2X2LA

Crystal structure of phosphorylated ret tyrosine kinase domain with inhibitor
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
311
structure length
287
Chain Sequence
GPLSLSVDAFKILPKWEFPRKNLVLGKTLGEGEFGKVVKATAFHLKGRAGYTTVAVKMLKENASPSELRDLLSEFNVLKQVNHPHVIKLYGACSQDGPLLLIVEYAKYGSLRGFLRESRKVRALTMGDLISFAWQISQGMQYLAEMKLVHRDLAARNILVAEGRKMKISDFGLSRDVYEEDSVKRSQGRIPVKWMAIESLFDHIYTTQSDVWSFGVLLWEIVTLGGNPYPGIPPERLFNLLKTGHRMERPDNCSEEMYRLMLQCWKQEPDKRPVFADISKDLEKMMV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PROTO-ONCOGENE TYROSINE-PROTEIN KINASE RECEPTOR RET
publication title Synthesis, structure-activity relationship and crystallographic studies of 3-substituted indolin-2-one RET inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 89
structure length 287
sequence length 311
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2010-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2x2lA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2x2lA01
5LJJA 4FEQA 2QOQA 4A07A 3UODA 2GNHA 1JBPE 3F3ZA 4P7EA 5AR2A 4E6QA 4N6YA 3B2TA 4C36A 3RPYA 2ESMA 2HIWA 2WQOA 4FGBA 4I5PA 4K77A 3CJFA 5AV3A 3Q4CA 3RI1A 4EUUA 4AS0A 5L8KA 4BI2A 3KN5A 4L01A 4FTRA 2QO7A 4LMNA 4FTJA 4J7BA 4C37A 5CASA 1R1WA 3EFKA 3KF7A 3MJ2A 3ODZX 4KAOA 4YJQA 1OB3A 3UC3A 3F3UA 2VTJA 1URWA 5FP6A 3Q6UA 3TUCA 3VUGA 4TNBA 3R7GA 2PU8A 3UNZA 3V6SA 3VQUA 5BVDA 3VBWA 3V5JA 2XNGA 3UP7A 2B0QA 2Y4IB 2J0JA 4OT6A 5CVFA 1PRYA 5CI6A 5KZ0A 4ASEA 4EYMA 1SYKA 2QKWB 3SAYA 3AGMA 5F20A 2PWLA 4V0GA 4YTHA 2NO3A 2X9FA 4QT1A 2HCKA 3RHXA 4TPTA 4KIKB 5KMIA 3IG7A 2OXYA 1IAJA 5EYKA 5M56A 3QRKA 1FVTA 3MS9A 2YJRA 3NNUA 1PKDA 3DBQA 3NYNA 3Q5ZA 4FKLA 2GFSA 4X6RA 2QU6A 4KIOA 2IW9A 2JDOA 2YCRA 4Q5EA 3VBYA 4BYIA 4R8QA 1B39A 2BZKB 2C68A 3NUPA 1YDRE 4CV8A 3DXPA 1XBBA 4IFGA 5K0KA 3LMGA 3RPOA 4CFVA 3ZZWA 2YIYA 4Z7HA 3MWUA 3O51A 2XZSA 3AT4A 2BRMA 4GVAA 2O63A 4DGNA 3BELA 3CJGA 3REPA 4F6SA 2OJFE 5HNGA 4O82A 4O21A 3ZUTA 2OIQA 2J7TA 3RPRA 3UGCA 4DT9A 1ZMWA 4G17A 5L6WL 4HYSA 3E62A 3MFUA 2BAKA 4N57A 3IGOA 3BRBA 4QOXA 4L3PA 4FIJA 4IMYA 4M0YA 4R3RA 3OHTA 2UZOA 5D7VA 3VS4A 3F6XA 5FBNC 5FM2A 4YJSA 4OTRA 4EK3A 4IZ7A 1JVPP 5C9CA 2XM8A 3E8CA 3KB7A 4L68A 4EZ5A 1JWHA 4NFMA 5C1QB 4CD0A 1O9UA 5JFSA 2WQMA 3ORKA 3BYUA 3I0OA 2PMOX 2WEIA 3K5UA 3QQKA 4O0RA 5E1EA 4LRMA 1PKGA 2XK3A 4U40A 3T9TA 3WF7A 5IA0A 2YWVA 2C0OA 2WD1A 1GY3A 4D1XA 4HZSA 4JDKA 1IG1A 3TTJA 1PXKA 1ZY5A 2V5QA 3MB7A 3LFAA 2EVAA 4JG7A 2OH0E 3NLBA 2WMSA 3LXPA 5FGKA 4E4MA 4R78A 4OAUC 1H1PA 1UU8A 3BU5A 3BBTB 1JAMA 1SM2A 2NRYA 2O3PA 3E88A 3KEXA 2YWPA 3MV5A 4FYNA 4MXAA 3PVBA 3WBLA 4CFWA 1I09A 4EOOA 4EUTA 5AR3A 4BTKA 4BYJA 4XBRA 2I40A 5LQFA 5HHWA 2CPKE 4QNAA 3AXWA 5HU3A 5KBRA 4A4XA 4TN6A 2PVHA 4UYNA 4FR4A 2PVJA 4G9CA 5EG3A 3ZXTA 4AN3A 3R7EA 5AR4A 4WG5A 2BCJA 4RIWB 4U42A 2PSQA 1APME 3LCSA 2YDIA 2XRUA 3JS2A 1YWVA 3O7LD 3R00A 2PHKA 3GQLA 5IQEA 2WELA 2W5AA 2OBJA 1KOAA 3RALA 2GHLA 3FMNA 1JQHA 3UMXA 5H8BA 4JQ8A 4C4IA 4PNIA 2BTRA 5EFQA 4F0GA 3I5ZA 4W8EA 3EQHA 3H4JA 1H00A 3DBEA 3KK8A 4CRSA 3WZEA 4XOYA 4AU8A 4F09A 5BQ0A 4O27B 1URCA 3R63A 4FSNA 4U43A 4C33A 3OW3A 5IQFA 3OC1A 5ANEA 4QP9A 1H27A 3BHUA 4PNKA 2GS2A 2YM4A 5D12A 2LGCA 4RC4A 4IX4A 4O91A 5A3XA 4R7BA 3TNWA 1F3MC 1WBPA 4RIOA 1U4DA 2C5VA 3DK6A 3M1SA 3U4WA 5ETAA 3QHRA 3H10A 3KULA 5L3AA 4E26A 2CKQA 4Y95A 3MH2A 2OXDA 2VO7A 3GOKA 2P4IA 2WTKC 3BGZA 3NUYA 5AA8A 5M4FA 4M15A 5CU6A 2HK5A 3OWPA 4A9UA 4KABA 3OCGA 4BFMA 1X8BA 4ZY5A 3SA0A 3BU6A 3AMAA 3NW7A 4MF0A 3MFRA 4EOLA 3KCFA 3V5PA 5EM8A 1Y6AA 3BEAA 3I79A 3PE1A 4OTGA 4TWOA 4P90A 4ZMEA 3MDYA 3NUSA 3Q2JA 3POZA 4D2RA 1JKLA 2VWZA 3UVRA 4A9TA 2OZAA 4MAOA 3VVHA 4RX5A 5GHVA 4FZ6A 4QP6A 1BUHA 3NEWA 4GK2A 4J96A 2XVDA 3I60A 4HPTE 5IA5A 4XV9A 4AW2A 4DGLC 3PA4A 4D2VA 1WZYA 2ETRA 4PPBA 5CYIA 3TACA 4BCKA 3RAKA 2C6MA 4N6ZA 4R1VA 4BI1A 1JLUE 3VS1A 4ZLYA 4I6QA 3NS9A 3QKKA 2Z2WA 1XH6A 4IWDA 5HNIX 4GCJA 3PLSA 2BMCA 3BLHA 3O7LB 2JBPA 3UYTA 1OIUA 4ZTMA 4GFMA 2CJMA 5CZHA 4FSRA 5HQ0A 3TUBA 3QCSA 1ZOHA 5EOLA 3QTRA 2PUPA 4C3RA 4AZSA 5GZAA 1XH5A 2B1PA 3QQHA 3BHVA 5FEEA 3BGQA 5CF5A 3P86A 3R1NA 3ZFMA 2C6DA 3W33A 4O0WA 5EHLA 5CENA 4FZ7A 3OMVA 2PZYA 1NA7A 4UMUA 3D5VA 4XG3A 3KK9A 5ANDA 4EC8A 2W1DA 2WTDA 4E4NA 4WRGA 5M55A 4J53A 1M14A 3I4BA 4U44A 3ZSGA 4AGCA 2R3LA 4BTMA 4ZS0A 3E3PA 5IA4A 3QTXA 5M4CA 4HYHA 4JOAA 4TYIA 4FODA 4RJ5A 3DKOA 2R7IA 3C4ZA 4YZNA 4RVLA 2G15A 5GIPE 4H3QA 3RPVA 4D2PA 3KCKA 4EC9A 3DKCA 3TXOA 4EWQA 1PXIA 4JBQA 3HRFA 5J1VA 3FEGA 4PMTA 2VNYA 4NZWB 1JNKA 4KS7A 2C3KA 2HELA 3OD6X 3ET7A 5EHYA 4DYMA 3PTGA 3CSVA 1Q8WA 5J79A 3W55A 4U80A 1J7LA 3MW1A 3MA6A 4EHVA 4U41A 2X6EA 3BIZA 4CG8A 3FQEA 1KE9A 1PMEA 4BCQA 5J7BA 2WU7A 4IB0A 4FK6A 4IVCA 4QNYA 2O0UA 4QTAA 5CVGA 2VWYA 4XYFA 5IUGA 1W83A 5AUZA 3D7TA 5EW3A 4QMXA 5A9UA 3RBWA 3MA3A 4GIIA 4YHFA 4H58A 4C2VA 5CAUA 4OTHA 1H1SA 1K2PA 3EFJA 3U9CA 4J52A 4RFYA 4DAWA 4E6CA 1ATPE 3FZSA 3KRRA 1Q61A 4R3PA 5KMLA 2CGXA 2R3OA 4GVJA 5DGZA 4B99A 4KKHA 2P33A 4O22A 2FSOX 2PMLX 4QP4A 2JKOA 3NCZA 4FSUA 3GEQA 2W1EA 3F2RA 4RFZA 3WF8A 3FLYA 3PJ8A 4KRCA 4FEUA 4ZY6A 4C0TA 1M2RA 5BPYA 5EW9A 4C4FA 3DJ6A 1ZRZA 4U79A 5IQGA 3PIXA 3ROYA 1KE8A 3MBLA 4UB7A 