A 3EN4A 1OIUA 3P7AA 5L2QA 3DQXA 1U5RA 3I5NA 2XM8A 4TKSA 5B0XA 5K0KA 4PWNA 3HMOA 3RWPA 1K2PA 1U54B 4C4JA 5KMNA 4QQ5A 4U43A 1XKKA 5CU3A 5A6OA 4N57A 2VTTA 3D4QA 4EOLA 5TO8A 3G9LX 3PA5A 1IEPA 3FYKX 3ZLSA 5CU4A 4D28A 3AC4A 3DLZA 3R8UA 3NUNA 4BIEA 1U4DA 4FTNA 4TYHA 4G3FA 2R3JA 4AAAA 5IH4A 4WNPA 3ROCA 3UNZA 4F6SA 5AR5A 4PV0A 4BB4A 2E9PA 4QD6A 4X3FC 2YLEA 3ZS5A 5K5XA 2W4JA 3LFAA 4O7WA 3EYGA 2OIDA 4O2ZA 1M7QA 3ZFXA 4XJ0A 3DKFA 2YM7A 3G33A 4AQCA 2H8HA 4K9YA 3N4UA 3C1XA 3FMMA 1YW2A 1WBSA 1SVGA 4L3PA 3C4WA 1V1KA 4RLKA 4BI0A 5AJQA 1BUHA 2YM8A 4F0GA 1FMOE 2WMVA 2BIYA 2X9FA 3I0OA 4J52A 3EJ1A 3NAYA 2IZSA 4DEBA 5HE3A 4EOQA 2QHMA 4I3ZA 4NFNA 5LVMA 3D15A 2VU3A 5BYLA 5LVOA 1YDRE 4X3FA 3Q96A 4H1JA 3KK9A 3ORXA 2FO0A 3ZDUA 2DWBA 3UNKA 4YJTA 2LAVA 2HW6A 3V5WA 1YXSA 1VR2A 3LFEA 2X7OA 4NM7A 4DG3E 4RWLA 3QQFA 3WZEA 4AZEA 4FKOA 3ATTA 3DZQA 4IC8A 1YVJA 3K3IA 3ZM9A 4O96A 4ZY6A 2R64A 1H24A 3Q9XA 3BRBA 3IW5A 4AOJA 4X6QC 2QO9A 3O8PA 2BUJA 4DFLA 1H1QA 4KAOA 2OW3A 1UNHA 5DT4A 3EFLA 3ALNA 3ORTA 2YABA 4AW5A 5DLSA 1AD5A 2VNYA 4BCKA 4DEDA 4XP2A 3QCXA 5IA0A 2XNNA 4TYIA 4MYGA 4KWPA 5FBOA 4AA4A 2XZSA 3BHUA 3D5UA 2PWLA 2UW9A 3S00A 4RVTA 4TWOA 3A4PA 3DBQA 2P2HA 4RA5A 4IWQA 4F9CA 4WRGA 4XG7A 3F2NA 3MIYA 3DKOA 3P1AA 3OC1A 4FT9A 2PVNA 3OCBA 3V01A 4WG4A 4ANSA 4J99A 3OFMA 4RA4A 2G2FA 4P7EA 3LFDA 2J7TA 3NUAA 3I6UA 4OAUC 3PG3A 4EJ7A 1OGUA 2C0IA 4KSQA 5HZNA 3BI6A 2HWOA 4RJ5A 3D94A 2OFVA 1J1CA 4JBVA 4BDDA 3OWKA 5HVJA 2IWIA 3KQ7A 4GL9A 4FV7A 4GYGA 3MBLA 1OI9A 3EB0A 4RJ3A 2EXCX 3VO3A 5KO1A 4MXOA 3TZ7A 4IJ9A 3PY3A 1TQMA 1UU8A 3AC2A 4FSMA 1UNLA 2X81A 2RG6A 3PY0A 4A9UA 4D58A 4U6RA 4RIYB 4O81A 1BI8A 5H9BA 4W4XA 5CY3A 1OIRA 3TL8A 3A7JA 3QZFA 3WF9A 3AD4A 4CEGA 1SM2A 1L8TA 3O8TA 4IMYA 1REKA 2XBAA 5D7AA 4AE9A 3QXOA 4U80A 2G15A 2XKFA 3IGGA 3QTQA 4PX6A 2UZTA 3OWJA 3RPRA 4APCA 5DT3A 3R30A 2Z2WA 4HYUA 4ZZOA 4O0TA 4JBQA 3NNVA 4BBMA 5AV0A 2V22A 4UMRA 4FT5A 3WZDA 4LG4A 4YHTA 4JAJA 3DBCA 1F0QA 4ZTMA 1KWPA 4FKLA 2FSOX 3IK3A 1OPKA 3LFCA 4WNKA 3BLRA 4F70A 1NA7A 4LRMA 4II5A 1ERKA 3R8LA 4AFEA 4AF3A 1OBDA 5HNIX 1ZMWA 2R3HA 2WFYA 1RQQA 2YJRA 3FY0A 4Z9LA 2HXQA 4NM5A 4O0YA 4A07A 2W17A 5CVGA 3IW6A 2J4ZA 3SA0A 3DGKA 2WTVA 4C58A 4K18A 2BIKB 4R6VA 4YLJA 4EZ7A 2J50A 4GFOA 4Z55A 3LFSA 2GFCA 3L9LA 3KN5A 2P2IA 3W16A 5I9WA 5I9VA 4HPUE 2IZTA 3QQHA 2ZMDA 3TKHA 3U6HA 2QLUA 2GQRA 5LWMA 1YHVA 4HZRA 3U51A 4EBVA 2YIWA 1J91A 4E73A 3I4BA 3R0TA 3DJ7A 2OO8X 4OTFA 3RPSA 3Q6UA 2F2CB 3QGWA 1O6YA 2QR8A 5CVHA 4H3PA 3AMBA 3PJ8A 4XG2A 3KY2A 3KB7A 4ANOA 2IZRA 4J96A 1GIJA 1JSUA 3WARA 3Q3BA 3NW5A 3L9MA 5LVPA 4CVAA 1W7HA 3R21A 4CFXA 2VTAA 2VTNA 2Y4IC 2I1MA 1OECA 5EOBA 1H00A 2BRMA 3FKOA 4FEUA 5A4LA 4FG7A 2F57A 4V0GA 5H3QA 3UOLA 2PUNA 3IW8A 2ITVA 3U4UA 2OKRA 4FTLA 4GT4A 3ENHA 3RK9A 4L52A 5JSMA 2HY81 3CIKA 4IAZA 1ZYCA 5ACBC 3CXWA 3ZHPC 2HIWA 3Q04A 3S95A 4CG8A 4DTBA 1SMHA 4M8TA 