2X2LA

Crystal structure of phosphorylated ret tyrosine kinase domain with inhibitor
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
311
structure length
287
Chain Sequence
b'GPLSLSVDAFKILPKWEFPRKNLVLGKTLGEGEFGKVVKATAFHLKGRAGYTTVAVKMLKENASPSELRDLLSEFNVLKQVNHPHVIKLYGACSQDGPLLLIVEYAKYGSLRGFLRESRKVRALTMGDLISFAWQISQGMQYLAEMKLVHRDLAARNILVAEGRKMKISDFGLSRDVYEEDSVKRSQGRIPVKWMAIESLFDHIYTTQSDVWSFGVLLWEIVTLGGNPYPGIPPERLFNLLKTGHRMERPDNCSEEMYRLMLQCWKQEPDKRPVFADISKDLEKMMV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PROTO-ONCOGENE TYROSINE-PROTEIN KINASE RECEPTOR RET
publication title Synthesis, structure-activity relationship and crystallographic studies of 3-substituted indolin-2-one RET inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 89
structure length 287
sequence length 311
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2010-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2x2lA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2x2lA01
4KIKB 4W8DA 3OFMA 1H28A 3VBXA 1FMKA 3O7LB 5AUZA 2B9FA 1NW1A 3RZBA 1R78A 4IWPA 4AT4A 2WIPA 3LCSA 2OW3A 4G6NA 4MCVA 3NW7A 4LMUA 4KIKA 2P33A 4IANA 5AX9A 4KNBA 4NM3A 4D9UA 3OXTA 2ZVAA 3QD4A 4AW0A 2HXLA 3FMMA 3LFEA 5CALA 4XP3A 3OVVA 4H3PA 4FV2A 3UDBA 2ETKA 3LIJA 4DTBA 2X7GA 4L52A 5IG1A 1LUFA 2C6OA 3FZPA 4CG8A 3LFSA 3QL8A 2HW7A 4V01A 4IBMA 4V04A 4YLKA 4ZXTA 4BDIA 4NT4A 4CVAA 4LM5A 3NVKI 3POZA 2W0JA 2CKPA 4WIHA 5CY3A 4OTPA 3NVMB 5HG8A 4WSYA 1OKYA 2HZIA 3CXWA 4H3BA 1NXKA 1WBNA 5FEEA 2J0MB 1J1CA 1U54A 4RWKA 5L6WL 1G8AA 3SG8A 4NH1A 2PVLA 3G2FA 4J7BA 4RWIA 5FTOA 5CEMA 2X6DA 1XH6A 2H8HA 2XJ2A 3IW8A 4AA4A 5DIAA 3SW4A 1TQIA 4EYJA 4CKIA 3DA6A 5C8MA 3SOAA 2ZJWA 1Y6AA 1YWRA 4QMZA 1CMKE 4YZCA 3DZOA 2XS0A 3I0QA 3HV4A 3OTUA 1ZAOA 3AT3A 5K5XA 2C5NA 2XIKA 5DRDA 2C6KA 4I4EA 4O96A 4OBPA 4CKRA 3LXKA 3LFCA 2E9NA 2JKMA 2W7XA 2EU9A 3C4CA 3SC1A 4DEDA 4FKGA 3R1SA 4IVDA 4AT3A 4OLIA 4LGHA 5DVRA 5C4LA 4U45A 3PXKA 3NNWA 4IAZA 4FSRA 4OBOA 4P4CA 2C5XA 3V6SA 3BBTB 5TR6A 4K6ZA 3OCSA 4Z7GA 3UIMA 2SRCA 2X9EA 4M15A 1ZYDA 4C61A 1Q97A 3IS5A 5M07A 5AR7A 1OM1A 4L6QA 3EN4A 1DAWA 3KXMA 3OG7A 4MQ2A 2UW9A 5ANDA 4E6AA 3DDPA 3EFWA 3ORKA 4GT3A 5BYLA 3FMDA 5DYJA 1H1RA 3MWUA 4PY1A 5ANEA 4C4JA 2OIBA 2GTMA 1QMZA 4OTHA 3WF8A 2I40A 4C58A 4QNAA 5AFVA 3UP2A 1BLXA 2NP8A 3D5VA 5AP3A 1OKZA 3COKA 3DDQA 3PPZA 3GOPA 3PUPA 5IDPA 3ZLXA 3RJCA 3ZC5A 1WCCA 4BDGA 4C3FA 1PKDA 3EKKA 3OW3A 4BTJA 4M97A 3TG1A 4PTCA 5FQDC 4O83A 4K18A 4FKVA 5DT0A 4R3CA 5H8BA 3DCVA 3MPMA 4HYSA 5LVMA 5KKRC 2BROA 4I6FA 5LJJA 2ZV2A 1SNXA 4BTKA 4JAIA 4JDHA 4BGHA 2F49A 1APME 1ZMWA 3BU3A 3EHAA 4LL5A 3FPQA 3TNIA 3PDTA 5FWKK 3R8UA 3V3VA 4II5A 1OGUA 3TUBA 3RAIA 2G01A 2VTPA 1RW8A 2RKUA 4IH8A 4ZSAA 5DPVA 3GU4A 4FE2A 4FIFA 3O50A 5FUTA 3NAYA 3ZOSA 3R8MA 5IQCA 3L1SA 1YXXA 2WQEA 3UGCA 4DGOA 4QMYA 4F7JA 4BF2A 2GMXA 4XS2A 3OCBA 5EYKA 4A4LA 3UNZA 3PFQA 4EYMA 4U79A 5M4FA 2VWVA 2W9ZB 4E1ZA 3TM0A 2UVYA 3IO7A 2EWAA 4FTUA 5I9ZA 5F4NA 3R7UA 4PPCA 4X7QA 4YJUA 2C3JA 4GKIA 1M2RA 1VZOA 5HBEA 2F4JA 4IC7A 3CPCA 3R8LA 2X8IA 1ZY5A 2R3NA 4M8TA 2ZM3A 5TOZA 3SXSA 4OTDA 4DH5A 1W0XC 4N0SA 5HE2A 4GK2A 2XF0A 1MP8A 5KMJA 5DGZA 2YISA 4PDYA 4OUCA 5JGDA 4RIYB 4IVBA 4C3RA 2YLEA 4NFNA 4BRXA 2ITWA 4I5CA 4CEGA 3PJCA 5GZAA 1PRYA 2CGWA 4ASEA 3WZEA 1G5SA 2FA2A 1YWNA 4ZY5A 2BMCA 5CAOA 3TJCA 2OF4A 3IDCA 3OZ6A 4ZSEA 3BV2A 1XJDA 3PJ8A 2VTAA 3MH3A 3NMUF 3IW7A 3MY0A 4U43A 4EOKA 2VWXA 2WTKB 4BWPA 5IF1A 5BVOA 4EH7A 5LMKA 1H8FA 4PF4A 3ORXA 3BWFA 4MKCA 2WTJA 2OIDA 3GU7A 3O0GA 4EOJA 5AP0A 3KB7A 2OK1A 2X8EA 3G5DA 2B55A 5IMXA 5HESA 3MH2A 4YLJA 4UWCA 2UUEA 4CZTA 4EUTA 1YDTE 4NM5A 2JGZA 2QOQA 3EQIA 4GU9A 1YWVA 2BDFA 5ANJA 2XUUA 3PVBA 5AUYA 4B0GA 4CRLA 4EOQA 4XLVA 3ZSHA 5ETAA 4XP2A 4JBQA 1O6YA 3FLSA 3N9XA 4PDSA 4L8MA 3ITZA 5AMNA 5HE3A 4X2GA 5AJQA 3PSBA 4L44A 3BHHA 2QNJA 3SAYA 4M7IA 3FI2A 1YOMA 4XOYA 4MD8E 1M2QA 4FOBA 1AD5A 2UVXA 4P5QA 2XNPA 5IA5A 3VULA 1Y8GA 4HPTE 4J53A 3ZSIA 4DGNA 4E26A 4AF3A 4DFYA 3UIXA 2OICA 5AM6A 4GG7A 1V1KA 3S2PA 5JGAA 2PMOX 3QYZA 3WOWA 4ZEGA 3FHRA 4L68A 5CU3A 3ZM9A 2WMBA 3ORTA 5AR4A 4ZSJA 4W4VA 3Q5ZA 1AGWA 3CS9A 4KSPA 3E7VA 4E5BA 5BUJA 4B7TA 2LAVA 3TZ8A 2WEIA 3Q32A 3OC1A 4KKHA 5C01A 4EEVA 4ZY4A 5EH0A 5JRSA 4DT8A 4ZTMA 3FLNC 4AW2A 4F7NA 3CY3A 1IA8A 2GPHA 4FKJA 4BKZA 3F5GA 1Q8TA 4QRCA 4EH2A 3G15A 3PXYA 4QQJA 4YJNA 2BRMA 5HEZA 4E5WA 4FF8A 2FSMX 4NIFB 4PDPA 2JBPA 1PMEA 3ZHPC 4D2VA 4DFXE 5IUGA 2CNQA 5EG3A 3KC3A 3P4KA 3QTZA 4WT6A 3IKAA 4XG7A 3AT4A 2CN5A 3UZRA 3R9RA 3LPBA 5HBHA 4YGAA 4O7VA 3NYOA 3GCVA 2XIZA 3C9WA 3TKUA 2VX1A 2JD5A 1Q41A 4ALVA 5L6PA 1G8SA 3UPXA 4JG8A 3UO6A 3R1QA 3MVHA 1Q4LA 3F88A 2OI4X 4WOVA 3TV4A 5EQEA 2PVFA 4TRLA 3GCQA 4FOCA 2J2IB 2OXXA 3SXFA 3NX8A 5B0XA 3PSDA 4RRVA 1PHKA 5FDPA 1R3CA 5GIOE 3I7BA 3DU8A 5IEXA 3FI8A 3DY7A 3UMWA 3GQIA 5FP6A 5E7RA 2C3KA 3RAWA 1L8TA 4BCMA 5D41A 5EHYA 3RPSA 4R8QA 3RNYA 2W99B 3VBVA 4RBLA 3ZC6A 5JEBA 3MDYA 3ZZWA 4G16A 4K2RA 4C34A 4D4YA 4F0FA 3GB2A 3OROA 3MYGA 4QMVA 2R3LA 3KL8A 4YBKA 2IW9A 3ZO2A 1HCLA 1OB3A 4D2RA 4DFUA 1NVRA 2PMNX 4JBVA 2EB2A 4UN0C 5HX6A 5I9WA 2B0QA 2JC6A 4FZ7A 3HEGA 3AC4A 3UNJA 2NNWB 3R1NA 4TWNA 3HMNA 2CJMA 4G34A 4FT0A 