2X2LA

Crystal structure of phosphorylated ret tyrosine kinase domain with inhibitor
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
311
structure length
287
Chain Sequence
GPLSLSVDAFKILPKWEFPRKNLVLGKTLGEGEFGKVVKATAFHLKGRAGYTTVAVKMLKENASPSELRDLLSEFNVLKQVNHPHVIKLYGACSQDGPLLLIVEYAKYGSLRGFLRESRKVRALTMGDLISFAWQISQGMQYLAEMKLVHRDLAARNILVAEGRKMKISDFGLSRDVYEEDSVKRSQGRIPVKWMAIESLFDHIYTTQSDVWSFGVLLWEIVTLGGNPYPGIPPERLFNLLKTGHRMERPDNCSEEMYRLMLQCWKQEPDKRPVFADISKDLEKMMV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords PROTO-ONCOGENE TYROSINE-PROTEIN KINASE RECEPTOR RET
publication title Synthesis, structure-activity relationship and crystallographic studies of 3-substituted indolin-2-one RET inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 89
structure length 287
sequence length 311
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2010-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2x2lA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2x2lA01
3KXXA 5BQ0A 3OFMA 4IZ7A 3COHA 2XBJA 3KRRA 1FOTA 4FKRA 3BLQA 3FLQA 4G3GA 4OTFA 4AG8A 3HNGA 5FBNC 1XHAA 5HZNA 2OK1A 2H6DA 4JDKA 4QPSA 4F7NA 3DZOA 5CU0A 5IQEA 4MVFA 3QC9A 2B9FA 3BI6A 3ZFYA 5DI1A 3ZLYA 1H27A 4B0GA 3QHRA 4EUUA 1IAHA 3PA3A 5IA4A 1GNGA 4BTMA 3K5VA 4NCTA 4XLIA 4YJTA 4F6UA 4EC8A 3QTXA 3P7AA 1B6CB 4H1MA 5BVFA 1YXSA 2IVSA 2WQEA 2PVHA 3QBNA 4FZ6A 3NRMA 3WZEA 3U9NA 1OKVA 4BIEA 3FI4A 4H58A 2UZOA 3EQRA 4M69A 4NW6A 2O0UA 3C0HA 4U44A 4ALWA 1H24A 3BCEA 4EQUA 3BE9A 5HLPA 4KIOA 3RM6A 2OZAA 3E62A 1YXTA 3TKHA 3ZC5A 2BZIB 4DEIA 2I0HA 4I6BA 5C27A 2PMNX 3EQPA 2XK6A 3MDYA 4PTCA 4IZAA 3C9WA 5IU2A 2UV2A 2QCSA 2W1DA 3FZOA 1YDRE 2WTIA 2Y9QA 3SXRA 3NW7A 4LRKA 5DH3A 5HEZA 2WMXA 4Y72A 1H1SA 4C4HA 3EMGA 4OBOA 5C4LA 2IG7A 2C5YA 4YTHA 3AGLA 2VU3A 3B2WA 4FUXA 4NKSA 5H9BA 3VF9A 1H1RA 4F64A 4ZZOA 2OFUA 4USDA 4L8MA 4IFGA 3DTWA 3F69A 3ENMA 4FIEA 4BIDA 3VUTA 5H8BA 4QMWA 4JQ8A 4EHEA 3W10A 4U42A 4D1XA 4DN5A 3QUDA 4I4EA 3DJ5A 4XX9A 4GS6A 3KVWA 1VEBA 4V04A 3QGWA 4RLLA 3ITZA 3F88A 2BAJA 1J7IA 4PL3A 1Q41A 2DYLA 1UA2A 1IEPA 2HXLA 4FMQA 3W33A 2X81A 3HDNA 4F63A 3Q04A 3F7WA 5CF4A 4N6ZA 3PIXA 5ANJA 4CRLA 2VX0A 3VIDA 3MTFA 3CJGA 4R78A 4BB4A 1JVPP 3MVHA 4F6SA 4W9WA 5EYKA 3UDBA 2WKMA 3DLSA 3KU2A 5DBXA 3IO7A 3UZTA 3DU8A 2BZKB 3CD8A 5CASA 2RG5A 5J7BA 2R3IA 3HLLA 3V5WA 4FTNA 3GC8A 4AN2A 1GZOA 4IBMA 3BU3A 4V05A 4CXAA 3LJ2A 4CCBA 1PYEA 3TACA 5LWNA 2XCKA 3ZMMA 3BYOA 4X6QC 3FWQA 1FMOE 3L8XA 3LMGA 3R73A 4QP7A 2YIWA 3MH2A 2XKFA 4FNZA 5M56A 3C0IA 3O2MA 4C4GA 2Q0NA 4XG2A 2VTTA 3FHRA 4H1JA 3NNUA 3BRBA 2A27A 1B39A 3OXIA 2HZ4A 5D1JA 4R3CA 3D2IA 1JAMA 1AD5A 3NDMA 4E5WA 4EOIA 5JFWA 3R9RA 1YOJA 4KIKA 3OCTA 2SRCA 2YM4A 4LG4A 2J0IA 4AA0A 3WI6A 4CCUA 4JIKA 4RIOA 3HAVA 4KKHA 3M42A 3OF0A 4JAIA 4L00A 2W5AA 4S31A 3MY0A 5IH4A 2Z2WA 1YXUA 2QOIA 3Q4TA 4RIWB 3R63A 4BGGA 4FE2A 4D28A 2HY0A 4J97A 2ACXA 4KRCA 3GCUA 4EK3A 4AA5A 1LR4A 3HVCA 4FNXA 5A6NA 4QO9A 1YVJA 4JRVA 4O7YA 3VBVA 4HVDA 1SM2A 1H8FA 1QMZA 4AN9A 4DEDA 5FDXA 2UVZA 3O96A 4O0WA 5AAFA 3UPZA 4R8QA 2R3PA 4JDHA 4F1OA 3CD3A 5A6OA 1BUHA 4L6QA 4EKLA 3FDNA 5HIEA 2BZJA 1IAJA 4QMPA 3EQHA 4X3FB 1SNUA 3ANRA 5DHJA 2J51A 2PE1A 5HBEA 3NYXA 4FKQA 4H3QA 5HNBA 3G6GA 3I6UA 3EQCA 2AUHA 3KRLA 4FEVA 4KS8A 3A99A 3NMUF 2H8HA 5CTPA 5K0XA 3OXTA 1U59A 3QCYA 2FB8A 2X7OA 1ZYDA 4FYNA 5IUIA 4RZVA 3R8PA 4H3PA 3KGAA 1TKIA 5EHOA 3IOKA 3FJQE 4O1OA 4ZSEA 4L01A 5L2IA 3FMMA 3TT0A 3DB6A 2R7IA 4ARKA 4DH1A 4A07A 2BTSA 3CEKA 4AZTA 3SHEA 5CT0A 3HRFA 3EFJA 5EM7A 3VQHA 5CS6A 3FLNC 1OM1A 3I0QA 2BZHB 3BGQA 2QOKA 3ZDUA 4K2RA 3PIYA 1H08A 4IAIA 2QLUA 5I9YA 4CRSA 4E6CA 2WQOA 5E8ZA 3VQUA 4FI1A 4HGTA 2V5QA 2JBOA 5CQWA 3RHXA 4FTCA 1Y91A 3U4UA 4V0GB 5CSWA 3ZM4A 5AR4A 4JAJA 4TYGA 2PZRA 4D9UA 4AS0A 3RTPA 4CT2A 4RIXB 1YXVA 2GS7A 4C38A 4BDCA 4D4VA 2UZLA 4YJVA 2YN8A 3CPBA 3PA5A 5BVNA 5LVOA 1NVSA 4XG7A 3VS0A 4FV0A 4LRMA 3FMDA 3V6RA 4BDDA 4BI1A 4X21A 4RWJA 1DS5A 2BILB 5FG8A 3QX2A 4EL9A 5L6PA 3PPJA 2F57A 5CEQA 2J9MA 5BVKA 2VTLA 2XK8A 5EHLA 4E4NA 4O7WA 4MNFA 3KMWA 5CXZA 3LJ0A 1CDKA 1H4LA 5JK3A 5CWZA 2ESMA 5CYIA 4PMTA 2GFCA 4FKOA 4OBQA 4QT1A 4W8EA 4ANQA 1FVRA 4EWHA 1WBTA 3BV2A 4FKSA 4EQCA 1UU8A 2PZPA 3PP0A 5AUYA 3PPZA 5LMBA 2CGXA 3QTSA 4W4YA 4NIFB 3QD3A 2PVRA 3I4BA 2XIRA 5C8KA 5CENA 4MNEA 2BRHA 5BUJA 2WXVA 3QZGA 5D7VA 4BGQA 4Z16A 4G9CA 4Z55A 4EJ7A 3LFDA 1FQ1B 3DPKA 5HE2A 3U8WA 4L46A 4OUCA 5G1XA 3JVRA 3Q5IA 4PTEA 4M8TA 4M84A 4N6YA 5J79A 4EWQA 2XK4A 2BIYA 3DV3A 3NNXA 4WHZA 5CALA 3LM0A 4QD6A 3LXPA 2C30A 2P33A 3KCFA 3LQ5A 4GJ3A 3TI1A 4J53A 4QOXA 3QC4A 4TYJA 4C62A 4CQGA 5KNJA 1URWA 2VWVA 4TPTA 4BBFA 2GHMA 2UW9A 3BHHA 5EDRA 3EN4A 2X1NA 4U80A 2WOUA 3ACJA 4FKGA 4GUBA 1E9HA 3EB0A 3V3VA 5CAPA 3UQGA 4CSVA 5L4QA 4TYHA 2RGPA 2WTKC 5HD7A 2AC3A 4E20A 5FXSA 4MWIA 3W2OA 5L8JA 4RIYB 4DGMA 3R1NA 5IF1A 1PXOA 2OLCA 4YJOA 4YR8A 4DH8A 3UNKA 4DBNA 3MI9A 4ACHA 4ZSJA 3V01A 3PZHA 5M4IA 4K1BA 1GJOA 5DN3A 5FQDC 2WO6A 2W06A 3EN7A 1BL6A 4GUEA 3TTJA 4HOKA 2J5FA 4RFMA 4H39A 4LL0A 3PIZA 4ZY6A 1W84A 2EXMA 2WMRA 3POOA 4WNPA 1M2PA 4Y8DA 3P4KA 2WTKB 3MIYA 4UYNA 3S95A 5M4FA 2JAVA 2PTKA 4BICA 1B38A 3BLHA 3GT8A 3BZ3A 1T45A 2VTPA 3CPCA 4GT4A 