3CPBA 4BDCA 5JK3A 5FD2A 4GIIA 1ZY5A 5L2TA 3IW4A 4BWXA 2XF0A 3Q9WA 3LLAA 3QKMA 5TF9A 3OBGA 4K6ZA 3FQHA 1G8SA 3OT3A 3QTXA 4D5KA 3UO5A 3A8XA 1WVYA 1ZMUA 4RIYA 5AUWA 4E6QA 3O7LD 4IM0A 3BYOA 5KX8A 2DS1A 4IDTA 3GGFA 1E9HA 4ARKA 2I40A 3LCSA 5E8UA 2GQGA 4IX4A 3WYXA 2WQOA 4PMTA 4N6ZA 4FVPA 4G1WA 3FUPA 1YOJA 4QTBA 3NNXA 4WBBB 4A7CA 4O86A 2VGOA 2WELA 3VIDA 4YBKA 4D4RA 1FMKA 1XBCA 3N4VA 3QQKA 2BAKA 4A9RA 2JDSA 2W96B 2WOTA 3R63A 4XS2A 4Q2AA 2OH0E 2VWUA 4DT8A 2EXEA 2CNUA 3OY1A 4FTMA 4CT2A 5CANA 1E1XA 1NW1A 2PUUA 3PJ2A 4AW1A 1UKHA 1PYEA 5I4NA 4FSTA 4AG8A 4GVAA 4B8LA 3JUHA 4N70A 4OLIA 4C02A 4MXXA 3QRKA 4LUEA 5HU3A 5JQ8A 2VRXA 3BCEA 2O3PA 4QTAA 4DGGA 1LR4A 1TVOA 1Q8YA 4DTKA 5LJJA 3G6GA 4ZY5A 4QQCA 5AMNA 5CEQA 4XX9A 2CNVA 2I0HA 4WRSA 2F7EE 5AUZA 3BE9A 4QMZA 2VX0A 3POZA 4CYJA 2BMCA 4FA2A 3ORMA 4FTAA 4D1ZA 5A6NA 4ZMFA 3KXHA 4BDBA 3D7ZA 2PZYA 2VTJA 3E3PA 3Q4UA 4F9AA 4RC3A 1NVRA 3HMIA 5AAGA 1T46A 1VZOA 4B0GA 3FBVA 3PSBA 4MQ1A 3V6RA 5IEXA 2V7AA 3I6WA 4MD9E 5KCVA 2I6LA 4LGGA 4M7IA 4XYFA 2YA9A 3OD6X 4FSNA 4YJQA 5EKNA 5M4CA 3QRTA 5BQ0A 2ITUA 4XBRA 2PMLX 3AC1A 2HZ4A 2R5TA 3H9FA 4YJVA 5C26A 2PVFA 4BHZA 5C01A 4C8BA 5I3OA 3H4JA 4C61A 4C3FA 4DTAA 2XK9A 4YNEA 4FV9A 4MD7E 2ERZE 5CX9A 4HZSA 4PF4A 3TV4A 4U81A 4MWIA 3ORIA 3SLSA 4D4YA 2GS2A 4IFCA 3D14A 4D2RA 1CKIA 4XLVA 2XKDA 2XA4A 5BVKA 2JAVA 3HMPA 1JVPP 3NS9A 1R0PA 3DDQA 1ZYJA 4FSUA 4OT6A 5HORA 5FXQA 2OIBA 3A7IA 3QRJA 4ZLZA 1H28A 1YHSA 2UVYA 3FXXA 4ITHA 4CTCA 4F63A 1KOAA 3HRCA 4YZBA 5JT2A 4IDVA 3MA6A 4GKIA 3GCPA 4R77A 3MH2A 1ZOEA 4F08A 3VF8A 2WIPA 2O2UA 2B4SB 2R2PA 3C5UA 4FKJA 1PXPA 4HCVA 4C59A 1GIHA 3Q32A 1OUKA 5HD7A 4ZSLA 1V0PA 4FTIA 1ZRZA 4QTEA 2EWAA 3MSSA 3HX4A 2E9NA 2KTYA 3FC2A 4F0FA 2ZAZA 4G3EA 1BL6A 5L3AA 2VO0A 1ZYDA 3QTIA 2WQBA 2ZV9A 4O0RA 5JFWA 2RL5A 4EHZA 2JDOA 3LPBA 3VVHA 4EH4A 3LMHA 3ZOSA 1YXUA 5IUGA 1NY3A 5JH6A 3LM0A 2C68A 3U54A 3ZC5A 4YTFA 4FTCA 4HVHA 4BYIA 4F7JA 3COKA 3BHVA 4BDGA 3FJQE 1XH5A 4DCEA 5DE2A 5B2KA 3SXFA 2R3RA 2B54A 2XIKA 4QMLA 5DRBA 4TT7A 4FZFB 5M4FA 4EK8A 3ZUTA 3BV2A 3DU8A 4DT9A 2XMYA 3HLLA 1PXKA 2AUHA 3OEZA 4FVQA 3Q9YA 4A9TA 1J7IA 2QOQA 3BHTA 2XK3A 4IXPA 5EDRA 4KABA 3RM7A 5DFPA 1JOWB 3CPCA 2VD5A 5D9HA 3UQCA 4CFWA 5EQYA 5CF5A 4NEUA 4DG2E 4RC4A 4GK3A 5J87A 5F9EA 4FKQA 4L67A 4NTSA 3VUKA 5CEOA 3TNPC 5JRQA 3QFVA 3R9NA 4FL2A 2YCQA 3NYOA 3OY3A 1WBWA 2XB7A 3PSDA 4IZ5A 5AP3A 3V8TA 4U0IA 4C2WA 4IIRA 5C03A 3W10A 2PZRA 2OU7A 4E4MA 2QOIA 4U7ZA 3VUGA 4IW0A 4QP7A 2A4LA 3WE8A 4FNYA 3LMGA 4CRLA 4UZHA 3EZRA 4MBIA 4BTMA 4MNFA 4Y83A 3U9NA 1Q62A 4RWKA 5CSHA 3NYXA 3F3WA 3CKXA 3KULB 3ODZX 1KOBA 4GIHA 1XQZA 4WNMA 5IQEA 4KSPA 4OBPA 3OHTA 3QYZA 4O1PA 2QOOA 3OTVA 3R1YA 3T9IA 3F2RA 3T9TA 2FB8A 2C0OA 3DFCB 3R8MA 3HA8A 2VWBA 1Q24A 3CKWA 4Q5EA 4E4NA 4BC6A 3NUYA 4YJRA 2B55A 3LM5A 1OL5A 4FG9A 4ALUA 4LI5A 4JXFA 3ITZA 4JNWA 3VBYA 4D2VA 3FPMA 3CQWA 3IDBA 4EWQA 