4IM2A 3ZRMA 2X2KA 4BKYA 5AA9A 3O2MA 5AAFA 3ZSGA 3U55A 4FTLA 3V6RA 4CG9A 4NEUA 4FNWA 4U41A 2UW7A 4EBWA 3P7CA 3QYWA 4YTFA 4RJ8A 3F6XA 2Q83A 2FGIA 3F5UA 5ACBC 3NW5A 4IX6A 4GK4A 3C4ZA 4JX7A 5DI1A 4MEDA 4JR3A 4X2JA 3FSKA 5E8ZA 1H1QA 3DJ5A 3CQUA 4E4NA 5IQBA 2H6DA 1Q62A 4D2TA 5D1JA 4GVJA 2OWBA 4IZYA 4AGWA 3EB0A 3G90X 2B4SB 2R3RA 2RIOA 4LQMA 1DM2A 4MD9E 4JBPA 4PPBA 3UPZA 3KRLA 4J98A 3C13A 3I6UA 2R3MA 3SGCA 2RFDA 4RVLA 5EM6A 2XYUA 3AD4A 5JFVA 1JNKA 3DOGA 3EJ1A 3F3TA 2GS2A 3DV3A 4K8AA 3F3VA 3TV6A 4A9RA 4UYNA 4IM0A 4S33A 3NYNA 4TW9A 1FGIA 3ACJA 2CKQA 4O84A 4KIOA 1Q8ZA 4G1WA 4H1JA 4FG7A 3N4UA 4I6HA 4AE6A 2WMRA 1O6KA 4C7TA 4E6CA 2R4BA 3CLYA 3VHKA 4HCUA 4WKQA 5H2UA 2GQSA 1OKVA 3QU0A 1CDKA 3QCYA 4FSMA 3EQDA 2C6DA 3CY2A 2XKEA 4BCQA 1I44A 5BVDA 2OLCA 1DAYA 5AR8A 2YM3A 2W1IA 2BTRA 2X39A 3EKNA 3H30A 2A19B 2PMLX 2CN8A 3I60A 3OWLA 5L2TA 3FY2A 3TT0A 2HY0A 4LOQA 4QMUA 4Q9ZA 3UNKA 4RFMA 5KZ0A 3KGAA 1Q3DA 4H1MA 4AZWA 2BKKA 5I0BA 1KV2A 2R3PA 5DEYA 2XZSA 2YIXA 3EN5A 4LOPA 4TNDA 2CGVA 2WMQA 2VGOA 3WI6A 4CFMA 5IH5A 3NZ0A 5A4EA 4MNEB 4Z3VA 3N51A 3IPHA 4AQCA 1OL5A 5HU3A 4NYEA 3ZUTA 5HG5A 5K0XA 4ZMEA 3GC9A 3P79A 3MPTA 3H4JA 1EH4A 2BVAA 3ZS5A 4YR8A 5AV4A 4PTEA 4FTCA 1URCA 3FQEA 3MVLA 4RGJA 4FODA 1E1VA 3RI1A 5B2KA 3G9LX 2WMAA 4FZFB 2VUWA 3OOMA 4C4EA 2W4KA 3EQGA 4AXAA 3HRBA 4N6YA 5DFPA 3F5PA 3C0GA 1Q8WA 4BIBA 2C5OA 2VNYA 3LE6A 3FC1X 3WE4A 3TXOA 5ANGA 5CU4A 4HPUE 2R0IA 1Q61A 4QNYA 4R7HA 5CEKA 3R7OA 2JEDA 3ZZEA 4DG3E 2WMTA 3EQRA 4ZZOA 1A9UA 2XEZA 3IOKA 4TY1A 5KMMA 5BYZA 5JQ8A 3BHVA 5KHXA 4I5MA 4N70A 4AZFA 5J1WA 4NTSA 2IG7A 2PSQA 1PY5A 1ERKA 2J0KA 4PQNA 5IQEA 1UU8A 4NSTA 3NWWA 2B9JA 2PVMA 4AACA 2JAMA 3VUDA 4QTEA 3C0HA 3KN5A 5FXSA 3RHKA 3A7HA 4YJTA 3KEXA 4B8MA 4UMUA 3PRIA 2JDSA 2WEVA 3QC9A 3HA8A 4DH7A 4E73A 4NFMA 3UJGA 2JBOA 3D7ZA 5JFXA 2HK5A 3CP9A 1P14A 2WAJA 3PA4A 3AMAA 4IEBA 2PVJA 3SRVB 3AMYA 3MN3A 3C4FA 4ANMA 4BWXA 4DGGA 3LJ0A 4IZ5A 4EOIA 4RQKA 1OL7A 4C8BA 3UIBA 4A9SA 2UV2A 3DAKA 5IA1A 4BZNA 2PMIA 1FGKA 2J50A 3SRVA 3QRIA 3C4XA 3P7BA 4BDAA 4O7SA 3NCGA 3SOCA 4BR3A 5JZNA 4YLLA 2YM8A 5D10A 5E8UA 4Y5QA 2J0IA 3HMMA 1JKKA 2I7QA 4U81A 3WARA 3MY1A 1XR1A 3R22A 2Y4IC 1YDRE 2FUMA 4Y73A 3WF6A 3C5IA 1KV1A 4QPSA 3VJOA 3R8PA 5T68A 4MYGA 4ZIMA 2ITYA 1WAKA 1Z9XA 2RGPA 2XIYA 3QLGA 3CQWA 3CTHA 4MHAA 3HDMA 4HGTA 4O91A 4WBOA 3M2WA 5AUTA 3LQ3A 3VUTA 2B1PA 4IHPA 3WZUA 4L01A 2VWZA 3NYVA 2Z7RA 4K33A 5CI6A 4FV5A 3VS5A 2AUHA 3OS3A 5HG7A 3BHUA 5LMBA 3FLYA 4GK3A 5G1XA 4BGQA 2BR1A 4G31A 4IWOA 3I81A 4XV9A 3AGLA 5EOLA 4JLCA 5CNNA 3NLBA 5EW8A 4USDA 2WMVA 5C26A 5KNJA 5TO8A 3ZRKA 4O81A 3BLRA 3CJGA 3Q9WA 4BDFA 5IQDA 2XKCA 3MJ1A 3W18A 3GC7A 2XRUA 3NGAA 4RJ7A 3K3JA 4DEAA 3OP5A 4LRMA 4IAAA 4UMTA 2GQRA 4DTAA 2WTDA 4GCJA 3BLHA 3CCNA 3EQBA 2J7TA 3D2IA 4YO4A 4M13A 4OAUC 5HD4A 4BDBA 3DXQA 1VJYA 3OW4A 5HE0A 2F57A 2XIRA 4F7SA 4RVMA 3HV7A 4BBEA 3MIAA 4XG3A 5I3RA 4RIOA 3FE3A 2OXYA 4USFA 2J5EA 3FHIA 5K9IA 3EN7A 2HELA 3S95A 3GGFA 3QUEA 3FMEA 4ANSA 4RX5A 5IA0A 3GVUA 2W1FA 3ACKA 3MVJA 5CEQA 4BFMA 3FZ1A 4EQUA 2RG5A 4YZDA 1U5RA 1ZXEA 3MB7A 4C33A 2YM6A 3DKFA 2CGUA 2JDTA 1W83A 2ESMA 2FSLX 3EN6A 4JRVA 4FTJA 4PDOA 4YHFA 3V8SA 4O82A 3LCDA 4DITA 4R1YA 3PYYA 3E92A 5J7BA 2PUUA 5D7VA 1BX6A 1XKKA 3DKGA 4M69B 3V5TA 3T9TA 4NCTC 2R3IA 2R3FA 5K4JA 5CXZA 1DS5A 2X2MA 5J79A 1STCE 4FZAB 3Q52A 4Z16A 4QYHA 4UZDA 3V51A 2OF2A 1J3HA 2QO2A 4UMQA 4XG8A 5BMSA 2VWWA 4EI4A 3BYUA 3VWAA 5AP6A 3OXIA 1VEBA 1S9IA 4HVHA 4TWCA 4W9XA 2H9VA 3KRXA 4PL5A 3UOLA 4FKIA 3QKLA 2P4IA 4CT2A 5IMEA 3UOHA 1J7UA 2ERKA 3VW6A 4B8LA 4CFVA 3KCKA 5ICPA 4IB5A 3RAKA 4RFYA 3DB8A 2WKMA 4RMZA 2X81A 3DZQA 4S31A 4XLIA 1H26A 2Z7SA 1W98A 3DBFA 4C4GA 4KIQA 2BUJA 2GFSA 3PE2A 3Q4CA 4U0IA 4DH3A 3PLSA 5EFQA 2Y7JA 4TYHA 3A4OX 5EKNA 1R39A 2XJ1A 1SVGA 2DQ7X 4XMOA 4YZNA 4A07A 4ZLOA 1RDQE 4O7YA 2EUFB 3HZTA 3OOGA 3O71A 4FKRA 4KA3A 4XX9A 3E5AA 2I6LA 3GFWA 3MIYA 3R28A 2C6EA 4Y72A 3VIDA 5L2IA 5CQWA 2V5QA 5TE0A 4FV9A 5CVFA 4XG4A 1PJKA 5AWMA 4CYJA 3UQCA 3DB6A 3SV0A 3LQ5A 2QU5A 4F1MA 1XH5A 4FSTA 4RA4A 5EYDA 1ZMUA 1NA7A 3QRKA 4TKSA 4YC3A 3SX9A 3ZUVA 5IDNA 1A06A 2V62A 5GINE 3HUBA 4QMPA 4TNBA 1U59A 3Q3BA 3NS9A 3BYSA 4PPAA 4L7SA 4B99A 4BYJA 4AU8A 4IDTA 2ITZA 4E3CA 2ZMCA 3U6JA 3GT8A 3CJFA 4BHZA 3D5XA 1GOLA 3V5PA 2WNTA 4B9DA 3MSSA 1M2PA 3UE4A 5IH4A 1LEZA 4C4FA 5E8SA 2VRXA 4KBKA 5AAGA 2CCIA 2BHHA 3QRUA 5BVWA 3FQSA 3NNVA 5JH6A 2CKEA 3CKWA 4ZTQA 4I6QA 3SHEA 1UA2A 2ZM1A 3Q04A 2BDJA 4MNFA 2XH5A 4G6LA 4BCPA 4TWOA 2R7BA 3I79A 3R7IA 4HGEA 1XO2B 2V55A 4IJPA 2VTSA 2O5KA 2VTHA 3AC5A 3TUCA 2XA4A 1REKA 3OEFX 3UTOA 1UNGA 3D0EA 2J51A 4P2KA 4UALA 5HCZA 5DR9A 2FO0A 4KINA 2XNEA 4U9AA 3Q4UA 4BDCA 3QKMA 3TZMA 1PXOA 3VUGA 4W4WA 5IEVA 1JQHA 4HGLA 4HVDA 1GIIA 1YW2A 4C59A 2R0UA 2NRYA 5CSXA 1DI8A 4EH9A 3F61A 4RVKA 1JBPE 2ONLC 2W5BA 2Y8OA 3TZ9A 3RVGA 1M17A 4QP7A 4J95A 4U5JA 4DHFA 5IA3A 5E8TA 4E6DA 2GNJA 4JXFA 4RX8A 5A9UA 2PTKA 3ET7A 4D2WA 4LRKA 5HO6A 1PF8A 2VAGA 4TWPA 2DYLA 5I3OA 3IECA 4MQ1A 4PX6A 4YO6A 4QP3A 3TACA 3GU5A 4DGMA 3QQFA 1OECA 1YQJA 2GCDA 5K4IA 3Q96A 4EHVA 3QRTA 3VS0A 4CFXA 3JUHA 4ZLYA 3D9VA 4EH5A 2REIA 3NUNA 4LV8A 5AV3A 2XNOA 4OW8A 4S32A 4EH6A 3LCTA 1YHVA 3LFFA 1JKLA 4FGBA 