4WO5A 4BDGA 3SVVA 4N57A 4GG5A 3BQCA 1W83A 2QI8A 3PVBA 5E1SA 5HE1A 2HZ0A 5K0KA 3AXWA 3RPVA 4CD0A 3U9CA 2R3LA 3WIKA 4XG6A 2ITPA 4BCIA 4EEVA 3DQWA 4ZY4A 4P90A 2VGPA 4L52A 2ZYBA 4OTDA 5AP0A 4S32A 4IANA 3AC3A 2F49A 3E5AA 3KXNA 2XKDA 5A4EA 2QG7A 1S9IA 4TY1A 2XCHA 2BAQA 4KKGA 4GK3A 1WVWA 5HBJA 3K2LA 4LUEA 4WNOA 2I7QA 4Y95A 4ZLYA 2X8IA 3DOGA 4D4SA 2VTSA 1PMEA 3UTOA 2QO7A 4ZZNA 3VS6A 4G3FA 5HU3A 2CKPA 5EDQA 3D15A 3PE1A 4XHKB 3MESA 4O6LA 3MJ2A 2W0JA 4CKIA 5M4UA 3VF8A 2WQNA 5ETAA 4TL0A 4MXZA 5JN2A 3FEGA 1J3HA 3R83A 5AM7A 5J8IA 4GVJA 4JG6A 5F20A 1IA8A 4CV9A 3RM7A 4AT4A 5AUWA 4WA9A 4DFXE 2OXYA 4E6AA 5KMJA 2FSTX 3OZ6A 1BLXA 1SNXA 2RFDA 3FMEA 5HO6A 1Q24A 3F2NA 4FTLA 2PZIA 1UNLA 5JGAA 1R0EA 3QU0A 1AGWA 5HCZA 1H1QA 3BPRA 1JNKA 2ITVA 3MS9A 5EG3A 2HOGA 2QOBA 1XWSA 2XJ0A 3DFCB 2UW8A 4FTIA 3I79A 5JRSA 4TXCA 3OD6X 2OH0E 3PDTA 3Q5ZA 4NL0A 3E8DA 3V5TA 1XH4A 2J7TA 4FK3A 2ITYA 4XP2A 3I5NA 3DBCA 2HWOA 2UZBA 4L67A 3FPMA 3OBJA 3TNHA 5L2SA 4FTKA 3PJ1A 4X6RA 5FBOA 4LOPA 4ZOGA 5AP7A 2W1CA 3KFAA 4MCVA 3DZQA 3S2PA 5H3QA 1M7NA 3KULA 3R7UA 2EXCX 2P3GX 5HVJA 5HCYA 3P7BA 5HG5A 1JBPE 3BX5A 4FNWA 4C4JA 4ORKA 5CF6A 4FSWA 3CIKA 4PDYA 1G3NA 3GGFA 3HP5A 4X7QA 3TNPC 2HENA 3ZRLA 2PMIA 4FTQA 1PKGA 2IZRA 4F9CA 5AMNA 5CSPA 3GXLA 2JDVA 2XIXA 3FQHA 5E8TA 1MUOA 3VS1A 3PSBA 3CC6A 2GDOA 4IX5A 4D2TA 1URCA 3MVMA 3C4XA 4BDHA 4O81A 2RL5A 2WMSA 4YTCA 2O2UA 2J2IB 1W8CA 4MX9A 2W9ZB 5DRDA 5ETFA 4E26A 3BHVA 3LCDA 1ZMVA 3KQ7A 1Q8ZA 4BCGA 2PMLX 4CFMA 4F99A 4CZTA 4YPSA 3FXWA 4E7WA 5CAOA 1WBWA 4IJ9A 3R04A 1YWVA 2YDKA 4C4EA 3OY1A 3EYHA 4ZZMA 4NH1A 4A7CA 2YZLA 4FOCA 3C50A 4PPBA 3F61A 5HVYA 4EZ3A 2OIBA 4U41A 4RA4A 4RZWA 3JY9A 4YBKA 4FV4A 3A7IA 2UVYA 3FI3A 2Z7RA 3A62A 4MXAA 4WNMA 3R9NA 5KMOA 4FEXA 1I09A 1XH5A 4I0TA 5LQFA 3QLGA 3KRXA 4EH9A 2JAMA 3D9VA 2BRNA 4OT6A 3RVGA 3KCKA 4B6LA 5J7HA 3BU5A 3VW6A 4APCA 4ACCA 4G3DA 2OJJA 2VTAA 2VX1A 3P1AA 4K18A 4C35A 2VTIA 2QOFA 5E8XA 5DEYA 5HVKA 3SW4A 1RJBA 3LM5A 1OPJA 4AZSA 3Q2JA 3PTGA 3Q9WA 3BWJA 3R9DA 5IEXA 1ZYSA 2E9PA 4CNHA 5AR5A 4I3ZA 4D1ZA 4M0YA 4FZAB 2XKCA 5C9CA 5AX3A 5IA5A 2XM9A 1WBSA 3E8NA 3H3CA 3BBTB 2BALA 2FSMX 2VN9A 3JVSA 2CCHA 4MF1A 2WQBA 5M57A 3LCOA 4J98A 3F3UA 1QPCA 4M12A 4YZMA 1PXIA 4GU9A 3UZPA 4EYJA 3AMAA 3KXZA 3MH1A 3C4WA 4P4CA 3UOLA 1FVTA 3CTHA 2PVNA 4YSMA 4PRJA 3NUXA 5HE0A 4FTAA 3BYUA 5TO8A 3ZBXA 4IM2A 2PVMA 2W05A 5M51A 1UU7A 1OL5A 4L68A 4M0ZA 3RBWA 4E5AX 4DA5A 3MV5A 4L45A 4UV0A 4XG9A 5CU3A 4BTFA 3OT8A 2UZEA 5GHVA 3OT3A 4MXOA 4O0XA 3LW0A 1ZWSA 3MSSA 3RWPA 5A4QA 4CQEA 1PF8A 4I5HA 1H01A 5HG8A 3KA0A 1KOAA 3SRVB 5C01A 4BDEA 5AV4A 4RWIA 3MPTA 2JIIA 3E63A 4IM3A 4GV1A 3QQKA 4ZMEA 4KWPA 4AGUA 2ITNA 2R7BA 2OJIA 4ONAA 3C0GA 3HV5A 2CN8A 3B8RA 3N9XA 4E4MA 3UIMA 4RWLA 5HIDA 4JVGA 2WD1A 3AC4A 2ZV9A 3NUNA 4FSQA 3UMXA 2F7ZE 3N4VA 3CSVA 3DKGA 4D2WA 1JQHA 3SC1A 2Z7QA 2PUPA 4CZUA 3C4CA 3CGOA 4MHAA 4EOMA 4F9AA 4EH5A 4BI2A 4GFOA 1LUFA 4Z3VA 4EOLA 3NUAA 3P86A 4DG0E 4D2SA 3KXHA 2PPQA 3EHAA 4XCUA 3RK9A 4FV6A 3H10A 3AD5A 5E1EA 3ZONA 2H34A 4O7NA 1OIYA 5GNKA 2VWZA 4APPA 5BYYA 4RG0A 2YA9A 1YWRA 3P0MA 4U81A 3PJ3A 1FVVA 4USFA 3RK7A 1LEZA 4G3CA 1RW8A 3FLZA 4XLVA 1BI8A 4OTRA 5JFXA 2FH9A 3TKUA 4QMOA 3PZEA 1RE8A 2NP8A 4FODA 4XBUA 3NAYA 4YZ9A 1E1VA 5AAEA 3SOAA 3E3BX 4ASXA 2ZV2A 2WEIA 3DNDA 1PKDA 4I6FA 4XBRA 3UYSA 3GU8A 4FSRA 2YM6A 5M44A 4IADA 1Y8YA 4O2ZA 4UMTA 1P2AA 1ND4A 4PNKA 2CKQA 2WNTA 3PJ8A 3RAWA 4QQCA 2OW3A 4HPUE 4ZAUA 2WMBA 4Y46A 5IQAA 4R6VA 4IAZA 1KE9A 2PVJA 3SX9A 3V51A 3FZSA 4PP9A 3NYOA 4DBXA 2C0IA 3VS7A 3RK5A 4RIWA 3TDVA 4WG4A 5L2TA 3MGYA 4LMUA 3FXXA 4MBJA 2UZWE 3QCXA 2IO6A 4O7RA 2W1IA 4EK5A 4EK4A 4J8MA 2VWBA 1BI7A 3GFEA 5H2UA 3AT4A 2ZDTA 4RPVA 1JKSA 4IDVA 3LFEA 5DVRA 4G3EA 2PVYA 2CNVA 2O65A 4HYHA 1IG1A 3PFQA 3UOKA 5HX6A 1OIUA 3PY1A 3DAEA 5CF5A 3RCJA 4X3FA 1O6KA 5L6OA 1CM8A 1XJDA 3DK6A 1MQ4A 2X4ZA 3ID6C 4H36A 4DTKA 4FT9A 1VZOA 1M52A 4TNDA 4D1SA 3WIGA 2R9SA 4IB1A 4X3JA 2CPKE 4BKZA 4ZS4A 3UP7A 4YJSA 1T46A 2R3OA 2UW5A 2BDJA 3AQVA 3FKLA 2OJFE 5IKWA 1QL6A 3F2AA 3FSKA 4YZCA 4JX7A 4JIAA 2XA4A 4JDJA 1REJA 4ANNA 3W2QA 2YIXA 4X2NA 5DOSA 2VD5A 2DQ7X 2IWIA 3SA0A 3UJGA 2JDTA 1G8AA 2IVVA 2W1HA 4BBEA 4CGAA 5FXRA 1JSUA 3L1SA 3FMKA 4RVLA 4IB0A 4IX6A 3OTVA 3ZOSA 4BBMA 4YLJA 4HZSA 3V5QA 3HAMA 3UC4A 4V0GA 3EFWA 4UWYA 4DLIA 2XYNA 4R7BA 4DGOA 4UXQA 2YERA 4RIXA 4PDSA 3NAXA 3VO3A 1PMNA 3S0OA 5I3RA 4XYFA 2G2HA 3KN6A 4QP6A 2VZ6A 4RJ3A 3IPHA 4BCOA 3RAHA 4DT8A 4NJ3A 4NU1A 5JQ5A 3FI2A 5E8UA 4J8NA 4LI5A 3UIXA 3D7ZA 3GOKA 2W1ZA 3NNVA 4PF4A 3EN9A 4XG3A 3L9NA 5M55A 3DS6A 4AA4A 5KKRC 2R3MA 1Q3WA 2JBPA 3AMYA 5H8EA 3FLYA 2ITQA 3ZUVA 1UNGA 3MPAA 4Y73A 4FT0A 4FG7A 4FGBA 5DA3A 2YIRA 4QTDA 2OKRA 4XG8A 1W7HA 4K33A 3MH0A 5DR2A 3CKWA 3AG9A 4M13A 4R3RA 4XUFA 2A19B 3FL4A 3OCGA 5JSMA 4JJRA 4MWHA 2BAKA 1XO2B 3R7GA 3UE4A 4DEEA 5KKRB 5HX8A 5IPJA 4O2PA 4XEYA 4NIFA 4C0TA 3G0EA 1ZARA 2C5XA 5I0BA 2A2AA 3QA0A 4I20A 4U45A 4D2RA 5FWKK 3COMA 2R3HA 1Q5KA 3PXKA 5K4JA 2GQGA 5KZIA 4GSBA 2C6MA 4F0GA 5IA1A 1TVOA 2ONLC 4C8BA 4E5BA 4U9AA 4EOSA 1QPDA 4E6QA 3Q60A 2C3KA 2UW0A 2VO0A 4O1PA 5HG9A 4RRVA 4I93A 4FSUA 3BHTA 3UVQA 3O51A 4CFNA 5I9UA 3ROYA 4PL4A 4CG9A 4O0VA 1L3RE 3QQLA 4QTCA 3D7TB 4F7LA 3TEIA 