5M44A 4RX7A 3E8DA 3BU6A 4KS7A 3TG1A 4CKIA 5M06A 1YDSE 2E9VA 2B9FA 3KK8A 4Y5QA 5AM6A 3R7OA 4YGAA 1ND4A 5IQIA 2A1AB 3DNEA 4M0YA 4FGRA 2F7XE 4PDSA 1G8AA 2QO7A 3GVUA 4ANNA 4YLKA 3GEQA 2C5VA 4RC2A 5DH3A 4MAOA 3ERKA 3OS3A 5GIOE 3WF6A 4IH8A 2H9VA 2YISA 3QD0A 3IO7A 3NWWA 1XHAA 4IM3A 4YTHA 5GZ9A 2XK6A 1G3NA 4NW6A 2VTQA 4KA3A 3UOKA 3S2PA 5M07A 3RHXA 1H1SA 3PA4A 2IVVA 4XG4A 2J51A 5E9EA 3R01A 4WNOA 3NYVA 3FZSA 1PY5A 4ANBA 4JIKA 3H10A 5E7RA 4E5AX 4ASZA 1YDTE 4O7LA 4XOYA 2ITNA 4CMTA 5EI2A 4I23A 4BI2A 4NTTA 3KCFA 1AGWA 3FMKA 3LCOA 3KXNA 2YWVA 3H30A 3UODA 3NMUF 1SNXA 2C3KA 2C6IA 2WMQA 3A61A 3FL4A 2W4OA 4EH8A 4ZSGA 1YRPA 4TWPA 2ZB1A 4PNKA 3GFEA 4ONAA 4AZTA 2VN9A 4FOBA 4EEVA 4D4VA 2WTKB 5AP7A 2WO6A 3K2LA 5CAQA 4RVLA 3PRIA 3GC7A 1JSVA 2RFDA 2YCRA 2O8YA 2WKMA 2VWIA 4FIGA 4RLLA 5HIBA 4AACA 4CFVA 2WMXA 4ITJA 4EOIA 5IMEA 1PHKA 3U9CA 4TN6A 3QD4A 5EK7A 3RZBA 1H0WA 4YSMA 2F9GA 4U8ZA 5GIPE 4ZK5A 4ZTRA 5EDQA 3LQ8A 3BPRA 2X7FA 4DH5A 4EI4A 4G3GA 1J3HA 4G6NA 5A4QA 4QTCA 4L44A 3F61A 5GNKA 4IX3A 4IM2A 3EWHA 5DPVA 3A2CA 2P3GX 2W5BA 4RX8A 1APME 4RX5A 1YI4A 4RIXB 4FV8A 2SRCA 5J1WA 2VO7A 4FZAB 4GK2A 3W1FA 5IUIA 4FUXA 2Z7RA 5JGAA 3QX2A 2YAKA 5E8ZA 5FBNC 2WMTA 3I5ZA 2JD5A 3JVSA 3ANRA 3R6XA 4FMQA 4IE9A 3KULA 4FSZA 4KRDA 4CCBA 4O7YA 4QYFA 3TWJA 4KBAA 5L4QA 5AR8A 4ZZMA 5AR2A 5LCKA 3ALOA 5EDPA 1OZ1A 4DH3A 5LMAA 3UC3A 3RINA 5KBQA 4FEVA 4L42A 2WPAA 3VJOA 4W4VA 2BCJA 2C1BA 2P4IA 4QP4A 3S3IA 3FI8A 4IVAA 2CKPA 2XK7A 2QOFA 5KMLA 2R3KA 4QMYA 5HQ0A 5HEZA 2YCFA 3KMWA 2VX1A 3U6JA 1UVRA 3MB7A 3I1AA 3SD0A 1RDQE 4EONA 1QL6A 1WBTA 1ZYSA 5KKRB 4N0SA 2YLFA 1QPEA 2CPKE 4G6LA 4RMZA 3GU7A 3SRVA 3S4QA 4NU1A 2J0LA 4BFMA 5DWRA 4ACGA 5BVEA 4AOTA 4CQGA 5HBJA 4AFJA 3EQCA 4D4SA 3LCDA 4CV8A 2HY0A 4HPTE 1P4FA 5HG5A 4C4GA 1PRYA 3RBWA 3OVVA 4TZRA 2EUFB 1H27A 5L2IA 1ZWSA 2CJMA 3FZTA 3PVBA 3F5UA 4B6LA 2O64A 3O2MA 4IVCA 3DKCA 4B7TA 1KUTA 5IUHA 3KVXA 2A0CX 2RGPA 3E7VA 3MPTA 5FM3A 3SKCA 3ZLXA 2C6OA 2GFSA 1ZARA 2HXLA 2CCHA 2UZEA 5CI7A 4TYHB 5A4TA 4HGSA 3BKBA 5L6PA 3HUCA 3SQQA 2C6MA 4FVRA 4W9WA 4O21A 1CKPA 3MVMA 2QVSE 2W1ZA 3HMNA 4IZYA 4S2ZA 3GENA 4W8DA 1OITA 4ACHA 2VUWA 4ORKA 2ITOA 2J9MA 3HV5A 1MUOA 4NCTC 3AD6A 4FUYA 4B9DA 1GNGA 4R8QA 4RIWB 4AGDA 2W1IA 4L01A 1UU9A 5HVYA 3R9OA 3NCZA 3R22A 4U45A 3I60A 3FMLA 3QC9A 3EQRA 1OL7A 3TJDA 4YO6A 3NEWA 4P5ZA 3LXKA 1I44A 2A19B 4L45A 5EW3A 4FBXA 3KRLA 2BDWA 3O0GA 2WXVA 4MD8E 5AUYA 4L6QA 3V51A 2BPMA 2UW0A 3E8NA 3IDPA 4LV8A 2VO3A 3RZFA 1S9IA 4G5PA 4X3FB 5ETFA 5CEMA 2OF2A 1YOLA 3KXGA 3PJ3A 3AC3A 3P79A 1PYXA 3CJFA 3FXWA 3GCUA 4NCTA 4JR7A 3WZKA 3AT4A 4X2NA 2R4BA 2V55A 3TTIA 3QGYA 3ZBFA 4GCJA 2PMIA 4FEWA 4ASXA 5CF8A 2JEDA 5IKWA 3TV6A 4CMOA 4QQTA 3L1SA 1SVEA 4EK6A 4JDKA 2JITA 4AT5A 4I5MA 4Z16A 5BVWA 4U41A 4E5BA 2ERKA 2J0IA 4NT4A 2P55A 3QUDA 3PXZA 4UEUA 4I22A 4LQMA 4BL1A 1U46A 5EYKA 3LLTA 4IAYA 1ZYLA 3TZ8A 1WVWA 3E92A 