4ZOGA 4RC2A 5A4QA 2OXDA 1U46A 4AX8A 3ZFXA 3R6XA 4ZAUA 3O96A 5FM3A 3BU5A 3CPBA 4FV6A 3DBDA 5HORA 5JFSA 4ZMFA 3C1XA 5HCYA 4BDDA 4D4SA 2C30A 2BFXA 2CPKE 3HV3A 4YZMA 5B2LA 1OVEA 1U54B 2ETMA 4B4LA 4C02A 4CNHA 2GS6A 2YM7A 3V5JA 2YM5A 4O27B 3RAHA 2ERZE 2KTYA 4EQMA 5CF4A 2E2BA 3BLQA 2AYPA 4PWNA 4G3EA 3G0EA 4NK9A 2VTJA 3G33A 3O8TA 4QP2A 4OT5A 3EMGA 5CSWA 1L3RE 2VTRA 2YM4A 3Q5IA 4FKTA 3KRWA 1WBSA 3BCEA 4LGDA 4V05A 2GTNA 3PXZA 3FL4A 3LKMA 3HVCA 3HKOA 3Q53A 4FIIA 1K2PA 2WGJA 1IASA 2ITXA 2XNGA 5CNOA 2C69A 2WTKC 2Z7QA 3HRFA 3OT3A 4G6OA 4ALUA 2X0GA 3TIYA 4YHTA 1MRUA 1OL1A 3DNDA 4TYGA 4XH6A 3RKBA 4DFBA 1JOWB 3A7GA 3C0IA 3WIKA 2OJFE 4IVAA 3FMNA 1ZARA 4N6ZA 4FYOA 1SVEA 4ZTLA 2CCHA 4RZVA 4WNPA 5DN3A 1O6LA 1R0PA 2PVNA 4TPTA 3TV7A 4YU2A 3HYHA 3PPJA 2W1DA 4O38A 3DK7A 3E8CA 4XCUA 2F9GA 3HX4A 3QUDA 4X6QC 3OMVA 5EQPA 1YI6A 4FZDB 3DNEA 5DT4A 2VWBA 4LFIA 3DXNA 3HRCA 1PW2A 4FG9A 4TT7A 5DNRA 1LEWA 2WXVA 3KK9A 4JIKA 2OO8X 3ORNA 4U8ZA 4GEOA 1E1XA 3V8TA 5BYYA 2C0OA 2QC6A 1RJBA 1O9UA 2UZUE 2QKRA 4A7CA 3FLQA 4F9CA 5TF9A 2WTWA 4FKOA 2ZB0A 5FTGA 2WU7A 3P86A 5L8JA 4BTFA 3PRFA 3DJ6A 1B6CB 3FJQE 3E88A 2LGCA 1KE5A 1OIYA 2VGPA 4FSZA 4NW5A 3PXQA 4AZVA 3BGPA 4OTWA 5GJDA 3KF4A 1CSNA 4J71A 5BVEA 2HZNA 5IQFA 3VJNA 4I0RA 5J1VA 3R21A 4BCIA 2XYNA 2RG6A 1XH9A 4GS6A 3E93A 1ZOGA 1GY3A 1OIRA 2A1AB 4RJ4A 5KMLA 5CU2A 5J95A 3LFDA 4LI5A 4WNMA 3R9DA 2WELA 1KOAA 1GAGA 1GNGA 4WUNA 5HIBA 4ZJVA 2WB8A 3KVXA 2QCSA 4BDEA 3LMHA 5JZJA 1T46A 4C36A 4AGDA 3WZKA 2W1GA 3MTFA 1ZOHA 4KD1A 3TNHA 4CFUA 2ITQA 3KFAA 5L6OA 2PZYA 3CTJA 3D2KA 2W06A 3ORZA 4G17A 4YP8A 3Q9ZA 4EKLA 1JWHA 4QTBA 2C5VA 4IX3A 5DE2A 4RT7A 3U6HA 2OGVA 3W8QA 2H34A 2ZM4A 1MQBA 4FKQA 4I94A 3FY0A 5HG9A 5DMZA 5DEWA 4HNIA 3IW6A 1M7QA 3JXWA 3LLTA 5AP7A 4DFLA 3UODA 3LQ8A 4HYUA 4FA2A 1JPAA 3PP1A 3EZVA 3TI1A 2ONLA 4FSNA 5GNKA 3DKCA 3NUAA 2UZEA 3ENHA 3P78A 2EB3A 4C62A 4DEEA 3EL7A 1ZRZA 2QOKA 3A8WA 3NUSA 3ZCLA 1VYWA 5GIPE 5BVNA 4JI9A 2WFYA 3IG7A 3VUMA 2IVUA 2QLUA 4JL9A 3F69A 3U87A 4H58A 4QP8A 4FEQA 3QC4A 4QQCA 1UNLA 2F7EE 3Q60A 3VHEA 4L43A 1OPLA 5HCXA 2VN9A 3W2OA 4NZWB 1S9JA 4UBAA 3ATTA 3EQFA 4PTGA 3S4QA 5HX8A 4JDIA 5A4TA 4AE9A 4EHZA 3ZDIA 2E9VA 4I5HA 4EK4A 4LUEA 5A4CA 3M11A 3P1AA 3HP2A 4YNEA 3WZJA 3NRMA 3VN9A 3F2AA 2RSVA 4Z9LA 3PG1A 3ALNA 2Z7LA 1YDSE 3KMUA 3DQXA 4FSYA 5EDQA 4ANBA 4MWIA 2W4OA 1SVHA 4APCA 5CS6A 3QD2B 3R2YA 2YIRA 5D12A 5TT7A 2FH9A 2PVKA 5BPYA 2C6LA 5AR5A 2OZAA 1MUOA 1PMNA 2RFEA 3RPOA 4GKHA 2YWVA 4FUXA 3REPA 4IQ6A 5B2MA 5KO1A 3LFAA 2W96B 2PUIA 1Q5KA 5KMOA 4EK8A 3FI3A 2QOIA 1UWJA 3BX5A 4ZTHA 5FTQA 2VWYA 5E90A 3MI9A 3ID6C 5FLFA 1YXVA 5EM7A 2O63A 3Q2JA 5M08A 4AOIA 5JMSA 3GCSA 4L3JA 3NCZA 4AN2A 3R7YA 2PZIA 2PWLA 2BZIB 3H9RA 2QO9A 4HYHA 3JS2A 5HIDA 3U9CA 3ZM4A 1IAJA 4WG3A 4X0MA 4BICA 4FVPA 4QOXA 2WMXA 2XJ0A 3FMHA 4U42A 2WO6A 3VRYA 2XK9A 3GNIB 3GXLA 2EXMA 4BI2A 4DINA 2Z60A 5HTCA 2BCJA 2VTIA 3II5A 4ASXA 5EDPA 5IH6A 4Q5EA 3QAME 5DH3A 2JDVA 3A99A 4DBNA 3G6GA 4MXZA 3HECA 4N57A 2BFYA 4AUAA 4J52A 4WO5A 2RFNA 3VBYA 3C51A 2GFCA 4KB8A 1V0OA 2JIIA 3AC8A 3QGYA 4FTRA 4OTRA 1V0PA 1CTPE 4PNIA 4XG6A 3ROYA 2UW6A 5CF8A 5CYIA 4PMPA 1YI3A 1OIQA 3WF5A 2ZYBA 5C8KA 4X2FA 4NJDA 5JSMA 4ACMA 4BYIA 4CRSA 4O6LA 2QODA 5K3YA 3TJDA 4UYAA 4HYIA 3BE2A 1WZYA 2WU6A 3ZLWA 5KKRB 2G9XA 1GZNA 1A48A 2YEXA 2VWIA 4ZSGA 3AGMA 4RIXB 5A6NA 4FL2A 2UZWE 3S0OA 4FKLA 5AR3A 3D83A 1FOTA 2XK6A 3OCGA 1UKIA 5LVPA 2XKDA 4IX5A 4CTCA 1OI9A 3G9NA 4RIXA 5AP5A 3U51A 3ZEWA 4BVUA 2RF9A 1Q99A 5IZFA 1XBBA 4DA5A 4GUBA 4AZTA 4OTFA 3IK3A 1Z57A 2HWPA 3HLLA 3NUPA 3ZTXA 4CKJA 2GNLA 4CCUA 4W9WA 1J7LA 4KBAA 4EQCA 5L2WA 2E9PA 4ZS0A 5D11A 3FZRA 2PK9A 1IR3A 2UZOA 1XBCA 2QHNA 5IQHA 2QU6A 2B9HA 4O86A 2P55A 3AC2A 3POOA 3SD0A 4EOPA 4RIWA 4CZUA 4MD7E 3QRJA 4YJOA 2C0TA 4ANLA 4ASDA 1ZMVA 4BCOA 1P2AA 4Y83A 2YLFA 4QMOA 4WSQA 4BWKA 4F70A 5HNIX 1ZY4A 3BQRA 5BNJA 1CKIA 4CMUA 3EYHA 3L9LA 3HNGA 5J8IA 2JLDA 3QD3A 3CR0A 4D9TA 4F1TA 5JK3A 1ZWSA 3SW7A 2CMWA 4UY9A 4FNXA 3QX4A 4O2ZA 3FLWA 2C1BA 2PULA 4IAKA 5DBXA 3EFLA 4GH2A 1J91A 3QFVA 1UNHA 2UVZA 3F5XA 2VWUA 4R7IA 4JG6A 1BI8A 3RK7A 3HAVA 4R78A 1M52A 4IB0A 2WTIA 3DQWA 5CX9A 3QTWA 3DT1A 3FZSA 2R3HA 3VBQA 3B2TA 4FV7A 3UO5A 3QQLA 5AP4A 2X8DA 3KXHA 2NRUA 3JPVA 3D5WA 1I09A 4LMNA 5BMMA 2E9OA 2OJJA 3THBA 3AMBA 3RK5A 4C2VA 3AXWA 3RWPA 3ZEPA 3RHXA 1FVTA 5HU9A 3FMJA 2G2FA 3AD5A 3LMIA 2YFXA 1J1BA 2I0YA 3MBLA 2JIVA 2UZNA 5ANKA 2XB7A 4DEHA 3FEGA 3GOKA 3LHJA 2QR8A 3DXPA 1KE8A 3MVMA 4DAWA 4IMYA 3K5VA 4D1ZA 3ETAA 4IAYA 4I21A 5M51A 5BUIA 5CVHA 1SM2A 3IDPA 1H24A 3OF0A 1NT2A 2BIKB 4MK0A 3FSFA 4L9IA 5KCVA 3V01A 4FEVA 4RWJA 4DH8A 5CENA 2X9FA 5EK7A 3V8WA 3ZDUA 3QZHA 2F7XE 4CZYB 5HHWA 2B53A 5H8EA 2C1AA 4KS7A 4ANNA 2R3OA 4XJ0A 3RGFA 3HUCA 4D5KA 2X7OA 3UIUA 5EDRA 4MF0A 2QOOA 2EXEA 2WTCA 3UC3A 1GZKA 1LP4A 2QR7A 2BZHB 3ANQA 2GHMA 3COMA 4PV0A 2OIQA 3F82A 4YSJA 4AS0A 5CEIA 1CKJA 5FBOA 4RA5A 3EH9A 1U5QA 2YACA 4D4RA 1UWHA 3UOJA 1H08A 3QXPA 5I9UA 4F65A 2AC5A 3WF9A 3KXGA 5KMNA 2W5AA 4JT3A 4FZ6A 3ZO3A 4TTHB 1IG1A 2AC3A 5T3QA 3ULIA 3O7LD 4HOKA 4IDVA 3RMFA 3RM6A 4M68A 4OGRA 4AW1A 3L8VA 3R83A 2WD1A 4U80A 3ZMMA 5CAVA 2GSFA 2YWPA 4BCFA 2YITA 5HO8A 4CYIA 1VYZA 3MB6A 4HVSA 5CF5A 