3QQHA 4EHVA 3NVMB 5ANOA 3A4OX 2B54A 4QNAA 2R3RA 2CKEA 5FXQA 3ZM9A 3NCZA 4ZSGA 3BWFA 4DG3E 2WTWA 4O6EA 2VTOA 4ALUA 1ZY4A 4FYOA 2CNQA 5JQ8A 3VS5A 3A7HA 4EK6A 2QONA 3VBXA 2C3IB 2J4ZA 2NNWB 3ORZA 4L3JA 1WCCA 2ITUA 2JITA 5EQYA 4FEUA 3U6JA 3MFTA 2QOLA 4L43A 1M7QA 4XS2A 3CTJA 4FT3A 4MQ2A 5DRBA 5D9HA 4FT5A 3QZHA 4C57A 5J5SA 3ANQA 4I5MA 3EYGA 4KAOA 3UQFA 4USEA 4AZWA 5FGKA 4NFNA 1DM2A 4ZSLA 3MPMA 1A9UA 3EKKA 2XEYA 4HYSA 4BDJA 2WTCA 3IDPA 1A48A 3B8QA 3CTQA 5IQCA 4IAKA 5B7VA 4L42A 4O0RA 3FQSA 3PE2A 5HE3A 2C47A 3I7CA 2G1TA 1Q8WA 5EI2A 2IZUA 4UYAA 3REPA 3W2PA 2BHEA 5BMSA 3VJOA 3ZLXA 2BRMA 3Q4CA 2UW6A 5L2QA 4GK4A 5E8WA 4DFBA 3VUKA 4RT7A 4MYGA 4RX8A 2PHKA 2YDJA 4QYGA 1WMKA 2CMWA 4YBJA 5HD4A 2BUJA 5D7AA 4O96A 3PXQA 4XRJA 4ZTSA 1H25A 4R5YA 4NM3A 4D5HA 4FKPA 4WRSA 4JT3A 1J1CA 1HCKA 2R2PA 3EWHA 3SOCA 3SW7A 2X8DA 3WBLA 3WF6A 5GJDA 4A4LA 3MY5A 3GUBA 5AV1A 2CLXA 1R78A 1VYZA 2YCRA 3FLSA 3Q9XA 4QQJA 2YISA 3I60A 3HV7A 4KS7A 1GIIA 2OF4A 5CEMA 3MWUA 3T9IA 4PX6A 2JKKA 4PY1A 2QR7A 2W4KA 3LIJA 3PWDA 4DYMA 2W96B 3TV4A 2ZB0A 4UMPA 2HELA 3E88A 2QR8A 4IAYA 4O83A 3GOPA 5GJFA 5TKDA 5IZFA 2R3GA 4UB7A 3LE6A 3R7YA 4BTJA 5HLNA 3VBYA 3SG9A 4DAWA 4QTAA 3FC1X 3S00A 1UWHA 5EW8A 2Y8OA 4K0YA 4YSJA 4YP8A 3QFVA 4WG3A 4LL5A 4O0TA 5DFPA 2BFYA 5TR6A 3QRJA 2QKWB 5ANDA 5KBRA 4FR4A 5ETCA 5L8LA 4RX9A 2PYWA 3SXSA 5M08A 3FMLA 5HESA 2WZJA 3WZUA 2Y6MA 3FL5A 3EIDA 3IDCA 3NLBA 4W9XA 2UZDA 2XNMA 5IQDA 2O64A 3OTUA 3TDWA 2BCJA 3ZC6A 4IQ6A 1U54B 3EH9A 3RP9A 1R3CA 1Q62A 3ZZEA 3BYVA 3LLAA 4QMNA 4YNOA 2WTJA 1O6YA 4R77A 4FSNA 4DEAA 3F5GA 4IWOA 3ZCLA 5KMNA 3ZO2A 3Q96A 5IQGA 3W8QA 2RKUA 4EH8A 2GQSA 2ZMDA 4GU6A 2C5VA 5HNIX 4QPMA 5K3YA 1JKTA 1XBCA 3OCSA 1YOMA 4G16A 5DPVA 5AM6A 4O0YA 4BYJA 2PULA 5C1QB 4BCHA 1XH7A 3LQ3A 3R8MA 1UNHA 4GJ2A 4RVTA 3VHKA 2ITWA 4UY9A 3E87A 3LFSA 3RALA 1GIJA 3NSZA 5KHXA 4OTWA 4ZSAA 2IPXA 5DLSA 3QD0A 1ZXEA 1ZY5A 2BDWA 4IX4A 3N4TA 4EORA 3QAME 3ZDIA 3CY2A 5E8YA 1IA9A 5IEVA 5BYLA 1H1PA 5EQEA 2O3PA 3O7LB 3NVKI 3OUKA 4L3PA 2XK3A 3W32A 2XIZA 4GIHA 3II5A 2BKZA 3PVWA 4TW9A 3VUHA 2W7XA 4IC7A 2WMWA 4CTBA 4DCEA 2F7XE 3BQRA 4AE6A 3PLSA 3NYVA 5CSXA 1PHKA 1LPUA 4N4SA 4DTAA 2YFXA 2DS1A 5GZAA 3UG1A 5AR2A 5AWMA 1ERKA 3NNWA 5IQFA 2P4IA 3A7FA 3F66A 1JKLA 3FI8A 2CDZA 3NZ0A 2W5BA 3HP2A 3LHJA 4CMOA 4HGLA 4AT5A 5HIBA 4A4OA 5BVDA 3ZTXA 5T68A 3VS4A 4JR7A 5K9IA 3VUIA 5BPYA 2X0GA 2GNJA 4LFIA 4GIIA 1QPEA 4EZ7A 4QYFA 5CVFA 1LP4A 4BKJA 5EI8A 3Q6UA 3CQWA 3QTRA 4FIHA 4QP4A 3ZS5A 4A9SA 3IKAA 4GYGA 2HK5A 3UGCA 3G5DA 3JS2A 2YIYA 4PMPA 3O0GA 4GKHA 2B52A 1Z9XA 2OGVA 1YDSE 1ZMUA 3T9TA 3E8CA 3W2SA 2OFVA 3L8PA 3VS2A 1SMHA 3D2KA 2E9OA 1J91A 5AX9A 2GNLA 3E8EA 3C4FA 3QYZA 3V5LA 5HU9A 4ANLA 5CNOA 4CFFA 1CMKE 2XRUA 3FLWA 4GL9A 3QQUA 3R7OA 1ZOGA 4M67A 1RDQE 2OWBA 4YUQA 2CN5A 4BYIA 3MTLA 1H0VA 4FKIA 4O7VA 3G15A 4C59A 2A4LA 4JDIA 1ZYJA 3A4PA 4G6NA 3KF7A 1WBNA 4LGDA 2ERKA 4DEBA 1QPJA 3NUPA 3EN6A 2WPAA 3GCPA 1R1WA 3DQXA 3SRVA 4FV1A 4DFUA 5ANIA 5A46A 2R4BA 4Q9ZA 3TNWA 2Y6OA 4UZDA 3H0ZA 3ZYAA 4C58A 3R22A 4EOJA 2YM3A 4CLJA 4K8AA 4EH2A 3FSFA 3PYYA 4OGRA 4YPDA 4JLCA 2GS2A 2OIQA 3P23A 4QP9A 5LCJA 4O0UA 3R71A 5C8MA 4K77A 3DAJA 4O86A 4AUAA 4C2WA 5CANA 1H07A 4C36A 1REKA 4NTSA 3ZXTA 4KNBA 2IW9A 4D9TA 4LV8A 3ORIA 5HLWA 4QQ5A 2YLEA 4PTGA 1K3AA 3FYKX 3A7JA 4EUTA 4BCFA 2VO7A 3GI3A 1Q97A 2WELA 2UW4A 3C1XA 2GNGA 2UUEA 4ZJJA 4Z9LA 3RPYA 2XB7A 3KRWA 4FSTA 4F9WA 5AA9A 5HGIA 5GJGA 4AW5A 2YCSA 2R0IA 3FMNA 4AZFA 4EK8A 2OG8A 4LOQA 3LCSA 3TIZA 3ZBFA 4CYIA 4YU2A 1CKPA 3FXZA 4ERKA 1PYXA 3LKMA 5AP2A 5KX8A 1P4FA 2GNFA 3DDQA 3F5UA 4U6RA 4W4WA 4DFZE 4N70A 4RX7A 3QQFA 4C34A 3GC7A 2JIVA 4CVAA 3QL8A 5I9ZA 5IMEA 3PJCA 1ZRZA 3DFAA 2GTNA 4BCMA 2VWUA 3GQLA 4NM0A 4BZDA 1OVEA 3UO4A 2IVTA 3GU5A 4O0SA 5DT0A 4AOJA 4GVAA 1Q3DA 1IASA 3I0OA 3LVPA 3SLSA 4FV8A 2VTHA 3FMHA 3WYYA 3EL8A 4FSMA 5JEBA 5JKGA 2C68A 1GY3A 3TCPA 4YO6A 3A2CA 1XQZA 2JC6A 4ALVA 2W4OA 2QO9A 2OXXA 2IZTA 4FKLA 3KEXA 4FVQA 1NY3A 4KIQA 3DXQA 4IACA 2ZOQA 2Y0AA 4ASDA 4BCQA 4EOPA 4UMRA 1DI8A 3OWLA 1FMKA 5A54A 3V8SA 1OL7A 3EFKA 3QTUA 2J5EA 4NM7A 1G5SA 1PMVA 4IZ5A 2CLQA 3QZIA 4QMSA 2XRWA 5CQUA 2FA2A 4ITHA 3R21A 1Y8GA 2CKOA 3D5UA 3ORPA 2G2IA 4OLIA 5D11A 2PY3A 4HVIA 1Q99A 4JL9A 4OT5A 2JFLA 5DNRA 4QQTA 5LCKA 1KV2A 4JG8A 3LLTA 4J95A 4KD1A 5HHWA 5IUGA 3IOPA 4HYUA 1OECA 3EOCA 4QMXA 5TT7A 3ULZA 5B2LA 4RVMA 5A4CA 1ZLTA 4E93A 1KUTA 1PY5A 4NW5A 2X7FA 1H26A 2GTMA 3ACKA 5E7RA 3CS9A 2QURA 5EKOA 2X7GA 5J1VA 1H0WA 3QD4A 5AP1A 4AOTA 4J99A 1PRYA 3IGOA 4OW8A 3VVHA 3W18A 3WARA 5HTCA 5KUPA 4Q9SA 3PY3A 4RBLA 2GHLA 4ANOA 5J95A 4O7TA 1OL1A 4TWPA 1KSWA 3LXLA 4EKKA 3AOXA 4HCTA 3VRYA 2B7AA 3VULA 5BUEA 3E7VA 3BKBA 1M17A 2ZV7A 4OTGA 3UBDA 4B9DA 5AFVA 3BHUA 4QRCA 4RJ8A 3E92A 2C3JA 4FT7A 3ZUTA 4IFCA 4MAOA 4FIIA 4DEGA 4BI0A 2G9XA 2P2IA 2VTQA 5E9EA 4DINA 2ZB1A 4KA3A 4LGHA 2X4FA 2YM5A 1JPAA 4FG9A 3VRZA 4UX9A 3CXWA 2XNPA 3G90X 1KOBA 4EZ5A 1MQBA 2B9IA 3CBLA 4XH6A 1A06A 2E9VA 3LAUA 4RA5A 1OIQA 4FKTA 4QYEA 1V0OA 2W4JA 5ACBC 3K5UA 1VJYA 2GNHA 3V8WA 3A60A 3OCBA 3QUEA 1YKRA 3TXOA 3VC4A 3ZU7A 4IVDA 3PXRA 4FSYA 5JMSA 4ZJVA 5I3OA 3HMMA 2XUUA 3S1HA 1I44A 4HGSA 1SVGA 4HJOA 3PRFA 4ASEA 3KB7A 4C33A 1W98A 3AMBA 3GU6A 