5CQWA 4DFNA 4ZJJA 4E5WA 2C47A 2W06A 3OZ6A 3SW4A 5FRIA 3KRWA 5HOAA 2YM3A 3FXZA 3FHRA 1Q41A 2XH5A 3Q2JA 2R0UA 5FP5A 3KN6A 3OXZA 4DEEA 1HCLA 4CYIA 1QPCA 3TUBA 3UO6A 2XIZA 3VS2A 2J0JA 3VHEA 4DBNA 3GXLA 5D12A 5TOZA 5EM6A 4QPSA 4AGCA 2ZDTA 4FF8A 3EIDA 4R3RA 4DFXE 4R7BA 3VBXA 3F82A 5BMMA 4F7LA 3F69A 3HP2A 2VAGA 4YNOA 4RJ7A 2R7IA 3HVCA 3BIZA 4GEOA 3UYTA 4C7TA 5BMSA 3N4TA 3LFNA 4WO5A 4WUAA 1IAHA 2ESMA 3F2AA 3UIXA 3O8UA 4KKHA 3QYWA 4USEA 2X8IA 4S34A 2R3OA 3P78A 2CSNA 3HRFA 4ZZNA 1H0VA 3HMMA 3RK7A 4AN9A 5AR3A 4RIOA 3HDMA 3WZJA 3VS1A 3UO4A 4BCHA 1IAJA 5F95A 1VEBA 4EHGA 3JPVA
chains in the Genus database with same CATH superfamily
3IOPA 4PDPA 2Y4PA 1GOLA 5T6KA 5M4UA 1MRUA 2B9IA 2BVAA 4BVUA 2QI8A 3NX8A 4UX9A 2J2IB 4BCNA 4WSQA 2WTIA 1XH8A 4RIWA 5CSXA 4FE2A 3NRMA 5IISA 4IACA 4I4EA 4QMMA 4KIQA 3LJ0A 3UOJA 5KMIA 4FL3A 4BY9E 4IVBA 3ZO2A 3GT8A 5M53A 4LOQA 5CEIA 2UZDA 3PP0A 2YCSA 5CT7A 2UVZA 3UMXA 1FQ1B 4MK0A 4FOCA 4UWYA 3JY9A 3V5PA 3UE4A 5CVFA 5IQHA 3EQDA 3T3VA 3BLQA 3MB6A 4DGLC 4DH1A 5CXZA 3QRUA 3UC4A 1ZOGA 1QCFA 4JDIA 1OKWA 2WHBA 2UZNA 3S0OA 3DOGA 3RVGA 5DHJA 4A4XA 2X2KA 5A46A 5FG8A 5DR6A 2W1DA 3B8RA 3R7UA 5BNJA 2WGJA 3GB2A 2W99B 3DDPA 4QYYA 1JWHA 2NP8A 2R3IA 1M52A 4X3JA 3Q6WA 5L6WL 2XM9A 3ZSHA 1PMEA 1LEZA 4M84A 5J8IA 3ZONA 3ZZEA 4F7NA 4C34A 4RRVA 4QDEA 2X4ZA 1OL1A 4IAAA 4C3PA 1H1WA 4JG6A 1Q8ZA 4KNBA 3JXWA 5E91A 5DA3A 2YWPA 1H8FA 3NYNA 4O2PA 4EUUA 5J5TA 4MF0A 1ZMVA 3MY1A 4Y8DA 4FTJA 3L9NA 4YR8A 2ZFYA 3KGAA 3UG1A 1Y6BA 4XV3A 3RAIA 3CS9A 3G15A 3DAJA 1SZMA 2YDJA 3U6IA 5HVKA 3I81A 5CZHA 5JZJA 4PL3A 4I6FA 4S33A 2JKKA 4WD5A 3VRYA 2CGWA 4RZVA 4YJOA 2IW8A 3VWAA 1XH9A 3ZEPA 2QG5A 4D1XA 2X2LA 4GW8A 1BI7A 2VZ6A 3B8QA 4LV7A 3KMUA 3W33A 4V0GB 1MQBA 2R3FA 3W18A 4DFUA 3DB6A 1BMKA 2WQEA 3E3BX 4UWBA 3MV5A 2P33A 1Q99A 4NUSA 3P08A 4I93A 4OW8A 3F3ZA 4EYMA 3IOKA 3QTZA 4AZVA 1GZOA 3DV3A 4I0TA 3ETAA 4QP6A 4M15A 3ZM4A 2JFMA 5I9UA 1XBBA 5KZ0A 2UW7A 3A60A 2P0CA 4WG5A 4BWKA 4GJ3A 4GG5A 3W0SA 2HCKA 2Y4IB 3FSKA 3G90X 4RJ8A 4W9XA 1NVQA 4PUZA 4GS6A 2G01A 4Y85A 3HV6A 2BROA 1IA9A 3NFFB 4ZS4A 4FZ6A 4IAFA 4KUJA 5FEDA 4JVGA 4YJNA 3ORZA 2WIHA 3VAPA 3DA6A 4P4CA 2G2HA 3KRRA 4FR4A 3UIUA 2PE1A 4BDAA 4I6QA 4IEBA 4LL0A 2R3PA 2ZV8A 4GYIA 5HG8A 3VRZA 3WF5A 5HLWA 5HTBA 2W1EA 5EHOA 1RE8A 1ZZ2A 4HVSA 5EW9A 3MFRA 1O9UA 3QUPA 4O27B 4EOMA 1OB3A 1YWVA 5LWNA 3E7OA 4UYNA 4TYGA 4O38A 3SX9A 4EUTA 4MNEB 4XRJA 1H25A 4FIJA 4FKRA 4JRNA 4UXLA 3ZZWA 4RFMA 2Y6MA 5HNBA 2XALA 3UJGA 4YTCA 2XJ2A 1FVRA 3MPMA 3KF7A 2IPXA 2WOUA 2YFXA 3RHKA 2XNEA 3LJ2A 4EH9A 5ITAA 4TWCA 3MDYA 3NZ0A 4H3BA 3CQEA 4I4FA 4K77A 1OKVA 4RZWA 3MESA 4M13A 4XH6A 3ZYAA 4JG8A 3EL7A 3PYYA 5CI6A 3VF9A 4L53A 2UW4A 4NH1A 2EU9A 3OF0A 3I7BA 2FUMA 1GY3A 2AC5A 1ZAOA 2B9HA 3P4KA 2IVUA 2C5XA 1Q5KA 3W2PA 5IQAA 2C1AA 1OL6A 4UMQA 2WEVA 3SAYA 3D5VA 1YKRA 3C4XA 3POOA 4IWDA 4BCQA 4BKYA 4D9UA 4DEIA 