4JJRA 3OXZA 5C9CA 2UW3A 1H27A 3QQKA 3G6HA 4FKUA 4NKAA 3KULB 3S3IA 5FEQA 4A4OA 2JIUA 2OU7A 5E8XA 4Z55A 5AUXA 4E93A 4E7WA 3UOKA 4X3FC 3E87A 1H00A 1K3AA 3C7QA 3ORLA 4JS8A 4AP7A 1DI9A 3FZTA 5DT3A 2R7IA 3KULA 4QMSA 3LXPA 5CEPA 2IJMA 3PTGA 4D0WA 5KMKA 5KZIA 5F1ZA 4CXAA 2XM8A 3DKOA 3LLAA 5DA3A 4P5ZA 1YOLA 5E91A 5FG8A 4AN9A 3LFNA 1YXSA 3KK8A 3OUNB 5LWNA 3JVRA 4O7TA 3E63A 2H96A 2YJRA 4FC0A 4KBCA 4FUYA 4PL4A 4BDHA 4I41A 4QMTA 4F9BA 4HCTA 3BHYA 1OUYA 5AX3A 4JDKA 3GEQA 2W1ZA 3PG3A 4O2PA 3R7VA 5EI2A 4MXAA 4YC8A 5CSHA 1FBNA 1BYGA 3KMWA 4DCEA 3HAMA 2HWOA 3PZHA 4HZSA 3RINA 2GNGA 3ZU7A 3TUDA 3ZYAA 4FIGA 2C6TA 4GU6A 5A6OA 3U4WA 4I3ZA 3RTPA 5FEDA 4GYIA 5CLPA 4I20A 1P4FA 3R0TA 4ZTRA 4QYFA 2QVSE 3A61A 4WUAA 2IPXA 2C3LA 5LVOA 4ITIA 1F5QA 3NAXA 1R0EA 5I5ZA 1OPKA 5J9LA 3JR1A 4RQVA 4V0GA 4IFGA 3Q4ZA 3UG1A 4QMXA 3DFCB 4DN5A 2PE1A 3UC4A 4BCJA 2PVHA 5EI6A 4BI0A 4XV2A 5CU0A 2GNFA 3W2CA 4IM3A 3IDBA 2BRGA 4QYGA 5AIRA 2J0LA 3OTVA 3QWJA 2HW6A 3DAJA 2R3KA 4EK5A 4O1OA 4MXOA 2IO6A 4RLLA 2HXQA 2PE2A 4X2NA 4EWHA 3ZBXA 3BGQA 4EH4A 3NR9A 3CD3A 5CAUA 4PMTA 2B7AA 3K54A 3QQGA 2VO0A 4U6RA 3QUPA 4ZJJA 4PNKA 3IGOA 4WD5A 1JLUE 1H1SA 2I0EA 3M42A 3FXWA 1LR4A 4FT5A 4FG8A 5I9YA 4FV1A 4FV8A 1FVVA 4NU1A 4PUZA 5HLPA 3F7ZA 3A2CA 1PXNA 4GFOA 4WG5A 2ZV8A 4Y8DA 2BAJA 4AT5A 3PLAE 3WBLA 4NTTA 4AFJA 1H01A 5FM2A 4CSVA 3GC8A 4RSSA 2IVTA 4BGGA 2VTLA 2VNWA 3S1HA 4PP9A 1SZMA 2O3PA 4M0ZA 4JNWA 5EYMA 4DYMA 4ZSLA 4FSQA 3A60A 3FBVA 2YERA 3R73A 5HNBA 4J8MA 3VW8A 1JAMA 3A4PA 3IQ7A 2XNMA 3BGZA 3TWJA 4BDJA 2YIQA 2OJ9A 3P23A 3UP7A 1CKPA 5FDXA 2PYWA 3BQCA 2PZRA 3U8WA 1Y6BA 2F2UA 2P2IA 1M7NA 3D14A 4LGGA 4MXYA 2RFSA 4GFMA 4EHEA 5HVJA 2I0VA 4XG9A 3RZFA 3ALOA 2WOUA 3I1AA 5HOAA 5E1EA 4TYHB 5AP1A 2OFVA 4QYYA 4KSQA 3R9OA 4RVTA 4Q5HA 4JQEA 4KIPA 4BB4A 5ETFA 4KUJA 4C0TA 2KULA 5AR2A 1WBOA 2UW5A 4J1RA 3UYTA 3KN6A 2CDZA 4TZRA 4QPMA 4DCAA 4E4LA 2G15A 4TN6A 4ERKA 4ZTSA 5J7HA 3MTLA 2WIHA 3GP0A 4KABA 2YDJA 3VVHA 5M55A 1BL6A 4EOMA 5LOHA 4J97A 2VTTA 5EYCA 4IZ7A 5CWZA 4E20A 3IW5A 3OWKA 4K1BA 5AV0A 3U54A 3LZBA 5DLSA 2O64A 3G51A 4FTNA 2GNIA 2BRNA 3GU8A 3U4UA 3TN8A 3BEGA 5C27A 3UG2A 5CEOA 4AA5A 3JY9A 2J5FA 2PZPA 3FYKX 3CSVA 3PSCA 2R9SA 2GHGA 2YABA 3BRBA 4NWMA 3ANRA 3DGKA 3N4VA 2X1NA 3QZGA 2P3GX 2Y4IB 4EZ5A 1QPCA 3VS4A 5E1SA 4BDKA 2HZ0A 4XG2A 4B6LA 4DFNA 3TDVA 2PPQA 4X3FA 3DK6A 4AG8A 4FV0A 4F6SA 3ULZA 1VR2A 4DH1A 3R7GA 1ZZLA 3KQ7A 4I22A 4KWPA 2YDKA 5GZ9A 4CFNA 2ZV7A 4FK6A 4XUFA 1URWA 4HZRA 3QHWA 5C03A 4F63A 3F2RA 5HTIA 1H25A 2G2IA 2PY3A 3E3PA 4IIRA 4ARKA 1HCKA 3R9NA 4CMOA 4F99A 4O0XA 3HGKA 4QTCA 1RQQA 2P0CA 5DWRA 2UW4A 2YJSA 2W4JA 4W8EA 3FZOA 4XEYA 3BYOA 4FYNA 4AN3A 4DTKA 2XMYA 1TVOA 3NSZA 3UZPA 3W8LA 3GU6A 3AC3A 2WMSA 3EIDA 3TKIA 3FYJX 3ELJA 5KE0A 4DE4A 3A8XA 3VRZA 1KSWA 3QQUA 4XV1A 4L3LA 2JAVA 3MA6A 5T6KA 5ACKA 4AOTA 4GL9A 5J87A 3NUXA 3W55A 4QMLA 3D7TB 3H3CA 4K0YA 4W4YA 4YJPA 3PJ2A 2OJGA 1ND4A 2JDRA 4QMWA 4HVIA 5JN2A 4X6RA 3VUHA 3CD8A 2YCRA 3BV3A 2WTVA 3D7TA 5A4LA 5HTBA 2QG7A 1K9AA 1QL6A 2J9MA 4BKJA 4OTQA 4NL0A 2IW6A 2Y9QA 3QD0A 4FBXA 1PXMA 2Y0AA 3WYYA 4EORA 5HVKA 5LWMA 3AT2A 3BWJA 2YZAA 4AA0A 5ANIA 1BKXA 4KKGA 3OY1A 3VUKA 2WQMA 2F7ZE 4IB1A 3O8UA 4FV4A 1BL7A 4FK3A 4QQ5A 3TCPA 4EHGA 3RNIA 4G9CA 4AWIA 3EQHA 4U44A 2CHLA 2XCKA 2FB8A 3MFTA 2C68A 3P9JA 3VS3A 3COIA 3VQUA 4F7LA 4U97A 2E9UA 1WBWA 1JSVA 4MH7A 2R3JA 4RJ3A 4S2ZA 3AOXA 4F4PA 2BAQA 3RBWA 5ITAA 4F0IA 2OFUA 4EKKA 3QTRA 3H10A 4MF1A 4FIJA 3DK3A 4Y46A 1UU3A 5HI2A 2QD9A 4KRCA 4EZ3A 4C35A 2JKOA 4YJSA 5KX8A 2BHEA 3TDWA 1ZLTA 4UWBA 5J9YA 4NCTA 4QP4A 4QO9A 4R1VA 3FXZA 5LMKC 1RE8A 4GYGA 4ZS4A 4ACCA 1OMWA 4L7FA 1WVXA 4AOJA 3SA0A 3EFJA 1YHWA 2QOBA 5HVYA 4HVGA 4DFZE 3KREA 3KVWA 4J8NA 3PY1A 2A2AA 3EOCA 3Q6UA 3QKKA 4BBMA 2JKQA 4I24A 1TKIA 3EL8A 4C3PA 4GIHA 4FV3A 2QONA 3OWPA 5L3AA 3QLFA 5B7VA 2XVDA 5C8NA 3MFRA 4K77A 4UZHA 3F9NA 2ITPA 4KKEA 2C0IA 2YA9A 1YKRA 3LJ2A 5LMAA 3NIEA 5JGBA 5GZ8A 2W17A 5M09A 2WQNA 3A7JA 1TQMA 4L00A 4D28A 3QHRA 3C5UA 5G6VA 5ETIA 1Z5MA 4MX9A 2C47A 4O0WA 4ZZNA 1WVWA 4D4VA 3MJ2A 4IAFA 1B38A 3KKVA 2PUPA 3RWQA 5IEYA 3OBJA 5CTPA 2BPMA 2HZ4A 4ZY6A 4H39A 2IZUA 3LAUA 4DBXA 4F9AA 4UXQA 2OJIA 3ZFYA 3OHTA 5CAQA 3EWHA 3BI6A 2CNUA 4USEA 2YIWA 2ITTA 4C2WA 1KOBA 1NVSA 1IEPA 1Q8YA 2ZDUA 5FGKA 2UZVA 4J99A 1P5EA 4EH3A 4G5PA 3CQEA 3HMPA 1SYKA 1H07A 3L9PA 2QQ7A 4M66A 4OTIA 4FTAA 4FTOA 1H4LA 4L67A 3VS7A 4BL1A 2XBJA 2Y4PA 5HLNA 2YCSA 1OBGA 2Z8CA 4JQ7A 4ONAA 2W1HA 4O0VA 2BAKA 2OG8A 3MFSA 1BI7A 4H3QA 3PIZA 3ORMA 3VAPA 2YZLA 1KE9A 4GJ2A 5EQYA 1Q8UA 4XBRA 4FR4A 3ZLSA 4WBBB 5E4HA 4C57A 5HLWA 3E64A 3E62A 2QOCA 2CLQA 5M44A 3LCKA 5CZIA 4L53A 2JKKA 4XV3A 1OPJA 3SLSA 2A0CX 4O0SA 2IN6A 3PY0A 4DC2A 1FMOE 3KF7A 3Q9XA 4IJ9A 3P5KA 4RFZA 2DS1A 3ZO1A 1X8BA 2YDIA 4YPSA 1WMKA 4F0GA 1CM8A 3DJ7A 3MY5A 3BPRA 4M3QA 4OTGA 3VC4A 4O7NA 2C4GA 3B8RA 3QGWA 4ANQA 5CI7A 4ID7A 3DBEA 3FWQA 3KU2A 5KBQA 1M14A 3QCSA 5E92A 3CE3A 3PXRA 4RWLA 4LG4A 4AW5A 2HY81 3PVGA 2QKWB 2R5TA 2WQBA 3R9HA 2IVVA 1JKTA 1SNUA 4LRJA 5AADA 5IA2A 3CC6A 4BC6A 4L46A 3ORIA 3WILA 3AQVA 5CXHA 3OEZA 2C6IA 4HCVA 3R8VA 5JRQA 4HGSA 3FKOA 3K2LA 3LW0A 4Y5HA 4YSMA 3L8PA 3L9NA 3PA5A 4O7ZA 5KUPA 3BYVA 3W33A 3NUUA 3MV5A 