5F94A 3ALOA 4W8DA 2YCFA 2W9FB 2GS6A 2Z8CA 3PPKA 5DGZA 4AACA 5KCVA 4QP8A 5IUHA 4ACMA 1OIRA 1E1XA 1JWHA 3I81A 3TTIA 4BCPA 3RMFA 2ZJWA 3A61A 3WE8A 3K3JA 4E4LA 4F70A 4ITJA 4P5QA 3DXNA 3QCSA 5CSVA 3UVRA 2GQRA 3GBZA 5CEKA 4QTEA 1YXXA 5CEOA 4FV9A 4FV3A 4AN3A 4KBAA 4Y85A 3IECA 3BELA 4FK6A 3FV8A 4B4LA 2YAAA 3L9PA 5AP3A 3GEQA 4I0SA 3ETAA 4OTHA 5AIKA 4AOIA 2HZIA 4BGHA 2Z02A 3PUPA 4MNEB 3KK9A 3GCSA 5TE0A 1V1KA 1FGIA 3KL8A 4W4XA 3PWYA 4FIFA 4FTTA 4IW0A 4C4IA 3KREA 2WMTA 2OXDA 2FVDA 3DLZA 3EQIA 3RPSA 1PXJA 3R2BA 1OL6A 2YHVA 2ONLA 2PSQA 2QO2A 4LOOA 4N0SA 4ID7A 5J87A 4C61A 5D12A 4S30A 4FF8A 2X6DA 3DJ6A 4L7SA 1STCE 2ZAZA 2VGOA 4NSTA 2WQMA 4IHPA 4K9YA 5KMMA 4RSSA 4NJDA 5AUVA 1WAKA 2ERZE 2V7OA 4Q5HA 1Q8UA 3HV3A 5EFQA 1QCFA 1UKIA 1ZMWA 5CU2A 2FGIA 4GRBA 4IVBA 1X8BA 2JKOA 4TYHB 2VUWA 3PY0A 5K5NA 2CGVA 3ZSIA 1GAGA 5A14A 5J9YA 4DH7A 4AP7A 3P7CA 4BFMA 4M97A 2QNJA 4I0RA 2FO0A 4MKCA 2VNWA 3MW1A 5CEIA 2Z7LA 3HGKA 2UZUE 4U5JA 4CKRA 2GHGA 2H9VA 4O38A 4GH2A 4RJ5A 1CKIA 4W4VA 4JX3A 3K54A 4OBPA 4DF3A 3RCDA 4GK2A 4X2KA 3JPVA 4WIHA 5M07A 5IQIA 2UW7A 1K9AA 4ZMFA 3UP2A 1TQMA 3CP9A 3NUYA 2C0TA 3TZ8A 2ITZA 4F0IA 4QMYA 3A7GA 5FDPA 4MXYA 4YHTA 3QGYA 3WF7A 3QKMA 4G2FA 3JXWA 4L44A 4AXAA 3QTIA 1WBOA 3NW6A 3LMIA 2EVAA 3M2WA 1P5EA 4MXCA 4CFXA 2ITTA 3ODZX 4E4XA 2ZV8A 4PPCA 2QU6A 2Y4PA 5I9WA 3ZO1A 2BTRA 5DMZA 3CY3A 2IJMA 3Q4ZA 2RFNA 3LQ8A 5FP6A 2BVAA 4K6ZA 3F3VA 2Q0BA 5EYMA 4EHGA 3JR1A 1TQIA 1OKYA 2CJMA 4QYYA 3UNZA 2B55A 2JDOA 4L53A 2A0CX 1WBPA 3AT2A 3NIEA 5B2KA 2ZMCA 5C4KA 3MY1A 3WF8A 3ZLWA 4E1ZA 1S9JA 3NX8A 5ETIA 4EBVA 3RI1A 3JYAA 4A4XA 2WMVA 2YWVA 5M09A 4S2ZA 4UN0C 3KXMA 2WGJA 4MK0A 3UODA 2C1BA 3IW4A 3BU6A 4QNYA 3H9RA 5LVLA 3TZ7A 4CEGA 4Y5HA 3Q53A 1R39A 5LMKC 4FZ7A 5HICA 5IEYA 5GINE 5ITAA 4G6OA 5AV2A 4FSZA 2PZYA 4ACGA 3AC1A 4ZJIA 4CKJA 3ET7A 1RQQA 2X9FA 2QQ7A 3DDPA 4HNFA 5CNNA 4KBKA 3SQQA 4WKQA 4AT3A 1J7LA 4G9RA 4JS8A 3U51A 1F5QA 5J9LA 5FUTA 4OAUC 3WE4A 5F9EA 5C8NA 4YJUA 4U3YA 4HZRA 4CMTA 3UYTA 2XIYA 3IW8A 3KC3A 3CGFA 4D0WA 2JKQA 1WVXA 3CQUA 1BL7A 2XJ2A 3KKVA 4ANBA 1ATPE 1U54A 2QD9A 3MVLA 2OI4X 4LV5A 2LGCA 3GNIB 3F6XA 3H9FA 2FUMA 3F3ZA 3FC2A 3IW5A 2I0YA 3LZBA 3PVUA 4FNYA 3EQGA 2GU8A 5EOBA 3W1FA 4AGDA 4AW1A 5IDPA 2CHLA 3DCVA 2ITXA 3NR9A 3Q2MA 3FZ1A 4ERWA 4RQKA 2GCDA 2B53A 1GZKA 5AV0A 2CSNA 3NUSA 2XZSA 2RIOA 4FV2A 4BHNA 3D5WA 4BDBA 4PDPA 3LPBA 3NPCA 2HZNA 4FTOA 4NTTA 3VW8A 4RX5A 5IQHA 4A9TA 5EM5A 4QYHA 3QRKA 2YIQA 5HCXA 4MBIA 3ZEPA 4ZY5A 4BN1A 5KE0A 4PL5A 1O6LA 1KE5A 2JLDA 3OXZA 4RFYA 1Y57A 4RJ6A 3CLYA 3VHEA 3FBVA 4FIGA 2C1AA 4R7IA 4UBAA 3ZXZA 4E3CA 4LGGA 5DR6A 5K5XA 5JH6A 3OG7A 5KMIA 3TM0A 1ZZ2A 1PXKA 4A9UA 5E8VA 5CU6A 3ZH8A 1M14A 4FA2A 2XNOA 3BEAA 3QWJA 4MEDA 4YC3A 5AP6A 3TIYA 4BCNA 3PG3A 4KINA 5CAUA 3VAPA 2IZSA 4I5CA 3JUHA 4O22A 4II5A 3SV0A 3OWKA 3TJDA 5F95A 3QXOA 4TYEA 3LFAA 4U8ZA 3HKOA 2HW7A 4XV2A 1L8TA 3FY0A 3UG2A 4KBCA 4TN6A 3QTWA 5BUIA 5CAQA 4KKEA 3VBQA 3GC9A 3P9JA 2VWWA 4BZNA 4O7SA 2YLFA 3Q6WA 2I40A 2C6EA 3ERKA 4I92A 5J1WA 2X2LA 2AYPA 2CCIA 4IH8A 4JOAA 1BX6A 4YLLA 5C03A 5FM2A 4B7TA 4GFMA 3IONA 1K2PA 5D10A 4P2KA 5T3QA 4DEHA 4GT5A 4GMYA 2FYSA 1YDTE 2YCQA 5M4CA 2I0EA 3BV3A 3ZUUA 5AV3A 3OY3A 4DG2E 2XS0A 5E91A 4LQMA 2HXQA 1PXLA 2RFSA 3EKNA 2O8YA 5DIAA 5EYDA 3DK3A 3C5IA 4FIJA 4BZOA 3TWJA 4EHZA 3E3PA 5LMAA 4HVGA 4Z7GA 4NT4A 3AT3A 4YNEA 4NK9A 1MRYA 5L3AA 3DK7A 2EU9A 3WZKA 3EZVA 4XRLA 3CR0A 4AZEA 3H9OA 3EZRA 4IJPA 3H4JA 4RIYA 4D2PA 4DITA 2C6IA 2R3KA 3A8WA 3W2RA 1PW2A 2C6DA 4G6LA 4UWCA 2YWPA 2GSFA 3QWKA 4D0XA 4F7SA 1OPLA 4ZLZA 3C13A 5CAVA 3BHYA 4JBOA 5L2WA 3V5JA 4CT1A 3PLAE 4LRJA 3P78A 4FGRA 1U4DA 2XMYA 2NRUA 3Q9YA 4BVUA 4IXPA 3ROCA 3SGCA 3AD4A 5EOLA 4IX3A 3T3UA 3U55A 4CYJA 2V62A 3ORLA 4K11A 2OJ9A 3LOKA 5HKMA 2C6TA 4IEBA 3IS5A 2VRXA 5CI7A 2UZTA 3ALNA 3BLRA 2XBAA 5EQPA 4FEQA 3PJ2A 3OVVA 4I41A 4RQVA 2BRGA 2PWLA 3NCGA 4UEUA 3EQBA 4UZHA 4PP7A 1OI9A 2E2BA 2IW8A 4WUNA 4JR3A 3KVXA 2OJGA 3NUUA 3NGAA 1UV5A 4IC8A 3H30A 3CE3A 1KE6A 3R9HA 3BGPA 3DT1A 3ORXA 2WIHA 4AU8A 4EBWA 2XNNA 4GYIA 1J7UA 1LEWA 5KMLA 3D5XA 1R0PA 2XH5A 3QF9A 2VNYA 1VYWA 3HV6A 5DT3A 3R8ZA 5HTIA 3HMOA 1OKZA 4FKJA 3Q3BA 3V04A 1PMUA 5HNGA 3R8UA 3HUBA 2BRBA 5EKNA 4BDFA 4FICA 4MXXA 4O91A 4Q2AA 3H0YA 3O17A 2WU6A 1CTPE 1GZ8A 1XBBA 2HAKA 4C3PA 5A9UA 4ZTNA 4A9YA 4Y83A 3LFNA 3OC1A 3BGZA 3IW7A 5FTGA 4WBBB 4I24A 4AGWA 3RINA 4DE4A 2GPHA 1CSNA 3TG1A 3AC8A 2YABA 4ASZA 2B1PA 2QHNA 3IG7A 1UVRA 2R0UA 4BC6A 2IW6A 4M14A 5KBQA 4HGEA 3IGGA 2BIKB 5E4HA 5EW3A 2C5OA 5HBHA 4BCJA 5JZJA 4GKIA 3OUNB 1OITA 1W0XC 3BE2A 2J0MB 5DG5A 4BR3A 4FKUA 4GFGA 3O71A 3MFUA 4A9RA 2WAJA 3G33A 3E7OA 3QTQA 5BVEA 1MP8A 2W99B 5A3XA 3VS3A 3VUMA 5LOHA 2QOOA 2QG5A 4PUZA 4B8LA 3ZLSA 3D94A 3HECA 4QMZA 4X2FA 4X3FC 2YITA 4WOVA 2CGWA 2XK7A 3RAIA 3D83A 2PL0A 3P5KA 2HCKA 4IAAA 1Z57A 4O21A 2DUVA 4XV1A 3GU4A 4IDTA 2ETMA 2YEXA 4ZTQA 4YGAA 3UMWA 1PXMA 3R0TA 2R3QA 4J1RA 4DLJA 4AW0A 3OP5A 5IG1A 3ATSA 4OTIA 3C7QA 1DI9A 3ATTA 1FINA 1XH8A 4XG4A 2EUFB 4XP0A 4RLKA 5JRQA 4IB5A 4MQ1A 4WT6A 3GVUA 2FSLX 2J50A 1CKJA 2WU7A 3UO5A 3W16A 2YJSA 1XH9A 3FYJX 1OBDA 3DXPA 4U7ZA 4NYEA 4I6HA 3MA3A 5CT7A 2R3NA 2R3FA 3AC5A 1Q61A 3LJ1A 4ACDA 4H05A 3HZTA 3PSDA 4BCKA 