3TNHA

Cdk9/cyclin t in complex with can508
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
321
structure length
288
Chain Sequence
VECPFCDEVSKYEKLAKIGQGTFGEVFKARHRKTGQKVALKKVLMENEKEGFPITALREIKILQLLKHENVVNLIEICRTSIYLVFDFCEHDLAGLLSNVLVKFTLSEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLITRDGVLKLADFGLARAFSNRYNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLALISQLCGSITPEVWPNVDNKVKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWSDPMPSDLKGML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cyclin-dependent kinase 9
publication title The CDK9 C-helix Exhibits Conformational Plasticity That May Explain the Selectivity of CAN508.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 80
structure length 288
sequence length 321
ec nomenclature ec 2.7.11.22: Cyclin-dependent kinase.
pdb deposition date 2011-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3tnhA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3tnhA01
3BELA 4ZJJA 5EKOA 3EHAA 4NM3A 3L8SA 4BKZA 4O86A 3DT1A 4K11A 3VS4A 1WVYA 4G3CA 4WIHA 1G5SA 2YCFA 3NPCA 3ANRA 4RX7A 4D2WA 4DGMA 1KE5A 3FQSA 1P5EA 1NW1A 3LLTA 1UNLA 3RPVA 3DTCA 4G5JA 4I4FA 5IF1A 4IH8A 4YUQA 5KMKA 2VWWA 5BPYA 2UZWE 2PMOX 2J0KA 4H58A 4H3PA 4K18A 3LFQA 3DXNA 3PSCA 3OW3A 3P7CA 4R3PA 4FTCA 2XMYA 3NUUA 4C0TA 4YHFA 2PMLX 3DBQA 3TNIA 2YITA 4DGNA 3NDMA 3BIZA 4O38A 1KV1A 1NVQA 1XBBA 2B9IA 3D5WA 2W4JA 4MD9E 5HNBA 5HTCA 5FTGA 3GFEA 4FKGA 4GVAA 3OHTA 3Q5IA 5TR6A 4XRLA 4FF8A 4JT3A 3ROYA 4ANMA 2OJFE 3PUPA 4FKOA 3GC0A 4HJOA 3FZ1A 4OBQA 4FT5A 5DWRA 2PZPA 3FL5A 3PSBA 3W2RA 4EJ7A 3MBLA 5FEDA 4I4EA 2W9ZB 3MFUA 2JBPA 4G31A 3OXTA 4O1OA 2XEZA 3VBWA 3G6HA 4D58A 4IIRA 4O7RA 3RPSA 2JAVA 3IQ7A 4RIWA 2RFDA 4X0MA 4BZDA 3TNHA 3KF4A 2IW8A 1Y6AA 4QTBA 5CAUA 4PDSA 3VVHA 4AT4A 1H24A 2QU5A 5IQFA 3A7HA 3B8QA 4CQEA 4NM7A 2JKOA 2OGVA 1Q8ZA 2HW6A 3PVBA 1VJYA 4RA5A 3EQRA 3KC3A 4TT7A 4UALA 5HBEA 5A46A 1Q4LA 2A19B 2HY81 1OM1A 5J9LA 1OB3A 1VR2A 3QD3A 2Z60A 4JR3A 3IW4A 4FVPA 4LYNA 5EYKA 4BCFA 3U9NA 5HIBA 3EQCA 2FUMA 2OK1A 2HYYA 2QVSE 3HP2A 4I92A 1H0WA 3ET7A 4D1ZA 4GMYA 3PZEA 3C5IA 1DAWA 4QPAA 1BUHA 3GOKA 2R5TA 4V04A 4FE2A 1Z9XA 3I0QA 3FWQA 5D10A 2PYWA 5CAPA 3TIYA 4S32A 3IDCA 4AX8A 3CJFA 5DEWA 4DFLA 5CEQA 4EYMA 3V8WA 4EBVA 4BYJA 4E3CA 1YOMA 3JUHA 3BGQA 4A4LA 3P78A 4E4MA 1CKIA 4OT5A 3PFQA 2R7IA 4NM0A 4FOBA 4O0YA 4M0YA 1IG1A 1KE6A 2OIQA 3F6XA 5IH6A 2Y0AA 3WE4A 3QZIA 1W98A 4L44A 4I41A 4IE9A 2G2IA 4FOCA 3DXPA 1OIRA 4TRLA 5JKGA 4GU6A 3U8WA 4W9XA 5HU3A 3FBVA 3DS6A 3OWKA 4FEVA 3C4FA 3TV4A 3VS3A 1Q99A 3IW8A 4FKQA 5TO8A 4U3ZA 2WMWA 4IM3A 4U5JA 4K77A 2W05A 4O1PA 1O6KA 2BZHB 2I0HA 4D4SA 3W2SA 1FOTA 5EHOA 5EW9A 4CZTA 5AM6A 3M11A 1M2PA 5LWMA 4QPSA 3UYTA 5LVLA 3ORNA 4IB5A 2FGIA 5CZHA 1REKA 3COMA 3EQFA 4GG5A 3KRLA 1M2RA 4AA0A 1ZOGA 4W4XA 4G3FA 4RT7A 1KOBA 4ERWA 2XUUA 5J1WA 3PP0A 2RG5A 2JKKA 5AJQA 5FBNC 4XJ0A 5C8NA 2HELA 4IZAA 2W7XA 3TEIA 4F7NA 1GJOA 3A7FA 3ALNA 4JL9A 2XJ0A 4MD8E 3VUHA 3E3PA 4GK3A 4IVDA 5BYZA 2GNIA 5AEPA 3LCKA 3BU5A 4CKRA 5AP4A 3PXZA 4WNMA 4C3RA 1LUFA 3CXWA 2DUVA 2H6DA 1YI3A 4U9AA 3ZFXA 4BBEA 4AT5A 1QPDA 5M08A 4ZS0A 5C03A 4RIOA 5H3QA 2XRUA 4RVMA 5F20A 2Z7SA 1E1VA 2X0GA 3QA0A 5CSVA 5DBXA 3ENHA 5ACKA 3VUGA 4ZY6A 2QOLA 1JVPP 1YVJA 5C01A 3TXOA 4XP2A 1PJKA 2JIIA 2YN8A 3RPYA 2RSVA 5BVOA 3ZTXA 5L6OA 4AGDA 2XEYA 4YNOA 1OMWA 3EB0A 1I09A 3NEWA 3PP1A 4FV3A 3RCDA 4QTAA 5CF8A 5CY3A 2ITOA 4O7YA 4UYNA 2J4ZA 2JDTA 3QGWA 4FV6A 2ZAZA 1XH7A 1QPEA 2F2UA 1BLXA 2CDZA 3EFLA 3ORTA 3QRKA 4I0SA 4MWIA 4XS2A 3SKCA 3VF9A 1H27A 1XH6A 2DQ7X 4GIIA 5DHJA 2PVYA 3EN6A 2GCDA 5CAOA 4MX9A 1MRUA 3DB6A 1CM8A 1UA2A 3SHEA 2UW4A 2W1GA 4LOOA 4G2FA 3C4XA 2C3LA 3FAAA 4U43A 5FD2A 1PYXA 3MB6A 4PRJA 4IVAA 4V05A 4KS8A 4I5CA 3G51A 3UVPA 2HCKA 3ULIA 2ZYBA 2HENA 2X4FA 2IJMA 2ITVA 4PMTA 4AW0A 5CSHA 3GEQA 2R3FA 4J98A 3DB8A 5CVGA 4HNIA 1UWJA 1X8BA 2Y4PA 5BVKA 1FPUA 4FV1A 2PZ5A 4A07A 3RK5A 4H3QA 4IAYA 4CQGA 4UN0C 5IQBA 3F61A 4ZJIA 3RPRA 4DFZE 3BPRA 3GU7A 3RVGA 4E5BA 4O0VA 5HKMA 1H8FA 5E7RA 3ZSHA 3AC3A 4LMUA 3LIJA 4DEIA 3BLQA 3FUPA 2XYUA 3C1XA 1SM2A 3D9VA 3QFVA 4YJSA 4RJ3A 1GIHA 2J0MB 3OXZA 4M97A 3IW7A 1Q97A 3PLSA 3LXLA 1YW2A 3GC9A 2YIXA 2GHLA 3NRMA 4PTEA 5AIRA 5DVRA 3T8OA 4ZSAA 4ZSJA 4IDTA 3BU6A 3Q3BA 5HGIA 3V8TA 4N4SA 5CEPA 3P7AA 4LUDA 2EUFB 1WBSA 4YSMA 4KSPA 2VTJA 3IDBA 2C6OA 1B6CB 4KSQA 3ZS5A 4D2RA 1UU7A 1YXTA 3FLZA 3KREA 2NP8A 3T9IA 5FXSA 3N4TA 4F08A 2FB8A 2XK7A 2ONLC 2ZV8A 3F5XA 3KA0A 2O0UA 3FMDA 4TYHB 4AZTA 4A9RA 2GS2A 3NZ0A 4MCVA 1XH8A 4KIPA 4P7EA 4IBMA 5J9ZA 1S9JA 2KTYA 1BL6A 2GNHA 4FNWA 3UIBA 3BLRA 4FV2A 3GU4A 2Y4IC 5LJJA 1R39A 2PPQA 4G16A 3PY1A 3QQKA 5CU3A 3FEGA 5IQAA 1H28A 4JRVA 4CFXA 5AADA 3RHXA 1OIQA 3MJ2A 1QPJA 4RJ6A 4XNEA 5CNNA 3DNEA 2I40A 1XH5A 2Z2WA 5IA0A 4WSQA 2C4GA 4X2JA 5EW8A 4JXFA 5JZNA 4OT6A 5FEQA 4EOKA 2YAAA 5KUPA 1EH4A 2J5EA 4XX9A 4FKSA 3TN8A 4DFNA 4PMPA 3Q2JA 5ETIA 2CGWA 4JX7A 4ORKA 4RLKA 3HECA 1JBPE 3WOWA 1PF8A 2F4JA 5TKDA 2WFYA 1H25A 4QQ5A 2R3OA 