5JQ5A 2GS7A 4QYEA 3MS9A 3ORPA 1V0BA 3GQLA 5HO7A 2A4LA 2J0JA 4EJ7A 3FAAA 1UU7A 3LM5A 4D55A 1OL2A 3KRJA 4D58A 3H0ZA 3Q6WA 4FT7A 2OZAB 2XIXA 3NUYA 4IE9A 4JR7A 3D15A 4A06A 4YURA 2QI8A 3N4TA 3O23A 3VUIA 4K11A 4P90A 1E9HA 4FVQA 4BHNA 4DLIA 4Q9SA 4P7EA 4RIYA 3I7CA 1ZZ2A 3WF7A 5IISA 5CVGA 2BZKB 5IU2A 3CGOA 1H1WA 4D2PA 3DPKA 3FI4A 3QCXA 4AZSA 2BDWA 4PMSA 3ZONA 5KMIA 5M4UA 2XK4A 4ZK5A 1XH4A 2XBAA 1SMHA 3QTXA 4UB7A 2QO7A 3L8SA 4GG5A 4WA9A 4EOOA 2J6MA 2W05A 3COHA 4FNZA 4FTIA 1GZ8A 2VX3A 5A54A 4ACDA 1GIJA 3W16A 4EK3A 1W84A 2OBJA 4U3YA 4XP0A 2UW0A 4CFFA 5CSPA 5J5TA 2I1MA 2QHMA 3M1SA 4L45A 4YJQA 2GHLA 2QURA 1F3MC 2BIYA 2JDOA 4EOSA 2O65A 2IW8A 3GCPA 5HKMA 3E8DA 1WFCA 4TYJA 2VTOA 1MQ4A 3F3WA 3HV5A 4NM0A 2VO6A 3F3UA 4GT5A 3QTQA 3QCQA 3LFQA 3VS6A 3RPRA 4A9YA 1TQPA 2XCHA 5GJFA 3A62A 4ASZA 5BUEA 1PXKA 3PY3A 1Q3WA 4GUEA 4H36A 5JKGA 2ZV9A 2ITUA 2Q0BA 3QWKA 3KXZA 1YI4A 4JG7A 4X3JA 1QPDA 1WBVA 4CD0A 1IA9A 3VNTA 5H3QA 3E3BX 1OITA 3RCDA 3UVQA 4G3FA 4LOOA 2XP2A 4EH8A 4NJ3A 4RC3A 4C37A 4RJ5A 4F08A 4ZP5A 4GMYA 4A9UA 2DUVA 4S34A 1HOWA 3ODYX 3R30A 1Y91A 2WHBA 4KAOA 4R77A 4RC4A 3F3ZA 4FVRA 4RX7A 4FKPA 2V22A 3ROCA 2BZJA 3KA0A 3UBDA 4E5AX 2ZDTA 2QG5A 4O1PA 2HYYA 3FC2A 2JFLA 3T3UA 3IGGA 1Q24A 3LJ1A 2QOHA 3O8PA 3KMMA 3QTSA 1FQ1B 4YJVA 4CQEA 4F9YA 4NIFA 4YHJA 1WBTA 4MXCA 4FEUA 3L9MA 4ZJIA 2UZLA 4AFEA 2PUNA 5M57A 3L8XA 4C4HA 3F2NA 1FVRA 3QZFA 4GW8A 4LV5A 4XRJA 4GRBA 4XYFA 3HDNA 4YBJA 4EZ7A 4GJ3A 5AV2A 4IAIA 3OT8A 4Q2AA 5HGIA 2YN8A 1ZYCA 3PIYA 3W10A 2VTMA 4YUQA 3QTIA 2WQOA 3B8QA 3EZRA 4QP1A 3OCTA 2W1EA 4L42A 5CAPA 4TYEA 4JQ8A 4A4XA 4IADA 3NIZA 4RIWB 2EXCX 3OUKA 3WZDA 4ANOA 3ZBFA 4EC9A 5J9ZA 3RP9A 3QQJA 1W82A 4W4XA 3FQHA 1YXTA 5IA4A 3DBQA 2FVDA 2GNHA 4RZWA 5FXRA 4IWQA 3MFUA 3FDNA 2PVRA 4S30A 5K0KA 3BE9A 4FT3A 4F6WA 3WYXA 5HIEA 3GUBA 5FBNC 4I1ZA 2UZTA 3ENMA 2F2CB 3TNWA 4JBOA 4YMJA 3ZH8A 4MBIA 2HENA 2W9FB 3CIKA 2IZTA 1P4OA 4CFWA 3UZTA 5EOBA 3PJ3A 5M06A 4E6QA 3TL8A 2FYSA 4HJOA 5AM7A 4M84A 4YC6A 4OAVB 2NO3A 2FSTX 4FSUA 3OD6X 4GT4A 5AUVA 3JY0A 4G3CA 5LXMA 1YVJA 3B2WA 3BYMA 3I4BA 4GVAA 4WNKA 4EK6A 4I6BA 4IXPA 4ITHA 5L2SA 4FIHA 3GENA 3G0FA 2O8YA 3HV6A 5EHOA 5EHLA 4BIDA 4E4XA 1KWPA 3KRRA 3NEWA 2BRBA 3AC1A 3R02A 4GIIA 1BUHA 4Y85A 4EJNA 2UZDA 5LQFA 3UVRA 5IQIA 4OR5A 4QMQA 4DT9A 5I9VA 3PP0A 5DHJA 3ZRLA 4CLJA 2XK3A 4U7ZA 2PU8A 4R5SA 3PZEA 3VBTA 5DRBA 2Y6MA 3AD6A 3MH0A 3PVWA 3OBGA 3W1FA 1QPJA 2VTQA 4CV8A 4O7LA 4AZEA 3H9OA 2VD5A 3R00A 3PWDA 4JVGA 2GDOA 3PXFA 4QTDA 2CLXA 1ATPE 4K9YA 2ITOA 4AGCA 2V7OA 5I4NA 1QPEA 4DGLC 2X4FA 3TZ7A 4GV1A 5L4QA 5A46A 3R63A 3VF9A 1OIUA 3HMIA 2QOLA 3QZIA 4DEIA 2IZRA 4JOAA 5I9XA 4H05A 2P2HA 5EKOA 2B54A 3P7AA 1KUTA 1XBAA 2YHVA 3V5QA 5J5SA 3EN9A 3HA6A 2G2HA 3I5NA 4JRNA 4MWHA 4I93A 5ANOA 1PXJA 3U6IA 3UQGA 3MW1A 4JX3A 3ZUUA 3OWJA 3ZXTA 2PVYA 2PZ5A 4UMPA 5E9EA 4YJRA 3DLSA 1Y57A 1W7HA 4XRLA 4QTAA 5EM5A 4XNEA 3EQPA 2R3QA 3VS1A 3LMGA 4C38A 3SQQA 2CKOA 3GC0A 2WPAA 4WHZA 1OZ1A 5E8VA 5M56A 3V04A 2XKFA 2CNVA 5IUHA 5DG5A 5LVNA 4KS8A 3JYAA 4J96A 4FTTA 4CT1A 3LFBA 2C6MA 4YTIA 4CV9A 4BY9E 4E4MA 2EVAA 2BRHA 2HOGA 5AA8A 2OH0E 3I5ZA 5JT2A 5E8WA 3NDMA 3VBWA 4F64A 4OBQA 4MNEA 4ACHA 2X2LA 2C5YA 4L3PA 4FKWA 2RL5A 5CT7A 5CZHA 4IWDA 1LPUA 3I6WA 3KCFA 3PJ1A 3A7IA 2WZJA 3KXXA 4IVCA 5EW3A 3DAEA 4U40A 3DBCA 1JSTA 3NYXA 1PXPA 1ZYSA 4FICA 1AQ1A 3A7FA 5CSVA 3S00A 1KE6A 4WRSA 3AG9A 4MAOA 4YZ9A 2GU8A 4QQTA 4RPVA 4FL3A 4LUDA 5K5NA 4CTBA 4FSWA 3KXNA 4IC8A 3OY3A 4QP6A 3W32A 1MRVA 5GJGA 4MBLA 3RPYA 2PE0A 4QD6A 5HNGA 5C4KA 5FXQA 1U4DA 4AAAA 1XH7A 4G3DA 1KE7A 1PKGA 3R01A 4FNYA 5FP5A 3FMLA 4D2SA 5H8GA 2XK7A 2Y6OA 5AIKA 3BU6A 5F20A 3CBLA 3DLZA 3TNPC 3HP5A 4RJ6A 1B39A 4IX4A 4QP9A 3P08A 4D5HA 2DWBA 4R5YA 4G9RA 4CGAA 4O7WA 3LXNA 3NW6A 4IACA 4MXXA 5HE1A 3BZ3A 3RPVA 5CASA 2VU3A 4HW7A 5F9EA 2YCQA 3P0MA 5HD7A 4DEBA 3DFAA 2OSCA 4IFCA 4BCNA 5HZNA 5H9BA 4JDJA 3BELA 2R2PA 2XK8A 3D5UA 4BTMA 4D0XA 3RK9A 3PWYA 1PMVA 4HNFA 3T9IA 4BZDA 3ZLYA 1ZYLA 4FTKA 3FUPA 3SXRA 4DG2E 4YPDA 3R04A 5IQGA 4F6UA 3PPKA 4M0YA 1IAHA 4O22A 3Q2MA 1OBDA 2B9IA 5AAEA 2ACXA 3PA3A 1QCFA 5KHWA 4EC8A 4XHKB 3WIGA 4OT6A 3W2RA 2BKZA 4O21A 2Q0NA 3IONA 4TXCA 3VF8A 4V0GB 4O7RA 2X4ZA 4D1SA 3QALE 2PHKA 4X21A 5KBRA 4BI1A 4PL3A 2UW8A 5CF6A 3TEIA 5IPJA 4XOZA 2R64A 3V5LA 3SG9A 5EW9A 1BMKA 2ZAZA 4F9WA 5L8LA 1XHAA 3QA8A 4ITJA 1FPUA 1PXLA 5L2QA 4M12A 4UMRA 3QBNA 4EONA 5D9HA 3MGYA 4FEXA 1R1WA 5DR2A 2VV9A 1JKSA 3EFKA 4EBVA 2C3IB 4QMMA 4I92A 4JAJA 4TYIA 2XNBA 4I0TA 4XBUA 2B52A 3MESA 2BALA 4QPAA 4UV0A 5AEPA 3JVSA 5LCJA 3FKLA 4ALWA 3FMKA 4RX9A 3R71A 4ZLZA 3D4QA 5IKWA 5LARA 2PL0A 3ZFMA 2O2UA 2ETRA 3NPCA 3O51A 4YTHA 1Y8YA 1ZYJA 2XRWA 3SKCA 3V5WA 5FD2A 4N4SA 2JFMA 3DS6A 3ERKA 4FTQA 3QX2A 5DOSA 5DR6A 3TKHA 1XWSA 3TIZA 3FV8A 4O0RA 4Z7HA 1OUKA 3FPMA 3NNUA 3LOKA 5HICA 4DLJA 2Z2WA 1YOJA 3GCUA 2NPQA 4R3PA 2CSNA 3VO3A 2BILB 2G1TA 3BHTA 2WMUA 3MPAA 2VZ6A 3ODZX 4X2KA 2ZMDA 3CEKA 3DTCA 3FLZA 2QLQA 3MH1A 4FKSA 3T3VA 4FTMA 2VTNA 4DG0E 5HBJA 4UXLA 3PE1A 5D7AA 1JSUA 4G5JA 3W2QA 2JITA 3HL7A 3FKNA 4WRGA 4A9TA 3QQHA 3BEAA 4GSBA 4IZAA 4TL0A 3GI3A 4FL1A 4O0YA 5ETCA 5LCKA 3ATSA 1UU9A 4M14A 5M53A 4IW0A 3PIXA 5A3XA 5L8KA 1PYXA 3KY2A 5FRIA 1UVRA 2XNNA 