3NIZA 5FLFA 3F5PA 4PNIA 3MBLA 3RZBA 4I22A 2P55A 4RC3A 2QKRA 3GP0A 1DAYA 3DBEA 3UC3A 4IMYA 3QRIA 3NYNA 3PXFA 4ANSA 4QMMA 5ANGA 2W1FA 4TYIA 3KK8A 5AR8A 5TF9A 4F1MA 3ZRKA 3WOWA 4BDIA 3F2RA 3I1AA 3PA4A 4BDKA 4FG8A 5IQBA 5DE2A 3MN3A 4FOBA 4FEWA 4TZRA 4AQCA 5AR3A 4YO4A 2JGZA 2XF0A 5EHYA 3DGKA 3UOJA 2R3JA 2CNUA 2WMAA 4KSPA 4XP3A 2AC5A 2V22A 1J1BA 3HRCA 2RSVA 3TNIA 1DAWA 1M2QA 2CGUA 2R64A 4IWQA 4F4PA 3AD6A 5J5TA 4FUYA 4AFEA 5HI2A 4C4FA 4X2JA 3FKOA 5EK7A 3DBDA 1F0QA 2C69A 4I1ZA 5FEEA 4V01A 4DFLA 4YTFA 1SYKA 4FL3A 3UVPA 4F6WA 4IZYA 1ZAOA 3TUDA 3R8VA 3DNEA 3ORKA 3VJNA 4PWNA 3NWWA 4HCUA 4M15A 4R1YA 2PUNA 3B2TA 3ZRMA 2BFXA 3E64A 5LARA 3I5ZA 5AAGA 3R1QA 3F3TA 3AC2A 3ULIA 4HW7A 3RZFA 3IK3A 3FUPA 4NCTC 1PXNA 2PUIA 2W5HA 1M2RA 3F5XA 3VBWA 4D5KA 2RG6A 5LXMA 3PXZA 2HWPA 5JGDA 3R01A 4LMNA 4YURA 2X8EA 3RNIA 3QD2B 2G2FA 3HMIA 4QTBA 3S3IA 4B8MA 2PMOX 3AGMA 3LFQA 1XR1A 2F2UA 1BKXA 1KE8A 3O8UA 5ICPA 1OUKA 3L8VA 2EB3A 2F4JA 2G01A 4RWKA 4M66A 2JIUA 2ETKA 5I9VA 2HYYA 1U5QA 4I5PA 5IH5A 5GIPE 4NEUA 2J90A 3D14A 4CG8A 4KABA 4CFWA 5EDPA 1UKHA 3C5UA 3QQJA 5FM3A 2JEDA 4R7HA 4BL1A 4KRDA 4D2VA 5IA2A 2WMQA 3MYGA 3U87A 3PSCA 3W55A 5KMKA 5AUUA 3ODYX 4M69B 3UOHA 4J96A 2JDRA 3C4EA 4TWOA 4YZBA 5TOZA 4EONA 5CEPA 2HW6A 1WFCA 1VR2A 2OZAB 1WZYA 2PVLA 3HYHA 4JBPA 4FL1A 1APME 1GZNA 3OWPA 2HIWA 4OR5A 5CI6A 3RPOA 5AADA 4FV5A 2QLQA 1WBVA 5B0XA 3T8OA 1NVRA 5IISA 5CSHA 5KZ0A 3DB8A 1Z5MA 4PMSA 3MFSA 2VTNA 1JSTA 2V55A 2KULA 3TJCA 3UIUA 4X2GA 2B0QA 5BX0A 5FTOA 1IR3A 3GC0A 3MA6A 4YJPA 3QZFA 3KMMA 4M68A 2XM8A 3OW4A 5IA0A 4FV7A 4C3RA 1XH6A 3DY7A 3EFLA 4CZYB 2BPMA 3LCKA 3N51A 3HRBA 4I94A 2XYUA 4X0MA 5BVWA 2J6MA 4M3QA 4ZP5A 3V5PA 3ZSGA 4CV8A 3FPQA 4D4YA 3PP1A 3G9NA 4NKAA 5JZNA 4U0IA 5EH0A 3FZTA 4GG7A 3RGFA 3D0EA 4ZXTA 3GFWA 3GCQA 3OWJA 1YHSA 4ENXA 4EYMA 4KUJA 4R3PA 5EW9A 2YM8A 3P79A 3VN9A 2NRYA 5CVGA 1OMWA 4P7EA 3DBFA 2C0OA 4M7IA 4O7LA 5FEQA 4GT3A 4DTBA 4LUDA 3C4ZA 4HPTE 4U97A 1ZYCA 3M1SA 3BYMA 5JGBA 3ZO3A 4G31A 4KSQA 4UALA 2X39A 4F9BA 3FZPA 2YZAA 4FTMA 3ZEWA 4EOOA 2P2HA 2PVKA 3G0FA 3HDMA 3PXYA 2F9GA 3BBWA 4TT7A 4QMQA 3QRTA 5EM6A 3UIBA 4C2VA 3HEGA 2YACA 3G6HA 4FBXA 4PPAA 5T6KA 3VWAA 4E73A 2XK9A 2I6LA 1Y6AA 2XNBA 3VBTA 1P14A 4CMUA 4EOKA 3F7ZA 2BMCA 4GW8A 3HA6A 2EXEA 4L7FA 4MD7E 2QOHA 5DYJA 4XOZA 2BROA 2B4SB 4ZTLA 1H00A 2B9HA 2F7EE 3LFBA 4I4FA 2J0JA 5CZHA 3WZDA 4WUAA 4KIKB 4LM5A 1PXPA 2VV9A 2XVDA 5HTBA 1YI4A 2QC6A 2QOCA 1OGUA 4U40A 4AAAA 4OAVB 2P0CA 3L9LA 4ZK5A 3DA6A 4J71A 2YAKA 1JLUE 4G17A 5CY3A 4YHFA 3RPRA 2C3LA 3VUDA 2UW3A 5ACKA 1G8SA 2GNIA 3R6XA 4FZFB 3Q32A 1XKKA 4H3BA 5A4TA 2VWXA 3DJ7A 4JBQA 5BVOA 3IDBA 2O5KA 2YJRA 2W17A 2JDSA 3I6WA 2RF9A 3IQ7A 4MD8E 1OZ1A 5I4NA 3LXNA 2YDIA 4BKYA 4WG5A 4DGNA 3IW6A 5FP5A 3UPXA 2YM7A 2X9EA 5AP5A 1YHWA 2BDFA 4ZTHA 3HMPA 5AP4A 4BY9E 2PUUA 3HUCA 2BR1A 2J0KA 2I1MA 2OO8X 5CF8A 5LMKA 4IAFA 3ELJA 4NZWB 3T3VA 1OKWA 5E8SA 2PZ5A 3RKBA 4ZLOA 2B9JA 2PE0A 3S4QA 2QVSE 2ZM4A 2Y4IC 4P5ZA 3COKA 3SXFA 3FE3A 4YJQA 5M53A 4O7ZA 2WOTA 4S34A 3DKOA 4TKSA 4CFVA 4YJRA 1MRVA 4WSYA 4BWXA 4DFYA 3DBQA 3MVJA 4BWKA 4CFUA 3WF9A 4FC0A 4CLIA 4O27B 1NVQA 2E9NA 4OTQA 4HVSA 2E9UA 3GQIA 2Z7SA 4FVPA 4YC8A 2Z60A 3TKIA 2OIDA 1V0BA 3W2CA 4EI4A 4RFZA 1P4OA 2G15A 1HCLA 3R2YA 4AE9A 4NM5A 3FQEA 4YTIA 1KE7A 2Y4IB 2WMUA 4JXFA 4DFNA 4WSQA 2HY81 4IM0A 4JBVA 3D4QA 4J52A 5HO8A 3R1YA 4ITIA 2ZDUA 3BYSA 4FZDB 4FTJA 4ZEGA 4Z7HA 5AEPA 2ZM3A 3QX4A 3C51A 2DWBA 2J0LA 5FTQA 3TUBA 3UZRA 4RC4A 4EJNA 3TV6A 5KHWA 1PJKA 2VWYA 4R1VA 4ENYA 4DGLC 3QALE 4E8AA 5IDNA 4BHZA 4DCAA 4FX3A 3DKCA 4F08A 3COIA 4D4RA 2WIPA 4IB3A 3QQGA 2XNEA 5B2MA 4IVAA 1O9UA 2C6OA 4TNBA 5CU4A 5C26A 2XJ1A 4ZS0A 2VTJA 4AZVA 5CVHA 1EH4A 3HX4A 2ZVAA 2ZM1A 5DR9A 3QTZA 2V7AA 4FTUA 4Q5EA 4XJ0A 3ZHPC 4EQMA 4BRXA 4C37A 4JG7A 5HO7A 4DT9A 5FRIA 4DC2A 3TNQB 2REIA 3QKKA 4QP1A 3U54A 4C7TA 2NO3A 4MBLA 4ZTRA 1GIHA 3R30A 5E92A 3FMJA 1NW1A 2FSOX 3CKXA 5CX9A 2UZNA 5HG7A 2RFEA 4YJNA 2R5TA 5AUZA 3OMVA 4L9IA 5F4NA 2VTRA 5AA8A 1WVYA 3MH3A 1UWJA 5H8GA 2VTMA 4J7BA 3A8XA 2QODA 4TWNA 3HV4A 3OEFX 5IA3A 4U43A 4C3FA 1YI6A 1JSVA 4YZNA 3MIAA 3THBA 3ZFMA 2XEZA 2VWIA 3FAAA 2JFMA 3TN8A 5GZ9A 3D5VA 3OHTA 3CCNA 5J9ZA 1JOWB 4Y5QA 3MFRA 3CQEA 3O8TA 3P08A 4EH4A 3D7TA 4XV3A 4D58A 2V0DA 2W1GA 3Q4UA 2OBJA 3FZRA 3KN5A 4IE9A 4PV0A 5AUTA 3TV7A 1V0PA 1NXKA 3KY2A 5AJQA 3KRJA 5AR7A 3F3WA 3G9LX 4JNWA 3R7VA 2UZVA 1SVHA 2OICA 2VO6A 5I9XA 4DHFA 4GEOA 4B99A 4XNEA 3DTCA 2C6LA 5ANEA 4F9YA 2QHMA 5KO1A 4QMUA 4FKWA 4UWBA 3R7EA 5JFSA 5LVMA 2VX3A 4XMOA 1NA7A 2X6EA 4UXLA 4WBOA 1BYGA 5LVPA 5EM8A 1OBGA 4RJ7A 1W82A 1HOWA 4G34A 4MF0A 3QHWA 5LJJA 4KIPA 5E90A 1SZMA 3L8SA 3OOMA 3R1SA 3KMUA 4HNIA 1YQJA 3OROA 1FPUA 2VAGA 2C5NA 3GCVA 3EL7A 1AQ1A 1OUYA 4IWPA 2LAVA 3WF5A 4EC9A 4O82A 4AWIA 2WEVA 4EH3A 3POZA 2PU8A 1BMKA 1YWNA 5CZIA 3RNYA 1IRKA 3SD0A 4F0FA 4F1TA 3Q52A 3RHKA 5IH6A 1OPKA 4YLKA 4WRGA 1FBNA 4NWMA 3V6SA 5M06A 3CJFA 3HMNA 3OOGA 4RVKA 2F2CB 3ZFXA 4BWPA 2NPQA 4IVCA 4L3LA 5LWMA 1UU9A 3R7IA 1YW2A 1YI3A 4JRNA 4YMJA 2X2KA 3QXPA 4YHJA 1ZYLA 3SKCA 3PRIA 4OTPA 5D41A 4UMUA 5LVNA 5L6WL 4GCJA 3O7LD 3GU7A 2OH4A 3PVGA 4QP2A 2IN6A 3ORTA 3SAYA 3VUGA 2O63A 3EJ1A 4QMVA 5DT4A 3F9NA 3MB7A 4ZIMA 