5AA9A 5L6PA 2PZYA 2QC6A 3FMHA 4S34A 2UW9A 3JVRA 3R8ZA 3OEZA 1GY3A 3EWHA 4NTTA 4R7IA 5D41A 5BMSA 3NWWA 1FVVA 3VS5A 4DT9A 4L46A 4C2VA 4TNDA 5JK3A 4F70A 5M4FA 2XNOA 3GGFA 5M44A 2B52A 2OXYA 3EQGA 4JRNA 2ITXA 3ODZX 4R1VA 4OW8A 4RPVA 3Q4CA 4FTMA 2E9OA 3ETAA 1TQIA 2WQBA 4O96A 4QOXA 4WNKA 5ANOA 5AWMA 4JBQA 2YCRA 4C36A 5CU0A 3DBCA 4O0WA 4XMOA 4R7BA 3QD2B 2XM9A 4RC4A 4BGQA 3DKFA 3EQBA 3L9PA 3F69A 4L43A 5CVHA 5DR2A 4Y72A 4KKGA 5HHWA 4FC0A 1KUTA 4U45A 5I9ZA 1BMKA 3CPBA 3EL8A 4DINA 2VNWA 2OZAA 2O2UA 1YRPA 4FTRA 4I6QA 5M57A 2E9NA 1ZZ2A 2YDIA 3D94A 5EW3A 3H9FA 4ENXA 5IQCA 2J90A 2VGPA 3HA6A 5AR7A 5ETAA 5I0BA 4I6HA 3AD6A 5L2TA 3OUNB 4IMYA 2I7QA 3MV5A 3B2TA 4L6QA 5TT7A 4CGAA 2NO3A 4E73A 2NNWB 4WG3A 2J0LA 1MRYA 3NCZA 4F09A 3LJ0A 4G3GA 2WU6A 4ZJVA 3UPZA 3OY3A 5ANEA 2CKEA 3R7UA 1J7IA 4YR8A 2RGPA 3B2WA 4PL5A 2YERA 4JDHA 2ACXA 4B6LA 1Z57A 2JFMA 4CLJA 4QP9A 3BCEA 3MESA 3DU8A 5DMZA 2VTNA 5KMMA 3SGCA 4MWHA 3KXNA 4BHNA 2ZM4A 3DAEA 3VS1A 4F6UA 3L8XA 3LQ5A 4GK2A 3I6UA 4QPMA 1NXKA 4AOIA 4C34A 2C5OA 3AT4A 3MPTA 4DH5A 2YEXA 2ZVAA 1R78A 4IFCA 4AFEA 2B9JA 1PXJA 4R7HA 5AR5A 4O7TA 5AP7A 4BKYA 3WYYA 4NJ3A 4CFUA 2CLQA 3P86A 1ND4A 3QCQA 4YNEA 5K5NA 4DG3E 3KEXA 2QOBA 3UDBA 3MH2A 4PQNA 4F63A 3D2KA 2CCHA 5HX8A 1TQPA 3EH9A 3TKIA 4BCJA 1Q3WA 4YJQA 4C02A 4FV8A 5E8YA 5C4LA 2OJ9A 3KRJA 4W8EA 3MDYA 5A4LA 4E5WA 1PY5A 1W84A 3KU2A 4RWKA 2ETKA 3QTUA 2VO0A 4KS7A 4FSZA 3GBZA 5GHVA 1PXPA 3GCPA 5CT7A 2PVMA 4HW7A 2PMIA 4TYHA 4C4GA 4BN1A 4O0UA 2AC5A 5EG3A 3TT0A 4D2PA 1UU9A 4MQ2A 3RNYA 4E20A 4J95A 3W16A 2R3NA 4F6SA 2CKOA 4CV8A 4Q2AA 3TUBA 4DITA 2V0DA 3R30A 3G15A 4WBOA 3O50A 5HBHA 1XBCA 5LARA 1Z5MA 4AXAA 5EQPA 4CT1A 1QPCA 2UVXA 2UZTA 4PNIA 4V01A 3QXPA 4MBLA 2XJ2A 4ASXA 5CANA 1RJBA 3BZ3A 4R3CA 4BDFA 1U4DA 2IW6A 3FYKX 4I21A 2WQNA 3UNJA 5IH5A 3S95A 1Q8WA 4HGLA 5DYJA 4IVBA 3R71A 4PP7A 5HEZA 1STCE 1PMVA 2YIRA 4FKJA 2OO8X 4AN2A 2OLCA 3G9NA 2BUJA 4QMYA 2HZ4A 4U81A 4F9WA 1FQ1B 4YLJA 4FIEA 5FUTA 3C0GA 4M69A 4IWPA 2XNMA 3NUNA 4YHJA 2CLXA 5HG9A 3KN5A 3QCSA 3FPQA 5LMAA 2YJSA 3BHVA 4FSQA 2WIPA 3K3IA 4GFOA 5AP2A 3SRVA 4RIXA 1YWNA 2VTAA 5A14A 3E8EA 1SVHA 3ID6C 5L2IA 2XKDA 4LL0A 4O91A 4AOJA 5BX0A 2EWAA 3UBDA 4IM2A 3HDMA 4FKVA 4J71A 4XP0A 2WMRA 4BCPA 4EYJA 5CLPA 3ORZA 1VYZA 2PE0A 2I0YA 2PVNA 4F65A 3FMJA 4L3LA 4YJUA 1OKWA 2F2CB 2GNGA 4AN9A 2V22A 3CSVA 2UUEA 3ZBFA 5I9UA 4EZ7A 4OAVB 1KE7A 4FV0A 3D5XA 5LMKC 3IG7A 3OCGA 4JDJA 5FXQA 3RI1A 4FIJA 3PZHA 4ITHA 4H05A 4IACA 3LXPA 2XKFA 3EQIA 1ZYDA 4ASDA 4DLIA 4ZLYA 3COHA 3MWUA 2CNVA 4YTCA 1F0QA 3CD8A 3TZ9A 4F1OA 5J7HA 3FMEA 4TYIA 3PPKA 5AUWA 3WF5A 3HV5A 3R8PA 3F9NA 2QG7A 2V55A 5HICA 4IM0A 1ZAOA 5EDPA 4B8LA 2O3PA 3OF0A 3LVPA 5HCXA 2QI8A 3WZJA 2J9MA 1YHVA 2QOOA 4BWKA 3ORXA 4IEBA 5E9EA 3UQGA 2OBJA 1XKKA 2V5QA 3A99A 3QALE 3QYZA 4W4VA 5ACBC 3BYSA 3E8NA 5CSXA 3UIMA 3UNKA 2W1CA 3PVWA 4XYFA 2XIYA 3QD4A 3R0TA 3ZBXA 4JVGA 3N4UA 5CQWA 4CRLA 2EB3A 3NMUF 3H0ZA 4KIOA 4C4FA 2YCSA 5FGKA 2CJMA 1M7NA 5IUGA 4EL9A 4N57A 3LFNA 4EQMA 5CENA 4MF1A 4UMPA 4UMRA 3LCOA 5LCKA 3FSFA 4PTCA 4GFMA 2QR7A 1WBVA 3R1YA 5BVWA 3IW6A 4I93A 3M42A 3E93A 3BBWA 5IPJA 5IMEA 1OKYA 3PIXA 5KHWA 4AGUA 5HNGA 4EJNA 5CI7A 4O82A 3T9TA 2YIYA 5FWKK 4X2FA 2WGJA 3PA5A 3MA6A 4FK3A 2XK4A 1JKKA 4TZRA 4FKRA 4EOOA 5LOHA 3ZUUA 2OSCA 2WOUA 5DGZA 5GZAA 1K3AA 3E7VA 5EH0A 4XH6A 4KBAA 3AT2A 5D9HA 2R3HA 5EKNA 1OZ1A 3MPMA 3P79A 3TNWA 5KMIA 3VUDA 4JNWA 2OXDA 3LM5A 4Z9LA 2VX3A 3LPBA 3VHKA 4EEVA 3FMKA 4DG2E 4EZ3A 5CZIA 3V5PA 3VBXA 4MXAA 3F2RA 2W9FB 4FSNA 4NKAA 2CMWA 4PWNA 4YZCA 4DEGA 4X6QC 4DCEA 3I79A 4MK0A 1LP4A 4XHKB 3G5DA 5AV2A 2YJRA 5HO7A 1XH4A 4H1JA 4LGGA 4AE6A 4RVKA 3EN7A 5DR9A 3QX4A 2Z02A 3KCKA 4X2KA 3BQRA 3EKKA 4S31A 4DN5A 4XP3A 5CU2A 4ZAUA 3GXLA 2GNFA 3OOMA 2X9FA 4RGJA 3QTIA 2SRCA 4HPUE 4ZTNA 2IW9A 3R8UA 4EC8A 4O7NA 2P33A 2VTOA 4FG8A 3Q4TA 1YDRE 2J5FA 4U97A 3F3ZA 3H9RA 4ENYA 1RQQA 2R3KA 4GW8A 4D28A 3E88A 4QD6A 4L3JA 3F66A 3U54A 4D4RA 3UP2A 4FZFB 4BWPA 5ITAA 4EHGA 4XG6A 3D5VA 1IR3A 4Y8DA 5CU6A 4HGSA 4DHFA 4F7JA 4RZVA 4XCUA 2WMUA 5K3YA 4EONA 3DA6A 5GZ8A 2CNQA 3OBJA 5JQ8A 2X39A 2JDSA 3C7QA 2BR1A 2HOGA 2VTMA 3KY2A 1OPLA 4BDIA 1UKIA 2WZJA 3QTSA 4UYAA 3AXWA 5C9CA 5C8MA 5HORA 1ZRZA 3KXZA 2QKWB 4HOKA 4QMMA 5ANJA 3ZUVA 3ZRLA 3K5VA 2XKEA 1VZOA 4EQUA 5EM7A 5L2QA 3D0EA 4MQ1A 5AAGA 2FVDA 3R9RA 4FMQA 4DGOA 2ZDTA 1UWHA 3EN9A 3OOGA 2QO2A 2VV9A 3RAKA 4D9UA 3GU5A 2UZBA 2FO0A 2C5NA 1FMOE 1Y8YA 4PNKA 3Q32A 4FG7A 4EWHA 1YOJA 4AF3A 1XJDA 5CASA 2GQGA 4Z7HA 4WRSA 4I5HA 1J3HA 2XS0A 2Y9QA 3M1SA 4BZNA 4NYEA 2BRGA 2OH4A 2IZSA 4S30A 2GS7A 3DQXA 4WNOA 4A4XA 4EZ5A 3UZRA 4A06A 4YU2A 2BPMA 4YMJA 2BCJA 3ZM4A 3DDPA 4EH2A 4FTAA 2WTJA 4ZSLA 4EK3A 2W17A 3SAYA 5IQIA 2GHMA 5FXRA 2W1FA 4D2SA 2QQ7A 3AGMA 5KX8A 4YURA 4E6AA 2AUHA 2BDFA 3O96A 3MTLA 5BMMA 3RMFA 2PVFA 3WBLA 4GS6A 4ZXTA 3FQEA 1PXMA 3F7ZA 3PDTA 1ZOHA 4JS8A 3RM7A 1JLUE 1U59A 3Q6UA 3UZTA 1DS5A 4MD7E 2A4LA 4IVCA 4LM5A 2BIYA 4OUCA 1REJA 3HVCA 5CI6A 4AW1A 3HRCA 3EOCA 5J5SA 3BU3A 4ITJA 3QXOA 3BI6A 2WTKC 