3AD4A 2QLQA 2JD5A 4EBWA 3NUUA 4B8LA 1Q3WA 5A46A 2QI8A 4B7TA 4WSYA 4BCNA 5AR8A 4GEOA 5BVEA 3U4UA 3LLAA 2GPHA 3PXZA 1WCCA 3Q5IA 3W2SA 3RAIA 1IA8A 3DBDA 5JFXA 3CS9A 3NDMA 3TIZA 2AUHA 3JVRA 1M2QA 4MEDA 2BAJA 2V7OA 1H1QA 1OGUA 2PPQA 4FKUA 3U8WA 4BICA 2I1MA 5AAFA 1XBCA 2YACA 5CSPA 2UZVA 3AC4A 3KL8A 1LUFA 5E8WA 3UO5A 4WG4A 3NUAA 2HOGA 1LEWA 4PWNA 1OPLA 2W7XA 3KKVA 1PXPA 3VF9A 1K3AA 5IMEA 1H24A 2X8DA 3MFTA 4IHPA 4L43A 2IZSA 3HP2A 4IC8A 4NUSA 4XG9A 3SW4A 2VTRA 3BQRA 3HZTA 4YP8A 3U9NA 1Y91A 3FZTA 3C7QA 4U45A 4EH4A 2WHBA 3MH0A 4MCVA 4FBXA 3IW5A 3DLSA 4B9DA 2QOCA 1J91A 2BDWA 2IWIA 2IZRA 4NW6A 4YNEA 4O81A 3DXQA 2VAGA 4KNBA 5BVFA 3EOCA 4X2GA 5CEMA 3R8VA 3WOWA 2GSFA 3ODYX 4UY9A 4FT3A 5TO8A 5JFVA 4YJVA 3NAXA 3ATTA 2GTNA 3ZFXA 4IAAA 3R7IA 5J5SA 3FSKA 4AW0A 3TV7A 3UQCA 2OJGA 5CAQA 5CT7A 5A4CA 5KMNA 4JIKA 3UOHA 2PE0A 4IAYA 5LVLA 3ZUUA 2YM3A 4OTQA 3MSSA 1QPCA 1GJOA 3KGAA 1L3RE 2WIPA 4TW9A 4D55A 5HKMA 2B4SB 2VWVA 3U54A 4M84A 2UZWE 3UO6A 3LVPA 3OTUA 4ZK5A 4AACA 2OJ9A 4FG9A 4UXLA 5CXHA 4C7TA 1ZZLA 5HGIA 3HMNA 3NUXA 2J51A 4WO5A 3CCNA 4U97A 3VWAA 2YM7A 4FTQA 3SX9A 1U46A 5IH4A 4HYIA 1SZMA 2ZB1A 2E9NA 3O96A 4GUEA 1UV5A 5DHJA 4FIEA 4EHEA 4FV9A 1XBAA 5AUWA 1YRPA 3ZRMA 4F1OA 5AP2A 3E5AA 4I4FA 4XRJA 3QYZA 4QMLA 5CWZA 4FTCA 4RX8A 2P3GX 2PYWA 3FI8A 3LCDA 2QO2A 1UWJA 1OBDA 4C2WA 2AYPA 4U3ZA 3SD0A 3LJ1A 2BZJA 5DPVA 1U5RA 2ITVA 4FX3A 5BX0A 4PL5A 3SC1A 5IPJA 2JGZA 2C3JA 4BC6A 2V7AA 1PF8A 2UW7A 4KIKA 2CNUA 3EL8A 3FMDA 1V1KA 1YHWA 2IZUA 4CV9A 1FBNA 4DH3A 3HUCA 4NFNA 3G6GA 3NAYA 3Q9WA 2C1BA 4FTUA 4XJ0A 4CT1A 3LQ3A 1WBSA 4DFBA 4I4EA 5IQIA 3S3IA 2GQSA 3DFAA 3I7BA 2W9ZB 4UWYA 3PSBA 3QUEA 5FLFA 4G34A 2QG5A 2A2AA 2PTKA 3Q4TA 3RNIA 2ZJWA 5DT4A 5LOHA 2XF0A 2ZM4A 4QYFA 4D2WA 3QRJA 3ZUVA 4DH8A 4O0UA 4BZOA 5D11A 4G1WA 2B9HA 2PUNA 5AV0A 4K8AA 2FH9A 3MYGA 1KV1A 3AQVA 2UVXA 4FKTA 4S32A 3VRZA 4AN9A 5M51A 4TWCA 3UBDA 3VS0A 2BHHA 5CLPA 3FJQE 4ZSJA 3U51A 4EOSA 3WILA 3DAEA 3FC2A 5HICA 4KKGA 5B2LA 2Y4IC 3SLSA 3SXFA 2Z7RA 4QMPA 3K3JA 5FP5A 1R0EA 4XBUA 2F57A 2RFEA 3ZMMA 4B4LA 4ENXA 5M44A 3Q9YA 3ZM4A 4EHGA 4C59A 4M68A 3I7CA 3OY1A 4Y5QA 5HTIA 2R64A 3LCKA 1BKXA 4TL0A 4ZLOA 5CANA 3C4XA 3EQFA 4GK4A 3FPMA 4PV0A 5KKRB 3WZUA 4FV1A 4MNFA 5DEWA 3PXYA 5E8UA 4RC2A 4E93A 3DZQA 5EYCA 5FDXA 3EQPA 2GFCA 4IVDA 3GFWA 5JK3A 2HXQA 3F3WA 2WQEA 3ZBXA 5L2SA 2HWPA 5FTOA 2BVAA 4IFCA 4RX7A 4RVTA 5ANGA 2IVTA 4BVUA 5JSMA 1P5EA 2XIXA 3W2CA 4BR3A 3K3IA 3FE3A 5AR7A 1PMNA 3GNIB 3VHEA 2BRHA 3TCPA 4AQCA 4BDDA 4O7YA 5E8TA 5M06A 3UQGA 5CEIA 3HDMA 3MTFA 2P2HA 4UMTA 3ZCLA 4CZTA 4RIWA 3U6HA 2SRCA 3ZM9A 2PK9A 3AT2A 4Y5HA 3RAHA 3GCSA 3IDCA 4FEXA 5FEDA 3RKBA 1RDQE 5A6OA 1WAKA 2G2HA 3MPTA 2FUMA 3GFEA 3RNYA 2OG8A 4TYJA 5HORA 3FXWA 4FTKA 5JEBA 3DJ5A 4ZJIA 4F6UA 3F2NA 3LJ2A 2ETKA 5ANJA 3THBA 2DYLA 3BWFA 5DH3A 3P08A 4RC3A 4C61A 2JDVA 4BY9E 5JMSA 3ZLYA 1KUTA 2VD5A 4YTFA 2OH4A 5A4LA 3DXNA 3VAPA 4FT5A 3QTIA 4H3BA 3FQSA 3TN8A 3TJCA 3TZ9A 3IQ7A 1P4FA 2OIBA 3EQGA 4QPAA 4NH1A 3EQRA 2JDTA 1QMZA 2XBAA 5HU9A 2WMWA 2Z7LA 4GFGA 4UN0C 5IMXA 2EWAA 4ACMA 1T45A 4EKKA 5DE2A 4UMQA 3KMMA 4CT2A 5HEZA 1FGIA 5FDPA 4FV4A 4AE9A 3GT8A 3PXQA 4RJ4A 2JIVA 5KZIA 3N4VA 2O64A 4MH7A 4DEIA 3OCTA 3PJ3A 3PZHA 2UUEA 2CLQA 3C9WA 3IECA 4RA4A 3ZO3A 5DI1A 2X4ZA 4C57A 5C4KA 4ACHA 3IW7A 2C0IA 1YXTA 5EDRA 2ERKA 3TZ7A 3MFSA 1U5QA 4JS8A 1H0WA 4HGSA 3RK9A 2AC3A 1FMOE 4TY1A 1Y57A 3PXKA 4ANNA 1U59A 3HL7A 5CX9A 4AX8A 4O7WA 4X3FB 4NKAA 3RPSA 1Q5KA 4UZDA 3Q96A 4PL4A 3QD0A 4FZAB 5K0XA 4S33A 4HVIA 1W0XC 3ZC6A 2ZV9A 4QP3A 3DB8A 4YTCA 5JQ8A 4CG9A 2ITOA 3R9NA 2PVFA 4TRLA 3VW8A 4A9SA 1YDSE 4YSMA 4E8AA 5M4UA 4O7ZA 4CSVA 2GNLA 5E91A 1JSVA 4DEEA 2XNBA 3CKWA 3CXWA 3PZEA 5E1SA 4OTWA 5HI2A 4OW8A 3D94A 1CSNA 3DTWA 1CM8A 3GCUA 3D2KA 2H8HA 4QYEA 3UNKA 5C27A 3Q04A 4MNEA 3OEZA 4I41A 4OTFA 4EH6A 3HAMA 1P2AA 1H8FA 4JX7A 4H3PA 2B55A 1Q8YA 4FVPA 4IACA 5KE0A 3FI2A 3QF9A 4N70A 3MB6A 2HXLA 4QPMA 2GS6A 3IONA 3ZFYA 3CQWA 4PMSA 4NWMA 1PJKA 4E73A 3ALNA 2YIRA 3QXPA 3FXZA 4A9YA 5BYLA 4YBJA 4PP9A 4ALUA 3LW0A 2H34A 3IW4A 2Z7QA 4IWQA 2UW4A 4QQCA 3N4TA 3QC4A 1WBWA 4JQEA 3DFCB 2WFYA 4NM5A 2ITQA 4FSWA 2QU5A 5IF1A 3A7IA 3E8EA 3PIZA 4LGGA 2WOTA 2NPQA 3R7YA 2X7GA 3W2QA 3UZTA 5M09A 3R7UA 3LAUA 1FGKA 2W1ZA 3QALE 4GL9A 3TZMA 3GCVA 4IX6A 4QYHA 3P23A 4CTCA 4LQMA 4WNPA 3QQFA 4FKPA 4XP0A 3T3VA 3Q52A 5IUIA 4K6ZA 2WZJA 3FZPA 3SRVB 2GQGA 4FKSA 5JZNA 4EH9A 4GS6A 4IDVA 4FA2A 4ITHA 3IGGA 4MKCA 4QMOA 5LWMA 3ZHPC 4AT4A 4CKJA 3SW7A 4WNMA 3P7BA 5HVKA 3MN3A 2WB8A 1CMKE 3UZPA 3HECA 2CHLA 2PE2A 1XJDA 4Q5HA 3R71A 4DC2A 1UU9A 4PY1A 4MXXA 1Q41A 4NW5A 2H9VA 1WVXA 2BKZA 2WMXA 3C1XA 3MY0A 3N9XA 3ZSHA 4CNHA 5CSWA 4CLJA 1ZLTA 2WMAA 3FZRA 4GJ2A 3KRLA 3BYSA 3S1HA 3ZXZA 5B2MA 4NEUA 2PVRA 3D15A 4JI9A 1S9JA 3RWPA 2XKDA 2F9GA 2OW3A 4E5WA 5L2TA 3DNDA 3V51A 2VTHA 3KFAA 4UWBA 3MGYA 4R77A 2IVSA 4XUFA 2YERA 4XV3A 2IJMA 5I9YA 2BZHB 4QMUA 4YPSA 3TG1A 1PXLA 1UNLA 3O23A 4JBVA 4LUDA 4BGGA 2W1FA 3MH1A 5LVPA 2EXCX 3U55A 1EH4A 3V3VA 4Y8DA 1RE8A 1P14A 2VX1A 2PZPA 4EONA 5LMBA 4P4CA 4XH6A 3VUIA 1YWRA 4ANSA 4F7JA 2VN9A 3G9LX 2EUFB 3KRWA 2C6TA 2C5NA 4YZMA 2XJ0A 1R0PA 3UP2A 4F63A 5G6VA 3IOPA 4QRCA 4TZRA 2QVSE 4PPCA 3FLQA 3COHA 3VS2A 