3CE3A 3D7TA 5GZAA 3H0ZA 5FTQA 4XLIA 5HX6A 3QTUA 2I0EA 2QU5A 4AW0A 2PK9A 4AXEA 3PVUA 1JQHA 5CENA 3PDTA 2C6LA 3UNJA 3V5TA 1TQIA 2EB2A 3B2TA 4K0YA 4XRLA 5DT0A 2Q0BA 4L68A 5JQ5A 5L8KA 3QWJA 3ZFYA 3VC4A 4YJPA 2ZM4A 4X2GA 5FUTA 3W2OA 4ZJIA 4FZDB 5AM7A 4BR3A 4X2KA 4YZMA 4HVIA 5L8LA 4CQEA 3R9RA 4FIEA 2AC3A 3ZO1A 3RTPA 3SXRA 4KIKA 4M67A 2PL0A 3LKMA 4RFYA 3TNWA 2O63A 4I0SA 3GC0A 1Q97A 5LCJA 2W0JA 3SOCA 4LUDA 2UW5A 2OSCA 3W0RA 3WOWA 4AXAA 1PJKA 2JDTA 2OJIA 3CY3A 2CKQA 3AD5A 1ZLTA 2YM5A 5GJGA 1FINA 4MXZA 3H3CA 1FPUA 3DTCA 1PMUA 1ZXEA 2A27A 5HIEA 3DBFA 3NW6A 4FNZA 4JDHA 3MIAA 1FBNA 3B2WA 4J98A 4NYEA 2FA2A 2PVLA 4QT1A 1J7UA 4DFBA 4GFMA 1TQPA 2C30A 3UOHA 2AEGA 4LM5A 3ZLYA 2PUPA 3LFBA 3N51A 3C51A 4HCTA 3ZSGA 3TZMA 3DK3A 4I5HA 1Y57A 4C33A 1KE6A 2OJJA 3DJ5A 4FI1A 3P9JA 3R02A 4L00A 2CGVA 5KZIA 2PVRA 3UZTA 4Q9ZA 3ORLA 3QQGA 3W55A 5K3YA 5HO7A 2HELA 3PTGA 4XEYA 4E6CA 5KHWA 2YACA 5KUPA 5HE0A 3BGQA 3PJCA 3FAAA 4LMUA 4O0VA 4X21A 4I92A 1V0OA 3TNHA 4F6UA 3H0YA 4C37A 4MNEA 3OW3A 4G3DA 3AGMA 3O5AA 3OT8A 2BFXA 5TE0A 4ZMEA 4DHIB 3QHRA 3DT1A 2C5YA 4JIAA 2C3LA 4H36A 4GK4A 4KRCA 4C4FA 4YJUA 3R1QA 3PIXA 3PZHA 4HCUA 5I9YA 3MH1A 3PXKA 4FYNA 1Q8TA 4EOPA 3BGPA 1VEBA 3MFTA 4XG8A 3AKLA 3LQ3A 1U5QA 2OJ9A 2OFUA 3BWFA 5C8KA 1VLRA 4Q9SA 3NVKI 4EK5A 4QYGA 4TRLA 3BQCA 5T3QA 3BYVA 3RK5A 4NK9A 1JSTA 3C0HA 3P23A 3Q4CA 1NT2A 1SNUA 3K3JA 3LXNA 5AA9A 2JKQA 4YZNA 3HGKA 2ZDUA 3VBWA 4DHJA 3FI2A 2PYWA 4QRCA 2UZUE 4L8MA 1FGIA 2ZOQA 4L43A 5C4KA 3IPHA 4RQVA 4GFGA 3FEGA 3KXMA 4AUAA 2RG5A 3C0GA 5KMKA 2H6DA 2W9ZB 2YIRA 2JIVA 4FZ7A 3G51A 3LIJA 2OBJA 3HKOA 4P90A 5H8BA 2W1HA 5BYZA 3VUIA 4EOKA 4HYIA 4E8AA 3PUPA 5JGBA 2B53A 5LOHA 3F7WA 4GUEA 5CASA 2HZIA 4CZTA 3DK6A 1YWRA 4FV2A 4A9SA 5TKDA 3T8OA 3RNIA 3LXPA 2PU8A 1K9AA 1ATPE 1BL7A 4RVMA 2OGVA 1PXMA 1W2DA 5CALA 2WTJA 5I3RA 3VNTA 3FZ1A 2YEXA 4M66A 2BDFA 3HV3A 4EC9A 3KFAA 2PMNX 3ML1A 4NSTA 4FX3A 4BRXA 3RPYA 2FSLX 3BEGA 4RX9A 4ACDA 2XKEA 2NYAA 3HAMA 3PJ1A 5M51A 1UWHA 4X2JA 4QMUA 3EQBA 1PXJA 1R0EA 3VULA 4W8EA 2Y8OA 2YN8A 4H39A 3ULZA 1VYWA 3CTJA 4XBUA 5C9CA 5CSPA 4G6OA 4DEAA 3DK7A 5EI8A 2YIXA 2QOBA 4CGAA 4D2PA 5C4LA 3OMVA 1XH6A 4FV3A 1PXNA 3QTSA 5ETCA 1IRKA 4HGTA 3ZRKA 4E26A 4ANQA 3KREA 4CKJA 4GH2A 2HOGA 2X2MA 3W8QA 3SC1A 4BCMA 5J9ZA 4ZOGA 5HLPA 4LGHA 4IJPA 3HAVA 1XJDA 1ZZLA 5HI2A 2PSQA 2HZ0A 3TMOA 2NPQA 3TV7A 3KVWA 2WMWA 3E64A 4IWOA 2G9XA 4F1TA 3TUDA 2ACXA 5IA2A 2C4GA 4A4OA 3PWDA 2BKKA 3EQIA 2JIUA 4BCIA 5BVOA 4FV5A 3IG7A 4FODA 3QX4A 3KKVA 1WBNA 5ANGA 3BQRA 1DAWA 2GNIA 2GHLA 3FMNA 5E90A 3ZXTA 1PMVA 4EQMA 4CZYB 5M08A 3CTQA 3OXTA 2OH4A 4C36A 5IDNA 4NWMA 2XAOA 3HRBA 3UQFA 2GNGA 1W82A 4JQ7A 4UMTA 4W4YA 3H9RA 5KMOA 1Z9XA 2WTCA 3SHEA 2VX3A 2BDJA 1OPLA 2FYSA 4MBJA 4F9BA 5A14A 5LVNA 4L46A 2QO2A 3A62A 4CMUA 5CAUA 2CLXA 2ETKA 3U55A 2R3NA 1PKGA 2XNPA 4EOJA 2QLQA 4BTKA 1QPDA 3PUFC 2WTDA 1IG1A 2XNOA 4DAWA 