5CS6A 5EHLA 1TKIA 3GI3A 3WIKA 2OG8A 4X2GA 4WKQA 4XV3A 4TYEA 4AZWA 4KAOA 3FV8A 3H30A 4XG4A 4N6ZA 2GS6A 4C4IA 4FEWA 5C8KA 2RKUA 1OL2A 5T3QA 5BVFA 2BDWA 2PVHA 4UWYA 3ZU7A 1SVGA 4Z7GA 4NM5A 4RWJA 4AQCA 3G6GA 1FVRA 4R3RA 2J6MA 3VQHA 4AN3A 3K54A 3HP5A 4G3DA 5CEMA 1OGUA 2R3MA 2R3RA 3MJ1A 3AC1A 4KABA 3Q9YA 5HO8A 4EH5A 1OI9A 4L9IA 3KXMA 3NNXA 5FTQA 4APPA 4FR4A 4BICA 3I5ZA 1XWSA 2Z7RA 5EK7A 3R83A 2DWBA 4B9DA 1UKHA 5A6NA 4FT9A 3NUPA 4XBRA 2QODA 3K3JA 4GJ3A 2YLFA 2QHMA 3BQCA 3QCXA 2PHKA 3R04A 4WHZA 2HZ0A 4JLCA 4UB7A 4N6YA 1H26A 4PPAA 3QF9A 3VHEA 3ZO2A 5K4JA 2HXQA 1PXOA 4FKLA 4BKJA 2WTWA 3V5WA 5M4UA 4ACGA 4YO6A 3IGOA 3VJOA 4EC9A 2OF2A 3HV3A 3RBWA 3FHIA 5J5TA 3DLZA 3P1AA 4E8AA 4MBIA 4RIYB 5KZIA 4EK4A 2BRMA 1ZY4A 3KL8A 2OW3A 2ZV7A 3A60A 3KKVA 2O8YA 4EUTA 2A2AA 4NFMA 2E9VA 2F7ZE 4HVGA 3TZ7A 2CCIA 2QOCA 2V62A 2BHHA 4MHAA 5JN2A 3H0YA 1OUKA 3DK7A 4YSJA 3AMYA 4QT1A 3KRXA 4MYGA 4X3JA 4UX9A 1Q61A 4TNBA 1GAGA 4XEYA 4B4LA 4G17A 3ZDIA 4Y5HA 3BEGA 4FSWA 3FDNA 3BHTA 3F5PA 4GVJA 5HVKA 3F3VA 1OUYA 4HZSA 1VEBA 2ZOQA 3BEAA 3CQUA 4GV1A 4RLLA 3N4VA 3ORLA 2NRYA 3CC6A 3VS2A 2XP2A 3AMAA 3ZEWA 3Q9ZA 1Y8GA 3BWJA 4IZYA 3C0IA 4D2VA 4C7TA 2B7AA 2FA2A 4LUEA 4CFWA 5CVFA 3E63A 2QHNA 3LFAA 1JKTA 1OITA 4BTKA 4U42A 2I1MA 4BCHA 3ZLXA 4L67A 3UC3A 4C58A 5KO1A 4EH6A 5KHXA 4KNBA 4X3FC 5E8TA 4RZWA 3Q5ZA 4UY9A 4I3ZA 2WMTA 4DEHA 3HZTA 5KNJA 3BV2A 3Q4ZA 3BYMA 2DS1A 2R3GA 4C35A 4CD0A 4F1TA 4BDBA 3HKOA 5CEOA 2ERKA 1JSUA 3DY7A 3I6WA 5AP3A 5KKRC 5CYIA 4J8NA 3UO6A 4F99A 3IW5A 4JI9A 3TI1A 2GTMA 1OKZA 1V0PA 4FODA 1FINA 3KRWA 4QYFA 2QOQA 5IA4A 1XQZA 2HWPA 3CQEA 4NK9A 5LVOA 3S1HA 5HVYA 5B0XA 4YJTA 3ZO1A 3CTJA 2O65A 5EOLA 4WBBB 3CTQA 4HYHA 4CFFA 2FSMX 3WZUA 1BI7A 4R78A 3DBFA 3FSKA 5JFXA 3PJ1A 3ATTA 3DBDA 3MI9A 2KULA 4LI5A 3L8VA 3QC9A 3G0FA 4J99A 5D7AA 3QRTA 2VX1A 3KQ7A 3ERKA 4XRJA 3DNDA 4I1ZA 4XUFA 4MXCA 3TACA 3R9OA 1L8TA 4EOSA 2JEDA 2CKQA 3LQ8A 1YWRA 2X7OA 3FLWA 4IC7A 1ZY5A 2VX0A 5DEYA 4CVAA 4F9BA 4RWIA 4EHVA 3CJGA 4RFMA 4FIIA 4FK6A 3FL4A 3NNUA 4ANBA 4FNYA 1IAJA 4NT4A 4DGGA 2OZAB 2WTVA 2CKPA 4GYIA 3V5LA 5D1JA 5CF5A 2GHGA 4UV0A 2XKCA 4NZWB 4FEUA 4Q9ZA 4FSYA 4AT3A 4P5QA 3WYXA 5HTIA 3FXWA 3UPXA 2Z7LA 4IX5A 5AP5A 3PJ8A 3ACKA 4TYJA 3QRUA 5BYYA 2V7AA 3ODYX 3TNQB 3R1QA 3F7WA 4JBPA 1WMKA 2WMXA 3WZKA 3HL7A 2HIWA 2YM3A 4GYGA 4JAJA 1DM2A 3GU8A 4IHPA 4ZK5A 3W8LA 2VTLA 4FKUA 4FGRA 2PY3A 2HZIA 4M67A 5CQUA 4AFJA 3HRBA 5M07A 4QMXA 3O7LB 4OTQA 2G1TA 3VBTA 5M53A 3WF8A 1K9AA 4LRMA 4RC2A 1IA9A 3I7BA 4CG9A 3HLLA 3KMMA 4IFGA 2WTIA 4QMOA 5GJDA 4RIYA 3WZEA 3COKA 4F7SA 5B2LA 2BZJA 2ITUA 2W1EA 1KE9A 1GIJA 3PIZA 2PWLA 2I6LA 4RBLA 3QC4A 2C6EA 4FTUA 3AC8A 4FVRA 4NIFB 4H1MA 3OP5A 1M14A 4KKEA 1XR1A 3CQWA 5A9UA 2W1HA 3FZSA 3RWQA 3R6XA 2UZEA 3HGKA 5AUVA 3MTFA 3QAME 4WG4A 2W99B 3QUPA 5BYLA 1IEPA 4IWQA 5DA3A 3Q4UA 3NYVA 3E87A 2HWOA 3BYOA 3NUYA 5IUHA 5JFWA 2OJGA 4YHTA 3F88A 3QHRA 4BI1A 1YXXA 4RA4A 3PA4A 5AUYA 1Y57A 4TN6A 2X7GA 3RK9A 2CNUA 3AD4A 2XZSA 4FNXA 4NH1A 2ITWA 3W18A 5G1XA 3VWAA 3KMUA 4A4OA 1PW2A 4QMVA 1SZMA 3ZDUA 5E8WA 2UV2A 4QP2A 3R01A 4JBVA 5T68A 3KF7A 1TVOA 2VTRA 4DYMA 4X6RA 5A4CA 5A4TA 4CTCA 4C4EA 3U55A 4V0GB 3U6HA 2C5VA 2J0JA 3QWKA 4X7QA 1FGIA 2LAVA 4EOJA 1MP8A 1I44A 4MNFA 3GT8A 3IOPA 5IEXA 4DFUA 3WF9A 4DT8A 4L53A 2WQEA 1TQMA 4WUNA 2OKRA 2IZTA 4BCQA 1J7LA 2W1ZA 1NVRA 3AQVA 3C4EA 4H39A 4NJDA 2HW7A 4D9TA 3R7IA 2OXXA 3QRIA 3RP9A 4L52A 4EORA 1LEWA 1URCA 3C4ZA 4CMUA 1E1XA 5E8XA 3DQWA 4XG8A 1UNHA 2YZAA 4YJVA 3S2PA 4GT3A 3VULA 1ZWSA 2GFSA 2Y7JA 3NYOA 4M69B 3V8SA 1XH9A 4XG7A 4BCKA 3HMPA 3FE3A 3A62A 3IOKA 2JIVA 2Y4IB 1LEZA 2WNTA 3R00A 4L01A 3DJ6A 4M84A 3W2CA 3SRVB 4RIXB 4O7LA 4DAWA 3O8TA 3ZOSA 3FI4A 3BHHA 4NUSA 4YZ9A 5CU4A 3ZUTA 3ZRMA 3P7BA 2EXEA 4ZS4A 4FTQA 5CWZA 5JQ5A 2BFYA 5GIOE 4WO5A 1UNGA 2UVYA 4K2RA 3R7YA 2P3GX 4RJ4A 4O21A 4RMZA 4ZZOA 5AFVA 3L9MA 3PE2A 2PTKA 3RPOA 4QMQA 2QOIA 1WZYA 3RAWA 3DJ7A 5L6WL 5CNOA 1Q8YA 4YTHA 3SA0A 1NT2A 2VTSA 3TTJA 1WBNA 3RZBA 3TKUA 4MXZA 5EM6A 2PVKA 3KCFA 4PX6A 3PXRA 4I5MA 2XCHA 2PVLA 2QO9A 4GUBA 4MAOA 5ANGA 4DFXE 1WAKA 3TIZA 5HD4A 3S0OA 4ALUA 4F7LA 2QNJA 4L42A 3DAJA 4ZTSA 5E4HA 4JAIA 5HG5A 2G9XA 2UVZA 4JJRA 3A4PA 3E8CA 3NS9A 3O0GA 4FTIA 4OTRA 5M09A 1CKJA 5DFPA 2ITTA 2BHEA 4M15A 4KBKA 2CN8A 3G9LX 5J9YA 3GUBA 4GCJA 3R9NA 4QMSA 4RJ8A 2R64A 4TKSA 4DTKA 2Z8CA 3PWDA 4J8MA 5CAVA 3WIGA 3U6IA 1YI4A 2B0QA 2O63A 1UU3A 3HMMA 3JPVA 2QU6A 3FMMA 4DTAA 3RAHA 2JLDA 4FV9A 5H9BA 5AR4A 1H1PA 4DH1A 4MXYA 5HU9A 5FTOA 4D1SA 1CKPA 4AG8A 1XHAA 4FIFA 3S4QA 3MVMA 4FI1A 4NIFA 3NR9A 3TJCA 2ZB0A 5F95A 2VWXA 1JKSA 3HMIA 4OTDA 3I81A 3FXXA 4PF4A 4QRCA 3OROA 4XOZA 5E1EA 5FEEA 2YA9A 3MFSA 3ORMA 3T3UA 2ZB1A 5J1VA 5ETFA 5AV3A 2YACA 3LE6A 4C37A 2XCKA 4IQ6A 2NRUA 1Q24A 4BGHA 5DT3A 1JNKA 4BTJA 3F5UA 3QLGA 4ZMEA 2QOKA 3HRFA 3QL8A 4II5A 4R8QA 3DJ5A 4CZUA 4AGWA 2P2IA 3IKAA 3OS3A 3FZRA 4YJNA 4CRSA 3LMHA 4GKIA 2AYPA 4FZ7A 4YLKA 4ASEA 3N51A 5HNIX 5DT4A 2VNYA 3LFCA 4PY1A 3QX2A 5AAEA 4G5PA 2PUNA 4QMWA 1S9IA 5IQEA 2XIKA 1PKDA 2GQRA 