1XBAA 3OW3A 5HORA 3HA8A 1ZZLA 4WNKA 3R02A 4HCVA 3KXGA 2BKKA 3HL7A 4F65A 3TUCA 4CTCA 1YRPA 4ANMA 4TWCA 4IIRA 5CLPA 3QRUA 4PQNA 1U46A 3FY2A 2ETRA 4AF3A 3QCQA 5FD2A 4R5SA 3TL8A 2C6KA 3Q9ZA 5BMMA 2QOQA 1H1WA 3ORNA 2XKEA 4LYNA 5DEWA 1ZOEA 4JI9A 3LXKA 3GENA 3QA8A 4QMLA 3WZJA 4DGGA 3U6IA 3LMHA 2GFSA 3QKLA 1KWPA 4DH3A 2PE2A 5GZ8A 3MJ1A 4FKVA 2EB2A 4AW2A 4C02A 5IMXA 3OEZA 3PG1A 5BYZA 3RWQA 3QYWA 4DH5A 4G5JA 1Q4LA 3G51A 5DWRA 3G2FA 4A06A 2JKMA 2WTDA 3F82A 3FHIA 3ENHA 1FGKA 4U3ZA 5L8KA 5I5ZA 5FEDA 2WTVA 3NEWA 4QMTA 4HVHA 3BIZA 3O50A 4EOQA 1YHVA 4FVRA 5HOAA 3LFFA 1GOLA 3UO6A 3W8LA 3TZ9A 4EH6A 5GIOE 5JT2A 3EQDA 3ZO4A 5G6VA 1H28A 2KTYA 4O84A 1OB3A 2XP2A 3DKFA 3NW5A 2VO3A 4MH7A 2PVFA 3EN5A 2WFYA 3LCTA 4JQ7A 4G5PA 3U6HA 4QPAA 2GMXA 3ZSHA 3TZMA 2ITOA 2X2MA 1JKKA 3O8PA 3WILA 2H96A 3KF4A 4E6DA 3QLFA 3R28A 4F7JA 4BTKA 3U4WA 3JY0A 4PMMA 1NT2A 2OU7A 4I21A 3R8LA 5A4LA 4FTRA 3L9MA 2IVUA 4TRLA 1OL2A 5AUXA 1ZOHA 4JQEA 1TQPA 3ZZWA 1Q8TA 3NS9A 4NFMA 3KULB 2QU5A 3R00A 2XNGA 4MTAA 3K3IA 1U5RA 2WHBA 1F3MC 2WB8A 4BF2A 1Q8YA 4MD9E 3LFCA 5ANKA 3UNJA 3GB2A 4HYIA 2A1AB 4IWDA 4TTHB 4PDOA 2XIKA 4U79A 5AIRA 3R9OA 4AX8A 4XV9A 3QUPA 4WD5A 4NUSA 4D55A 5K4IA 3SDJA 2Q83A 4FL2A 2EWAA 1Y6BA 3DAKA 2OF2A 3MB6A 3OBGA 4I23A 5EI6A 3VNTA 4ZTMA 3ORMA 4YC6A 3N4UA 3UQCA 2JD5A 4AFJA 5BNJA 4BDAA 5JFVA 4UMQA 3FKNA 3V8TA 2Y7JA 4QP3A 1MRUA 4RC2A 3O23A 4YZDA 3WYXA 4EH7A 4I6QA 3OS3A 4S33A 4RJ4A 1UU3A 2BHHA 2C4GA 2OSCA 4F09A 3BEGA 3SG8A 3E93A 5CXHA 3RAKA 2PK9A 5EYCA 4AGCA 4G1WA 3RJCA 1KV1A 4XOYA 2I0VA 4BIBA 3I7BA 5HQ0A 5F1ZA 3M11A 2OZOA 4KB8A 4RGJA 4RMZA 1SVEA 2UVXA 2W1EA 1YOLA 3EQFA
chains in the Genus database with same CATH superfamily
3KXXA 5BQ0A 3OFMA 4IZ7A 3COHA 2XBJA 3KRRA 1FOTA 4FKRA 3BLQA 3FLQA 4G3GA 4OTFA 4AG8A 3HNGA 5FBNC 1XHAA 5HZNA 2OK1A 2H6DA 4JDKA 4QPSA 4F7NA 3DZOA 5CU0A 5IQEA 4MVFA 3QC9A 2B9FA 3BI6A 3ZFYA 5DI1A 3ZLYA 1H27A 4B0GA 3QHRA 4EUUA 1IAHA 3PA3A 5IA4A 1GNGA 4BTMA 3K5VA 4NCTA 4XLIA 4YJTA 4F6UA 4EC8A 3QTXA 3P7AA 1B6CB 4H1MA 1VLRA 5BVFA 1YXSA 2IVSA 2WQEA 2PVHA 3QBNA 4FZ6A 3NRMA 3WZEA 3U9NA 1OKVA 4BIEA 3FI4A 4H58A 2UZOA 3EQRA 4M69A 4NW6A 2O0UA 3C0HA 4U44A 4ALWA 1H24A 3BCEA 4EQUA 3BE9A 5HLPA 4KIOA 3RM6A 2OZAA 3E62A 1YXTA 3TKHA 3ZC5A 2BZIB 4DEIA 2I0HA 4I6BA 5C27A 2PMNX 3EQPA 2XK6A 3MDYA 4PTCA 4IZAA 3C9WA 5IU2A 2UV2A 2QCSA 2W1DA 3FZOA 1YDRE 2WTIA 2Y9QA 3SXRA 3NW7A 4LRKA 3P5JC 5DH3A 5HEZA 2WMXA 4Y72A 1H1SA 4C4HA 3EMGA 4OBOA 5C4LA 2IG7A 2C5YA 4YTHA 3AGLA 2VU3A 3B2WA 4FUXA 4NKSA 5H9BA 3VF9A 1H1RA 4F64A 4ZZOA 2OFUA 4USDA 3UDZA 4L8MA 4IFGA 3DTWA 3F69A 3ENMA 4FIEA 4BIDA 3VUTA 5H8BA 4QMWA 4JQ8A 4EHEA 3W10A 4U42A 4D1XA 4DN5A 3QUDA 4I4EA 3DJ5A 4XX9A 4GS6A 3KVWA 1VEBA 4V04A 3QGWA 4RLLA 3ITZA 3F88A 2BAJA 1J7IA 4PL3A 1Q41A 2DYLA 1UA2A 1IEPA 2HXLA 4FMQA 3W33A 2X81A 3HDNA 4F63A 3Q04A 3F7WA 5CF4A 4N6ZA 3PIXA 5ANJA 4CRLA 2VX0A 3VIDA 3MTFA 3CJGA 4R78A 4BB4A 1JVPP 3MVHA 4F6SA 4W9WA 5EYKA 3UDBA 2WKMA 3DLSA 3KU2A 5DBXA 3IO7A 3UZTA 3DU8A 2BZKB 3CD8A 5CASA 2RG5A 5J7BA 2R3IA 3HLLA 3V5WA 4FTNA 3GC8A 4AN2A 1GZOA 4IBMA 3BU3A 4V05A 4CXAA 3LJ2A 4CCBA 1PYEA 3TACA 5LWNA 2XCKA 3ZMMA 3BYOA 4X6QC 3FWQA 1FMOE 3L8XA 3LMGA 3R73A 4QP7A 2YIWA 3MH2A 2XKFA 4FNZA 5M56A 3C0IA 3O2MA 4C4GA 2Q0NA 4XG2A 2VTTA 3FHRA 4H1JA 3NNUA 3BRBA 2A27A 1B39A 3OXIA 2HZ4A 5D1JA 4R3CA 3D2IA 1JAMA 1AD5A 3NDMA 4E5WA 4EOIA 5JFWA 3R9RA 1YOJA 4KIKA 3OCTA 2SRCA 2YM4A 4LG4A 2J0IA 4AA0A 3WI6A 4CCUA 4JIKA 4RIOA 3HAVA 4KKHA 3M42A 3OF0A 4JAIA 4L00A 2W5AA 4S31A 3MY0A 5IH4A 2Z2WA 1YXUA 2QOIA 3Q4TA 4RIWB 3R63A 4BGGA 4FE2A 4D28A 2HY0A 4J97A 2ACXA 4KRCA 3GCUA 4EK3A 4AA5A 1LR4A 3HVCA 4FNXA 5A6NA 4QO9A 1YVJA 4JRVA 4O7YA 3VBVA 4HVDA 1SM2A 1H8FA 1QMZA 4AN9A 4DEDA 5FDXA 2UVZA 3O96A 4O0WA 5AAFA 3UPZA 4R8QA 2R3PA 4JDHA 4F1OA 3CD3A 5A6OA 1BUHA 4L6QA 4EKLA 3FDNA 5HIEA 2BZJA 1IAJA 4QMPA 3EQHA 4X3FB 1SNUA 3ANRA 5DHJA 2J51A 2PE1A 5HBEA 3NYXA 4FKQA 4H3QA 5HNBA 3G6GA 3I6UA 3EQCA 2AUHA 3KRLA 4FEVA 4KS8A 3A99A 3NMUF 2H8HA 5CTPA 5K0XA 3OXTA 1U59A 3QCYA 2FB8A 2X7OA 1ZYDA 4FYNA 5IUIA 4RZVA 3R8PA 4H3PA 3KGAA 1TKIA 5EHOA 3IOKA 3FJQE 4O1OA 4ZSEA 4L01A 5L2IA 3FMMA 3TT0A 3DB6A 2R7IA 4ARKA 4DH1A 4A07A 2BTSA 3CEKA 4AZTA 3SHEA 5CT0A 3HRFA 3EFJA 5EM7A 3VQHA 5CS6A 3FLNC 1OM1A 3I0QA 2BZHB 3BGQA 2QOKA 3ZDUA 4K2RA 3PIYA 1H08A 4IAIA 2QLUA 5I9YA 4CRSA 4E6CA 2WQOA 5E8ZA 3VQUA 4FI1A 4HGTA 2V5QA 2JBOA 5CQWA 3RHXA 4FTCA 1Y91A 3U4UA 4V0GB 5CSWA 3ZM4A 4I6LA 5AR4A 4JAJA 4TYGA 2PZRA 4D9UA 4AS0A 3RTPA 4CT2A 4RIXB 1YXVA 2GS7A 4C38A 4BDCA 4D4VA 2UZLA 4YJVA 2YN8A 3CPBA 3PA5A 5BVNA 5LVOA 1NVSA 4XG7A 3VS0A 4FV0A 4LRMA 3FMDA 3V6RA 4BDDA 4BI1A 4X21A 4RWJA 1DS5A 2BILB 5FG8A 3QX2A 4EL9A 5L6PA 3PPJA 2F57A 5CEQA 2J9MA 5BVKA 2VTLA 2XK8A 5EHLA 4E4NA 4O7WA 4MNFA 3KMWA 5CXZA 3LJ0A 1CDKA 1H4LA 5JK3A 5CWZA 1ST0A 2ESMA 5CYIA 4PMTA 2GFCA 2IF8A 4FKOA 4OBQA 4QT1A 4W8EA 4ANQA 1FVRA 4EWHA 1WBTA 3BV2A 4FKSA 4EQCA 1UU8A 2PZPA 3PP0A 5AUYA 3PPZA 5LMBA 2CGXA 3QTSA 4W4YA 4NIFB 3QD3A 3VONA 2PVRA 3I4BA 2XIRA 5C8KA 5CENA 4MNEA 2BRHA 5BUJA 2WXVA 3QZGA 5D7VA 4BGQA 4Z16A 4G9CA 4Z55A 4EJ7A 3LFDA 3W0PA 1FQ1B 3DPKA 5HE2A 3U8WA 4L46A 4OUCA 5G1XA 3JVRA 3Q5IA 4PTEA 4M8TA 4M84A 4N6YA 5J79A 4EWQA 