4GFGA 4BCHA 2VO7A 4UEUA 1H0WA 3HMOA 4QMNA 1T45A 3E8NA 1OKWA 5BQ0A 2O0UA 3RALA 2W1CA 3SDJA 4F09A 1WBPA 2IVSA 2XEYA 3VS2A 4M69A 4QT1A 4BCGA 4FGRA 3LXLA 4FEWA 2WOTA 2X7FA 4F1OA 4ZTNA 1OL6A 5M4IA 4I0SA 5CANA 3WE8A 4R7BA 2OH4A 2YIYA 4NW6A 4NM7A 3RM7A 2YAKA 3LVPA 3EQCA 3RCJA 2J4ZA 2UZBA 4KRDA 3PVUA 3C4EA 4E8AA 3NNXA 1MRYA 3CTQA 3EYGA 2IZSA 4CQGA 4EL9A 4JIAA 3TNQB 4I4FA 4DEGA 1IRKA 3FXXA 4EUUA 5GHVA 3C4WA 4PMMA 3R1YA 3H9FA 4G2FA 4MVFA 4EOLA 3O17A 4YZBA 1H0VA 4O6EA 4RLKA 1H1PA 3CGFA 3LCOA 4ACGA 3UQFA 4U3ZA 1G3NA 4X3FB 4PP7A 5CT0A 3ZXZA 1F0QA 3E7OA 5BVKA 5JFWA 5C1QB 4ERWA 5CQUA 1XQZA 2R3GA 2OKRA 3UYSA 5TKDA 1PYEA 2HCKA 1NY3A 4O0TA 4Y95A 4NKSA 2I0HA 2Z02A 5BVFA 2VX0A 4D1XA 1PXIA 4M67A 5IQAA 1WVYA 4FT9A 3D94A 5AUWA 4DF3A 4NUSA 4CLIA 1YHSA 3GFEA 3IOPA 4ORKA 1YRPA 1GJOA 1UKHA 4MTAA 3TTJA 3VQHA 3Q9YA 3QF9A 4WG4A 4LYNA 5CU6A 5F95A 3T8OA 4ENXA 3GBZA 4FX3A 2ITVA 1UV5A 3K5UA 4LL0A 3UMXA 2XM9A 3W2SA 3BBWA 4CCBA 3MA3A 1JVPP 4UX9A 2ZOQA 4R6VA 5AUUA 3R7EA 2HIWA 4YNOA 3UVPA 2OZOA 5BX0A 4C4IA 1ZOEA 1YXUA 2GQGA 3QA0A 5AP2A 4BZOA 4YTCA 2V7AA 2HAKA 4FI1A 5F94A 3LM0A 4RG0A 4FMQA 3I0OA 1NVQA 5M4CA 2ZB1A 5EI8A 5A14A 2X6EA 4PRJA 2IWIA 2A27A 5E8YA 5LVLA 2W5HA 2WMWA 3DTWA 2BTSA 2CGXA 3IW4A 3K3IA 4ENYA 3SVVA 5AV1A 4R3RA 5HQ0A 3F7WA 4CMTA 3BIZA 3Q4TA 4AGUA 1J7IA 1W8CA 4I5PA 1XH8A 3R2BA 4G3GA 3BKBA 2YAAA 2YCFA 3FL5A 4IB3A 3W2PA 3R8ZA 3F66A 4MBJA 3QXOA 3U9NA 2V0DA 2J90A 3E8EA 1GZOA 4BBFA 3QTUA 4FIEA 3CKXA 2ITNA 4UWYA 3H0YA 3C50A 4O0UA 1REJA 4WNOA 4EWQA 4APPA 2FSOX 2VO3A 5IUIA 3ZO4A 3TTIA 1GIHA 1FINA 4BN1A 5EM8A 1PMUA 2QOFA 4BIEA 3UO4A 4I23A 4BCKA 4ZZMA
chains in the Genus database with same CATH superfamily
4KIKB 4W8DA 3OFMA 1H28A 3VBXA 1FMKA 3O7LB 5AUZA 2B9FA 1NW1A 3RZBA 1R78A 4IWPA 4AT4A 2WIPA 3LCSA 2OW3A 4G6NA 4MCVA 3NW7A 4LMUA 4KIKA 2P33A 3W0PA 4IANA 5AX9A 4KNBA 4NM3A 4D9UA 3OXTA 2ZVAA 3QD4A 4AW0A 2HXLA 3FMMA 3LFEA 5CALA 4XP3A 3OVVA 3BL9A 4H3PA 4FV2A 3UDBA 2ETKA 3LIJA 4DTBA 2X7GA 4L52A 5IG1A 1LUFA 2C6OA 3FZPA 4CG8A 3LFSA 3QL8A 2HW7A 4V01A 4IBMA 4V04A 4YLKA 4ZXTA 4BDIA 4NT4A 4CVAA 4LM5A 3NVKI 3POZA 2W0JA 2CKPA 4WIHA 5CY3A 4OTPA 3NVMB 5HG8A 4WSYA 1OKYA 2HZIA 3CXWA 4H3BA 1NXKA 1WBNA 5FEEA 2J0MB 1J1CA 1U54A 4RWKA 5L6WL 1G8AA 3SG8A 4NH1A 2PVLA 3G2FA 4J7BA 4RWIA 5FTOA 5CEMA 2X6DA 1XH6A 2H8HA 2XJ2A 3IW8A 4AA4A 5DIAA 3SW4A 1TQIA 4EYJA 4CKIA 3DA6A 5C8MA 3SOAA 2ZJWA 1Y6AA 1YWRA 4QMZA 1CMKE 4YZCA 3DZOA 2XS0A 3I0QA 3HV4A 3OTUA 1ZAOA 3AT3A 5K5XA 4DDGA 2C5NA 2XIKA 5DRDA 2C6KA 4I4EA 4O96A 4OBPA 4CKRA 3LXKA 3LFCA 2E9NA 2JKMA 2W7XA 2EU9A 3C4CA 3SC1A 4DEDA 5BV3A 4FKGA 3R1SA 4IVDA 4AT3A 4OLIA 4LGHA 5DVRA 5C4LA 4U45A 3PXKA 3NNWA 4IAZA 4FSRA 4OBOA 4P4CA 2C5XA 3V6SA 3BBTB 5TR6A 4K6ZA 3OCSA 4Z7GA 3UIMA 2SRCA 2X9EA 4M15A 1ZYDA 4C61A 1Q97A 3IS5A 5M07A 5AR7A 1OM1A 4L6QA 3EN4A 1DAWA 3KXMA 3OG7A 4MQ2A 2UW9A 5ANDA 4E6AA 3DDPA 3EFWA 3ORKA 4GT3A 5BYLA 3FMDA 5DYJA 1H1RA 3MWUA 4PY1A 5ANEA 4C4JA 2OIBA 2GTMA 1QMZA 4OTHA 3WF8A 2I40A 4C58A 4QNAA 5AFVA 3UP2A 1BLXA 2NP8A 3D5VA 5AP3A 1OKZA 3COKA 3DDQA 3PPZA 3GOPA 3PUPA 5IDPA 3ZLXA 3RJCA 3ZC5A 1WCCA 4BDGA 4C3FA 1PKDA 3EKKA 3OW3A 4BTJA 4M97A 1W2DA 4PTCA 5FQDC 3TG1A 4O83A 4K18A 4FKVA 5DT0A 4R3CA 5H8BA 3DCVA 3MPMA 4HYSA 5LVMA 5KKRC 2BROA 4I6FA 5LJJA 2ZV2A 1SNXA 4BTKA 4JAIA 4JDHA 4BGHA 2F49A 1APME 1ZMWA 3BU3A 3EHAA 4LL5A 3FPQA 3TNIA 3PDTA 5FWKK 3R8UA 3V3VA 4II5A 1OGUA 3TUBA 3RAIA 2G01A 2VTPA 1RW8A 2RKUA 4IH8A 4ZSAA 5DPVA 3GU4A 4FE2A 4FIFA 3O50A 5FUTA 3NAYA 3ZOSA 3R8MA 5IQCA 3L1SA 1YXXA 2WQEA 3UGCA 4DGOA 4QMYA 4F7JA 4BF2A 2GMXA 4XS2A 3OCBA 5EYKA 4A4LA 3UNZA 3PFQA 4EYMA 4U79A 5M4FA 2VWVA 2W9ZB 4E1ZA 3TM0A 2UVYA 3IO7A 2EWAA 4FTUA 5I9ZA 5F4NA 3R7UA 4PPCA 4X7QA 4YJUA 2C3JA 4GKIA 1M2RA 1VZOA 5HBEA 1OGYA 2F4JA 4IC7A 3CPCA 3R8LA 2X8IA 1ZY5A 2R3NA 4M8TA 2ZM3A 5TOZA 3SXSA 4OTDA 4DH5A 1W0XC 4N0SA 5HE2A 4GK2A 2XF0A 1MP8A 5KMJA 5DGZA 2YISA 4PDYA 4OUCA 5JGDA 4RIYB 4IVBA 4C3RA 2YLEA 4NFNA 4BRXA 2ITWA 4I5CA 4CEGA 3PJCA 5GZAA 1PRYA 2CGWA 4ASEA 3WZEA 1G5SA 2FA2A 1YWNA 4ZY5A 2BMCA 5CAOA 3TJCA 2OF4A 3IDCA 3OZ6A 4ZSEA 3BV2A 1XJDA 3PJ8A 2VTAA 2A98A 3MH3A 3NMUF 3IW7A 3MY0A 4U43A 4EOKA 2VWXA 2WTKB 4BWPA 5IF1A 5BVOA 4EH7A 5LMKA 1H8FA 4PF4A 3ORXA 3BWFA 4MKCA 2WTJA 2OIDA 3GU7A 3O0GA 4EOJA 5AP0A 3KB7A 2OK1A 2X8EA 3G5DA 2B55A 5IMXA 5HESA 3MH2A 4YLJA 4UWCA 2UUEA 4CZTA 4EUTA 1YDTE 4NM5A 2JGZA 2QOQA 3EQIA 4GU9A 1YWVA 2BDFA 5ANJA 2XUUA 3PVBA 5AUYA 4B0GA 4CRLA 4EOQA 4XLVA 3ZSHA 5ETAA 4XP2A 4JBQA 1O6YA 3FLSA 3N9XA 4PDSA 4L8MA 3ITZA 5AMNA 5HE3A 4X2GA 5AJQA 3PSBA 4L44A 3BHHA 2QNJA 3SAYA 4M7IA 3FI2A 1YOMA 4XOYA 4MD8E 1M2QA 4FOBA 1AD5A 2UVXA 4P5QA 2XNPA 5IA5A 3VULA 1Y8GA 4HPTE 4J53A 3ZSIA 4DGNA 4E26A 4AF3A 4DFYA 3UIXA 2OICA 5AM6A 4GG7A 1V1KA 3S2PA 5JGAA 2PMOX 3QYZA 3WOWA 4ZEGA 3FHRA 4L68A 5CU3A 3ZM9A 2WMBA 3ORTA 5AR4A 4ZSJA 4W4VA 3Q5ZA 1AGWA 3CS9A 4KSPA 3E7VA 4E5BA 5BUJA 4B7TA 2LAVA 3TZ8A 2WEIA 3Q32A 3OC1A 4KKHA 5C01A 4EEVA 4ZY4A 5EH0A 5JRSA 4DT8A 4ZTMA 3FLNC 4AW2A 4F7NA 3CY3A 1IA8A 2GPHA 4FKJA 4BKZA 3F5GA 1Q8TA 4QRCA 4EH2A 3G15A 3PXYA 4QQJA 4YJNA 2BRMA 5HEZA 4E5WA 4FF8A 2FSMX 4NIFB 4PDPA 2JBPA 1PMEA 3ZHPC 4D2VA 4DFXE 5IUGA 2CNQA 5EG3A 3KC3A 3P4KA 