3OVVA 4UMUA 2CPKE 3IS5A 4Q5EA 3LAUA 3F2AA 1YHSA 4PPCA 4HVIA 3GFWA 2RG6A 3ZSIA 3A8WA 4L7FA 2X8EA 3AOXA 4JX3A 4V0GA 1A48A 5AAFA 4P90A 2XK8A 4R77A 1CMKE 5AMNA 4E6DA 4Z3VA 2OH0E 2RFSA 4BI2A 3ZLWA 3TUCA 3ZFYA 3CP9A 4DEEA 3TDWA 3PLAE 3E92A 3V6SA 4O7WA 5M55A 4G34A 4F0IA 5DH3A 2ONLA 4XG3A 4EBWA 4M14A 3EMGA 3N9XA 5IQDA 3ZRKA 3OG7A 3R1NA 5EDRA 5BUJA 3U6JA 1WVXA 2CGUA 3P4KA 4DLJA 4FA2A 4PDPA 3RAIA 1ZYLA 3NCGA 4FV5A 2ZV9A 3E3BX 3FLQA 5D12A 4Y5QA 5AP6A 4ARKA 1CSNA 2UW6A 4HYSA 3VRYA 1IAHA 3VF8A 3MA3A 3QQUA 3UOLA 3LOKA 4WD5A 4YP8A 2BRBA 4E5AX 5M4IA 4YC3A 3SVVA 4A9YA 3FY2A 5IUIA 2JKMA 2Y6MA 5BVDA 3RCJA 3EFWA 4IZ5A 3OD6X 2C3IB 3ZSGA 2HAKA 2ITNA 3W2OA 5FM2A 4AA5A 2WU7A 4YZNA 3W8QA 4A9TA 4B7TA 4I5PA 2YWPA 5AIKA 2BKZA 3UG2A 1U46A 3POOA 4MEDA 1PHKA 3CEKA 1BL7A 2WIHA 1P4FA 1ATPE 1YXVA 3I5NA 2Q0BA 3UTOA 3FI2A 2JDVA 2R3IA 4HZRA 4QP6A 5AX3A 3UIUA 2PUIA 3HAMA 3PJ2A 4UZHA 5DG5A 2IVTA 3FC1X 2ZM3A 2C1AA 5M4CA 4RG0A 3UYSA 2BAKA 2R3PA 4IADA 3F3UA 4NW6A 4PTGA 5E1SA 3GU6A 4C8BA 3VN9A 5AP1A 1P4OA 3LFDA 3LXKA 4R1YA 4U3YA 4YZMA 5DE2A 5DR6A 4FSTA 1WBTA 3QKMA 2VWYA 4H36A 4EK6A 1V0BA 5I4NA 3PSDA 3TV6A 3FKLA 3OY1A 3ZMMA 5IDPA 4FZAB 4M12A 1T45A 1SMHA 1WBOA 3ZONA 3Q96A 3C50A 3NAYA 3OC1A 4AS0A 4RVTA 3FLYA 4PMSA 4RX9A 3ZO3A 5EI6A 2ERZE 1OIUA 2CGXA 5CSWA 1URWA 3NYNA 4C4JA 4EOQA 5KMJA 4QQTA 4Q5HA 3UE4A 5AUXA 5I9WA 3AMBA 1SNXA 4FT3A 5GZ9A 2PVRA 3GQIA 3QCYA 4DGLC 3UMWA 2R7BA 4BR3A 2QD9A 3CKWA 1JOWB 2VTHA 2YM8A 3JXWA 1H1RA 4BRXA 4X2NA 2YIWA 4FTOA 3QQGA 4W4YA 3UOJA 3QGYA 2BRNA 3QQHA 2WKMA 3A61A 2W96B 2GFCA 3VUIA 4QYYA 5JT2A 2BIKB 4C2WA 4CZYB 3AC2A 4HVHA 3R9HA 1G8SA 2EXCX 1PYEA 2C0TA 3PE1A 3ZH8A 4A9SA 4R5SA 5HVJA 5LXMA 4IAAA 4Y85A 4RQKA 4BY9E 3LJ1A 5E8ZA 4ALWA 4EKLA 5IH4A 3DK3A 3DKGA 4FV4A 3TZ8A 5HCYA 4ALVA 3OEFX 1QMZA 3ZCLA 4HCVA 4BTMA 2ZMDA 5LMBA 4ASZA 2WPAA 1U5RA 5EHYA 1DI9A 4O2ZA 2ZM1A 4CNHA 3KVWA 3LCTA 2UW8A 2WMBA 4XOYA 2FSOX 4ACDA 5HCZA 1FVTA 1OL1A 4RFYA 2ITYA 3VNTA 2A1AB 4C61A 4O0RA 5A4EA 5FQDC 1V1KA 5HIDA 1H1SA 3FYJX 5LVMA 1SYKA 4FYNA 1P14A 4GRBA 2XYNA 5BNJA 3QZHA 3VQUA 3U87A 3NAXA 4CLIA 4L00A 3PJ3A 3EYHA 1J7UA 4ANOA 3O71A 4A7CA 3RJCA 4CKJA 3EN4A 5K9IA 1P2AA 2BILB 4OTIA 5FP6A 4D5HA 4QO9A 2QURA 3OWLA 3PRFA 5KBQA 3QRJA 3PWYA 3VUMA 4QMUA 3GCUA 5M51A 1M52A 3CPCA 2RL5A 3UZPA 3AC5A 2JDOA 2WQOA 4G6OA 5CXZA 4HYIA 1OPKA 4FICA 2YIQA 2JDRA 1PKGA 5C4KA 4DH3A 5AUUA 1H1WA 4ONAA 4FKIA 5E8VA 4JDIA 4M66A 2UW0A 1F3MC 4M3QA 2YFXA 4ZP5A 5IA1A 3BKBA 3LFBA 3MVLA 3E5AA 4D2TA 3BBTB 3MS9A 3MB7A 3TL8A 3I1AA 2HZNA 4FL1A 1M2QA 4IX6A 4J7BA 4FTJA 1PRYA 1W83A 2VAGA 3DLSA 3JY9A 3DDQA 4QYGA 3ULZA 3CIKA 4KD1A 4AZEA 4JDKA 3UG1A 2C5YA 2UZUE 3DV3A 3PXQA 4N70A 3NW5A 4YBJA 4KIKB 3R7EA 3ZYAA 4ZY5A 2R4BA 2UZDA 3ENMA 3U4UA 4F9YA 1OPJA 5HLNA 4ZOGA 3HNGA 5ICPA 2RFNA 4BDHA 3ZZEA 4LOPA 4BIDA 4UZDA 5ANIA 2YAKA 5GINE 5ANKA 3BGPA 4EHZA 3OT8A 2BRHA 3IONA 4G6LA 4NW5A 4C4HA 4EH7A 4UXQA 3C9WA 3QTXA 4J52A 4XBUA 5AUZA 3RM6A 3SD0A 2BVAA 4FBXA 4G6NA 4FV7A 4XG9A 5I9VA 4FKWA 4EK8A 2VWZA 2Y6OA 1PXIA 4DH7A 1YHWA 5TF9A 3UQFA 4PPBA 4YZBA 4DG0E 3GOPA 3P5KA 5EM5A 5DI1A 3KULB 3V51A 3W2PA 4ZTMA 3QBNA 1MRVA 2ESMA 4O0TA 1OVEA 2R3LA 5D11A 4BC6A 2FH9A 4FT7A 1J1CA 4ACHA 5IA3A 3L9LA 3KRRA 5E8SA 4DBNA 5B2MA 2VO3A 5IQGA 5LQFA 2FYSA 2OJIA 4QP8A 5DN3A 3NUAA 4NSTA 2VWBA 4FYOA 4FG9A 4FNZA 4PL3A 3VIDA 2X2KA 1G3NA 3V01A 4LFIA 3O23A 4N0SA 4E6QA 1A06A 4IB0A 5DIAA 5FRIA 4AAAA 2ITZA 3MW1A 2EB2A 3MN3A 2X8DA 3DOGA 4O22A 1WBWA 4UMQA 5ANDA 5FLFA 5AX9A 2C30A 3QU0A 4IAFA 2GU8A 3ITZA 5KMLA 5LMKA 2VWIA 3I4BA 2CHLA 4AE9A 3VRZA 3BYUA 3HEGA 1R0EA 2UZNA 2H34A 4BFMA 2PZRA 3UOHA 3GNIB 4E4NA 3AT3A 3HX4A 2C5XA 4K0YA 5F94A 3MVHA 1KE8A 1MQ4A 3D7TB 3WF6A 2R3JA 2VRXA 1GIIA 3LZBA 4FGBA 4OBPA 4MXXA 3JR1A 4GJ2A 3RKBA 3UVRA 4BBFA 2FSLX 3HMOA 4B0GA 4C57A 3R8VA 3MGYA 3MPAA 3VBVA 4S2ZA 2OFUA 4QYHA 4WA9A 3NIZA 3FKOA 2JD5A 3MSSA 3W33A 3HUBA 4HNFA 4QYEA 4WG5A 3VS7A 5FDPA 1H07A 4HPTE 4KB8A 2GDOA 4PDOA 3SW4A 3CE3A 4P4CA 5HLPA 3ZHPC 4F9CA 5L8KA 2YM6A 4M13A 3OMVA 3R73A 4Y46A 5FG8A 2HY0A 2V7OA 4MF0A 5IEVA 4OAUC 1ZXEA 3Q52A 1LPUA 3R28A 4IWOA 5C26A 3PYYA 3WF7A 4NL0A 3EJ1A 4BVUA 4Y73A 5AR8A 3DBEA 5JGDA 2X7FA 2WTKB 2BMCA 3DZOA 2BTSA 3M2WA 4H3BA 2NPQA 4QQJA 4RQVA 3ZFMA 4EUUA 2XNPA 2J50A 4TWCA 1J1BA 4BCGA 3KXGA 3SOAA 3THBA 4EKKA 2I0VA 3JYAA 4XV9A 3DGKA 5K5XA 4MTAA 3CCNA 4L3PA 2XNNA 5EYDA 4O7VA 2JITA 3Q6WA 1KOAA 5K4IA 3L8PA 2BAQA 1ZZLA 3D2IA 5H2UA 3R63A 4BDCA 3IO7A 5A54A 3MY1A 3GC8A 4EH4A 5JGBA 2IZRA 4IDVA 4U6RA 4EOMA 3LCSA 1GZ8A 5L8JA 3V5JA 4EH8A 4BBMA 4AW5A 4CYJA 3SOCA 2Z7QA 3O17A 5J87A 1OIYA 3NW7A 5HI2A 1XO2B 4K33A 3SW7A 3E7OA 3O8PA 3MIAA 1ZARA 3ROCA 4IW0A 3QD0A 4ZSGA 3IK3A 3SX9A 3OCSA 4ZTHA 3DKCA 3L9NA 1J91A 2CN5A 3I60A 4JIAA 4KIKA 4RWLA 4F64A 1M17A 4YPDA 1U54B 2BDJA 3FI8A 2B4SB 3NSZA 5HE1A 4FEXA 4AW2A 2XK3A 4BIEA 4M68A 2B9FA 3MFRA 4QP3A 4DCAA 3AGLA 4XV2A 3MIYA 2C68A 1JSTA 2YABA 3DTWA 4JG8A 4K8AA 4DEBA 2PUUA 4UXLA 4FIGA 3FY0A 3D15A 4AGCA 3QQJA 2O5KA 2XH5A 4JQEA 5TOZA 4LL5A 4CYIA 5EQEA 