4FEXA 3BYSA 3ZXZA 1EH4A 4F9YA 4DC2A 1OM1A 2Z7LA 4MVFA 4NKSA 2J90A 4RFZA 5B2MA 4FEQA 1UU3A 1FOTA 4AE6A 2IZUA 5FXRA 4AX8A 4E4XA 4X6RA 3R9HA 2ITPA 5IMXA 3GCVA 5D7VA 4DCAA 2BHHA 4U97A 5CS6A 2Y9QA 4YC3A 3FI3A 5AP4A 3DBEA 4EK4A 1X8BA 2QODA 3EKNA 3TUCA 3EL8A 3PWYA 4JDJA 3PA3A 2HK5A 4FTOA 3SOAA 2Q83A 5CWZA 3G5DA 3QD3A 2YITA 4ZTSA 4ZIMA 3UMWA 2WAJA 4FKSA 3BV3A 3RAWA 5C8NA 3VW8A 4K8AA 4UV0A 5T68A 2XP2A 3F3TA 5FLFA 3PPKA 3UQGA 5J7BA 3IDCA 5HLNA 4CNHA 4DEHA 2CNQA 5E8XA 1NXKA 1LEWA 2B0QA 4TWNA 3QA8A 2B52A 2W4KA 4JG7A 4FK3A 1PF8A 3NUXA 5A3XA 3FYJX 2KULA 5EHLA 3GQIA 2UUEA 3PLSA 1OL2A 4PPBA 2IVTA 3KRJA 1H1PA 3DNDA 4FIFA 4OUCA 2XEYA 4GVJA 5DR2A 4G31A 4ERKA 3FMHA 3SRVB 5AUVA 2GTMA 3R8PA 3VUMA 3ZUVA 4GU6A 5AX3A 4CV9A 3DPKA 4XV1A 4BZOA 4CD0A 5CF6A 4LRKA 1XH4A 4BTFA 4FT0A 2WMSA 2C5OA 4P2KA 1IR3A 3SXSA 3Q4ZA 3R28A 1Y91A 4ZTNA 5ANOA 4O7SA 3FE3A 2X6EA 4AZSA 3IS5A 3V5JA 1WBVA 4RT7A 3DKGA 5DIAA 5EOLA 4FSQA 4BDFA 3E62A 3GOPA 4F1MA 2PPQA 2UW3A 5H8GA 1G5SA 4ANLA 2QHNA 4QNAA 2E9OA 1JPAA 2PE2A 5GZ8A 3V8WA 3HL7A 5HO6A 3VQHA 3ORKA 3SDJA 2ITXA 5IA3A 4DHZA 5J7HA 4U42A 3QTRA 3C13A 2PY3A 2ZYBA 3R83A 3KC3A 1UNGA 1P14A 4FNWA 4TPTA 4XP0A 4IB3A 3AT2A 5AV2A 1XBAA 2BZJA 5FXSA 4ERWA 3OXIA 2EB3A 4ZSAA 5J9YA 3KXXA 2UZLA 3K5UA 1S9JA 1Q8WA 3ZRMA 4BGGA 3EOCA 3DBDA 2XKCA 5BPYA 3E88A 3GNIB 4BDKA 4D55A 3CEKA 2YHVA 3OP5A 4UB7A 1Y8GA 3DZOA 2GU8A 4K33A 4GU9A 4KINA 2EVAA 3D0EA 2OXXA 3UIBA 4MCVA 4CSVA 4ENYA 4CZUA 5CAOA 3HP5A 3IONA 3RGFA 5KMJA 4Z7HA 3A7HA 5AP2A 2XEZA 4GT5A 2WQNA 5ANKA 3MWUA 3ZFMA 2GCDA 4C57A 4YSJA 2VWXA 3FZOA 3GU8A 4XOZA 4BN1A 3C9WA 3GQLA 1VJYA 2QG7A 3A8WA 5CEPA 5IH5A 3PXQA 3DB8A 4P5QA 3IW7A 4IAIA 4UXQA 5HBEA 4USFA 2X6DA 4GSBA 5K4JA 3VS4A 3ZUUA 4L3LA 3D83A 4QP1A 4FTUA 1GZKA 4QMSA 4O82A 3UIMA 2C0TA 4K11A 4RBLA 1J1BA 3LAUA 4X0MA 3O50A 3ULIA 4DDGA 4NFMA 1XO2B 3HDNA 4UZDA 4ZS0A 2X0PA 2XJ1A 4MWHA 4DF3A 2QOCA 4GKHA 2J0KA 4DBXA 2ZVAA 1YQJA 2Y6OA 1JKTA 4FKTA 5E8TA 3QRIA 4JL9A 4J97A 1UA2A 5LQFA 4QP3A 3R8VA 4N4SA 3DLSA 3TACA 4QMTA 2X9EA 3F3UA 3QZHA 3OTUA 5HIDA 3DXPA 5HU9A 2ZB0A 3MVHA 4EH5A 4NM3A 1KV1A 3V5QA 4EZ3A 3R04A 4IAKA 3FKLA 3G6HA 5A9UA 1DS5A 3OBJA 1O6KA 3BL9A 2VTSA 3EQHA 4ZY4A 3D9VA 5BX0A 2JGZA 3UP2A 3GC9A 3PIYA 5L2WA 3BWJA 4I6BA 5DNRA 4O6EA 1MRYA 4KIOA 3QCSA 3UZRA 1YI6A 3REPA 4MBLA 2VTIA 4KKEA 4KBCA 3TDWA 2REIA 4NZWB 3TEIA 5E4HA 3QL8A 4HYSA 5AV1A 4GMYA 2OK1A 4FGBA 4PTEA 4UYAA 5HCXA 4BGHA 3Q52A 3BEAA 3G0FA 1WBPA 4J71A 4MH7A 5JFSA 4O7TA 4I41A 2I7QA 3W32A 3RKBA 3UDSA 2R7BA 3F66A 5IG1A 3SG8A 1H07A 2X7GA 3FLZA 3PSCA 4WUNA 4CT1A 4ACCA 3VS0A 3KRXA 1QMZA 3PXYA 4BKJA 4GV1A 4QO9A 3VN9A 4LRJA 1P5EA 3M2WA 3BHYA 2I0VA 4R1YA 2YIYA 3H9OA 2JBPA 3FQEA 4IZAA 4K1BA 1TKIA 1G8KA 2OLCA 3ZCLA 1QPJA 5G6VA 3VQUA 3BELA 2VWWA 3BGZA 4TNDA 1OGYA 4NJ3A 4J95A 4FSWA 4TNBA 2QR7A 3EQGA 5EQEA 5FDPA 1OUYA 2C6KA 3OG7A 5I9ZA 4IFGA 3ZEWA 4ZEGA 