2UW5A 4JXFA 3UVQA 4RJ3A 4Q9ZA 5F9EA 2FYSA 3LE6A 4JDJA 4CVAA 4DFXE 1SNXA 4EOQA 3W2PA 1BI7A 1ZY4A 1BLXA 3BWJA 3NW6A 3UC4A 4OAVB 5E8SA 1WBOA 2RFNA 3B8QA 3R8ZA 3ORIA 4QMWA 1WBTA 4WUNA 4AFEA 4Z7GA 5M53A 2IW6A 4C58A 5FXRA 4JNWA 3PLAE 2HZIA 5LVNA 4TT7A 4FNWA 5HBHA 2R3FA 3MVMA 5CZIA 4AWIA 5I3OA 4PUZA 2B53A 3CTQA 2F7XE 3GI3A 3WF6A 4IZYA 4EK6A 1J3HA 2LAVA 5LXMA 3DS6A 4FI1A 4AA4A 4Q9SA 1A48A 2ZOQA 3A7HA 4JAIA 1DM2A 3W18A 1OBGA 2HWOA 5HG5A 4BDIA 4O6EA 2DS1A 3DKGA 3DV3A 3D5XA 4DGMA 5HTBA 3L1SA 4EK8A 2VO0A 1H1WA 2C3IB 1M17A 2ITUA 4UWCA 2IN6A 4ANLA 4RWKA 2RG5A 3F7ZA 4G3DA 4M3QA 4CTBA 4IVAA 3A61A 4XRLA 3QD4A 4RWJA 4RVKA 4WKQA 3MY1A 4BDHA 4DEDA 2IVUA 2YHVA 3D4QA 4NU1A 5I3RA 2CMWA 5CU2A 3E87A 5HE0A 2UVZA 4YHTA 4BBMA 4FC0A 4MVFA 3LFFA 4TWNA 4W8DA 5CEOA 5GIOE 1VYWA 2YDJA 3EN4A 3H9FA 3KMWA 3LXKA 4RFMA 3WI6A 3B8RA 3MIYA 2GNGA 4DH1A 5I5ZA 4DG0E 4U81A 3L9PA 3EFWA 3UG1A 3RHKA 5FXQA 5CAVA 2XIYA 4P5QA 3BEGA 4BCIA 3BHYA 4LMUA 3VBVA 3NMUF 4UV0A 5F4NA 1STCE 2DWBA 2H6DA 2QD9A 3F5UA 3ZRLA 4BIBA 4BL1A 3LKMA 3QQUA 2JKQA 4BCOA 2Y9QA 3IPHA 5D1JA 4DFZE 4QYGA 2UW9A 3G0FA 3L8XA 1ZAOA 2HY81 1V0BA 5ANIA 4E5BA 3AMBA 3EZVA 4AFJA 3OT8A 5AUVA 2B9IA 4I93A 3IDPA 1Q99A 2O8YA 3BYOA 4CEGA 5I4NA 3DB6A 4EJ7A 3LOKA 2R2PA 2QR7A 3OF0A 3SV0A 2OICA 5D9HA 4W4VA 1O6LA 3OROA 4ONAA 4BCPA 2JITA 2HW6A 5ICPA 3NVMB 5CI7A 4NCTA 3PSCA 1IASA 1WMKA 2AC5A 4PRJA 2F49A 2XK4A 3R9HA 5C8MA 3WE8A 4BHZA 4BI0A 2HZNA 4F9CA 4BTFA 4YC3A 5JN2A 4M97A 4JG6A 2QHNA 5CF8A 3GU8A 4WIHA 4MBLA 4DCAA 3UG2A 5AAGA 5AUTA 3ZU7A 2PUIA 4D4RA 4DBXA 2UV2A 2VRXA 2CKPA 4ZTNA 3CC6A 1UVRA 3KC3A 3Q4ZA 4YMJA 3TNHA 3QFVA 1OKYA 5FUTA 4LG4A 4YZCA 2QNJA 4R5YA 4W9XA 4V01A 3PG3A 3TNIA 2BAQA 2V62A 3T3UA 4OBOA 4G5JA 3DDQA 4EQCA 4PX6A 3DU8A 3D2IA 5H8EA 4FE2A 4MXOA 4V04A 4EOMA 3MY5A 3GCQA 4DA5A 4F64A 2R7BA 2Z7SA 5CTPA 3R1SA 4YZDA 4JX3A 2B9JA 4G3GA 3SHEA 3FLNC 4EYJA 2EB2A 4O2ZA 3NNVA 3VQHA 2OU7A 3FHRA 4IX5A 2WMBA 1E1VA 1UWHA 1ZMUA 4FTIA 2A0CX 5DNRA 4E4LA 1CKPA 2PUUA 4U3YA 3HKOA 3PWYA 5HO7A 2OIDA 4IM2A 3C13A 3FKOA 4XG8A 4OTIA 3FI3A 3QUDA 2RIOA 3H9RA 5ETIA 5AM6A 4B6LA 1L8TA 3ACJA 2YFXA 4FSQA 5CSXA 3BGPA 1YOJA 4E7WA 4I5HA 2IG7A 3D9VA 1OKZA 1XR1A 4QP7A 2UW6A 5K5XA 3U6JA 3MH3A 5EHOA 4ERKA 4GT3A 4LFIA 1Q8ZA 1ZZ2A 3IOKA 1Z57A 5M57A 5M4IA 4AAAA 1H01A 1T46A 4MTAA 4QMTA 4FKRA 3V5LA 3F3VA 4WA9A 3ZEWA 4DTBA 3I6WA 5HIEA 4L67A 4UZHA 2J6MA 3VBXA 4GG5A 1WFCA 4FUXA 4ZP5A 2GCDA 2DQ7X 1JKSA 4S30A 3WE4A 5F95A 5CF4A 3KF4A 4D2SA 4O2PA 2XJ1A 3A99A 3FMKA 1PW2A 1W82A 3HMMA 3QCYA 4FV3A 5FQDC 3TI1A 1ND4A 3R04A 4F70A 1TQMA 4XEYA 3UIUA 5BVKA 4D2TA 2XK9A 3AC3A 1GZKA 5F1ZA 4JDHA 3ZO4A 2VZ6A 3COIA 3GP0A 3R9DA 4BBEA 5E8VA 3QD3A 3QWKA 4OT5A 3IKAA 1FPUA 3CP9A 4AZEA 4KA3A 3ID6C 3BI6A 5HVJA 2JC6A 2X1NA 2W1CA 3PA3A 4PPAA 3HV5A 3LM0A 3EQBA 5JGAA 3LM5A 4FV6A 5HE3A 4IANA 5JT2A 4DH5A 2QKRA 3QQJA 2BFXA 4HVDA 5K4IA 4HVSA 5IA1A 1DAWA 4GJ3A 4K1BA 4D5HA 3CBLA 4WUAA 3DBCA 1YKRA 2UZLA 5FTQA 2JIUA 2RGPA 3BX5A 3KXNA 3LFQA 2HY0A 2X7FA 4BDEA 4UXQA 4S2ZA 5CAPA 2XEYA 3QQLA 1SNUA 2E2BA 1KE5A 5CS6A 5EKOA 5L2QA 3RCDA 4NYEA 3BLQA 3OCSA 5KMJA 2CCIA 4J98A 2ZYBA 1Y8GA 3WF5A 2JKMA 3FI4A 3E92A 4L3LA 5ETFA 5HOAA 3EN9A 5IDNA 4IAIA 4AA5A 3G90X 4XP3A 3U87A 4HGLA 3EH9A 3QAME 4YBKA 2YABA 1KV2A 4HNIA 3DAKA 3GC0A 4TYEA 4XCUA 2ZV2A 3TKHA 1DI9A 5CQUA 5CEPA 3FL4A 4UBAA 2WMRA 4ZJJA 4OR5A 2JKKA 2WMUA 4QQTA 3NSZA 4X3FA 4FSMA 2CN5A 3BKBA 3S95A 4U6RA 5HCXA 3UIXA 4AGDA 3COMA 3GU4A 3QU0A 3AD6A 3IO7A 5CU3A 4KIQA 2C47A 4FYOA 4FIIA 4BWPA 3EKKA 2OWBA 1H1RA 3D83A 2X39A 3NR9A 4QMYA 4ANOA 5IA3A 1GIIA 3VS6A 3TZ8A 4BGHA 4YJOA 4MBIA 5HCZA 3SXRA 3TT0A 1YXVA 3Q53A 4RQKA 4RT7A 2JFMA 4ZJVA 3KY2A 3SKCA 5L2WA 2R3KA 2YLFA 5J87A 2QHMA 2BALA 4G3EA 3PXRA 5HO8A 2JAMA 3LPBA 2F7EE 3V5QA 5DIAA 4DHFA 3DKFA 4QTEA 1H4LA 3UOJA 3MPAA 4TYHA 4ACCA 2ETMA 4XG6A 1ZOEA 4D4YA 3G15A 3HAVA 2FGIA 3NGAA 4BCJA 2VWWA 1OMWA 2YDKA 2XNPA 4ZAUA 1H25A 3CGFA 1U54B 4X2NA 1XKKA 4NM7A 3QXOA 4FNXA 3VIDA 2IW8A 3G0EA 2YITA 1DS5A 4RZVA 4ZSAA 4LM5A 1AGWA 5IKWA 5K3YA 2W9FB 2JIIA 4R7HA 4M12A 1OL1A 4YC6A 3UIMA 4FZDB 2HYYA 3GC7A 1M7NA 5B0XA 2DUVA 5JGBA 1HCKA 3GVUA 2X0GA 2Y7JA 4RVMA 2YM6A 3FYKX 3D5WA 4V0GB 4IC7A 2VWUA 4ZLZA 5F94A 5A14A 2F7ZE 4FTAA 3TNQB 4EOKA 3FQHA 2G9XA 4YHJA 3SRVA 4X2KA 3T9IA 4QD6A 3L9LA 4ZOGA 5H2UA 4E1ZA 3E8DA 4PDYA 4C3FA 3TL8A 4O6LA 2W5HA 3FLSA 1REKA 5I9UA 4PP7A 1W98A 2Y6MA 2WO6A 3VBTA 5TOZA 3HX4A 2YAKA 4U8ZA 3QCQA 3W2RA 4USFA 4XS2A 4XMOA 4OGRA 4GRBA 1YVJA 2WQNA 5AIRA 4ZZNA 3M11A 4D58A 2NP8A 3VRYA 3NNXA 3RWQA 2QO9A 4FNYA 3UE4A 2HW7A 3PYYA 3E8NA 4D5KA 2A1AB 4D9UA 2P0CA 2W1GA 3VS3A 4CXAA 3R9RA 4GUBA 3FKLA 4ZY4A 3L8SA 3PVGA 2VX3A 3LFDA 3QRUA 5EOBA 4BKZA 4DFYA 5E7RA 4APCA 4FUYA 5AIKA 4OUCA 2E9UA 4QMNA 1I44A 3ZYAA 1WVYA 2JEDA 4UALA 3PIYA 5DRDA 3C5UA 3QX2A 4FL2A 4RA5A 5FTGA 2C5OA 3G2FA 2Y4PA 4O0XA 1BX6A 5KBQA 4G3CA 3UDBA 4EI4A 2G2FA 3HNGA 2PVMA 5IEVA 3G5DA 5DT0A 1S9IA 3JR1A 3O8PA 4U7ZA 2GQRA 4OLIA 4FIGA 4FVRA 4A4LA 3QQGA 3DY7A 3OOGA 4O1PA 3O2MA 4BDAA 4DBNA 3SGCA 1FVVA 3OEFX 4FOCA 4HNFA 4ZTRA 4TWPA 3HMIA 1ZOGA 3EB0A 4IM0A 3WIKA 3LLTA 2VWIA 3RJCA 1NVSA 4YGAA 2GNFA 1BI8A 4UMPA 1UKHA 2WTKB 4GG7A 4IDTA 4XX9A 4BDBA 4EH7A 4C4EA 5GNKA 