4ANQA 2ZMCA 3GQLA 3V6RA 2PU8A 4O81A 4ACCA 3HV6A 3KB7A 2OWBA 1ZMWA 3EKNA 4UMTA 4GT5A 5JEBA 3KULA 4ZZNA 4E93A 4BDEA 4J1RA 1LR4A 3KXXA 5C27A 3IGGA 3O51A 2PE1A 3PIYA 3UJGA 2RF9A 2EXMA 3EFJA 3IECA 4RFZA 1OKVA 1ZOEA 1HCKA 2YISA 3EFKA 4USDA 4M0ZA 2W0JA 2RFEA 3NW6A 4AZFA 3FLSA 1XBAA 4CG8A 4P2KA 2A0CX 3EL7A 5HIEA 1W7HA 4QQCA 2GTNA 2XB7A 4KBCA 4BZOA 2VO7A 3E62A 4D5KA 4HVSA 4MBJA 3MFTA 4YJPA 3RK7A 4J53A 3OBGA 5GJGA 3V3VA 4CXAA 4DH8A 4KUJA 3TDVA 3NYXA 4FUYA 2X6DA 4X3FB 3R22A 5JGAA 2BKKA 3F2NA 3PXKA 4IXPA 1DI8A 5A3XA 1SNUA 3WARA 5KZ0A 2UZLA 3QYWA 5IA5A 3CY2A 3NUSA 3AC4A 4PDYA 3LQ3A 1O9UA 3SXSA 2XVDA 5DNRA 3ZO4A 3LXNA 4NTSA 3D7TA 2QCSA 3ORPA 3P0MA 3HAVA 2I0EA 4WUAA 4DF3A 2IO6A 1GZNA 4KA3A 4D4YA 5KKRB 3KMWA 3DKOA 4FIHA 5M06A 3EZRA 5K0KA 3DPKA 3GC7A 3HUCA 3UC4A 3DCVA 3ZM9A 1M7QA 3JVSA 3UMXA 2J2IB 2X9EA 1G8AA 5CALA 3U9CA 3A2CA 2WAJA 3OTUA 4A9UA 3MY0A 5EI2A 3TKHA 3VW6A 2C69A 1KV2A 4JQ8A 4HCTA 4BIBA 4DA5A 2ETRA 3CY3A 3MH3A 4AACA 4L45A 4Q9SA 3VUTA 3R9DA 3LMIA 2OI4X 1O6YA 4HCUA 5AV1A 5CXHA 1YQJA 4GFGA 3K5UA 5AM7A 3PXFA 2QLQA 3Q60A 3BGZA 4BDDA 4E26A 4FTNA 2ITQA 2F7XE 1W82A 2QR8A 4CFNA 2REIA 3ZC5A 4CT2A 1JSVA 2G2HA 5I3OA 1OBDA 3KVXA 2XM8A 4ITIA 2VGOA 5HE0A 4FKPA 4IAKA 5E91A 5GIPE 3PY0A 3CKXA 2R2PA 4IC8A 3TJDA 4I22A 5IEYA 2W4OA 3OFMA 2C6MA 3P23A 2C3JA 4AA4A 4KRDA 2VTIA 4EOLA 2C6IA 3JY0A 5KCVA 2OICA 4E4LA 2VZ6A 2YM7A 1H1QA 3CR0A 3PVUA 2WMQA 4UWBA 2QKRA 4BB4A 1L3RE 3F5GA 1FGKA 3BX5A 5K0XA 1WFCA 1QL6A 3PTGA 4M7IA 4ZIMA 3G33A 1NY3A 3RNIA 3VC4A 4AUAA 4YLLA 4O6EA 2JFLA 3DK6A 4OTGA 5AV0A 3VBYA 3E64A 4D55A 2C3KA 3QHWA 1Y6BA 3I0OA 3SG8A 3E8DA 3SG9A 4XLVA 3BLHA 2JAMA 1HCLA 1U54A 4OTFA 2C6LA 4K1BA 2ZJWA 4FTKA 4FUXA 2ZDUA 3QTZA 2BALA 5KBRA 5DOSA 3W2QA 2JGZA 4ZTLA 5B2KA 5DRBA 4BWXA 5EYMA 3IPHA 4WRGA 5M56A 3LM0A 4FX3A 4BDGA 5JMSA 4KINA 3TCPA 5BQ0A 4KIQA 5BUIA 3G2FA 2BTRA 3QZGA 3FKNA 4G1WA 4TY1A 5A6OA 2JIUA 3G0EA 3OUKA 4K9YA 2W5BA 4U7ZA 3P9JA 3RHKA 3ZEPA 5L4QA 2WTDA 4QMLA 5ETCA 4J97A 4ZTRA 3ACJA 2W5HA 3H9OA 4QNAA 2B1PA 4JOAA 3EN5A 4LG4A 5DRDA 3R8MA 4CTBA 3HYHA 4CFVA 4F6WA 1JPAA 3C0HA 4TXCA 3W10A 3OW4A 3LCDA 3ORKA 4BDJA 3A7IA 3DXQA 5L3AA 3TUDA 1GOLA 2J0IA 3VJNA 4R5YA 4AOTA 4LQMA 4EH3A 1Q3DA 4QP1A 4F1MA 2WMSA 5HBJA 2GQSA 5CSPA 3QQFA 3BYVA 3A4OX 2YDJA 1ZMUA 1H4LA 2F9GA 2WEIA 4I94A 5FDXA 4D0XA 2YWVA 2CGVA 3UGCA 2IG7A 3S3IA 4RX8A 1CDKA 3GCSA 4TWNA 3VW8A 4F4PA 2PSQA 2VN9A 4DE4A 1MQBA 2QLUA 2OIDA 3DFAA 4X3FA 5HOAA 2W4KA 2XIXA 5J8IA 4DBXA 4D0WA 5IMXA 2PUPA 2W5AA 2WOTA 1H00A 4W8DA 3ZC6A 1U5QA 2P0CA 3ZLYA 3PG3A 3GVUA 1WBPA 5AUTA 5AR3A 5IG1A 1PXKA 4TW9A 5JFVA 4ZY4A 2P2HA 4Y95A 3VS0A 2VUWA 3R2BA 3F3WA 2XIZA 3O2MA 5CX9A 1NVSA 5HX6A 2OU7A 5DT0A 5HD7A 4DC2A 5L2WA 2GNLA 4JG7A 1RDQE 1Q5KA 4EK5A 4PUZA 5KMNA 3NNVA 3R7GA 5A4QA 2C0IA 1YXUA 4I23A 3UP7A 2C1BA 2R0UA 4QMZA 1OBGA 4IANA 3ZLSA 4Z16A 2OF4A 3QWJA 3TV7A 4CFMA 5BVNA 5L2SA 3HV7A 1YDSE 3ELJA 2QOFA 4ERKA 1Y91A 2PE2A 3QTRA 2XNGA 4ZSEA 4NCTC 1AQ1A 5JRQA 4O0SA 4TWPA 1R0PA 1B38A 2R0IA 3D5UA 5CT0A 5G6VA 3LMGA 3CGOA 3H10A 2WQMA 5I3RA 3D14A 3DZQA 1A9UA 1ERKA 2QOHA 3NLBA 2WMVA 3O8UA 3PPJA 4WNPA 4BDKA 2YHVA 1T46A 2VD5A 3IDPA 4GT4A 4JQ7A 3UVQA 5IA2A 3QKKA 2JBOA 2R3QA 1HOWA 4USFA 1PMNA 3D4QA 4HGTA 2PULA 4U44A 3QA8A 4FVQA 4IWDA 3R7VA 4NKSA 3SC1A 4GL9A 1GZKA 4IX4A 3W1FA 3ZZWA 1R1WA 4W9WA 5HESA 1JWHA 3DFCB 4ZMFA 4F9AA 2UW3A 2XIRA 3DAKA 3LLAA 1AGWA 4TWOA 4LMNA 4GG7A 1AD5A 1W8CA 2E9UA 2C6DA 4U8ZA 5I5ZA 1KWPA 3H3CA 2G2FA 4HVDA 5L8LA 3CTHA 3EQHA 1IRKA 3K2LA 2IVUA 3F82A 5IKWA 2B53A 1JQHA 2GMXA 3G90X 3TZMA 2YDKA 4DEAA 4QTCA 2HXLA 3WE8A 3SLSA 3TM0A 3FMLA 5LWNA 4O83A 1UVRA 3MY5A 4NEUA 4O0XA 4FKTA 3C13A 2QG5A 5C1QB 3HMNA 4GKHA 3V5QA 4CMOA 5E92A 1H0VA 4MVFA 2IVVA 4MXOA 1YXSA 4CMTA 4QMTA 2X1NA 4FZDB 5FM3A 1CTPE 3SQQA 4B99A 3OZ6A 2YM4A 4UEUA 5AP0A 4U41A 1O6LA 2Q0NA 5J7BA 4RJ5A 4OR5A 3PRIA 3R7OA 2XK9A 2IZUA 4LOQA 2GNJA 3PG1A 3VUKA 4RJ7A 4YTFA 4USEA 2B54A 1ZYJA 4HYUA 4ZEGA 4ZTQA 4GU9A 4UWCA 1Q41A 4GK4A 4DEDA 5IQHA 4I0RA 4AWIA 1Q8UA 2YZLA 3MH1A 2F7EE 4X21A 3NUXA 4FEQA 4F0FA 3FHRA 4YTIA 3NGAA 3BHUA 2E2BA 4O6LA 5J95A 4YGAA 3UO5A 4IB3A 2E9PA 5HLWA 4RVLA 4FZ6A 4C38A 5FP5A 1QCFA 3I7CA 5JH6A 2IWIA 4MKCA 3RZFA 2QO7A 4GUEA 4AZVA 3VBQA 2OIBA 4E1ZA 3UOKA 4CCBA 3GP0A 3SXRA 4M8TA 4FTLA 4TTHB 3R2YA 4U80A 1F5QA 5EYCA 3BE2A 3JS2A 1GZOA 1H08A 3NIEA 4JG6A 2J7TA 3COIA 3MVJA 4XLIA 3SV0A 3QUDA 1W0XC 4BCNA 2ETMA 5IISA 2XA4A 3B8RA 3EZVA 3Q04A 3CS9A 4ID7A 5HG7A 5T6KA 2OZOA 3TTIA 3Q53A 3WZDA 4CKIA 4EH9A 3FQHA 2AC3A 4WSYA 2QONA 4GIHA 4WT6A 5GNKA 5KE0A 1PMUA 2LGCA 4MNEB 3U4WA 3QLFA 4IX3A 3R1SA 5IZFA 4IAZA 3VS6A 2VWVA 4FTTA 4QP7A 1KSWA 1BYGA 1VYWA 5IU2A 4G9CA 2XRWA 4ANNA 3GCQA 3ORIA 1PMEA 1APME 4E4XA 4ZLOA 4BCMA 4ZZMA 3C51A 4LV8A 2VTPA 2UW5A 4I24A 4C33A 5CTPA 4QTEA 4QMNA 4PP9A 5IDNA 2CSNA 1FMKA 4NU1A 4YBKA 3LW0A 3NNWA 4OTHA 2HK5A 4RX5A 4I6BA 4YC8A 2W06A 3LFFA 3PVGA 4C62A 2YM5A 3OCBA 1B39A 4ACMA 4R6VA 4C59A 2C0OA 2UW7A 2IPXA 4QNYA 1OL5A 5KMOA 3OCTA 4BYIA 3RTPA 3AD5A 4L7SA 4YC6A 