3MW1A 4JI9A 4C35A 3MFSA 2F4JA 1A48A 1REJA 4IVDA 4AN3A 4MHAA 5BUJA 5E92A 4M69A 3QQUA 4QPAA 2F7ZE 2WD1A 3DAEA 3O71A 2GQSA 4O84A 5M09A 2YERA 2W1GA 2OXYA 3P7CA 4JOAA 5BVNA 5L2SA 2ZMCA 4O0WA 3VJNA 4IZ7A 3HNGA 4TY1A 5C1QB 1FVTA 2ETMA 3BX5A 4X7QA 4AT3A 4IWPA 4O4BB 1MRVA 2IW6A 2OZAA 4LOPA 3AMAA 1JKLA 4Q5HA 3C4ZA 4BDEA 4BZDA 3LFQA 4FV0A 2GDOA 4YPSA 5FDXA 1SVHA 4PDOA 3BHHA 4G3CA 5HO8A 4M0ZA 4BICA 3BYUA 4L3JA 3KU2A 5ICPA 2Z7QA 3NSZA 3DTWA 3Q53A 4NW5A 2YZLA 4MXAA 4WHZA 3QCQA 4TL0A 4WBOA 5HE1A 5I0BA 2XYUA 2VO6A 4FSRA 3AGLA 1OIQA 4B4LA 4AXDA 3UVRA 5EW8A 4CKRA 2QC6A 1MP8A 1WVXA 4U3ZA 3V5LA 3RALA 4LDTA 4PDYA 4XG3A 5EKOA 3R2YA 4ZLOA 3PPZA 2JIIA 5KNJA 3O51A 5BYYA 1KE9A 4YC6A 4DGMA 4YHJA 3PXRA 4I1ZA 3A7GA 4PMSA 2Q0NA 3R7IA 3OWLA 5BVDA 4MF1A 5IA1A 2RIOA 3ID6C 3K5VA 4HGEA 4QOXA 5JFXA 5DEWA 1DI9A 4HNIA 4FTQA 2C6TA 3BBWA 1M2PA 3HV7A 3M42A 4OR5A 5F4NA 4F7SA 5F20A 2XK8A 3RJCA 4F64A 2AYPA 3V8SA 2ITWA 4KD1A 5GJFA 2FVDA 1P2AA 4G5JA 4XP3A 1UU7A 4OTRA 3F5XA 4FTRA 4BDHA 4ZXTA 2VWZA 2WEIA 3U8WA 3ZSIA 3EQFA 5F94A 3MGYA 3GCQA 4O4FA 3THBA 3FLYA 1OBGA 4DGOA 3FSFA 4U9AA 2XVDA 3E8EA 4G17A 3RPOA 3W0PA 2CLQA 3DJ6A 5HHWA 3MJ2A 1URCA 5LARA 4ZJVA 5K0XA 3MH3A 2GS6A 4E4LA 4R7IA 2GMXA 5HCYA 2W1FA 4R5YA 1Y8YA 3TN8A 3EZVA 3UVQA 3WI6A 4YP8A 3ENMA 2Y7JA 3QC4A 4XUFA 2JLDA 3RI1A 4F9WA 5FEEA 2IN6A 4YU2A 1CKJA 3VBVA 4AU8A 3F7ZA 5AP6A 4FIIA 2BHEA 3UPZA 5A54A 4F09A 2QU6A 1KV2A 4C3RA 2BILB 5J95A 1JBPE 4IBMA 3SW7A 2ITQA 2VTPA 2XNGA 4QP8A 3ZTXA 4DH8A 5CLPA 5AUUA 5EM8A 3UP7A 3D7TB 1Z5MA 4MQ2A 3DAKA 4S30A 3RAKA 2XBJA 2BRBA 4DINA 3DFAA 4IANA 4M12A 4O1OA 3TIZA 4FRFA 1Q4LA 4C2VA 4BDJA 2C3IB 2PZPA 2R3GA 4XV9A 5EM7A 3RMFA 4F65A 3F6XA 3NNWA 5E8SA 3GP0A 4I6HA 5CTPA 2QOLA 2XCHA 5AA8A 3OEFX 5HD4A 3CLYA 2ETRA 5AV3A 3UGCA 3EHAA 3F3VA 4U3YA 2PUIA 2YDKA 2WU6A 3ELJA 4FT7A 4BCJA 4O4CA 4R7HA 2YAAA 3EYHA 4EC8A 4BTJA 3RCDA 2BALA 4KIKB 3HEGA 4R3PA 4XG6A 3MTLA 4OT5A 4E3CA 2CMWA 4A06A 4D2WA 1OPJA 3ZH8A 3VW6A 3PP1A 3W2QA 2IG7A 4ZSJA 3BU5A 5DOSA 4XV2A 4PPAA 3AMYA 5EQPA 4HNFA 4V05A 5AR4A 3ZU7A 3BZ3A 4JX3A 3VBQA 4AA0A 1XR1A 4AGUA 1CTPE 4QP9A 3D2IA 4BCFA 3MS9A 1FGKA 4EWHA 2OXDA 4XG9A 3TI1A 4IHPA 5HNGA 3DXNA 3PZEA 5DMZA 4O7VA 1PMNA 5JMSA 1WZYA 1PKDA 3NLBA 4XCUA 3CD8A 3ZLWA 4CFMA 4WT6A 4BBEA 4AAYA 2GNJA 4QMNA 4BCGA 4J8MA 3QTWA 3DXQA 2GTNA 3AC5A 3O96A 3LQ5A 4AGWA 1BKXA 3PY1A 4RVKA 1U54A 1URWA 3EKKA 3CBLA 3MTFA 4O4EA 3CC6A 3VONA 3G9NA 3TT0A 4EHEA 2UV2A 4E1ZA 5E8WA 3OOMA 4KBKA 4H1MA 3GUBA 4DH7A 5LMBA 2W05A 2OICA 4OBQA 1A06A 2DQ7X 5LXMA 4Y95A 1NVSA 4FV4A 3GOKA 3L8SA 5ANEA 4AZFA 2W9FB 3BBTB 3NNUA 2WQMA 3IKAA 3OCTA 3A4OX 2PVKA 2VTOA 3R7GA 4LMNA 4LFIA 3R73A 4YLLA 3IECA 2BFYA 3VUTA 3LCKA 4C0TA 1YXTA 1PXLA 2NRUA 4PNIA 4BF2A 5CNOA 4JBOA 4DYMA 3ACJA 3UZPA 4C4EA 3P0MA 3O23A 1OKYA 4EOSA 4CLIA 3VUDA 5I9XA 1TFFA 2OJFE 4DE4A 3IQ7A 4BIDA 4D0WA 3SVVA 2CGUA 2QKWB 4RWJA 3S1HA 