2XK4A 2BIYA 3DV3A 3NNXA 4WHZA 5CALA 1G8JA 3LM0A 4QD6A 3LXPA 2C30A 2P33A 3KCFA 3LQ5A 4GJ3A 3TI1A 4J53A 4QOXA 3QC4A 4TYJA 4C62A 4CQGA 5KNJA 1URWA 2VWVA 4TPTA 4BBFA 2GHMA 2UW9A 3BHHA 5EDRA 3EN4A 2X1NA 4U80A 2WOUA 3ACJA 4FKGA 4GUBA 1E9HA 3EB0A 3V3VA 5CAPA 3UQGA 4CSVA 5L4QA 4TYHA 2RGPA 2WTKC 1W2FA 5HD7A 2AC3A 4E20A 5FXSA 4MWIA 3W2OA 5L8JA 4RIYB 4DGMA 3R1NA 5IF1A 1PXOA 2OLCA 4YJOA 4YR8A 4DH8A 3UNKA 4DBNA 3MI9A 4ACHA 4ZSJA 3V01A 3PZHA 5M4IA 4K1BA 1GJOA 5DN3A 5FQDC 2WO6A 2W06A 3EN7A 1BL6A 4GUEA 3TTJA 4HOKA 2J5FA 4RFMA 4H39A 4LL0A 3PIZA 4ZY6A 1W84A 2EXMA 2WMRA 3POOA 4WNPA 1M2PA 4Y8DA 3P4KA 2WTKB 3MIYA 4UYNA 3S95A 5M4FA 2JAVA 2PTKA 4BICA 1B38A 3BLHA 3GT8A 3BZ3A 1T45A 2VTPA 3CPCA 4GT4A 4WO5A 1TZDA 2X0OA 4BDGA 3SVVA 4GG5A 4N57A 3BQCA 1W83A 2QI8A 3PVBA 5E1SA 5HE1A 2HZ0A 5K0KA 3AXWA 3RPVA 4CD0A 3U9CA 2R3LA 3WIKA 4XG6A 2ITPA 4BCIA 4EEVA 3DQWA 4ZY4A 4P90A 2VGPA 4L52A 2ZYBA 4OTDA 5AP0A 4S32A 4IANA 3AC3A 2F49A 3E5AA 3KXNA 2XKDA 5A4EA 2QG7A 1S9IA 4TY1A 2XCHA 2BAQA 4KKGA 4GK3A 1WVWA 5HBJA 3K2LA 4LUEA 4WNOA 2I7QA 4Y95A 4ZLYA 2X8IA 3DOGA 4D4SA 2VTSA 1PMEA 3UTOA 2QO7A 4ZZNA 3VS6A 4G3FA 5HU3A 2CKPA 5EDQA 3D15A 3PE1A 4XHKB 3MESA 4O6LA 3MJ2A 2W0JA 4CKIA 5M4UA 3VF8A 3UDTA 2WQNA 3W0MA 5ETAA 4TL0A 4MXZA 5JN2A 3FEGA 1J3HA 3R83A 5AM7A 5J8IA 4GVJA 4JG6A 5F20A 1IA8A 4CV9A 3RM7A 4AT4A 5AUWA 4WA9A 4DFXE 2OXYA 4E6AA 5KMJA 2FSTX 3OZ6A 1BLXA 1SNXA 2RFDA 3FMEA 5HO6A 1Q24A 3F2NA 4FTLA 2PZIA 1UNLA 5JGAA 1R0EA 3QU0A 1AGWA 5HCZA 1H1QA 3BPRA 1JNKA 2ITVA 3MS9A 5EG3A 2HOGA 2QOBA 1XWSA 2XJ0A 3DFCB 2UW8A 4FTIA 3I79A 5JRSA 4TXCA 3OD6X 2OH0E 3PDTA 3Q5ZA 4NL0A 3E8DA 3V5TA 1XH4A 2J7TA 4FK3A 2ITYA 4XP2A 3I5NA 3DBCA 2HWOA 2UZBA 4L67A 3FPMA 3OBJA 3TNHA 5L2SA 4FTKA 3PJ1A 4X6RA 5FBOA 4LOPA 4ZOGA 5AP7A 2W1CA 3KFAA 4MCVA 3DZQA 3S2PA 5H3QA 1M7NA 3KULA 3R7UA 2EXCX 2P3GX 5HVJA 5HCYA 3P7BA 5HG5A 1JBPE 3BX5A 4FNWA 4C4JA 4ORKA 5CF6A 2AQXA 4FSWA 3CIKA 4PDYA 1G3NA 3GGFA 3HP5A 1W2CA 4X7QA 3TNPC 2HENA 3ZRLA 2PMIA 4FTQA 1PKGA 2IZRA 4F9CA 5AMNA 5CSPA 3GXLA 2JDVA 2XIXA 3FQHA 5E8TA 1MUOA 3VS1A 3PSBA 3CC6A 2GDOA 4IX5A 4D2TA 1URCA 3MVMA 3C4XA 4BDHA 4O81A 2RL5A 2WMSA 4YTCA 2O2UA 2J2IB 1W8CA 4MX9A 2W9ZB 5DRDA 5ETFA 4E26A 3BHVA 3LCDA 1ZMVA 3KQ7A 1Q8ZA 4BCGA 2PMLX 4CFMA 4F99A 4CZTA 4YPSA 3FXWA 4E7WA 5CAOA 1WBWA 4IJ9A 3R04A 1YWVA 2YDKA 4C4EA 3OY1A 3EYHA 4ZZMA 4NH1A 4A7CA 2YZLA 4FOCA 3C50A 4PPBA 3F61A 5HVYA 4EZ3A 2OIBA 4U41A 4RA4A 4RZWA 3JY9A 4YBKA 4FV4A 3A7IA 2UVYA 3FI3A 2Z7RA 3A62A 4MXAA 4WNMA 3R9NA 5KMOA 4FEXA 1I09A 1XH5A 4I0TA 5LQFA 3QLGA 3KRXA 4EH9A 2JAMA 3D9VA 2BRNA 4OT6A 3RVGA 3KCKA 4B6LA 5J7HA 3BU5A 3VW6A 4APCA 4ACCA 4G3DA 2OJJA 2VTAA 2VX1A 3P1AA 4K18A 4C35A 4DHJA 2VTIA 2QOFA 5E8XA 5DEYA 5HVKA 3SW4A 1RJBA 3LM5A 1OPJA 4AZSA 3Q2JA 3PTGA 3Q9WA 3BWJA 3R9DA 5IEXA 1ZYSA 2E9PA 4CNHA 5AR5A 4I3ZA 4D1ZA 4M0YA 4FZAB 2XKCA 5C9CA 5AX3A 5IA5A 2XM9A 1WBSA 3E8NA 3H3CA 3BBTB 2BALA 2FSMX 2VN9A 4O4DA 3JVSA 2CCHA 4MF1A 2WQBA 4FRFA 5M57A 3LCOA 4J98A 3F3UA 1QPCA 4M12A 4YZMA 1PXIA 4GU9A 3UZPA 4EYJA 3AMAA 3KXZA 3MH1A 3C4WA 4P4CA 3UOLA 1FVTA 3CTHA 2PVNA 4YSMA 4PRJA 3NUXA 5HE0A 4FTAA 1W2DA 3BYUA 5TO8A 3ZBXA 2X0PA 4IM2A 2PVMA 2W05A 5M51A 1UU7A 1OL5A 4L68A 4M0ZA 3RBWA 4E5AX 4FJVA 3MV5A 4L45A 4UV0A 4XG9A 5CU3A 4BTFA 3OT8A 4DA5A 2UZEA 5GHVA 3OT3A 4MXOA 4O0XA 3LW0A 1ZWSA 3MSSA 3RWPA 5A4QA 4CQEA 1PF8A 4I5HA 1H01A 5HG8A 3KA0A 1KOAA 3SRVB 5C01A 3W0OA 4BDEA 5AV4A 4RWIA 3MPTA 2JIIA 3E63A 4IM3A 4GV1A 3QQKA 4ZMEA 4KWPA 4AGUA 2ITNA 2R7BA 2OJIA 4ONAA 3C0GA 3HV5A 2CN8A 3B8RA 3N9XA 4E4MA 3UIMA 4RWLA 5HIDA 4JVGA 2XAMA 2WD1A 3AC4A 2ZV9A 3NUNA 4FSQA 3UMXA 2F7ZE 3N4VA 3CSVA 3DKGA 4D2WA 1JQHA 3SC1A 2Z7QA 2PUPA 4CZUA 3C4CA 3CGOA 4MHAA 4EOMA 4F9AA 4EH5A 4BI2A 4GFOA 1LUFA 4Z3VA 4EOLA 3NUAA 3P86A 4DG0E 4D2SA 3KXHA 2PPQA 3EHAA 4XCUA 3RK9A 4FV6A 3H10A 3AD5A 5E1EA 3ZONA 2H34A 4O7NA 1OIYA 5GNKA 4AAYA 2VWZA 4APPA 3W0SA 5BYYA 4RG0A 2YA9A 1YWRA 3P0MA 4U81A 4AXDA 3PJ3A 1FVVA 4USFA 3RK7A 1LEZA 4G3CA 1RW8A 3FLZA 4XLVA 1BI8A 4OTRA 5JFXA 2FH9A 3TKUA 4QMOA 3PZEA 1RE8A 2NP8A 4FODA 4XBUA 3NAYA 4YZ9A 1E1VA 5AAEA 3SOAA 3E3BX 4ASXA 2ZV2A 2WEIA 3DNDA 1PKDA 4I6FA 4XBRA 3UYSA 3GU8A 4FSRA 2YM6A 5M44A 4IADA 1Y8YA 4O2ZA 4UMTA 1P2AA 1ND4A 4PNKA 2CKQA 2WNTA 3PJ8A 3RAWA 4QQCA 2OW3A 4HPUE 4ZAUA 2WMBA 4Y46A 5IQAA 4R6VA 4IAZA 1KE9A 2PVJA 3SX9A 3V51A 3FZSA 4PP9A 3NYOA 4DBXA 2C0IA 3VS7A 3RK5A 4AXEA 4RIWA 3TDVA 4WG4A 5L2TA 3MGYA 4LMUA 3FXXA 4MBJA 2UZWE 3QCXA 2IO6A 4O7RA 2W1IA 4EK5A 4EK4A 4J8MA 2VWBA 1BI7A 3GFEA 5H2UA 3AT4A 2ZDTA 4RPVA 1JKSA 4IDVA 3LFEA 5DVRA 4G3EA 2PVYA 2CNVA 2O65A 4HYHA 1IG1A 3PFQA 3UOKA 5HX6A 1OIUA 3PY1A 3DAEA 5CF5A 3RCJA 4X3FA 1O6KA 5L6OA 1CM8A 1XJDA 3DK6A 1MQ4A 2X4ZA 3ID6C 4H36A 4DTKA 4FT9A 1VZOA 1M52A 4TNDA 4D1SA 3WIGA 2R9SA 4IB1A 4X3JA 2CPKE 4BKZA 4ZS4A 3UP7A 4YJSA 1T46A 2R3OA 2UW5A 2BDJA 3AQVA 1TFFA 3FKLA 2OJFE 5IKWA 1QL6A 3F2AA 3FSKA 4YZCA 4JX7A 4JIAA 2XA4A 4JDJA 1REJA 4ANNA 3W2QA 2YIXA 4X2NA 5DOSA 2VD5A 2DQ7X 2IWIA 3SA0A 3UJGA 2JDTA 1G8AA 2IVVA 2W1HA 4BBEA 4CGAA 5FXRA 1JSUA 3L1SA 3FMKA 4RVLA 4IB0A 4IX6A 3OTVA 3ZOSA 4BBMA 4YLJA 4HZSA 3V5QA 3HAMA 3UC4A 4V0GA 2XANA 3EFWA 4UWYA 4DLIA 2XYNA 4R7BA 4DGOA 4UXQA 2YERA 4RIXA 4PDSA 