5J9LA 1YI3A 3BHHA 3CD3A 4K11A 4WBBB 5AWMA 5AR5A 1KSWA 1PHKA 3QKMA 5LARA 3RCJA 3OUKA 3VS7A 4AW1A 4YR8A 1J1BA 4FKWA 2ZAZA 2JFLA 2Y0AA 3OBJA 3RP9A 4IJPA 4BDFA 4P5ZA 1JKTA 4FOBA 3KN6A 5A6NA 2YIWA 2QQ7A 3HVCA 3CKXA 2BILB 1J7UA 4O7RA 4CCBA 4EZ3A 4BRXA 3O17A 2R3IA 2ZB0A 3P7AA 4M67A 4YNOA 5AADA 2JLDA 4O7VA 4BZDA 2PZ5A 3A60A 3RK5A 2ONLA 2R3NA 2Q0BA 2OO8X 4OBPA 4DFLA 4ORKA 2XYNA 3JPVA 2VGOA 4AOJA 1UNGA 5J7HA 5CEKA 5GZ9A 4CQGA 1O6YA 1V0PA 4J8MA 4F0FA 3CEKA 1BYGA 3QTUA 4WNKA 2R3MA 2UZDA 2W0JA 4GW8A 4YJTA 5DOSA 3ZLXA 3GXLA 4FL1A 2WOUA 4O0VA 1NW1A 2VTSA 4ZSLA 5G1XA 4NJDA 5IQHA 2Y8OA 3ZDUA 2R3GA 4GYIA 4BHNA 1XO2B 4FTOA 3I0QA 4O1OA 5EM7A 4EQMA 1TQPA 3W2OA 3TUDA 3QRIA 4ZTSA 3E63A 5HE2A 4Y46A 3QGYA 4C8BA 2WNTA 4W4WA 3CTHA 2F4JA 1V0OA 4RLKA 4JRVA 4CFXA 4QMVA 4EOJA 5KNJA 1XH7A 4X2FA 2FB8A 3ZS5A 4OTPA 4CMTA 3UZRA 3A4OX 2HZ4A 1OL2A 3GB2A 3QZGA 4I24A 5L8JA 4NTSA 5BUIA 3CGOA 3R0TA 1Z9XA 4TNDA 4DTAA 2VU3A 2CKEA 4HW7A 4HYUA 4ASDA 4HGTA 5E9EA 2FSMX 4QTDA 4F4PA 5T68A 2XK6A 3EQIA 4BCHA 5EDQA 2PE1A 3BE9A 1HOWA 4QP1A 4AOTA 4HOKA 3TM0A 3AC1A 5ANKA 2GHGA 4FTNA 5LVOA 1R3CA 3DTCA 5KUPA 4ZZOA 4LUEA 1WBVA 3H0ZA 4ARKA 3A7JA 4MWIA 3ORMA 5K5NA 2ITWA 3NIEA 1WBNA 5J5TA 1VEBA 5LVMA 2R0IA 3EQCA 4XHKB 3TKIA 3WF9A 3S2PA 4J95A 4Z3VA 3EN5A 4ALWA 3QBNA 3TDVA 4ID7A 4M66A 2C6IA 1MRUA 3QHWA 5BVNA 2C69A 4GU6A 4HCVA 5HO6A 3C50A 4I20A 3PPKA 2W4KA 2Z8CA 3LFEA 3Q60A 5CY3A 5HG8A 2UZTA 5HBEA 2I6LA 5JKGA 1YOLA 2OLCA 4I5CA 1YHSA 3CTJA 3GU5A 4FK3A 4JJRA 4BIDA 4YU2A 2J5FA 3UNJA 3EJ1A 3LMHA 4FZFB 5CEQA 4RSSA 3EKNA 4WD5A 4M7IA 4X2JA 5GJGA 3W8QA 5GZ8A 3IDBA 2ZDTA 3L8PA 4PMMA 3W1FA 2OKRA 4KINA 2WKMA 4YSJA 4WOVA 1NXKA 4CFFA 1CTPE 1PYXA 3GOPA 4ZEGA 4ALVA 4B8MA 4H05A 3ALOA 1Q3DA 3Q6WA 2F2UA 3HMOA 2C6LA 5E8XA 4GMYA 3KQ7A 5AX9A 3SOCA 2BKKA 1XH4A 3CY2A 4KD1A 2W17A 5B7VA 4R6VA 4L8MA 4L9IA 3NIZA 4JR7A 1YXSA 2X7OA 3H30A 5AUYA 4RWIA 4DTKA 3E64A 4IZAA 4JRNA 4DLIA 4DH7A 4W4XA 3P5KA 3ZTXA 4BCFA 3A62A 2QONA 4E6AA 4Y73A 3QTSA 2OI4X 5J9YA 1TQIA 2EXEA 5DYJA 3JUHA 4F65A 2XIRA 2XKCA 3R9OA 3DJ7A 3ZDIA 2VGPA 4G6OA 3C4FA 4EK5A 1PXNA 4I6HA 5IG1A 4K0YA 1SMHA 2JDRA 3IW8A 1GIHA 3LFBA 4I1ZA 5IISA 2XUUA 1A9UA 1OKWA 4W9WA 3GUBA 4RG0A 4K9YA 2C30A 1R39A 4FV7A 4F6WA 2PVKA 4LGHA 4YO4A 2BZIB 2UW3A 4PTGA 4RIXB 4JVGA 3OP5A 3PA5A 3TV6A 3KXXA 3V8WA 3VW6A 5FRIA 1XHAA 3WZDA 4XV2A 3GENA 4YJNA 4ZTQA 4RIYB 4ANBA 2RL5A 3F3TA 1QL6A 1XQZA 2IO6A 3Q9XA 3LIJA 4IB5A 5FG8A 3V8SA 3PY1A 5HLWA 4O86A 4I3ZA 3K54A 1HCLA 4MX9A 2YZAA 3MJ1A 5DBXA 3HV6A 2C6KA 3FY0A 4AF3A 1IRKA 4KWPA 4C4HA 1PMVA 4QQ5A 4XNEA 5HG7A 1PY5A 4I92A 1OECA 1SVGA 4QTBA 5DA3A 2WTWA 2XJ2A 2FSTX 4FTMA 4F9BA 4P2KA 4EH3A 3CR0A 3P9JA 3VC4A 3LHJA 4FKJA 1REJA 2VTMA 2IVVA 5JRSA 3VUDA 5A4TA 4XV1A 2ITTA 3N51A 3G51A 3HRCA 3JVSA 4IWOA 5K9IA 4H1JA 3ZO1A 1YXUA 1OPJA 4J71A 3RTPA 5AP6A 4KUJA 5EK7A 4AGUA 2X2MA 4AXAA 5FD2A 5IH6A 2ZMCA 2GS7A 2J50A 4GH2A 5JQ5A 1SVHA 4WT6A 2WQBA 4FV0A 3BE2A 4WSQA 2BRBA 3C51A 3HV7A 4YLKA 3OWKA 4BWXA 3RGFA 5IEXA 2YAAA 4F7SA 1WVWA 4JL9A 3UMWA 3S4QA 3DZOA 2C6EA 4R5SA 1KWPA 2WMTA 4LV5A 3FY2A 5L6OA 3V01A 4O0SA 5BMSA 4I21A 4JBOA 3DGKA 1SVEA 4HVGA 4GU9A 3O71A 3PG1A 5C01A 4HVHA 5A4QA 5DMZA 3BQCA 4MQ1A 4ZIMA 4BIEA 4FKQA 3DQWA 4PMPA 4LRJA 5IDPA 2C1AA 2C5XA 2JDSA 3ACKA 3OWLA 4XP2A 3F61A 1FOTA 3ENMA 3PE2A 3O50A 2Y6OA 3NRMA 1VJYA 2RKUA 3KXMA 4FG7A 4DEBA 5D41A 3AGLA 2OFUA 1PMUA 3SG8A 1LR4A 2WTIA 2EXMA 5TT7A 2H96A 1U54A 4NSTA 2VV9A 5BNJA 5KMMA 1CKJA 1KE6A 3QZFA 3EMGA 4S31A 5HTCA 5DEYA 5EM5A 5IQAA 2YLEA 1LP4A 3F7WA 2UW0A 3R6XA 3LQ8A 1OUYA 5JZJA 3H9OA 3MIAA 2YM8A 5C26A 4O7LA 3LXLA 3F66A 2C0TA 5AUXA 4AZVA 5EQPA 4GKIA 2P55A 2RFSA 4RGJA 2XKEA 4DG2E 4KRDA 1MQBA 2YA9A 3KVXA 5L4QA 4I6BA 3PDTA 5IQCA 2VUWA 3AG9A 4NM3A 3VN9A 1R78A 4JR3A 4USEA 3F2AA 2X6DA 2J0IA 3ENHA 2QG7A 4CGAA 1YXXA 4XLVA 4BB4A 4F9WA 5C8KA 4IQ6A 4E6DA 3EN6A 1GNGA 4G16A 1W84A 4EBVA 3FMMA 3R8MA 3EWHA 3F5GA 2WMQA 5CALA 3AOXA 2YEXA 2E9VA 3GC9A 3R83A 3R8UA 3E3BX 4IAFA 1QPEA 2PZIA 4IADA 3ZLWA 3MPMA 3ZLSA 2RSVA 4EEVA 3LQ5A 2VTNA 4KKEA 3FLWA 4D1SA 3JYAA 4QMZA 3AMYA 4YPDA 3RAWA 4RBLA 4USDA 2W4JA 4RPVA 3G6HA 4KSQA 4A9RA 2I0YA 2XP2A 4ASZA 3PFQA 3FSFA 3W32A 4PDSA 3TTIA 5LCKA 2QOFA 4D0WA 2Q83A 4PQNA 4OBQA 1NVQA 4PF4A 3OVVA 3FMEA 1G3NA 3DQXA 5FXSA 3SOAA 3ORLA 1IEPA 3R01A 3FDNA 4HPUE 2A4LA 4JIAA 4ZZMA 2PVLA 3NCGA 3RINA 5D7AA 4FIFA 4FTLA 5HNBA 4LV8A 5AJQA 4EKLA 4QPSA 5L6PA 4CQEA 2XH5A 3ULIA 1YI6A 4FF8A 1G8AA 4AA0A 3BPRA 2QOLA 1TKIA 4BKYA 1Q8TA 2ERZE 3BZ3A 3QTZA 4J97A 3F69A 4CKIA 4MHAA 2QOBA 4RJ7A 4RQVA 1ZWSA 2E9PA 2ITZA 3TJDA 4X7QA 2R4BA 2WEVA 4ENYA 2WMVA 3OS3A 5E92A 2BIYA 3C0GA 3VULA 4DE4A 3NZ0A 3OXTA 4U9AA 5EM6A 1JOWB 5I0BA 4ZMFA 4M14A 3TKUA 2BROA 4IZ5A 3R21A 3H3CA 4EOPA 1OKVA 3FPQA 4KBAA 3DT1A 2VTTA 3CPCA 5AV2A 2B7AA 3HMPA 5HX8A 4FEVA 4EOIA 2WGJA 2HAKA 3D7ZA 2IZTA 3KU2A 4WNOA 2YISA 4UEUA 5J9ZA 2ZDUA 1IAHA 2R3HA 3KVWA 4FKIA 4WBOA 2PMIA 5BYYA 3DAJA 2ZV8A 1Q4LA 3WYYA 3ORNA 4G3FA 3ULZA 4KB8A 4PDPA 3R73A 2VTAA 3FMLA 4BBFA 3BV3A 4IXPA 4D1ZA 3IS5A 5CVHA 2VTOA 3FV8A 4EH8A 2R5TA 4NTTA 2CN8A 2QCSA 3WZJA 3HUBA 4MYGA 3SXSA 2BR1A 1OIYA 3D14A 3UOKA 5B2KA 4ZS4A 3L8VA 4AUAA 2RG6A 3VJOA 1OIRA 3R1QA 4Z16A 4AZTA 4IB1A 