1W2FA 1W0XC 1W98A 3FY2A 5J5SA 2OIQA 4AA5A 3NW7A 2XK4A 3HYHA 4FTKA 4N6YA 3CP9A 1M2RA 2J5EA 3TTJA 4JMQA 4TYEA 2ZV2A 3FC1X 4ITIA 4WSYA 4FTTA 4BI1A 4ZLYA 4IB0A 3AG9A 3QWKA 2VNWA 2XRUA 5DEYA 2NNWB 2IVSA 4YZDA 2E9UA 4JQ8A 4O22A 5JFVA 4WA9A 2W5HA 3W0MA 2HZNA 3R1SA 4I24A 4JBPA 5FP6A 3IGOA 4E6AA 2QOHA 5KBRA 3R00A 3FMEA 1O6LA 1CM8A 1SYKA 2HW7A 3ZMMA 1HCKA 3EN5A 3U87A 3UVPA 4ZTHA 4OAVB 3AOXA 4V01A 2JKOA 3Q9ZA 4JS8A 3QALE 3COHA 1A9UA 3C4EA 3FDNA 4UBAA 5CF4A 2ITYA 2CKOA 2CN8A 2VGPA 3NVMB 2OG8A 2VTHA 5D10A 5AAEA 1W84A 4E7WA 2FSMX 2RSVA 3LZBA 4H58A 5CAVA 2X4FA 4XHKB 1Q3DA 4OTGA 4QMWA 5CT0A 2X0QA 4R5SA 1OKZA 2OI4X 4J8NA 2ZV7A 3ODYX 4DGNA 1B38A 1Q3WA 4ZAUA 4RJ4A 3KXZA 5EI6A 1H08A 2QURA 2C6EA 2OF4A 4EKKA 5GHVA 2XANA 3PFYA 4ID7A 4PY1A 3W2RA 3P7BA 5BVFA 5CU0A 5ANJA 3Q5ZA 4FKUA 2OJGA 4QP2A 3VS3A 1R3CA 2C6DA 2CCIA 1I09A 4JAIA 3W2SA 3GU4A 2X8DA 3PPJA 4QMXA 2QQ7A 4DLIA 3MN3A 3R1NA 3KMMA 2WB8A 5A4EA 5DI1A 3TYKA 1V0BA 5LMKC 3QD2B 2J6MA 3ANQA 2ZM1A 2GNLA 2PE0A 2BAQA 2O65A 3EN9A 4R3CA 4XNEA 2F2UA 2WMUA 3FMDA 4O0UA 5G1XA 4PMPA 2R3QA 5L8JA 1ST4A 4PTGA 2JBOA 4B99A 5ETIA 2X8EA 2UZOA 3WILA 1DAYA 3EFJA 5CYIA 1YWNA 2IW9A 5HCZA 5JZNA 2GNFA 3TM0A 3W0QA 4UMPA 2PVHA 2GNHA 5J79A 1JAMA 3KEXA 1CSNA 4FT3A 4RJ6A 5A4CA 4FICA 5ANDA 3MFUA 2BZIB 2ONLC 4RQKA 5EM5A 5HKMA 4EL9A 5IEYA 4RG0A 5LMKA 4CG9A 3OW4A 3WF8A 4D1SA 4CLJA 5JN2A 4Z7GA 4BCOA 3C4CA 4USDA 1U59A 4FNXA 3ACKA 3UPXA 2PULA 3FPQA 5EYMA 3FHIA 4MX9A 3V3VA 3VS5A 2YIQA 5CXHA 3HUBA 2NRYA 3BYMA 1R1WA 1XWSA 5EYCA 3TZ9A 4NL0A 4AWIA 5EFQA 5DVRA 1YXXA 4ENXA 4LGDA 5AUXA 3HZTA 3OCSA 4HGLA 3R8ZA 3LMIA 1WAKA 3BLHA 2UW6A 4F78A 3FLSA 4U44A 3HV4A 3L8VA 2PVYA 3FMJA 2C3JA 2JC6A 2ONLA 3A99A 3JS2A 5EHYA 4EQCA 2UVXA 4D5HA 4UN0C 4E20A 5CU6A 5HG9A 1PXOA 3L9PA 3TXOA 5HTIA 3GC8A 2XRWA 3Q4TA 5D11A 4DG0E 1WBOA 1M2QA 3R2BA 4PL5A 3WIGA 2PHKA 2BAJA 4OTPA 5F1ZA 1AQ1A 3Q60A 3QZIA 4DFZE 3ZRLA 3COIA 4TXCA 4JX7A 3D2KA 4Y73A 4MKCA 3UBDA 1ZOHA 4DN5A 4U79A 3TCPA 4EH6A 5EH0A 5B2LA 4IQ6A 3R7EA 3EFWA 4QTDA 5DN3A 4MEDA 4QMQA 4FKVA 4BIBA 2EXMA 4MXYA 3FV8A 4FV1A 3ET7A 1R39A 4UWCA 2CHLA 1GZNA 2V62A 4NJDA 3C0IA 3D5XA 4DITA 5TR6A 3DY7A 4ALWA 2UZWE 3EH9A 3LW0A 3TJCA 4WOVA 4PTCA 4H3QA 4E93A 2HAKA 3OUKA 3LOKA 4TW9A 3RM6A 4O0SA 3QQJA 4YBJA 4AS0A 3GCSA 4U40A 3QKLA 1GZ8A 4Y72A 4LL5A 3EN6A 3EQPA 3LJ1A 3NPCA 2R9SA 4Z3VA 3EMGA 4I20A 4ZTLA 3C7QA 4MXCA 4HOKA 2BRGA 3G0EA 4AN2A 1KE5A 4YZCA 4JJRA 3QA0A 5FQDC 2V5QA 3F5GA 4O4DA 2OWBA 5AP1A 4APPA 4F4PA 4H05A 5D1JA 5AFVA 2QKRA 2XIRA 2R3MA 1IA8A 4NM0A 4YZ9A 5ETAA 4EYJA 4IADA 4IX6A 1J7LA 2VTMA 4YJSA 5FWKK 3Q5IA 3CGOA 3WIKA 3FQSA 3PE2A 4V04A 5HE2A 4TYJA 3JYAA 2RFSA 2RF9A 5HBHA 2B1PA 4D0XA 3FWQA 1F5QA 5K9IA 5AX9A 3RCJA 3QUEA 3UDBA 2G1TA 3NUPA 4IC7A 4RSSA 3C50A 2JKMA 2C69A 3QXPA 3HECA 2HENA 3SV0A 5J1VA 2PMOX 2X1NA 4PRJA 5IA5A 3WE4A 5IDPA 4BHNA 5K5NA 3CD3A 5HTCA 5FTGA 4FKIA 5CAPA