3QTZA 4WT6A 3IKAA 4XG7A 3AT4A 2CN5A 3UZRA 3R9RA 3LPBA 5HBHA 4YGAA 4O7VA 3NYOA 3GCVA 2XIZA 3C9WA 3TKUA 2VX1A 2JD5A 1Q41A 4ALVA 5L6PA 1G8SA 3UPXA 4JG8A 3UO6A 3R1QA 3MVHA 1Q4LA 3F88A 2OI4X 4WOVA 3TV4A 5EQEA 2PVFA 4TRLA 3GCQA 4FOCA 2J2IB 2OXXA 3SXFA 3NX8A 5B0XA 3PSDA 4RRVA 1PHKA 5FDPA 1R3CA 5GIOE 3I7BA 3DU8A 5IEXA 3FI8A 3DY7A 3UMWA 3GQIA 5FP6A 5E7RA 2C3KA 3RAWA 1L8TA 4BCMA 5D41A 5EHYA 3RPSA 4R8QA 3RNYA 2W99B 3VBVA 4RBLA 3ZC6A 5JEBA 3MDYA 3ZZWA 4G16A 4K2RA 4C34A 4D4YA 4F0FA 3GB2A 3OROA 3MYGA 4QMVA 2R3LA 3KL8A 4YBKA 2IW9A 3ZO2A 1HCLA 1OB3A 4D2RA 4DFUA 1NVRA 2PMNX 4JBVA 2EB2A 4UN0C 5HX6A 5I9WA 2B0QA 2JC6A 4FZ7A 3HEGA 3AC4A 3UNJA 2NNWB 3R1NA 4TWNA 3HMNA 2CJMA 4G34A 4FT0A 4IM2A 3ZRMA 2X2KA 4BKYA 5AA9A 3O2MA 5AAFA 3ZSGA 3U55A 4FTLA 3V6RA 4CG9A 4NEUA 4FNWA 1XMMA 4U41A 2UW7A 4EBWA 3P7CA 3QYWA 4YTFA 4RJ8A 3F6XA 2Q83A 2FGIA 3F5UA 5ACBC 3NW5A 4IX6A 4GK4A 3C4ZA 4JX7A 5DI1A 4MEDA 4JR3A 4X2JA 3FSKA 5E8ZA 1H1QA 3DJ5A 3CQUA 4E4NA 5IQBA 2H6DA 1Q62A 4D2TA 5D1JA 4GVJA 2OWBA 4IZYA 4AGWA 3EB0A 3G90X 2B4SB 2R3RA 2RIOA 4LQMA 1DM2A 4MD9E 4JBPA 4PPBA 3UPZA 3KRLA 4J98A 3C13A 3I6UA 2R3MA 3SGCA 2RFDA 4RVLA 5EM6A 2XYUA 3AD4A 5JFVA 1JNKA 3AKKA 3BL7A 3DOGA 3EJ1A 3F3TA 2GS2A 3DV3A 4K8AA 3F3VA 3TV6A 2XAMA 4A9RA 4UYNA 4IM0A 4S33A 3NYNA 4TW9A 2AQXA 1FGIA 3ACJA 2CKQA 4O84A 4KIOA 1Q8ZA 4G1WA 4H1JA 4FG7A 3N4UA 4I6HA 4AE6A 2WMRA 1O6KA 4C7TA 4E6CA 2R4BA 3CLYA 3VHKA 4HCUA 4WKQA 5H2UA 2GQSA 1OKVA 3QU0A 1CDKA 3QCYA 4FSMA 3EQDA 2C6DA 2XKEA 3CY2A 4BCQA 1I44A 5BVDA 2OLCA 1DAYA 5AR8A 2YM3A 2W1IA 2BTRA 2X39A 3EKNA 3H30A 2A19B 2PMLX 2CN8A 3I60A 3OWLA 5L2TA 4AXFA 3FY2A 3TT0A 2HY0A 4LOQA 4QMUA 4Q9ZA 3UNKA 4RFMA 5KZ0A 3KGAA 1Q3DA 4H1MA 4AZWA 2BKKA 5I0BA 1KV2A 2R3PA 5DEYA 2XZSA 2YIXA 3EN5A 4LOPA 4TNDA 2CGVA 2WMQA 2VGOA 3WI6A 4CFMA 5IH5A 3NZ0A 5A4EA 4MNEB 4Z3VA 3N51A 3IPHA 4AQCA 1OL5A 5HU3A 4NYEA 3ZUTA 5HG5A 5K0XA 4ZMEA 3GC9A 3P79A 3MPTA 3H4JA 1EH4A 2BVAA 3ZS5A 4YR8A 5AV4A 4PTEA 4FTCA 1URCA 3FQEA 3MVLA 4RGJA 3O5AA 4FODA 1E1VA 3RI1A 5B2KA 3G9LX 2WMAA 4FZFB 2VUWA 3OOMA 4C4EA 2W4KA 3EQGA 4AXAA 3HRBA 4N6YA 5DFPA 3F5PA 3C0GA 1Q8WA 4BIBA 2C5OA 2VNYA 3LE6A 3FC1X 3WE4A 3TXOA 5ANGA 5CU4A 4HPUE 2R0IA 1Q61A 4QNYA 4R7HA 5CEKA 3R7OA 2JEDA 3ZZEA 4DG3E 2WMTA 3EQRA 4ZZOA 1A9UA 2XEZA 3IOKA 4TY1A 5KMMA 5BYZA 5JQ8A 3BHVA 5KHXA 4I5MA 4N70A 4AZFA 5J1WA 4NTSA 2IG7A 2PSQA 1PY5A 1ERKA 2J0KA 4PQNA 5IQEA 1UU8A 4NSTA 3NWWA 2B9JA 2PVMA 4AACA 2JAMA 3VUDA 4QTEA 3C0HA 3KN5A 5FXSA 3RHKA 3A7HA 4YJTA 3KEXA 4B8MA 4UMUA 3PRIA 4FRFA 2JDSA 2WEVA 3QC9A 3HA8A 4DH7A 4E73A 4NFMA 3UJGA 2JBOA 3D7ZA 5JFXA 2HK5A 3CP9A 1P14A 2WAJA 3PA4A 3AMAA 4IEBA 2PVJA 3SRVB 3AMYA 3MN3A 3C4FA 4ANMA 4BWXA 4DGGA 3LJ0A 4IZ5A 4EOIA 4RQKA 1OL7A 4C8BA 3UIBA 4A9SA 2UV2A 3DAKA 5IA1A 4BZNA 2PMIA 1FGKA 2J50A 3SRVA 3QRIA 3C4XA 3P7BA 4BDAA 4O7SA 3NCGA 3SOCA 4BR3A 5JZNA 4YLLA 2YM8A 5D10A 5E8UA 4Y5QA 2J0IA 3HMMA 1JKKA 2I7QA 4U81A 3WARA 3MY1A 1XR1A 3R22A 2Y4IC 1YDRE 2FUMA 4Y73A 3WF6A 3C5IA 1KV1A 4QPSA 3VJOA 3R8PA 5T68A 4MYGA 4ZIMA 2ITYA 1WAKA 1Z9XA 2RGPA 2XIYA 3QLGA 3CQWA 3CTHA 4MHAA 1VLRA 4QDEA 3HDMA 4HGTA 4O91A 4WBOA 4F78A 3M2WA 5AUTA 3LQ3A 3VUTA 2B1PA 4IHPA 3WZUA 4L01A 2VWZA 3NYVA 4DHIB 2Z7RA 4K33A 5CI6A 4FV5A 3VS5A 2AUHA 3OS3A 5HG7A 3BHUA 5LMBA 3FLYA 4GK3A 5G1XA 4BGQA 2BR1A 4G31A 4IWOA 3I81A 4XV9A 3AGLA 5EOLA 4JLCA 5CNNA 3NLBA 5EW8A 4USDA 2WMVA 5C26A 5KNJA 5TO8A 3ZRKA 4O81A 3BLRA 3CJGA 3Q9WA 4BDFA 5IQDA 2XKCA 3MJ1A 3W18A 3GC7A 2XRUA 3NGAA 4RJ7A 3K3JA 4DEAA 3OP5A 4LRMA 4IAAA 4UMTA 2GQRA 4DTAA 2WTDA 4GCJA 3BLHA 3CCNA 3EQBA 2J7TA 3D2IA 4YO4A 4M13A 4OAUC 5HD4A 4BDBA 3DXQA 1VJYA 3OW4A 5HE0A 2F57A 2XIRA 4F7SA 4RVMA 3HV7A 4BBEA 3MIAA 4XG3A 5I3RA 4RIOA 3FE3A 2OXYA 4USFA 2J5EA 3FHIA 5K9IA 3EN7A 2HELA 3S95A 3GGFA 3QUEA 3FMEA 4ANSA 4RX5A 5IA0A 3GVUA 2W1FA 3ACKA 3MVJA 5CEQA 4BFMA 3FZ1A 4EQUA 2RG5A 4YZDA 1U5RA 1ZXEA 3MB7A 4C33A 2YM6A 3DKFA 2CGUA 2JDTA 1W83A 2ESMA 2FSLX 3EN6A 4JRVA 4FTJA 4PDOA 4YHFA 3V8SA 4O82A 3LCDA 4DITA 4R1YA 3PYYA 3E92A 5J7BA 2PUUA 5D7VA 1BX6A 2XARA 1XKKA 3DKGA 4M69B 3V5TA 3T9TA 4NCTC 2R3IA 2R3FA 5K4JA 5CXZA 1DS5A 2X2MA 5J79A 1STCE 4FZAB 3Q52A 4Z16A 4QYHA 3UDZA 4UZDA 3V51A 2OF2A 1J3HA 2QO2A 4UMQA 4XG8A 5BMSA 2VWWA 4EI4A 3BYUA 3VWAA 5AP6A 3OXIA 1VEBA 1S9IA 4HVHA 4TWCA 4W9XA 2H9VA 3KRXA 4PL5A 3UOLA 4FKIA 3QKLA 2P4IA 4CT2A 5IMEA 3UOHA 1J7UA 2ERKA 3VW6A 4B8LA 4CFVA 3KCKA 5ICPA 4IB5A 3RAKA 4RFYA 3DB8A 2WKMA 4RMZA 2X81A 3DZQA 4S31A 4XLIA 1H26A 2Z7SA 1W98A 3DBFA 4C4GA 4KIQA 2BUJA 2GFSA 3PE2A 3Q4CA 4U0IA 4DH3A 3PLSA 5EFQA 2Y7JA 4TYHA 3A4OX 5EKNA 1R39A 2XJ1A 1SVGA 2DQ7X 4XMOA 4YZNA 4A07A 4ZLOA 1RDQE 4JMQA 4O7YA 2EUFB 3HZTA 3OOGA 3O71A 4FKRA 4KA3A 4XX9A 3PUFC 3E5AA 2I6LA 3GFWA 3MIYA 3R28A 2C6EA 4Y72A 3VIDA 5L2IA 5CQWA 2V5QA 5TE0A 4BJJB 4FV9A 5CVFA 4XG4A 1PJKA 5AWMA 4CYJA 3UQCA 3DB6A 3SV0A 3LQ5A 2QU5A 4F1MA 1XH5A 4FSTA 4RA4A 5EYDA 1ZMUA 1NA7A 3QRKA 4TKSA 4BJJA 4YC3A 3SX9A 3ZUVA 5IDNA 1A06A 2V62A 5GINE 3HUBA 4QMPA 4TNBA 1U59A 3Q3BA 3NS9A 3BYSA 4PPAA 4L7SA 4B99A 4BYJA 4AU8A 4IDTA 2ITZA 4E3CA 2ZMCA 3U6JA 3GT8A 3CJFA 4BHZA 3D5XA 1GOLA 3V5PA 2WNTA 4B9DA 3MSSA 1M2PA 3UE4A 5IH4A 1LEZA 4C4FA 5E8SA 2VRXA 4KBKA 5AAGA 2CCIA 2BHHA 3QRUA 