4N4SA 4X21A 3F5PA 5DR9A 2XCHA 3DOGA 3A4PA 3FWQA 3ITZA 4M13A 2ACXA 2E9OA 5GJDA 4CFMA 1YHVA 3NYOA 3CD8A 3VBQA 3F5XA 3II5A 3QX4A 5AP0A 2VTPA 4LOOA 4NCTC 3COKA 2W99B 3IK3A 2ITYA 2ITXA 3MVJA 3G9NA 3C4EA 1YQJA 4BGQA 3RZBA 4EWHA 1PXOA 4ZXTA 2EB3A 2J9MA 3K2LA 2ITNA 5LMAA 4M0ZA 3MVLA 3PY3A 4WG3A 5EDPA 4DCEA 2B54A 3HDNA 1Q24A 3LJ0A 5AP4A 2PZRA 2R3QA 2XA4A 2BDJA 5M08A 1DAYA 1ZMVA 2VX0A 2YM5A 1DI8A 4IB3A 4FT7A 4L52A 1MRVA 4II5A 4IJ9A 3W8LA 2R0UA 3OOMA 5IA2A 2WTCA 1W7HA 5IU2A 2BFYA 1KE7A 2W1IA 3UPXA 1JSUA 1FINA 3FUPA 3NYXA 3QD2B 4I0RA 2C5YA 5ACBC 4F08A 1BL7A 2UVYA 1GZOA 3C4CA 1BL6A 2BPMA 1OVEA 5HIDA 4GYGA 3QTWA 2I0EA 2A19B 4MQ2A 5TR6A 2BHEA 2KULA 4EZ7A 4RJ8A 3FXXA 4PDOA 5BVWA 1UU3A 4AT3A 4EORA 3VF8A 2WAJA 5H8GA 4U5JA 5BUEA 4FNZA 2YCFA 1Q97A 2W06A 1QPDA 2YZLA 4RZWA 5M07A 4ERWA 3LZBA 4MXYA 5EI8A 5KKRC 2VNWA 5KMOA 3PJCA 5E8YA 3QCXA 4GV1A 2VO6A 2QOKA 5I9VA 4UX9A 3ROCA 3BHTA 2WTJA 4NIFB 5HESA 2W1HA 3VHKA 3VUTA 4K18A 4DEAA 4A7CA 5KHWA 1PXMA 4MNEB 2Q0NA 3ORTA 4ANQA 5AV1A 2GNJA 3AC5A 3KRJA 5AX3A 3PY0A 4ACDA 2QOOA 5JFWA 5EYMA 3V04A 3C0IA 5C8NA 4DINA 1ZXEA 3QKLA 3F9NA 4BF2A 4GK3A 5AAEA 2JAVA 3UYSA 4ASXA 2CGVA 2W4OA 1F5QA 3DK3A 4FICA 4FVQA 3PRIA 4RMZA 5DLSA 4O0YA 3ZBFA 4FMQA 5DT3A 4CCUA 2WPAA 3NX8A 3NYVA 4GT4A 1G8SA 3ZRKA 5T3QA 3NW5A 3P78A 5HZNA 4CMOA 5LCJA 4UMRA 3V5WA 3QGWA 2XMYA 4DF3A 3UJGA 2ITPA 2PVYA 3Q3BA 1Z5MA 4I0SA 4BDGA 1YWNA 4O83A 5CU0A 3KMUA 4L42A 2A27A 1OPKA 2HENA 3PP0A 5AP5A 3EYHA 4FV2A 3QWJA 3L9MA 4HJOA 1ZYCA 2J2IB 3ANRA 3JY0A 5IEYA 3PP1A 4AT5A 3AT3A 3Q32A 2P2IA 2PMNX 4KBKA 4KBCA 4QP8A 5D10A 4V05A 5AP1A 3R8LA 3V6RA 5HLNA 3HLLA 4M69B 2XYUA 1E1XA 2FA2A 3C4WA 3ORXA 2XS0A 4TTHB 4LL5A 1H08A 4D4SA 3MI9A 4C4GA 3JXWA 3R28A 4J99A 4DEGA 3CE3A 4XOZA 5GINE 3HYHA 4GFOA 2VTQA 1XH8A 4I0TA 5KHXA 2WIHA 3SVVA 2XNOA 2XK7A 4I94A 4NT4A 5FM3A 2JBOA 1AD5A 5CSHA 4O84A 4IH8A 3N4UA 3O0GA 4RIXA 3O8TA 3PJ1A 4L45A 4YLJA 5DFPA 3ERKA 3TEIA 3UQFA 1PYEA 1OI9A 2OK1A 1QPJA 2VO3A 3FMJA 3ZZEA 5HD4A 3DPKA 3CY3A 4RIYA 1B6CB 5EW8A 4ZTLA 1J7IA 4MD8E 5IH5A 2CSNA 3QUPA 1FVRA 1OIQA 3LFCA 3GCPA 4JG8A 2XIKA 1A06A 3OTVA 1FMKA 4ZSEA 4LI5A 3E7VA 4X3FC 1VYZA 2GTMA 3CPBA 3I5NA 4BKJA 1NVRA 2C3LA 4IAKA 4L6QA 2ZM1A 5TF9A 3DLZA 4LL0A 5IZFA 3UO4A 4AP7A 1QCFA 5BUJA 3V5TA 2FO0A 4D4VA 4GKHA 3ATSA 3Q2MA 3QRTA 4DFUA 3R02A 1OITA 3PVUA 5J95A 2V55A 4FKOA 4NL0A 2GMXA 4JQ7A 4FTTA 3PXFA 4G5PA 1RQQA 1MUOA 3A8XA 3EN7A 3FL5A 3RM6A 3GQIA 1OM1A 1GAGA 3NWWA 3ORZA 2B9FA 5DWRA 5CF6A 2XEZA 4WRSA 3OUNB 4EQUA 4CZYB 1YDTE 3BLRA 3G33A 3OWJA 5J1WA 3ZONA 4A06A 3R8PA 2HZ0A 3HGKA 4FSZA 5H3QA 2CNQA 3TIYA 4M8TA 1PXJA 4I23A 4EK4A 3HV4A 5HD7A 3NUNA 2RF9A 3WIGA 3ZH8A 5I9WA 4H1MA 3KREA 5C4LA 2G2IA 3MVHA 4IBMA 3Q4UA 4CRLA 4QQJA 4LRKA 3I81A 2BUJA 4I22A 5AV4A 3TNPC 2I0VA 4I5MA 3P7CA 3HA8A 1H28A 1ZYJA 3EFLA 3PRFA 4FT9A 4JBPA 4L3JA 2UZBA 4D28A 4DGOA 2PULA 3C5IA 2BTSA 2YCSA 5E4HA 5T6KA 4ACGA 3EIDA 2X2KA 5CNOA 2F2CB 4FKGA 4IM3A 4Z9LA 1UU7A 3SDJA 3AD5A 4BDKA 4C62A 4DGGA 3QZHA 4F1TA 3ZOSA 2R3PA 2G1TA 3R1YA 4AN2A 4Q2AA 2UW8A 2CDZA 5ETCA 3GU6A 1Q8UA 2KTYA 4JLCA 5AP3A 5CAOA 3QTQA 4DLJA 2XNNA 1H0VA 4IWPA 5EI6A 3CQUA 3I1AA 2X8EA 4J8NA 4AG8A 3L9NA 5A54A 5EQEA 3PPZA 2NNWB 4C3PA 2XNEA 4FT0A 4X0MA 5FEQA 4DG3E 5JH6A 4CYJA 3FMHA 3DBFA 1MRYA 4FKVA 3A8WA 3RMFA 3UPZA 3W16A 3FYJX 4E4XA 3FC1X 3LFNA 3FBVA 3KXHA 3T8OA 4XG2A 4YZBA 2XM9A 5CNNA 2X9EA 4BTJA 4FV5A 1M2PA 3POOA 3TDWA 3FKNA 1GZ8A 2NRUA 2XBJA 3HV3A 3ORPA 2WU6A 2CLXA 3QC9A 3FZOA 3ZO2A 2O2UA 1LPUA 3WZKA 2VWXA 1F0QA 2UZNA 2RFDA 3LFSA 4LGDA 4IEBA 3UIBA 3DCVA 3KRXA 4ITJA 4I6FA 2YIXA 3EZRA 2BRNA 2XCKA 3DDPA 4ITIA 4QP2A 5J8IA 3MTLA 4S34A 4RWLA 3DA6A 4AW5A 3IW6A 5K4JA 1GOLA 2YJSA 3R2YA 2ZM3A 2EU9A 3EYGA 1JKKA 1O6KA 2GDOA 3RVGA 3VNTA 3NNWA 3PPJA 5DR2A 4AE6A 4YUQA 5KO1A 2GHMA 2OJJA 2B52A 2CNVA 2X2LA 3QA0A 2OJIA 3TWJA 1ZYSA 2OXXA 3D0EA 1K9AA 2YIQA 4A4OA 1YW2A 3GC8A 1FQ1B 4FG8A 3M42A 4X6QC 4C38A 3OW4A 4QTCA 1P4OA 2VTLA 4U0IA 4QYYA 3VUHA 3QA8A 3BYMA 1VR2A 3NPCA 5KX8A 3R2BA 1VZOA 3OFMA 3DNEA 3KULB 3UOLA 4BN1A 2J5EA 4KSPA 1GIJA 1M7QA 5LMKA 4PTEA 2PY3A 2R3RA 1Q62A 5AA9A 4ANMA 3E7OA 4L7SA 4W4YA 3EQDA 1Y8YA 4LYNA 4YJRA 1OZ1A 3CLYA 4E5AX 5DR6A 2X81A 1E9HA 2W5BA 3BYVA 1NY3A 4YJPA 1MP8A 1RW8A 4LOPA 4F99A 2G01A 5CSVA 2V22A 2O5KA 5DVRA 5E90A 4AZWA 2W05A 3KXZA 5LWNA 5DG5A 1BMKA 3D5UA 1H26A 1MQ4A 3FHIA 4HZRA 4BWKA 4EL9A 2OZAB 2OGVA 3P79A 2X4FA 4IW0A 3R7VA 3LCOA 4OTDA 5H9BA 3S0OA 2VWBA 2I0HA 4CFUA 3H0YA 4EJNA 5BVOA 4HGEA 5IQDA 2PVNA 4Y72A 5AM7A 2QLUA 4AGWA 2ONLC 2FVDA 3F82A 4RRVA 4EH5A 2BIKB 4YC8A 4C4JA 4YTIA 5JGDA 3MESA 2J90A 4F7NA 2XK8A 4E20A 5IQBA 2XIZA 5HIBA 4G2FA 4JAJA 3OXZA 2J0MB 4F1MA 2QR8A 4GIHA 4YLLA 4BCGA 2OF4A 3VUMA 4HCUA 1JPAA 5AUUA 4O0TA 2XB7A 5TE0A 5L2IA 1TVOA 2YN8A 4APPA 2R3JA 1J1CA 3HP5A 3M2WA 3U6IA 2W96B 4DT8A 4GT5A 1H07A 4J1RA 4MBJA 4DITA 2BDFA 2ZVAA 4NKSA 2VTIA 3WARA 5CT0A 3ZEPA 5AMNA 4C02A 5LMKC 4FV8A 2Z60A 3A7GA 1KOBA 4FIHA 2QURA 2XKFA 4IAZA 4X3JA 1G5SA 2C6OA 3ETAA 4H36A 4GSBA 3OBGA 4E3CA 2UZUE 1ZARA 3K5VA 3P0MA 5CQWA 5DRBA 5IUHA 3OCBA 4O96A 5ACKA 4CFNA 3GU7A 5HVYA 4L00A 3PJ2A 3VUKA 3WYXA 3LCTA 5JRQA 3FZ1A 1RJBA 5AEPA 3ZC5A 4NK9A 2QC6A 1OUKA 3A2CA 3Q9ZA 4FSTA 5HLPA 