1IASA 4C3FA 5HG8A 2BZIB 3LKMA 1YKRA 2BROA 2G01A 1YWVA 4O27B 3FZPA 1ZLTA 5HE3A 1H01A 4ANLA 5JFSA 3BWFA 3C4CA 4OTWA 3ZXZA 2BAJA 2EU9A 3EQDA 3O7LD 2WEVA 5D7VA 4B8MA 5AA8A 2F57A 2P55A 3HDNA 2B9HA 4BI0A 4KWPA 5LVPA 2C47A 2BFXA 3OTVA 5CEKA 4D4VA 5I9XA 3P08A 4I0TA 4K6ZA 4GEOA 5CF4A 4YO4A 2FSTX 3S00A 2PVJA 4W4WA 3T3VA 4EOIA 5LCJA 1R3CA 1JAMA 1DAYA 3FZOA 4FSRA 3H4JA 4NCTA 2W1DA 3R21A 4BHZA 2W1IA 2XJ1A 2WB8A 5CEIA 3A8XA 3D7ZA 4GH2A 3F3TA 5F9EA 3KN6A 2WXVA 2B55A 4XV1A 4G3EA 2WD1A 5I9YA 3D83A 4KRCA 2PZIA 2BZKB 1BKXA 2PL0A 3L1SA 3PY3A 3Q9WA 4IB1A 3NX8A 2F49A 4O7SA 3BE9A 5EDQA 3OWPA 4OTPA 4EOPA 4L8MA 2WTCA 1Q62A 3EQPA 1ZMVA 1UV5A 2GPHA 3A7GA 3HA8A 3QTWA 4QTDA 5DPVA 5TE0A 4CEGA 5H8EA 4GSBA 2UZOA 1YDTE 5F4NA 3BRBA 4CCUA 3UIXA 1OL6A 4AU8A 3PJCA 3II5A 4EQCA 2JKQA 5EI8A 5DLSA 4E7WA 5B7VA 3ALOA 4U40A 4OBOA 4DTBA 1E9HA 3RWPA 3QTQA 4NWMA 1WCCA 1MUOA 1BI8A 5HO6A 4U0IA 2J51A 1BX6A 3PPZA 1IA8A 2G15A 2WO6A 3GB2A 4RC3A 3V04A 3OXIA 4PV0A 2UZVA 3Q2MA 3QUEA 2H8HA 1ZYCA 3V5TA 3CBLA 5CAQA 4BTFA 1UU8A 4P5ZA 3UO4A 3PA3A 2O64A 5E90A 2C6TA 2OJJA 3AG9A 3KGAA 2EVAA 2DYLA 4PL4A 1SVEA 1YI6A 3FC2A 4FSMA 5EM8A 2GSFA 2OFVA 1RE8A 2ZV2A 4LV5A 4UBAA 2XNBA 4JR7A 4WOVA 3TG1A 4YZDA 1NA7A 4BDAA 2X8IA 5AR2A 4CSVA 4JBOA 4D1XA 2IN6A 3PXYA 2X4ZA 3QKLA 4BL1A 4C3PA 3R02A 5H8GA 3WILA 5JRSA 4DFYA 3FMNA 4I6FA 5EFQA 5HTBA 2X81A 3HV4A 4S33A 3SDJA 4YPSA 2VWUA 4CV9A 4RIWB 3ANQA 3A7JA 4ANSA 1YOLA 3POZA 3VAPA 2PK9A 2VU3A 4AP7A 3R8LA 5HE2A 3GCVA 4FL2A 5JSMA 1JKLA 5CF6A 3VO3A 3EYGA 1WVWA 2Q83A 4O7ZA 3WI6A 4RRVA 5H8BA 5HQ0A 2YCQA 3OWJA 5HZNA 4MNEA 3ATSA 1ZYSA 5E8UA 3FXZA 2X2LA 4BGGA 3REPA 3TNPC 4Y83A 3W32A 4XG2A 3RALA 3TWJA 3CD3A 5EOBA 2C6KA 2WELA 4E6CA 4Z55A 3KXHA 2PMNX 4YJOA 2WMAA 4LRJA 3CGFA 5GJFA 1V0OA 4EHEA 2IVSA 4NFNA 4DFBA 3FLNC 3OT3A 2Y8OA 4FT0A 4FSUA 1OECA 4TYGA 2RIOA 2XF0A 5FBOA 2R9SA 3FJQE 5J79A 2XBJA 2XNEA 3KK9A 3FPMA 3NVKI 3MH0A 4BF2A 3SXFA 4JIKA 4OLIA 4F0GA 1PXNA 4O2PA 3QQLA 3LHJA 2VO6A 1K2PA 4RSSA 4LGHA 4PMMA 4HGEA 4EWQA 3KK8A 1Q8TA 3RINA 3FZTA 4I20A 1PXLA 3U51A 3BV3A 2P4IA 4LRKA 4IJPA 2A27A 5AV4A 2VTQA 4IZ7A 2XBAA 4QMPA 5JZJA 3LFSA 4KKHA 4QP4A 2YLEA 3Q9XA 3KFAA 4FL3A 2XK6A 4MH7A 3W55A 3QZFA 4L68A 3MYGA 1OL7A 1GNGA 4EI4A 5BUEA 5LVNA 5EQYA 3NVMB 3GENA 2JC6A 3FI3A 2H96A 3LFEA 3RGFA 3C4WA 3UODA 3LJ2A 3ZXTA 2X2MA 4AZSA 2H9VA 4ZLZA 4APCA 1FBNA 5BVEA 2ITPA 2WHBA 4IAIA 2VTTA 3UQCA 2X6EA 4OGRA 4J96A 3C5UA 4BCIA 4IJ9A 1RW8A 3UNZA 3EIDA 4O84A 3BHYA 4TPTA 5F1ZA 3CLYA 4LGDA 4TL0A 4G9RA 4U79A 4YJRA 4BCOA
chains in the Genus database with same CATH superfamily
3BELA 4ZJJA 5EKOA 3EHAA 4NM3A 3L8SA 4BKZA 4O86A 3DT1A 4K11A 3VS4A 1WVYA 4G3CA 4WIHA 1G5SA 2YCFA 3NPCA 3ANRA 4RX7A 4D2WA 4DGMA 1KE5A 3FQSA 1P5EA 1NW1A 3LLTA 1TFFA 1UNLA 3RPVA 3DTCA 4G5JA 4I4FA 5IF1A 4IH8A 4YUQA 5KMKA 2VWWA 5BPYA 2UZWE 2PMOX 2J0KA 4H58A 4H3PA 4K18A 3LFQA 3DXNA 3PSCA 3OW3A 3P7CA 4R3PA 4FTCA 2XMYA 3NUUA 4C0TA 4YHFA 2PMLX 3DBQA 3TNIA 2YITA 4DGNA 3NDMA 3BIZA 4O38A 1KV1A 1NVQA 1XBBA 2B9IA 3D5WA 2W4JA 4MD9E 5HNBA 5HTCA 5FTGA 3GFEA 4FKGA 4GVAA 3OHTA 3Q5IA 5TR6A 4XRLA 4FF8A 4JT3A 3ROYA 4ANMA 2OJFE 3PUPA 4FKOA 3GC0A 4HJOA 3FZ1A 4OBQA 4FT5A 5DWRA 2PZPA 3FL5A 3PSBA 3W2RA 4EJ7A 3MBLA 5FEDA 4I4EA 4AAYA 2W9ZB 3MFUA 2JBPA 4G31A 3OXTA 4O1OA 2XEZA 3VBWA 3G6HA 4D58A 4IIRA 4O7RA 3RPSA 2JAVA 3IQ7A 4RIWA 2RFDA 4X0MA 4BZDA 3TNHA 3KF4A 2IW8A 1Y6AA 4QTBA 5CAUA 4PDSA 3VVHA 4AT4A 1H24A 2QU5A 5IQFA 3A7HA 3B8QA 4CQEA 4NM7A 2JKOA 2OGVA 1Q8ZA 2HW6A 3PVBA 1VJYA 4RA5A 3EQRA 3KC3A 4TT7A 4UALA 5HBEA 5A46A 1Q4LA 2A19B 2HY81 1OM1A 5J9LA 1OB3A 1VR2A 3QD3A 2Z60A 4JR3A 3IW4A 4FVPA 4LYNA 5EYKA 4BCFA 3U9NA 5HIBA 3EQCA 2FUMA 2OK1A 2HYYA 2QVSE 3HP2A 4I92A 1H0WA 3ET7A 4D1ZA 4GMYA 3PZEA 3C5IA 1DAWA 4QPAA 1BUHA 3GOKA 2R5TA 4V04A 4FE2A 1Z9XA 3I0QA 3FWQA 5D10A 2PYWA 5CAPA 3TIYA 4S32A 3IDCA 4AX8A 3CJFA 5DEWA 4DFLA 5CEQA 4EYMA 3V8WA 4EBVA 4BYJA 4E3CA 1YOMA 3JUHA 3BGQA 4A4LA 3P78A 4E4MA 1CKIA 4OT5A 3PFQA 2R7IA 4NM0A 4FOBA 4O0YA 3UDZA 4FRFA 4M0YA 1IG1A 1KE6A 2OIQA 3F6XA 5IH6A 2Y0AA 3WE4A 3QZIA 1W98A 4L44A 4I41A 4IE9A 2G2IA 4FOCA 3DXPA 1OIRA 4TRLA 5JKGA 4GU6A 4O4DA 3U8WA 4W9XA 5HU3A 3FBVA 3DS6A 3OWKA 4F78A 4FEVA 3C4FA 3TV4A 3VS3A 1Q99A 3IW8A 4FKQA 5TO8A 4U3ZA 2WMWA 4IM3A 4U5JA 4K77A 2W05A 4O1PA 1O6KA 2BZHB 2I0HA 4D4SA 3W2SA 1FOTA 5EHOA 5EW9A 4CZTA 5AM6A 3M11A 1M2PA 5LWMA 4QPSA 3UYTA 5LVLA 3ORNA 4IB5A 2FGIA 5CZHA 1REKA 3COMA 3EQFA 4GG5A 3KRLA 1M2RA 4AA0A 1ZOGA 4W4XA 4G3FA 4RT7A 1KOBA 4ERWA 2XUUA 5J1WA 3PP0A 2RG5A 2JKKA 5AJQA 5FBNC 4XJ0A 5C8NA 2HELA 4IZAA 2W7XA 3TEIA 4F7NA 1GJOA 3A7FA 3ALNA 4JL9A 2XJ0A 4MD8E 3VUHA 3E3PA 4GK3A 4IVDA 5BYZA 2GNIA 5AEPA 3LCKA 3BU5A 4CKRA 5AP4A 3PXZA 4WNMA 4C3RA 1LUFA 3CXWA 2DUVA 2H6DA 1YI3A 4U9AA 3ZFXA 4BBEA 3TMOA 4AT5A 1QPDA 5M08A 4ZS0A 5C03A 4RIOA 5H3QA 2XRUA 4RVMA 5F20A 2Z7SA 1E1VA 2X0GA 3QA0A 5CSVA 5DBXA 3ENHA 5ACKA 3VUGA 4ZY6A 2QOLA 1JVPP 1YVJA 5C01A 3TXOA 4XP2A 1PJKA 2JIIA 2YN8A 3RPYA 2RSVA 5BVOA 3ZTXA 5L6OA 1XMMA 4AGDA 2XEYA 4YNOA 1OMWA 