3NAXA 3VO3A 1PMNA 3S0OA 5I3RA 4XYFA 2G2HA 3KN6A 4QP6A 2VZ6A 4RJ3A 3IPHA 4BCOA 3RAHA 4DT8A 4NJ3A 4NU1A 5JQ5A 3FI2A 5E8UA 4J8NA 4LI5A 3UIXA 3D7ZA 3GOKA 2W1ZA 3NNVA 4PF4A 3EN9A 4XG3A 3L9NA 5M55A 3DS6A 4AA4A 5KKRC 2R3MA 1Q3WA 2JBPA 3BLAA 3AMYA 5H8EA 3FLYA 2ITQA 3ZUVA 1UNGA 3MPAA 4Y73A 4FT0A 4FG7A 4FGBA 5DA3A 2YIRA 4QTDA 2OKRA 4XG8A 3PUFC 1W7HA 4K33A 3MH0A 5DR2A 3CKWA 3AG9A 4M13A 4R3RA 4XUFA 2A19B 3FL4A 3OCGA 5JSMA 4JJRA 4MWHA 2BAKA 1XO2B 3R7GA 3UE4A 4DEEA 5KKRB 5HX8A 5IPJA 4O2PA 4XEYA 4NIFA 4C0TA 3G0EA 1ZARA 2C5XA 5I0BA 2A2AA 3QA0A 4I20A 4U45A 4D2RA 5FWKK 3COMA 2R3HA 1Q5KA 3PXKA 5K4JA 2GQGA 5KZIA 4GSBA 2C6MA 4F0GA 5IA1A 1TVOA 2ONLC 4C8BA 4E5BA 4U9AA 4EOSA 1QPDA 4E6QA 3Q60A 2C3KA 2UW0A 2VO0A 4O1PA 5HG9A 4RRVA 4I93A 4FSUA 3BHTA 3UVQA 3O51A 4CFNA 5I9UA 3ROYA 4PL4A 4CG9A 4O0VA 1L3RE 3QQLA 4QTCA 3D7TB 4F7LA 3TEIA 3QQHA 4EHVA 3NVMB 5ANOA 3A4OX 2B54A 4QNAA 2R3RA 2CKEA 5FXQA 3ZM9A 3NCZA 4ZSGA 3BWFA 4DG3E 2WTWA 4O6EA 2VTOA 4ALUA 1ZY4A 4FYOA 2CNQA 5JQ8A 3VS5A 3A7HA 4EK6A 2QONA 3VBXA 2C3IB 2J4ZA 2NNWB 3ORZA 4L3JA 1WCCA 2ITUA 2JITA 5EQYA 4FEUA 3U6JA 3MFTA 2QOLA 4L43A 1M7QA 4XS2A 3CTJA 4FT3A 4MQ2A 5DRBA 5D9HA 4FT5A 3QZHA 4C57A 5J5SA 3ANQA 4I5MA 3EYGA 4KAOA 3UQFA 4USEA 4AZWA 5FGKA 4NFNA 1DM2A 4ZSLA 3MPMA 1A9UA 3EKKA 2XEYA 4HYSA 4BDJA 4QEBA 2WTCA 3IDPA 1A48A 3B8QA 3CTQA 5IQCA 4IAKA 5B7VA 4L42A 4O0RA 3FQSA 3PE2A 5HE3A 2C47A 3I7CA 2G1TA 1Q8WA 5EI2A 2IZUA 4UYAA 3REPA 3W2PA 2BHEA 5BMSA 3VJOA 3ZLXA 2BRMA 3Q4CA 2UW6A 5L2QA 4GK4A 5E8WA 4DFBA 3VUKA 4RT7A 4MYGA 4RX8A 2PHKA 2YDJA 4QYGA 1WMKA 2CMWA 4YBJA 5HD4A 2BUJA 5D7AA 4O96A 3PXQA 4XRJA 4ZTSA 1H25A 4R5YA 4NM3A 4D5HA 4FKPA 4WRSA 4JT3A 1J1CA 1HCKA 2R2PA 3EWHA 3SOCA 3SW7A 2X8DA 3WBLA 3WF6A 5GJDA 4A4LA 3MY5A 3GUBA 5AV1A 2CLXA 1R78A 1VYZA 2YCRA 3FLSA 3Q9XA 4QQJA 2YISA 3I60A 3HV7A 4KS7A 1GIIA 2OF4A 5CEMA 3MWUA 3T9IA 4PX6A 4DDIA 2JKKA 4PY1A 2QR7A 2W4KA 3LIJA 3PWDA 4DYMA 2W96B 3W0RA 3TV4A 2ZB0A 4UMPA 2HELA 3E88A 2QR8A 4IAYA 4O83A 3GOPA 5GJFA 5TKDA 5IZFA 2R3GA 4UB7A 3LE6A 3R7YA 4BTJA 5HLNA 3VBYA 3SG9A 4DAWA 4QTAA 3FC1X 3S00A 1UWHA 5EW8A 2Y8OA 4K0YA 4YSJA 4YP8A 3QFVA 4WG3A 4LL5A 4O0TA 5DFPA 2BFYA 5TR6A 3QRJA 2QKWB 5ANDA 5KBRA 4FR4A 5ETCA 5L8LA 4RX9A 2PYWA 3SXSA 5M08A 3FMLA 5HESA 2WZJA 3WZUA 2Y6MA 3FL5A 3EIDA 3IDCA 3NLBA 4W9XA 2UZDA 2XNMA 5IQDA 2O64A 3OTUA 3TDWA 2BCJA 3ZC6A 4IQ6A 1U54B 3EH9A 3RP9A 1R3CA 1Q62A 3ZZEA 3BYVA 3LLAA 4QMNA 4YNOA 2WTJA 1O6YA 4R77A 4FSNA 4DEAA 3F5GA 4IWOA 3ZCLA 5KMNA 3ZO2A 3Q96A 5IQGA 3W8QA 2RKUA 4EH8A 2GQSA 2ZMDA 4GU6A 2C5VA 5HNIX 4QPMA 5K3YA 1JKTA 1XBCA 3OCSA 1YOMA 4G16A 5DPVA 5AM6A 4O0YA 4BYJA 2PULA 5C1QB 4BCHA 1XH7A 3LQ3A 1G8KA 3R8MA 1UNHA 4GJ2A 4RVTA 3VHKA 2ITWA 4UY9A 3E87A 3LFSA 3RALA 1GIJA 3NSZA 5KHXA 4OTWA 4ZSAA 2IPXA 5DLSA 3QD0A 1ZXEA 1ZY5A 2BDWA 4IX4A 3O5AA 3N4TA 4EORA 3QAME 3ZDIA 3CY2A 5E8YA 1IA9A 5IEVA 5BYLA 1H1PA 5EQEA 2O3PA 3O7LB 3NVKI 3OUKA 4L3PA 2XK3A 3W32A 2XIZA 4GIHA 3II5A 2BKZA 3PVWA 4TW9A 3VUHA 2W7XA 4IC7A 2WMWA 4CTBA 4DCEA 2F7XE 3BQRA 4AE6A 3PLSA 3NYVA 5CSXA 1PHKA 1LPUA 4N4SA 4DTAA 2YFXA 2DS1A 5GZAA 3UG1A 5AR2A 5AWMA 1ERKA 3NNWA 5IQFA 2P4IA 3A7FA 3F66A 1JKLA 3FI8A 2CDZA 3NZ0A 2W5BA 3HP2A 3LHJA 4CMOA 4HGLA 4AT5A 5HIBA 2XALA 4A4OA 5BVDA 3ZTXA 5T68A 3VS4A 4JR7A 5K9IA 3VUIA 5BPYA 2X0GA 2GNJA 4LFIA 4GIIA 1QPEA 4EZ7A 4QYFA 5CVFA 1LP4A 4DDGA 4BKJA 5EI8A 3Q6UA 3CQWA 3QTRA 4FIHA 4QP4A 3ZS5A 4A9SA 3IKAA 4GYGA 2HK5A 3UGCA 3G5DA 3JS2A 2YIYA 4PMPA 3O0GA 4GKHA 2B52A 1Z9XA 2OGVA 1YDSE 1ZMUA 3T9TA 3E8CA 3W2SA 2OFVA 3L8PA 3VS2A 1SMHA 3D2KA 2XAOA 2E9OA 1J91A 5AX9A 2GNLA 3BL9A 3E8EA 3C4FA 3QYZA 3V5LA 5HU9A 4ANLA 5CNOA 4CFFA 3W0NA 1CMKE 2XRUA 3FLWA 4GL9A 3QQUA 3R7OA 1ZOGA 4M67A 1RDQE 4O4FA 2OWBA 4YUQA 2CN5A 4BYIA 3MTLA 1H0VA 4FKIA 4O7VA 3G15A 4C59A 2A4LA 4JDIA 1ZYJA 3A4PA 4G6NA 3KF7A 1WBNA 4LGDA 2ERKA 4DEBA 1QPJA 3NUPA 3EN6A 2WPAA 3GCPA 1R1WA 3DQXA 3SRVA 4FV1A 4DFUA 5ANIA 5A46A 2R4BA 4Q9ZA 3TNWA 2Y6OA 4UZDA 3H0ZA 3ZYAA 4C58A 3R22A 4EOJA 2YM3A 4CLJA 4K8AA 4EH2A 3FSFA 3PYYA 4OGRA 4YPDA 4JLCA 2GS2A 2OIQA 3P23A 4QP9A 5LCJA 4O0UA 3R71A 5C8MA 4K77A 3DAJA 4O86A 4AUAA 4C2WA 5CANA 1H07A 4C36A 1REKA 4NTSA 3ZXTA 4KNBA 2IW9A 4D9TA 4LV8A 3ORIA 5HLWA 4QQ5A 2YLEA 4PTGA 1K3AA 3FYKX 3A7JA 4EUTA 4BCFA 2VO7A 3GI3A 1Q97A 2WELA 2UW4A 3C1XA 2GNGA 2UUEA 4ZJJA 4Z9LA 3ML1A 3RPYA 4BJJB 2XB7A 3KRWA 4FSTA 4F9WA 5AA9A 5HGIA 5GJGA 4AW5A 2YCSA 2R0IA 3FMNA 4AZFA 4EK8A 2OG8A 4LOQA 3LCSA 3TIZA 3ZBFA 4CYIA 4YU2A 1CKPA 3FXZA 4ERKA 1PYXA 3LKMA 5AP2A 5KX8A 1P4FA 2GNFA 3DDQA 3F5UA 4U6RA 4W4WA 4DFZE 4N70A 4RX7A 3QQFA 4C34A 3GC7A 2JIVA 4CVAA 3QL8A 5I9ZA 5IMEA 3PJCA 1ZRZA 3DFAA 2GTNA 4BCMA 2VWUA 3GQLA 4NM0A 4BZDA 1OVEA 3UO4A 2IVTA 3GU5A 4O0SA 5DT0A 4AOJA 4GVAA 1Q3DA 1IASA 3I0OA 3LVPA 3SLSA 4FV8A 2VTHA 3FMHA 3WYYA 3EL8A 4FSMA 5JEBA 5JKGA 2C68A 1GY3A 3TCPA 4YO6A 3A2CA 1XQZA 2JC6A 4ALVA 2W4OA 2QO9A 2OXXA 2IZTA 4FKLA 3KEXA 4FVQA 1NY3A 4KIQA 3DXQA 4IACA 2ZOQA 2Y0AA 4ASDA 4BCQA 4EOPA 4UMRA 1DI8A 3OWLA 1FMKA 5A54A 3V8SA 1OL7A 3EFKA 3QTUA 2J5EA 4NM7A 1G5SA 1PMVA 4IZ5A 2CLQA 3QZIA 4QMSA 2XRWA 5CQUA 2FA2A 4ITHA 3R21A 1Y8GA 2CKOA 3D5UA 3ORPA 2G2IA 4OLIA 5D11A 2PY3A 4HVIA 1Q99A 4JL9A 4OT5A 2JFLA 5DNRA