3CIKA 3A7FA 3KA0A 5AP7A 2CGUA 4F9YA 4QMQA 5EH0A 5BYZA 3PSDA 4YURA 4RLLA 1XH9A 2ZMDA 3ELJA 4CLIA 2IPXA 4F0IA 4BDCA 3ZSIA 4IVBA 2ZV7A 4MK0A 4BZNA 4AOIA 4F9AA 5CU4A 4TXCA 4MD7E 2REIA 4NM0A 3P1AA 1UA2A 4RX9A 3R22A 5GJFA 5KCVA 3BU3A 3OZ6A 3KXGA 2OF2A 3EL7A 2GNIA 4XG7A 1YOMA 1ERKA 1ZYDA 3QYWA 4UYAA 4CZUA 5TKDA 4G6LA 1CDKA 4TKSA 5A4EA 1OL5A 3PUPA 3O8UA 5EQYA 4NJ3A 1IA9A 2C4GA 3D7TB 4RJ6A 3S00A 4D0XA 2GU8A 4DEHA 4IE9A 4WHZA 2BRGA 5I9ZA 3SG9A 4FEWA 2WTVA 3JY9A 3BBWA 5E8ZA 5DN3A 3BV2A 2J0LA 3EHAA 3HRBA 5I9XA 1NT2A 1UNHA 3HA6A 4R7IA 2UZEA 3QLGA 4IX3A 4Y85A 3QZIA 3DK7A 4BCMA 3AC2A 4O7SA 5BMMA 2QOHA 3I6UA 4G9RA 4PL3A 4D9TA 5HG9A 2XRWA 3R7OA 4LOQA 1XWSA 4IIRA 3RK7A 5ANOA 4G6NA 3LXNA 2J0KA 4CYIA 1IR3A 4C35A 1GZNA 5KMKA 1OL6A 1Y6BA 3BCEA 4MXZA 4Z55A 2I7QA 4NIFA 4XG4A 3OG7A 3VJNA 3PWDA 4L44A 1W8CA 2J4ZA 4QMSA 2OSCA 2O65A 4PTCA 1CKIA 4O7NA 3F88A 3QL8A 4H39A 3UVPA 4TYHB 4C34A 3FLZA 4MXCA 4ZSGA 2QODA 3GGFA 2QOIA 4K33A 3CQEA 3HEGA 3OXIA 4JDIA 3ANQA 3PVWA 4B0GA 4R1YA 2OFVA 3AC8A 4L53A 5CXZA 3W10A 4CKRA 4QMMA 5L8LA 5HBJA 3VO3A 4L46A 4YO6A 5HE1A 5ITAA 3B2WA 5FWKK 5AFVA 4FL3A 1JSTA 1AQ1A 2XNMA 5HCYA 5HX6A 2OZOA 4O38A 4R3CA 5EYDA 4MF1A 1UKIA 1YI4A 3OT3A 4KS8A 4DFNA 5C03A 3C0HA 4JT3A 2X8IA 4EHZA 2Z02A 3LMIA 4FGRA 1B38A 2R9SA 4KIPA 4YJUA 4CMUA 2YCQA 4QO9A 3V8TA 2FSLX 4ZTHA 3FAAA 4G31A 3RZFA 4N0SA 4HCTA 3GBZA 4Y83A 3TV4A 1ZYLA 2CCHA 2CKOA 1OL7A 3P4KA 4AZFA 5EKNA 3UTOA 4O7TA 4DN5A 2WXVA 2V0DA 3RM7A 1M52A 4M69A 4F7LA 4L7FA 4FSYA 4EH2A 3NVKI 4TYGA 3R30A 4BDJA 2PL0A 4YZ9A 1LEZA 4K2RA 3E93A 2CGWA 3OY3A 4XLIA 4MD9E 5EI2A 4MWHA 5FBOA 3QLFA 3VS5A 3SQQA
chains in the Genus database with same CATH superfamily
5LJJA 4FEQA 2QOQA 4A07A 3UODA 2GNHA 1JBPE 3F3ZA 4P7EA 5AR2A 4E6QA 4N6YA 3B2TA 4C36A 3RPYA 2ESMA 2HIWA 2WQOA 4FGBA 4I5PA 4K77A 3CJFA 5AV3A 3Q4CA 3RI1A 4EUUA 3ML1A 4AS0A 5L8KA 4BI2A 3NFFB 3KN5A 4L01A 4FTRA 2QO7A 4LMNA 4FTJA 4J7BA 4C37A 5CASA 1R1WA 3EFKA 3KF7A 3MJ2A 3ODZX 4KAOA 4YJQA 1OB3A 3UC3A 3F3UA 2VTJA 1URWA 5FP6A 3Q6UA 3TUCA 3VUGA 4TNBA 3R7GA 2PU8A 3UNZA 3V6SA 3VQUA 5BVDA 3VBWA 3V5JA 2XNGA 3UP7A 2B0QA 2Y4IB 2J0JA 4OT6A 5CVFA 1PRYA 5CI6A 5KZ0A 4ASEA 4EYMA 1SYKA 2QKWB 3SAYA 3AGMA 5F20A 2PWLA 4V0GA 4YTHA 1G8KA 2NO3A 2X9FA 4QT1A 2HCKA 3RHXA 4TPTA 4KIKB 5KMIA 3IG7A 2OXYA 1IAJA 3UDZA 5EYKA 5M56A 3QRKA 1FVTA 2XAOA 3MS9A 2YJRA 3NNUA 1PKDA 3DBQA 3NYNA 3Q5ZA 4FKLA 2GFSA 4X6RA 2QU6A 4KIOA 2IW9A 2JDOA 2YCRA 4Q5EA 3VBYA 4BYIA 4R8QA 1B39A 2BZKB 2C68A 3NUPA 1YDRE 4CV8A 3DXPA 1XBBA 4IFGA 5K0KA 3LMGA 3RPOA 4CFVA 3ZZWA 2YIYA 4Z7HA 3MWUA 3O51A 2XZSA 3AT4A 2BRMA 4GVAA 2O63A 4DGNA 3BELA 3CJGA 3REPA 4F6SA 2OJFE 5HNGA 4O82A 4O21A 3ZUTA 2OIQA 2J7TA 3RPRA 3UGCA 4DT9A 1ZMWA 4G17A 5L6WL 4HYSA 3E62A 3MFUA 2BAKA 4N57A 3IGOA 3BRBA 4QOXA 4L3PA 4FIJA 4IMYA 4M0YA 4R3RA 3OHTA 2UZOA 5D7VA 3VS4A 3F6XA 5FBNC 5FM2A 4YJSA 4OTRA 4EK3A 4IZ7A 1JVPP 5C9CA 2XM8A 3E8CA 3KB7A 4L68A 4EZ5A 1JWHA 4NFMA 5C1QB 4CD0A 1O9UA 5JFSA 2WQMA 3ORKA 3BYUA 3I0OA 2PMOX 2WEIA 3K5UA 3QQKA 4O0RA 5E1EA 4LRMA 1PKGA 2XK3A 4U40A 3T9TA 3WF7A 5IA0A 2YWVA 2C0OA 2WD1A 1GY3A 4D1XA 4HZSA 4JDKA 1IG1A 3TTJA 1PXKA 1ZY5A 2V5QA 3MB7A 3LFAA 2EVAA 4JG7A 2OH0E 3NLBA 2WMSA 3LXPA 5FGKA 4E4MA 4R78A 4OAUC 1H1PA 1UU8A 3BU5A 3BBTB 1JAMA 1SM2A 2NRYA 2O3PA 3E88A 3KEXA 2YWPA 3MV5A 4FYNA 4MXAA 3PVBA 3WBLA 4CFWA 1I09A 4EOOA 4EUTA 5AR3A 4BTKA 4BYJA 4XBRA 3W0PA 2I40A 5LQFA 5HHWA 2CPKE 4QNAA 3AXWA 5HU3A 5KBRA 4A4XA 4TN6A 2PVHA 4UYNA 4FR4A 2PVJA 4G9CA 5EG3A 3ZXTA 4AN3A 3R7EA 5AR4A 4WG5A 2BCJA 4RIWB 4U42A 2PSQA 1APME 3LCSA 2YDIA 2XRUA 3JS2A 1YWVA 3O7LD 3R00A 2PHKA 3GQLA 5IQEA 2WELA 2W5AA 2OBJA 1KOAA 3RALA 2GHLA 3FMNA 1JQHA 3UMXA 5H8BA 4JQ8A 4C4IA 4PNIA 2BTRA 5EFQA 4F0GA 3I5ZA 4W8EA 3EQHA 3H4JA 1H00A 3DBEA 3KK8A 4CRSA 3WZEA 4XOYA 4AU8A 4F09A 5BQ0A 4O27B 1URCA 3R63A 4FSNA 4U43A 4C33A 3OW3A 5IQFA 3OC1A 5ANEA 4QP9A 1H27A 3BHUA 4PNKA 2GS2A 2YM4A 5D12A 2LGCA 4RC4A 4IX4A 4O91A 5A3XA 4R7BA 3TNWA 1F3MC 1WBPA 4RIOA 1U4DA 2C5VA 3DK6A 3M1SA 3U4WA 5ETAA 3QHRA 3H10A 3KULA 5L3AA 4E26A 2CKQA 4Y95A 3MH2A 2OXDA 2VO7A 3GOKA 2P4IA 2WTKC 3BGZA 3NUYA 5AA8A 5M4FA 4M15A 5CU6A 2HK5A 3OWPA 4A9UA 4KABA 3OCGA 4BFMA 1X8BA 4ZY5A 3SA0A 3BU6A 3AMAA 3NW7A 4MF0A 3MFRA 4EOLA 3KCFA 3V5PA 5EM8A 1Y6AA 3BEAA 3I79A 3PE1A 4OTGA 4TWOA 4P90A 4ZMEA 3MDYA 3NUSA 3Q2JA 3POZA 4D2RA 1JKLA 2VWZA 3UVRA 4A9TA 2OZAA 4MAOA 3VVHA 4RX5A 5GHVA 4FZ6A 4QP6A 1BUHA 3NEWA 4GK2A 4J96A 2XVDA 3I60A 4HPTE 5IA5A 4XV9A 4AW2A 4DGLC 3PA4A 4D2VA 1WZYA 2ETRA 4PPBA 5CYIA 3TACA 4BCKA 3RAKA 2C6MA 4N6ZA 4R1VA 4BI1A 1JLUE 3VS1A 4ZLYA 4I6QA 3NS9A 3QKKA 2Z2WA 1XH6A 4IWDA 5HNIX 4GCJA 3PLSA 2BMCA 3BLHA 3O7LB 2JBPA 3UYTA 1OIUA 4ZTMA 4GFMA 2CJMA 5CZHA 4FSRA 5HQ0A 3TUBA 3QCSA 1ZOHA 5EOLA 3QTRA 2PUPA 4C3RA 4AZSA 5GZAA 1XH5A 2B1PA 3QQHA 3BHVA 5FEEA 3BGQA 5CF5A 3P86A 3R1NA 3ZFMA 2C6DA 3W33A 4O0WA 5EHLA 5CENA 4FZ7A 3OMVA 2PZYA 1NA7A 4UMUA 4LV7A 3D5VA 4XG3A 3KK9A 5ANDA 4EC8A 2W1DA 2WTDA 4E4NA 4WRGA 5M55A 4J53A 1M14A 3I4BA 4U44A 3ZSGA 4AGCA 2R3LA 4BTMA 4ZS0A 3E3PA 5IA4A 1W2FA 3QTXA 5M4CA 4HYHA 4JOAA 4TYIA 4FODA 4RJ5A 3DKOA 2R7IA 3C4ZA 4YZNA 4RVLA 2G15A 5GIPE 4H3QA 3RPVA 4D2PA 3KCKA 4EC9A 3DKCA 3TXOA 