3EB0A 1I09A 3NEWA 3PP1A 4FV3A 3RCDA 4QTAA 5CF8A 5CY3A 2ITOA 4O7YA 4UYNA 2J4ZA 2JDTA 3QGWA 4FV6A 2ZAZA 1XH7A 1QPEA 2F2UA 1BLXA 2CDZA 3EFLA 3ORTA 3QRKA 4I0SA 4MWIA 4XS2A 1OGYA 3SKCA 3VF9A 1H27A 1XH6A 2DQ7X 4GIIA 5DHJA 2PVYA 3EN6A 2GCDA 5CAOA 4MX9A 1MRUA 3DB6A 1CM8A 1UA2A 3SHEA 2UW4A 2W1GA 4LOOA 4G2FA 3C4XA 2C3LA 3FAAA 4U43A 5FD2A 1PYXA 3MB6A 4PRJA 4IVAA 4V05A 4KS8A 4FJVA 4I5CA 1W2FA 3G51A 2HCKA 3UVPA 3ULIA 2ZYBA 2HENA 2X4FA 2IJMA 2ITVA 4PMTA 4AW0A 5CSHA 3GEQA 2R3FA 4J98A 3DB8A 5CVGA 4HNIA 1UWJA 1X8BA 2Y4PA 5BVKA 1FPUA 4FV1A 2PZ5A 4A07A 3RK5A 4H3QA 4IAYA 4CQGA 4UN0C 5IQBA 3F61A 4ZJIA 3RPRA 4DFZE 3BPRA 3GU7A 3RVGA 4E5BA 4O0VA 5HKMA 1H8FA 5E7RA 3ZSHA 3AC3A 4LMUA 3LIJA 4DEIA 3BLQA 3FUPA 2XYUA 3C1XA 1SM2A 3D9VA 3QFVA 4YJSA 4RJ3A 1GIHA 2J0MB 3OXZA 4M97A 3IW7A 1Q97A 3PLSA 3LXLA 1YW2A 3GC9A 2YIXA 2GHLA 3NRMA 4PTEA 5AIRA 5DVRA 3T8OA 4ZSAA 4ZSJA 4IDTA 3BU6A 3Q3BA 5HGIA 3V8TA 4N4SA 5CEPA 3P7AA 4LUDA 2EUFB 1WBSA 4YSMA 4KSPA 2VTJA 3IDBA 2C6OA 1B6CB 4KSQA 3ZS5A 4D2RA 1UU7A 1YXTA 3FLZA 3KREA 2NP8A 3T9IA 5FXSA 3N4TA 4F08A 2FB8A 2XK7A 2ONLC 2ZV8A 3F5XA 3KA0A 2O0UA 3FMDA 4TYHB 4AZTA 4A9RA 2GS2A 3NZ0A 4MCVA 1XH8A 4KIPA 4P7EA 4IBMA 5J9ZA 1S9JA 2KTYA 1BL6A 2GNHA 4FNWA 3UIBA 3BLRA 4FV2A 3GU4A 2Y4IC 5LJJA 1R39A 2PPQA 4G16A 3PY1A 3QQKA 5CU3A 3FEGA 5IQAA 1H28A 4JRVA 4CFXA 5AADA 3RHXA 1OIQA 3MJ2A 1QPJA 4RJ6A 4XNEA 5CNNA 3DNEA 2I40A 1XH5A 2Z2WA 5IA0A 4WSQA 2C4GA 4X2JA 5EW8A 4JXFA 5JZNA 4OT6A 5FEQA 4EOKA 2YAAA 5KUPA 1EH4A 2J5EA 4XX9A 4FKSA 3TN8A 4DFNA 4PMPA 3Q2JA 5ETIA 2CGWA 4JX7A 4ORKA 4RLKA 3HECA 1JBPE 3WOWA 1PF8A 2F4JA 5TKDA 2WFYA 1H25A 4QQ5A 2R3OA 5AA9A 5L6PA 2PZYA 2QC6A 3FMHA 4S34A 2UW9A 3JVRA 3R8ZA 3OEZA 1GY3A 3EWHA 4NTTA 4R7IA 5D41A 5BMSA 3NWWA 1FVVA 3VS5A 4DT9A 4L46A 4C2VA 4TNDA 5JK3A 4F70A 5M4FA 2XNOA 3GGFA 5M44A 2B52A 2OXYA 3EQGA 4JRNA 2ITXA 3ODZX 4R1VA 4OW8A 4RPVA 3Q4CA 4FTMA 2E9OA 3ETAA 1TQIA 2WQBA 4O96A 4QOXA 4WNKA 5ANOA 5AWMA 4JBQA 2YCRA 4C36A 5CU0A 3DBCA 4O0WA 4XMOA 4R7BA 3QD2B 2XM9A 4RC4A 4BGQA 3DKFA 3EQBA 3L9PA 3F69A 4L43A 5CVHA 5DR2A 1G8JA 4Y72A 4KKGA 5HHWA 4FC0A 1KUTA 4U45A 5I9ZA 1BMKA 3CPBA 3EL8A 4DINA 2VNWA 2OZAA 2O2UA 1YRPA 4FTRA 4I6QA 5M57A 2E9NA 1ZZ2A 2YDIA 3D94A 5EW3A 3H9FA 4ENXA 5IQCA 2J90A 2VGPA 3HA6A 5AR7A 5ETAA 5I0BA 4I6HA 3AD6A 5L2TA 3OUNB 4IMYA 2I7QA 3MV5A 3B2TA 4L6QA 5TT7A 4CGAA 2NO3A 4E73A 2NNWB 4WG3A 2J0LA 1MRYA 3NCZA 4F09A 3LJ0A 4G3GA 2WU6A 4ZJVA 3UPZA 3OY3A 5ANEA 2CKEA 3R7UA 1J7IA 4YR8A 2RGPA 3B2WA 4PL5A 2YERA 4JDHA 2ACXA 4B6LA 1Z57A 2JFMA 4CLJA 4QP9A 3BCEA 3MESA 3DU8A 5DMZA 2VTNA 5KMMA 3SGCA 4MWHA 3KXNA 4BHNA 2ZM4A 2IEWA 3DAEA 3VS1A 4F6UA 3L8XA 3LQ5A 4GK2A 3I6UA 4QPMA 1NXKA 4AOIA 4C34A 2C5OA 3AT4A 3MPTA 4DH5A 2YEXA 2ZVAA 1R78A 4IFCA 4AFEA 3AKJA 2B9JA 1PXJA 4R7HA 5AR5A 4QDVA 4O7TA 5AP7A 4BKYA 3WYYA 4NJ3A 4CFUA 2CLQA 3P86A 1ND4A 3QCQA 4YNEA 5K5NA 4DG3E 3KEXA 2QOBA 3UDBA 3MH2A 4PQNA 4F63A 3D2KA 2CCHA 5HX8A 1TQPA 3EH9A 3TKIA 4BCJA 1Q3WA 4YJQA 4C02A 4FV8A 5E8YA 5C4LA 2OJ9A 3KRJA 4W8EA 3MDYA 5A4LA 4E5WA 1PY5A 1W84A 3KU2A 4RWKA 2ETKA 3QTUA 2VO0A 4KS7A 4FSZA 3P5JC 3GBZA 5GHVA 1PXPA 3GCPA 5CT7A 2PVMA 4HW7A 2PMIA 4TYHA 4C4GA 4BN1A 4O0UA 2AC5A 5EG3A 3TT0A 4AXEA 4D2PA 1UU9A 4MQ2A 3RNYA 4E20A 4J95A 3W16A 2R3NA 3O5AA 4F6SA 2CKOA 4CV8A 1TZDA 4Q2AA 3TUBA 4DITA 2V0DA 3R30A 3G15A 4WBOA 3O50A 5HBHA 1XBCA 5LARA 1Z5MA 4AXAA 5EQPA 4CT1A 1QPCA 2UVXA 2UZTA 4PNIA 4V01A 3QXPA 4MBLA 2XJ2A 4ASXA 5CANA 1RJBA 3BZ3A 4R3CA 4BDFA 1U4DA 2IW6A 3FYKX 4I21A 2WQNA 3UNJA 5IH5A 3S95A 1Q8WA 4HGLA 5DYJA 4IVBA 3R71A 4PP7A 5HEZA 1STCE 1PMVA 2YIRA 4FKJA 2OO8X 4AN2A 2OLCA 3G9NA 2BUJA 4QMYA 2HZ4A 4U81A 4F9WA 1FQ1B 4YLJA 4FIEA 5FUTA 3C0GA 4M69A 4IWPA 2XNMA 3NUNA 4YHJA 2CLXA 5HG9A 3KN5A 3QCSA 3FPQA 5LMAA 2YJSA 3BHVA 4FSQA 2WIPA 3K3IA 4GFOA 5AP2A 3SRVA 4RIXA 1YWNA 2VTAA 5A14A 3E8EA 1SVHA 3ID6C 5L2IA 2XKDA 4LL0A 4O91A 4AOJA 5BX0A 2EWAA 3UBDA 4O4CA 4IM2A 3HDMA 4FKVA 4J71A 4XP0A 2WMRA 4BCPA 4EYJA 5CLPA 4QEBA 3ORZA 1VYZA 2PE0A 2I0YA 2PVNA 4F65A 3FMJA 4L3LA 4YJUA 1OKWA 2F2CB 2GNGA 4AN9A 2V22A 3CSVA 2UUEA 3ZBFA 5I9UA 4EZ7A 4OAVB 1KE7A 4FV0A 3D5XA 5LMKC 3IG7A 3OCGA 4JDJA 5FXQA 3RI1A 4FIJA 3PZHA 4ITHA 4H05A 4IACA 3LXPA 2XKFA 3EQIA 1ZYDA 4ASDA 4DLIA 4ZLYA 3COHA 3MWUA 2CNVA 4YTCA 1F0QA 3CD8A 3TZ9A 4F1OA 5J7HA 3FMEA 4TYIA 3PPKA 5AUWA 3WF5A 3HV5A 3R8PA 3F9NA 2QG7A 2V55A 5HICA 4IM0A 1ZAOA 5EDPA 4B8LA 2O3PA 3OF0A 3LVPA 5HCXA 2QI8A 3WZJA 2J9MA 1YHVA 2QOOA 4BWKA 3ORXA 4IEBA 5E9EA 3UQGA 2OBJA 1XKKA 2V5QA 3A99A 3QALE 3QYZA 4W4VA 5ACBC 3BYSA 3E8NA 5CSXA 3UIMA 3UNKA 2W1CA 3PVWA 4XYFA 2XIYA 3QD4A 3R0TA 3ZBXA 4JVGA 3N4UA 5CQWA 4CRLA 2EB3A 3NMUF 3H0ZA 4KIOA 4C4FA 2YCSA 5FGKA 2CJMA 1M7NA 5IUGA 4EL9A 4N57A 3LFNA 4EQMA 5CENA 4MF1A 4UMPA 4UMRA 3LCOA 5LCKA 3FSFA 4PTCA 4GFMA 2QR7A 1WBVA 3R1YA 5BVWA 3IW6A 4I93A 3M42A 3E93A 3BBWA 5IPJA 5IMEA 1OKYA 3PIXA 5KHWA 4AGUA 5HNGA 4EJNA 5CI7A 4O82A 3T9TA 3W0PA 2YIYA 5FWKK 4X2FA 2WGJA 3PA5A 3MA6A 4FK3A 2XK4A 1JKKA 4TZRA 4FKRA 4EOOA 5LOHA 3ZUUA 2OSCA 2WOUA 