5BVWA 3FQSA 3NNVA 5JH6A 2CKEA 3CKWA 4ZTQA 4I6QA 3SHEA 1UA2A 2ZM1A 3Q04A 2BDJA 4MNFA 2XH5A 4G6LA 4BCPA 4TWOA 2R7BA 3I79A 3R7IA 4HGEA 1XO2B 2V55A 4IJPA 2VTSA 3TYKA 2O5KA 2VTHA 3AC5A 3TUCA 2XA4A 1REKA 3OEFX 3UTOA 1UNGA 3D0EA 2J51A 4P2KA 4UALA 5HCZA 5DR9A 2FO0A 4KINA 2XNEA 4U9AA 3Q4UA 4BDCA 3QKMA 3TZMA 1PXOA 3VUGA 4W4WA 5IEVA 1JQHA 4HGLA 4HVDA 1GIIA 1YW2A 4C59A 2R0UA 2NRYA 5CSXA 1DI8A 4EH9A 3F61A 4RVKA 1JBPE 2ONLC 2W5BA 2Y8OA 3TZ9A 3RVGA 1M17A 4QP7A 4J95A 4U5JA 4DHFA 5IA3A 5E8TA 4E6DA 2GNJA 4JXFA 4RX8A 5A9UA 2PTKA 3ET7A 4D2WA 4LRKA 3PFYA 5HO6A 1PF8A 2VAGA 4TWPA 2DYLA 5I3OA 3IECA 4MQ1A 4PX6A 4YO6A 4QP3A 3TACA 3GU5A 4DGMA 3QQFA 1OECA 1YQJA 2GCDA 5K4IA 3Q96A 2X0QA 4EHVA 3QRTA 3VS0A 4CFXA 3JUHA 4ZLYA 3D9VA 4EH5A 2REIA 3NUNA 4LV8A 5AV3A 2XNOA 4OW8A 4S32A 4EH6A 3LCTA 1YHVA 3LFFA 1JKLA 4FGBA 4ZOGA 4RC2A 5A4QA 2OXDA 1U46A 4AX8A 3ZFXA 3R6XA 4ZAUA 3O96A 5FM3A 3BU5A 3CPBA 4FV6A 3DBDA 5HORA 5JFSA 4ZMFA 3C1XA 5HCYA 4BDDA 4D4SA 2C30A 2BFXA 2CPKE 3HV3A 4YZMA 5B2LA 1OVEA 1U54B 2ETMA 4B4LA 4C02A 4CNHA 2GS6A 2YM7A 3V5JA 2YM5A 4O27B 3RAHA 2ERZE 2KTYA 4EQMA 5CF4A 2E2BA 3BLQA 2AYPA 4PWNA 4G3EA 3G0EA 1W2FA 2VTJA 4NK9A 3G33A 3O8TA 4QP2A 4OT5A 3W0OA 3EMGA 5CSWA 1L3RE 2VTRA 2YM4A 3Q5IA 4FKTA 3KRWA 1WBSA 3BCEA 4LGDA 4V05A 2GTNA 3PXZA 3FL4A 3LKMA 3HVCA 3HKOA 3Q53A 4FIIA 1K2PA 2WGJA 1IASA 2ITXA 2XNGA 5CNOA 2C69A 2WTKC 2Z7QA 3HRFA 3OT3A 4G6OA 4ALUA 2X0GA 3TIYA 4YHTA 1MRUA 1OL1A 3DNDA 4TYGA 4XH6A 3RKBA 4DFBA 1JOWB 3A7GA 3C0IA 3WIKA 2OJFE 4IVAA 3FMNA 1ZARA 4N6ZA 4FYOA 1SVEA 4ZTLA 2CCHA 4RZVA 4WNPA 5DN3A 1O6LA 1R0PA 2PVNA 4TPTA 4DDIA 3TV7A 4YU2A 3HYHA 3PPJA 2W1DA 4O38A 3DK7A 3E8CA 4XCUA 2F9GA 3HX4A 3QUDA 4X6QC 3OMVA 5EQPA 1YI6A 4FZDB 3DNEA 5DT4A 2VWBA 4LFIA 3DXNA 3HRCA 1PW2A 4FG9A 4TT7A 5DNRA 1LEWA 2WXVA 3KK9A 4JIKA 2OO8X 3ORNA 4U8ZA 4GEOA 1ST4A 3NFFB 4DHZA 1E1XA 3V8TA 5BYYA 2C0OA 2QC6A 1RJBA 1O9UA 2UZUE 2QKRA 4A7CA 3FLQA 4F9CA 5TF9A 2WTWA 4FKOA 2ZB0A 5FTGA 2AEGA 2WU7A 3P86A 5L8JA 4BTFA 3PRFA 3DJ6A 1B6CB 3FJQE 3E88A 4LDTA 2LGCA 1KE5A 1OIYA 2VGPA 4FSZA 4NW5A 3PXQA 4AZVA 3BGPA 4OTWA 5GJDA 3KF4A 1CSNA 4J71A 5BVEA 2HZNA 5IQFA 3VJNA 4I0RA 5J1VA 3R21A 4BCIA 2XYNA 2RG6A 1XH9A 4GS6A 3E93A 1ZOGA 3NFGB 1GY3A 1OIRA 2A1AB 4RJ4A 5KMLA 5CU2A 5J95A 3LFDA 4LI5A 4WNMA 3R9DA 2WELA 1KOAA 1GAGA 1GNGA 4WUNA 5HIBA 4ZJVA 4LV7A 2WB8A 3KVXA 2QCSA 4BDEA 3LMHA 5JZJA 1T46A 4C36A 4AGDA 3WZKA 2W1GA 3MTFA 1ZOHA 4KD1A 3TNHA 4CFUA 2ITQA 3KFAA 5L6OA 2PZYA 3CTJA 3D2KA 2W06A 3ORZA 4G17A 4YP8A 3Q9ZA 4EKLA 1JWHA 4QTBA 2C5VA 4IX3A 5DE2A 4RT7A 3U6HA 2OGVA 3W8QA 2H34A 3P5JC 2ZM4A 1MQBA 4FKQA 4I94A 3FY0A 5HG9A 5DMZA 5DEWA 4HNIA 3IW6A 1M7QA 3JXWA 3LLTA 5AP7A 4DFLA 3UODA 3LQ8A 4HYUA 4FA2A 1JPAA 3PP1A 3EZVA 3TI1A 2ONLA 4FSNA 5GNKA 3DKCA 3NUAA 2UZEA 3ENHA 3P78A 2EB3A 4C62A 4DEEA 3EL7A 1ZRZA 2QOKA 3A8WA 3NUSA 3ZCLA 1VYWA 5GIPE 5BVNA 4JI9A 2WFYA 3IG7A 3VUMA 2IVUA 2QLUA 4JL9A 3F69A 3U87A 4H58A 4QP8A 4FEQA 3QC4A 4QQCA 1UNLA 2F7EE 3Q60A 3VHEA 4L43A 1OPLA 5HCXA 2VN9A 3W2OA 4NZWB 1S9JA 4UBAA 3ATTA 3EQFA 4PTGA 3S4QA 5HX8A 4JDIA 5A4TA 4AE9A 4EHZA 3ZDIA 4I6LA 2E9VA 4I5HA 4EK4A 4LUEA 5A4CA 3M11A 3P1AA 3HP2A 4YNEA 3WZJA 3NRMA 3VN9A 3F2AA 2RSVA 4Z9LA 3PG1A 3ALNA 2Z7LA 1YDSE 3KMUA 3DQXA 4FSYA 5EDQA 4ANBA 4MWIA 2W4OA 1SVHA 4APCA 5CS6A 3QD2B 3R2YA 2YIRA 5D12A 5TT7A 2FH9A 2PVKA 5BPYA 2C6LA 5AR5A 2OZAA 1MUOA 1PMNA 2RFEA 3RPOA 4GKHA 2YWVA 4FUXA 3REPA 4IQ6A 5B2MA 5KO1A 3LFAA 2W96B 2PUIA 1Q5KA 5KMOA 4EK8A 3FI3A 2QOIA 1UWJA 3BX5A 4ZTHA 5FTQA 2VWYA 5E90A 3MI9A 3ID6C 5FLFA 1YXVA 5EM7A 2O63A 3Q2JA 5M08A 4AOIA 5JMSA 3GCSA 4L3JA 3NCZA 4AN2A 3R7YA 2PZIA 2PWLA 2BZIB 3H9RA 2QO9A 4HYHA 3JS2A 5HIDA 3U9CA 3ZM4A 1IAJA 4WG3A 4X0MA 4BICA 4FVPA 4QOXA 2WMXA 2XJ0A 3FMHA 4U42A 2WO6A 3VRYA 2XK9A 3GNIB 3GXLA 2EXMA 4BI2A 4DINA 2Z60A 5HTCA 2BCJA 2VTIA 3II5A 4ASXA 5EDPA 5IH6A 4Q5EA 3QAME 5DH3A 2JDVA 3A99A 4DBNA 3AKLA 3G6GA 4MXZA 3HECA 4N57A 2BFYA 4AUAA 4J52A 4WO5A 2RFNA 3VBYA 3C51A 2GFCA 4KB8A 1V0OA 2JIIA 3AC8A 3QGYA 4FTRA 4OTRA 1V0PA 1CTPE 4PNIA 4XG6A 3ROYA 2UW6A 5CF8A 5CYIA 4PMPA 1YI3A 1OIQA 3WF5A 2ZYBA 5C8KA 4X2FA 4NJDA 5JSMA 3UDSA 4ACMA 4BYIA 4CRSA 4O6LA 2QODA 5K3YA 3TJDA 4UYAA 4HYIA 3BE2A 1WZYA 2WU6A 3ZLWA 5KKRB 2G9XA 1GZNA 1A48A 2X0PA 2YEXA 2VWIA 4ZSGA 3AGMA 4RIXB 5A6NA 4FL2A 2UZWE 3S0OA 4FKLA 5AR3A 3D83A 1FOTA 2XK6A 3OCGA 1UKIA 5LVPA 2XKDA 4IX5A 4CTCA 1OI9A 3G9NA 4RIXA 5AP5A 3U51A 3ZEWA 4BVUA 2RF9A 1Q99A 5IZFA 1XBBA 4DA5A 4GUBA 4AZTA 4OTFA 3IK3A 1Z57A 2HWPA 3HLLA 3NUPA 3ZTXA 4CKJA 2GNLA 4CCUA 4W9WA 1J7LA 4KBAA 4EQCA 5L2WA 2E9PA 4ZS0A 5D11A 3FZRA 2PK9A 1IR3A 2UZOA 1XBCA 2QHNA 5IQHA 2QU6A 2B9HA 4O86A 2P55A 3AC2A 3POOA 3SD0A 4EOPA 4RIWA 3W0NA 4CZUA 4MD7E 3QRJA 4YJOA 2C0TA 4ANLA 4ASDA 1ZMVA 4BCOA 1P2AA 4Y83A 2YLFA 4QMOA 4WSQA 4BWKA 4F70A 5HNIX 1ZY4A 3BQRA 5BNJA 1CKIA 4CMUA 3EYHA 3L9LA 3HNGA 3AKJA 5J8IA 2JLDA 3QD3A 3CR0A 4D9TA 4F1TA 5JK3A 1ZWSA 3SW7A 2CMWA 4UY9A 4FNXA 3QX4A 4O2ZA 3FLWA 2C1BA 2PULA 4IAKA 5DBXA 4MUQA 3EFLA 4GH2A 1J91A 3QFVA 1UNHA 2UVZA 3F5XA 2VWUA 4R7IA 4JG6A 1BI8A 3RK7A 3HAVA 4R78A 1M52A 4IB0A 2WTIA 3DQWA 5CX9A 3QTWA 3DT1A 3FZSA 2R3HA 3VBQA 3B2TA 4FV7A 3UO5A 3UDTA 3QQLA 5AP4A 2X8DA 3W0MA 3KXHA