4EWQA 1PXIA 4JBQA 4MUQA 3HRFA 5J1VA 3FEGA 4PMTA 2VNYA 4NZWB 1JNKA 4KS7A 2C3KA 2HELA 3OD6X 3ET7A 5EHYA 4DYMA 3PTGA 3CSVA 1Q8WA 5J79A 3W55A 4U80A 1J7LA 3MW1A 3MA6A 4EHVA 4U41A 2X6EA 3BIZA 4CG8A 3FQEA 1KE9A 1PMEA 4BCQA 5J7BA 2WU7A 4IB0A 4FK6A 4IVCA 4QNYA 2O0UA 4QTAA 5CVGA 2VWYA 4XYFA 5IUGA 1W83A 5AUZA 3D7TA 5EW3A 4QMXA 5A9UA 3RBWA 3MA3A 4GIIA 4YHFA 4H58A 4C2VA 5CAUA 4OTHA 1H1SA 1K2PA 3EFJA 3U9CA 4J52A 4RFYA 4DAWA 4E6CA 1ATPE 3FZSA 3KRRA 1Q61A 4R3PA 5KMLA 2CGXA 2R3OA 4GVJA 5DGZA 4B99A 4KKHA 2P33A 4AAYA 4O22A 2FSOX 4QDVA 2PMLX 4QP4A 2JKOA 3NCZA 4FSUA 3GEQA 2W1EA 3F2RA 4RFZA 3WF8A 3FLYA 3PJ8A 4KRCA 4FEUA 4ZY6A 4C0TA 1M2RA 5BPYA 5EW9A 4C4FA 4BJJA 3DJ6A 1ZRZA 4U79A 5IQGA 3PIXA 3ROYA 1KE8A 3MBLA 4UB7A 3AD4A 2QLQA 2JD5A 4EBWA 3NUUA 4B8LA 1Q3WA 5A46A 2QI8A 4B7TA 4WSYA 4BCNA 5AR8A 4GEOA 5BVEA 3U4UA 3LLAA 2GPHA 3PXZA 1WCCA 3Q5IA 3W2SA 3RAIA 1IA8A 3DBDA 5JFXA 3CS9A 3NDMA 3TIZA 2AUHA 3JVRA 1M2QA 4MEDA 2BAJA 2V7OA 1H1QA 1OGUA 2PPQA 4FKUA 3U8WA 4BICA 2I1MA 5AAFA 1XBCA 2YACA 5CSPA 2UZVA 3AC4A 3KL8A 1LUFA 5E8WA 3UO5A 4WG4A 3NUAA 2HOGA 1LEWA 4PWNA 1OPLA 2W7XA 3KKVA 1PXPA 3VF9A 1K3AA 5IMEA 1H24A 2X8DA 3MFTA 4IHPA 4L43A 2IZSA 3HP2A 4IC8A 4NUSA 4XG9A 3SW4A 2VTRA 3BQRA 3HZTA 4YP8A 3U9NA 1Y91A 3FZTA 3C7QA 4U45A 4EH4A 2WHBA 3MH0A 4MCVA 4FBXA 3IW5A 3DLSA 4B9DA 2QOCA 1J91A 2BDWA 2IWIA 2IZRA 4NW6A 4YNEA 4O81A 3DXQA 2VAGA 4KNBA 5BVFA 3EOCA 4X2GA 5CEMA 3R8VA 3WOWA 2GSFA 3ODYX 4UY9A 4FT3A 5TO8A 5JFVA 4YJVA 3NAXA 3ATTA 2GTNA 3ZFXA 4IAAA 3R7IA 5J5SA 3FSKA 4AW0A 3TV7A 3UQCA 2OJGA 5CAQA 5CT7A 5A4CA 5KMNA 4JIKA 3UOHA 3W0MA 2PE0A 4IAYA 5LVLA 3ZUUA 2YM3A 4OTQA 3MSSA 1QPCA 1GJOA 3KGAA 1L3RE 2WIPA 4TW9A 4D55A 5HKMA 2B4SB 2VWVA 3U54A 4M84A 4O4BB 2UZWE 3UO6A 3LVPA 3OTUA 4ZK5A 4AACA 2OJ9A 4FG9A 4UXLA 5CXHA 4C7TA 3PFYA 1ZZLA 4O4DA 5HGIA 3HMNA 3NUXA 2J51A 4WO5A 3CCNA 4U97A 3VWAA 2YM7A 4FTQA 3SX9A 1U46A 5IH4A 4HYIA 1SZMA 2ZB1A 2E9NA 3O96A 4GUEA 1UV5A 5DHJA 4FIEA 4EHEA 4FV9A 1XBAA 5AUWA 1YRPA 3ZRMA 4F1OA 5AP2A 3E5AA 4I4FA 3O5AA 4XRJA 3QYZA 4QMLA 5CWZA 4FTCA 4RX8A 2P3GX 2PYWA 3FI8A 3LCDA 2QO2A 1UWJA 1OBDA 4C2WA 2AYPA 4U3ZA 3SD0A 3LJ1A 2BZJA 5DPVA 1U5RA 2ITVA 4FX3A 5BX0A 4PL5A 3SC1A 5IPJA 2JGZA 2C3JA 4BC6A 2V7AA 1PF8A 2UW7A 4KIKA 2CNUA 3EL8A 3FMDA 1V1KA 1YHWA 2IZUA 3KIOC 4CV9A 1FBNA 4DH3A 3HUCA 4NFNA 3G6GA 3NAYA 3Q9WA 2C1BA 4FTUA 4XJ0A 4CT1A 3LQ3A 3P5JC 1WBSA 4DFBA 4I4EA 5IQIA 3S3IA 2GQSA 3DFAA 3I7BA 2W9ZB 4UWYA 3PSBA 3QUEA 5FLFA 4G34A 2QG5A 2A2AA 2PTKA 3Q4TA 3RNIA 2ZJWA 5DT4A 5LOHA 2XF0A 2ZM4A 4QYFA 4D2WA 3QRJA 3ZUVA 4DH8A 4O0UA 4BZOA 5D11A 1VLRA 4G1WA 2B9HA 2PUNA 5AV0A 4K8AA 2FH9A 3MYGA 1KV1A 3AQVA 2UVXA 4FKTA 4S32A 3VRZA 4AN9A 3BLAA 5M51A 4TWCA 3UBDA 3VS0A 2BHHA 5CLPA 3FJQE 4ZSJA 3U51A 4EOSA 3WILA 3DAEA 3FC2A 5HICA 4KKGA 5B2LA 2Y4IC 3SLSA 3SXFA 2Z7RA 4QMPA 3K3JA 5FP5A 1R0EA 4XBUA 2F57A 2RFEA 3ZMMA 4B4LA 4ENXA 5M44A 3Q9YA 3ZM4A 4EHGA 4C59A 4M68A 3I7CA 3OY1A 4Y5QA 4LDTA 5HTIA 2R64A 3LCKA 1BKXA 4TL0A 4ZLOA 5CANA 3C4XA 3EQFA 4GK4A 3FPMA 4PV0A 5KKRB 3WZUA 4FV1A 4MNFA 5DEWA 3PXYA 5E8UA 4RC2A 4E93A 3DZQA 5EYCA 5FDXA 3EQPA 2GFCA 4IVDA 3GFWA 5JK3A 2HXQA 3F3WA 2WQEA 3ZBXA 5L2SA 2HWPA 5FTOA 2BVAA 4IFCA 4RX7A 4RVTA 5ANGA 2IVTA 4BVUA 5JSMA 1P5EA 2XIXA 3W2CA 4BR3A 3K3IA 3FE3A 5AR7A 1PMNA 3GNIB 3VHEA 2BRHA 3TCPA 4AQCA 4BDDA 4O7YA 5E8TA 5M06A 3UQGA 5CEIA 3HDMA 3MTFA 1ST0A 2P2HA 4UMTA 3ZCLA 4CZTA 4RIWA 3U6HA 2SRCA 3ZM9A 2PK9A 3AT2A 4Y5HA 3RAHA 3GCSA 3IDCA 4FEXA 5FEDA 3RKBA 1RDQE 5A6OA 1WAKA 2G2HA 3MPTA 2FUMA 3GFEA 3RNYA 2OG8A 4TYJA 5HORA 3FXWA 4FTKA 5JEBA 3DJ5A 4ZJIA 4F6UA 3F2NA 3LJ2A 2ETKA 5ANJA 3THBA 2DYLA 3BWFA 5DH3A 3P08A 4RC3A 4C61A 2JDVA 4BY9E 5JMSA 3ZLYA 1KUTA 2VD5A 4YTFA 2OH4A 5A4LA 3DXNA 3VAPA 4FT5A 3QTIA 4H3BA 3FQSA 3TN8A 3TJCA 3TZ9A 3IQ7A 1P4FA 2OIBA 3EQGA 4QPAA 4NH1A 3EQRA 2JDTA 1QMZA 2XBAA 5HU9A 2WMWA 2Z7LA 4GFGA 4UN0C 5IMXA 2EWAA 4ACMA 1T45A 4EKKA 5DE2A 1XMMA 4UMQA 3KMMA 4CT2A 5HEZA 1FGIA 5FDPA 4FV4A 4AE9A 3GT8A 3PXQA 4RJ4A 2JIVA 5KZIA 3N4VA 2O64A 4MH7A 4DEIA 3OCTA 3PJ3A 3PZHA 2UUEA 2CLQA 3C9WA 3IECA 4RA4A 3ZO3A 5DI1A 2X4ZA 4C57A 5C4KA 4ACHA 3IW7A 2C0IA 1YXTA 5EDRA 2ERKA 3TZ7A 3MFSA 1U5QA 4JS8A 1H0WA 4HGSA 3RK9A 2AC3A 1FMOE 4TY1A 1Y57A 3PXKA 1W2CA 4ANNA 1U59A 3HL7A 5CX9A 4AX8A 4O7WA 4X3FB 4NKAA 3RPSA 1Q5KA 4UZDA 3Q96A 4PL4A 3QD0A 4FZAB 5K0XA 4S33A 4HVIA 1W0XC 3ZC6A 2ZV9A 4QP3A 3DB8A 4YTCA 5JQ8A 4CG9A 2ITOA 3R9NA 2PVFA 4TRLA 3VW8A 4A9SA 4O4EA 1YDSE 4YSMA 4E8AA 5M4UA 4O7ZA 4CSVA 2GNLA 5E91A 1JSVA 4DEEA 2XNBA 3CKWA 3CXWA 3PZEA 5E1SA 4OTWA 5HI2A 4OW8A 3D94A 1CSNA 3DTWA 1CM8A 3GCUA 3W0OA 3D2KA 2H8HA 4QYEA 3UNKA 5C27A 3Q04A 4MNEA 3OEZA 4I41A 4OTFA 4EH6A 3HAMA 1P2AA 1H8FA 4JX7A 4H3PA 2B55A 1Q8YA 4FVPA 4IACA 5KE0A 3FI2A 3QF9A 4N70A 3MB6A 2HXLA 4QPMA 2GS6A 3IONA 3ZFYA 3CQWA 4PMSA 4NWMA 1PJKA 4E73A 3ALNA 2YIRA 3QXPA 3FXZA 4A9YA 5BYLA 4YBJA 4PP9A 4ALUA 3LW0A 2H34A 3IW4A 2Z7QA 4IWQA 2UW4A 4QQCA 3N4TA 3QC4A 1WBWA 4JQEA 3DFCB 2WFYA 4NM5A 2ITQA 4FSWA 2QU5A 5IF1A 3A7IA 3E8EA 3PIZA 4LGGA 2WOTA 2NPQA 3R7YA 2X7GA 3W2QA 3UZTA 5M09A 3R7UA 3LAUA 1FGKA 2W1ZA 3QALE 4GL9A 3TZMA 3GCVA 4IX6A 4QYHA 3P23A 4CTCA 1OGYA 4LQMA 4WNPA 3QQFA 4FKPA 4XP0A 3T3VA 3Q52A 5IUIA 4K6ZA 2WZJA 3FZPA 3SRVB 2GQGA 4FKSA 5JZNA 4EH9A 4GS6A 4IDVA 4FA2A 4ITHA 3IGGA 4MKCA 4QMOA 5LWMA 3ZHPC 4AT4A 4CKJA 3SW7A 4WNMA 3P7BA 5HVKA 3MN3A 2WB8A 1CMKE 3UZPA 3HECA 2CHLA 2PE2A 1XJDA 4Q5HA 3R71A 4DC2A 1UU9A 4PY1A 1ST4A 4MXXA 1Q41A 2ZFYA 4NW5A 2H9VA 1WVXA 2BKZA 2WMXA 3C1XA 3MY0A 3N9XA 3ZSHA 4CNHA 5CSWA 4CLJA 1ZLTA 2WMAA 3FZRA 4GJ2A 3KRLA 3BYSA 3S1HA 3ZXZA 5B2MA 4NEUA 2PVRA 3D15A 4JI9A 1S9JA 3RWPA 2XKDA 2F9GA 2OW3A 4E5WA 5L2TA 3DNDA 3V51A 2VTHA 3KFAA 4UWBA 3MGYA 4R77A 2IVSA 4XUFA 2YERA 4AXFA 4XV3A 2IJMA 5I9YA 2BZHB 4QMUA 4YPSA 3TG1A 1PXLA 1UNLA 3O23A 4JBVA 4LUDA 4BGGA 2W1FA 3MH1A 5LVPA 2EXCX 3U55A 1EH4A 3V3VA 4Y8DA 1RE8A 1P14A 2VX1A 2PZPA 4EONA 5LMBA 4P4CA 4XH6A 4AXDA 3VUIA 1YWRA 4ANSA 4F7JA 2VN9A 3G9LX 2EUFB 3KRWA 2C6TA 2C5NA 4YZMA 2XJ0A 1R0PA 3UP2A 4F63A 5G6VA 3IOPA 4QRCA 4TZRA 2QVSE 4PPCA 3FLQA 3COHA 3VS2A 2UW5A 4JXFA 3UVQA 4RJ3A 4Q9ZA 5F9EA 2FYSA 3LE6A 4JDJA 4CVAA 4DFXE 1SNXA 4EOQA 3W2PA 2XALA 1BI7A 1ZY4A 1BLXA 3BWJA 3NW6A 3UC4A 4OAVB 5E8SA 1WBOA 2RFNA 3B8QA 3R8ZA 3ORIA 4QMWA 1WBTA 4WUNA 4AFEA 4Z7GA 5M53A 2IW6A 4C58A 5FXRA 4JNWA 3PLAE 2HZIA 5LVNA 4TT7A 4FNWA 3BL7A 5HBHA 2R3FA 3MVMA 5CZIA 4AWIA 5I3OA 4PUZA 2B53A 3CTQA 2F7XE 3GI3A 3WF6A 4IZYA 4EK6A 1J3HA 2LAVA 5LXMA 3DS6A 4FI1A 4AA4A 4Q9SA 1A48A 2ZOQA 3A7HA 4JAIA 1DM2A 3W18A 1OBGA 2HWOA 5HG5A 4BDIA 4O6EA 2DS1A 3DKGA 3DV3A 3D5XA 4DGMA 5HTBA 3L1SA 4EK8A 2VO0A 1H1WA 2C3IB 1M17A 2ITUA 4UWCA 2IN6A 4ANLA 4RWKA 2RG5A 3F7ZA 4G3DA 4M3QA 4CTBA 4IVAA 3A61A 4XRLA 3QD4A 4RWJA 4RVKA 4WKQA 3MY1A 4BDHA 4DEDA 2IVUA 2YHVA 3D4QA 4NU1A 5I3RA 2CMWA 5CU2A 3E87A 5HE0A 2UVZA 4YHTA 4BBMA 4FC0A 4MVFA 3LFFA 4TWNA 4W8DA 5CEOA 5GIOE 1VYWA 2YDJA 3EN4A 3H9FA 3KMWA 3LXKA 4RFMA 3WI6A 3B8RA 3MIYA 2GNGA 4DH1A 5I5ZA 4DG0E 4U81A 3L9PA 3EFWA 4AQKA 3UG1A 3RHKA 5FXQA 5CAVA 2XIYA 4P5QA 3BEGA 4BCIA 3BHYA 4LMUA 3VBVA 2IEWA 3NMUF 4UV0A 5F4NA 1STCE 2DWBA 2H6DA 2QD9A 3F5UA 3ZRLA 4BIBA 4BL1A 3LKMA 3QQUA 2JKQA 4BCOA 3VONA 2Y9QA 1W2DA 3IPHA 5D1JA 4DFZE 4QYGA 2UW9A 3G0FA 3L8XA 1ZAOA 2HY81 1V0BA 5ANIA 3W0QA 4E5BA 3AMBA 3EZVA 4AFJA 3OT8A 5AUVA 2B9IA 4I93A 3IDPA 1Q99A 2O8YA 3BYOA 4CEGA 5I4NA 3DB6A 4EJ7A 3LOKA 2R2PA 2QR7A 3OF0A 3SV0A 2OICA 5D9HA 4W4VA 1O6LA 3OROA 4ONAA 4BCPA 2JITA 2HW6A 5ICPA 3NVMB 5CI7A 4NCTA 3PSCA 1IASA 1WMKA 2AC5A 4PRJA 2F49A 2XK4A 3R9HA 5C8MA 3WE8A 4BHZA 4BI0A 2HZNA 4F9CA 4BTFA 4YC3A 5JN2A 4M97A 4JG6A 3W0NA 2QHNA 5CF8A 3GU8A 4WIHA 4MBLA 4DCAA 3UG2A 5AAGA 5AUTA 3ZU7A 2PUIA 4D4RA 4DBXA 2UV2A 2VRXA 2CKPA 4ZTNA 3CC6A 1UVRA 3KC3A 3Q4ZA 4YMJA 3TNHA 3QFVA 1OKYA 4FRFA 4LG4A 4YZCA 5FUTA 2QNJA 4R5YA 4W9XA 4V01A 3PG3A 3TNIA 2BAQA 2V62A 3T3UA 4OBOA 4G5JA 3DDQA 4EQCA 4PX6A 3DU8A 3D2IA 5H8EA 4FE2A 4MXOA 4V04A 4EOMA 3MY5A 3GCQA 4DA5A 4F64A 2R7BA 2Z7SA 5CTPA 3R1SA 4YZDA 4JX3A 2B9JA 4G3GA 3SHEA 3FLNC 4EYJA 2EB2A 4O2ZA 3NNVA 3VQHA 2OU7A 3FHRA 4IX5A 2WMBA 1E1VA 1UWHA 1ZMUA 4FTIA 2A0CX 5DNRA 4E4LA 1CKPA 2PUUA 4U3YA 3HKOA 3PWYA 5HO7A 2OIDA 4IM2A 3C13A 3FKOA 4XG8A 4OTIA 3FI3A 3QUDA 2RIOA 3H9RA 5ETIA 5AM6A 4B6LA 1L8TA 3ACJA 2YFXA 4FSQA 5CSXA 3BGPA 1YOJA 4E7WA 4I5HA 2IG7A 3D9VA 1OKZA 1XR1A 4QP7A 2UW6A 5K5XA 3U6JA 3MH3A 5EHOA 4ERKA 4GT3A 4LFIA 1Q8ZA 1ZZ2A 3IOKA 1Z57A 5M57A 5M4IA 4AAAA 1H01A 1T46A 4MTAA 4QMTA 4FKRA 3V5LA 3F3VA 4WA9A 3ZEWA 4DTBA 3I6WA 5HIEA 4L67A 4UZHA 2J6MA 3VBXA 4GG5A 1WFCA 4FUXA 4ZP5A 2GCDA 2DQ7X 1JKSA 4S30A 3WE4A 5F95A 5CF4A 3KF4A 4D2SA 4O2PA 2XJ1A 3A99A 3FMKA 1PW2A 1W82A 3HMMA 3QCYA 4FV3A 5FQDC 3TI1A 1ND4A 3R04A 4F70A 1TQMA 4XEYA 3UIUA 5BVKA 4D2TA 2XK9A 3AC3A 1GZKA 4DHIB 5F1ZA 4JDHA 3ZO4A 2VZ6A 3COIA 3GP0A 3R9DA 4BBEA 5E8VA 3QD3A 3QWKA 4OT5A 3IKAA 1FPUA 3CP9A 4AZEA 4KA3A 3ID6C 3BI6A 5HVJA 2JC6A 2X1NA 2W1CA 3PA3A 4PPAA 3HV5A 3LM0A 3EQBA 5JGAA 3LM5A 4FV6A 5HE3A 3AKKA 4IANA 5JT2A 4DH5A 2QKRA 3QQJA 2BFXA 4HVDA 5K4IA 4HVSA 5IA1A 1DAWA 4GJ3A 4K1BA 4D5HA 3CBLA 4WUAA 3DBCA 3AKLA 1YKRA 2UZLA 5FTQA 2JIUA 2RGPA 3BX5A 3KXNA 3LFQA 2XANA 2HY0A 2X7FA 4BDEA 4UXQA 4S2ZA 5CAPA 2XEYA 3QQLA 1SNUA 2E2BA 1KE5A 5CS6A 5EKOA 5L2QA 3RCDA 4NYEA 3BLQA 3OCSA 5KMJA 2CCIA 4J98A 2ZYBA 1Y8GA 3WF5A 2JKMA 3FI4A 3E92A 4L3LA 5ETFA 5HOAA 3EN9A 5IDNA 4IAIA 4AA5A 3G90X 4XP3A 3U87A 4HGLA 3EH9A 3QAME 4YBKA 2YABA 1KV2A 4HNIA 3DAKA 3GC0A 4TYEA 4XCUA 2ZV2A 4FJVA 3TKHA 1DI9A 5CQUA 5CEPA 3FL4A 4UBAA 2WMRA 4ZJJA 4OR5A 2JKKA 2WMUA 4QQTA 3NSZA 4X3FA 4FSMA 2CN5A 3BKBA 3S95A 4U6RA 5HCXA 3UIXA 4AGDA 3COMA 3GU4A 3QU0A 3AD6A 3IO7A 5CU3A 4KIQA 2C47A 4FYOA 4FIIA 4BWPA 3EKKA 2OWBA 1H1RA 3D83A 2X39A 3NR9A 4QMYA 4ANOA 5IA3A 1GIIA 3VS6A 3TZ8A 4BGHA 4YJOA 4MBIA 5HCZA 3SXRA 3TT0A 1YXVA 3Q53A 4RQKA 4RT7A 2JFMA 4ZJVA 3KY2A 3SKCA 5L2WA 2R3KA 2YLFA 5J87A 2QHMA 4O4FA 2BALA 3UDTA 4G3EA 3PXRA 5HO8A 2JAMA 3LPBA 2F7EE 3V5QA 5DIAA 4DHFA 3DKFA 4QTEA 1H4LA 3UOJA 3MPAA 4TYHA 4ACCA 2ETMA 4XG6A 1ZOEA 4D4YA 3G15A 3HAVA 2FGIA 3NGAA 4BCJA 2VWWA 1OMWA 2YDKA 2XNPA 4ZAUA 1H25A 3CGFA 1U54B 4X2NA 3TMOA 1XKKA 4NM7A 4FGRA 3QXOA 4FNXA 3VIDA 2IW8A 3G0EA 2YITA 1DS5A 4RZVA 4ZSAA 4LM5A 1AGWA 5IKWA 5K3YA 2W9FB 2JIIA 4R7HA 4M12A 1OL1A 4YC6A 3UIMA 4FZDB 2HYYA 3GC7A 1M7NA 5B0XA 2DUVA 5JGBA 1HCKA 3GVUA 2X0GA 2Y7JA 4RVMA 2YM6A 3FYKX 3D5WA 4V0GB 4IC7A 3UDSA 2VWUA 4ZLZA 5F94A