5DGZA 5GZAA 1K3AA 3E7VA 5EH0A 4XH6A 4KBAA 3AT2A 5D9HA 2R3HA 5EKNA 3NFGB 1OZ1A 3MPMA 3P79A 3TNWA 5KMIA 3VUDA 4JNWA 2OXDA 3LM5A 4Z9LA 2VX3A 3LPBA 3VHKA 4EEVA 3FMKA 4DG2E 4EZ3A 5CZIA 3V5PA 3VBXA 4MXAA 3F2RA 2W9FB 4FSNA 4NKAA 2CMWA 4PWNA 4YZCA 4DEGA 4X6QC 4DCEA 3I79A 4MK0A 1LP4A 4XHKB 3G5DA 5AV2A 2YJRA 5HO7A 1XH4A 4H1JA 4LGGA 4AE6A 3UDTA 4RVKA 3EN7A 5DR9A 3QX4A 2Z02A 2A98A 3KCKA 4X2KA 3BQRA 3EKKA 4S31A 4DN5A 4XP3A 5CU2A 4ZAUA 3GXLA 2GNFA 3OOMA 2X9FA 4RGJA 3QTIA 2SRCA 4HPUE 4ZTNA 2IW9A 3R8UA 4EC8A 4O7NA 2P33A 2VTOA 4FG8A 3Q4TA 1YDRE 2J5FA 4U97A 3F3ZA 3H9RA 4ENYA 1RQQA 2R3KA 4GW8A 4D28A 3E88A 4QD6A 4L3JA 3F66A 3U54A 4D4RA 3UP2A 4FZFB 4BWPA 5ITAA 4EHGA 4XG6A 3D5VA 1IR3A 4Y8DA 5CU6A 4HGSA 4DHFA 4F7JA 4RZVA 4XCUA 2WMUA 5K3YA 4EONA 3DA6A 5GZ8A 2CNQA 3OBJA 5JQ8A 2X39A 2JDSA 3C7QA 2BR1A 2HOGA 2VTMA 3KY2A 1OPLA 4BDIA 1UKIA 2WZJA 3QTSA 4UYAA 3AXWA 5C9CA 5C8MA 5HORA 1ZRZA 3KXZA 2QKWB 4HOKA 4QMMA 5ANJA 3ZUVA 3ZRLA 3K5VA 2XKEA 1VZOA 4EQUA 5EM7A 5L2QA 3D0EA 4MQ1A 5AAGA 2FVDA 3R9RA 4FMQA 4DGOA 2ZDTA 2AQXA 1UWHA 3EN9A 3OOGA 2QO2A 2VV9A 3RAKA 4D9UA 3GU5A 2UZBA 2FO0A 2C5NA 1FMOE 1Y8YA 4PNKA 3Q32A 4FG7A 4EWHA 1YOJA 4AF3A 1XJDA 5CASA 2GQGA 4Z7HA 4WRSA 4I5HA 1J3HA 2XS0A 2Y9QA 3M1SA 4BZNA 4NYEA 2BRGA 2OH4A 2IZSA 4S30A 2GS7A 3DQXA 4WNOA 4A4XA 4EZ5A 3UZRA 4A06A 4YU2A 2BPMA 4YMJA 2BCJA 3ZM4A 3DDPA 4EH2A 4FTAA 4AXDA 2WTJA 4ZSLA 4EK3A 2W17A 3SAYA 5IQIA 2GHMA 5FXRA 2W1FA 4D2SA 2QQ7A 3AGMA 5KX8A 4YURA 4E6AA 2AUHA 2BDFA 3O96A 3MTLA 5BMMA 3RMFA 2PVFA 3WBLA 4GS6A 4ZXTA 3FQEA 1PXMA 3F7ZA 3PDTA 1ZOHA 4JS8A 3RM7A 1JLUE 1U59A 3Q6UA 3UZTA 1DS5A 4MD7E 2A4LA 4IVCA 4LM5A 2BIYA 4OUCA 1REJA 3HVCA 5CI6A 4AW1A 3HRCA 3EOCA 5J5SA 3BU3A 4ITJA 3QXOA 3BI6A 2WTKC 5CS6A 5EHLA 1TKIA 3GI3A 3WIKA 2OG8A 4X2GA 4WKQA 4XV3A 4TYEA 4AZWA 4KAOA 3FV8A 3H30A 4XG4A 4N6ZA 2GS6A 4C4IA 4FEWA 5C8KA 2RKUA 1OL2A 5T3QA 5BVFA 2BDWA 2PVHA 4UWYA 3ZU7A 1SVGA 4Z7GA 4NM5A 4RWJA 4AQCA 3G6GA 1FVRA 4R3RA 2J6MA 3VQHA 4AN3A 3K54A 3HP5A 4G3DA 5CEMA 1OGUA 2R3MA 2R3RA 3MJ1A 3AC1A 4KABA 3Q9YA 5HO8A 4EH5A 1OI9A 4L9IA 3KXMA 3NNXA 5FTQA 4APPA 4FR4A 4BICA 3I5ZA 1W2DA 1XWSA 2Z7RA 5EK7A 2DWBA 3R83A 1UKHA 4B9DA 5A6NA 4FT9A 3NUPA 4XBRA 2QODA 3K3JA 4GJ3A 2YLFA 2QHMA 3BQCA 3QCXA 2PHKA 3R04A 4WHZA 2HZ0A 4JLCA 4UB7A 4N6YA 1H26A 4PPAA 3QF9A 3VHEA 3ZO2A 5K4JA 2HXQA 1PXOA 4FKLA 4BKJA 3NFFB 2WTWA 3V5WA 5M4UA 4ACGA 4YO6A 3IGOA 3VJOA 4EC9A 2OF2A 3HV3A 3RBWA 3FHIA 5J5TA 3DLZA 3P1AA 4E8AA 4MBIA 4RIYB 5KZIA 4EK4A 2BRMA 1ZY4A 3KL8A 2OW3A 2ZV7A 3A60A 3KKVA 2O8YA 4EUTA 2A2AA 4NFMA 2E9VA 2F7ZE 4HVGA 3TZ7A 2CCIA 2QOCA 2V62A 4DHJA 2BHHA 4MHAA 5JN2A 3H0YA 1OUKA 3DK7A 4YSJA 3AMYA 4QT1A 3KIOC 3KRXA 4MYGA 4X3JA 4UX9A 1Q61A 4TNBA 1GAGA 4XEYA 4B4LA 4G17A 3ZDIA 4Y5HA 3BEGA 4FSWA 3FDNA 3BHTA 3F5PA 4GVJA 5HVKA 3F3VA 1OUYA 4HZSA 1VEBA 2ZOQA 3BEAA 3CQUA 4GV1A 4RLLA 3N4VA 3ORLA 2NRYA 3CC6A 3VS2A 2XP2A 3AMAA 3ZEWA 3Q9ZA 1Y8GA 3BWJA 4IZYA 3C0IA 4D2VA 4C7TA 2B7AA 2FA2A 4LUEA 4CFWA 5CVFA 3E63A 2QHNA 3LFAA 1JKTA 1OITA 4BTKA 4U42A 2I1MA 4BCHA 3ZLXA 4L67A 3UC3A 4C58A 5KO1A 4EH6A 5KHXA 4KNBA 4X3FC 5E8TA 4RZWA 3Q5ZA 4UY9A 4I3ZA 2WMTA 4DEHA 3HZTA 5KNJA 3BV2A 3Q4ZA 3BYMA 2DS1A 2R3GA 4C35A 4CD0A 4F1TA 4BDBA 3HKOA 5CEOA 2ERKA 1JSUA 3DY7A 3I6WA 5AP3A 5KKRC 5CYIA 4J8NA 3UO6A 4F99A 3IW5A 4JI9A 3TI1A 3W0RA 2GTMA 1OKZA 1V0PA 4FODA 1FINA 3KRWA 4QYFA 2QOQA 5IA4A 1XQZA 2HWPA 3CQEA 4NK9A 5LVOA 3S1HA 5HVYA 5B0XA 4YJTA 3ZO1A 3CTJA 2O65A 5EOLA 4WBBB 3CTQA 4HYHA 4CFFA 2FSMX 3WZUA 1BI7A 4R78A 3DBFA 3FSKA 5JFXA 3PJ1A 3ATTA 3DBDA 3MI9A 2X0QA 2KULA 4LI5A 3L8VA 3QC9A 3G0FA 4J99A 5D7AA 3QRTA 2VX1A 3KQ7A 3BLAA 3ERKA 4XRJA 3DNDA 4I1ZA 4XUFA 4MXCA 3TACA 3R9OA 1L8TA 4EOSA 2JEDA 2CKQA 3LQ8A 1YWRA 2X7OA 3FLWA 4IC7A 1ZY5A 2VX0A 5DEYA 3W0OA 4CVAA 4F9BA 4RWIA 4EHVA 3CJGA 4RFMA 4FIIA 4FK6A 3FL4A 3NNUA 4ANBA 4FNYA 1IAJA 4NT4A 4DGGA 2OZAB 2WTVA 2CKPA 4GYIA 3V5LA 2XALA 5D1JA 5CF5A 2GHGA 4UV0A 2XKCA 4NZWB 4FEUA 4Q9ZA 4FSYA 4AT3A 4P5QA 3WYXA 5HTIA 3FXWA 3UPXA 2Z7LA 4IX5A 5AP5A 3PJ8A 3ACKA 4TYJA 3QRUA 5BYYA 2V7AA 3ODYX 3TNQB 3R1QA 3F7WA 4JBPA 1WMKA 2WMXA 3WZKA 3HL7A 2HIWA 2YM3A 4GYGA 4JAJA 1DM2A 3GU8A 4IHPA 4ZK5A 3W8LA 2VTLA 4FKUA 4FGRA 2PY3A 2HZIA 4M67A 5CQUA 4AFJA 3HRBA 5M07A 4QMXA 3O7LB 4OTQA 2G1TA 3VBTA 5M53A 3WF8A 1K9AA 4LRMA 4RC2A 1IA9A 3I7BA 4CG9A 3HLLA 3KMMA 4IFGA 2WTIA 4QMOA 5GJDA 4RIYA 3WZEA 3COKA 4F7SA 5B2LA 2BZJA 2ITUA 2W1EA 1KE9A 1G8KA 1GIJA 3PIZA 2PWLA 2I6LA 4RBLA 3QC4A 2C6EA 4FTUA 3AC8A 4FVRA 4NIFB 4H1MA 3OP5A 1M14A 4KKEA 1XR1A 3CQWA 5A9UA 2W1HA 3FZSA 3RWQA 3R6XA 2UZEA 3HGKA 5AUVA 3MTFA 3QAME 4WG4A 2W99B 3QUPA 5BYLA 1IEPA 4IWQA 5DA3A 3Q4UA 3NYVA 3E87A 2HWOA 3BYOA 3NUYA 5IUHA 5JFWA 2OJGA 4YHTA 3F88A 3QHRA 4BI1A 1YXXA 4RA4A 3PA4A 5AUYA 1Y57A 4TN6A 2X7GA 3RK9A 2CNUA 3AD4A 2XZSA 4FNXA 4NH1A 2ITWA 3W18A 5G1XA 3VWAA 3KMUA 4A4OA 1PW2A 4QMVA 1SZMA 3ZDUA 5E8WA 2UV2A 4QP2A 3R01A 4JBVA 5T68A 3KF7A 1TVOA 2VTRA 4DYMA 4X6RA 5A4CA 5A4TA 4CTCA 4C4EA 3U55A 4V0GB 3U6HA 2C5VA 2J0JA 3QWKA 4X7QA 3BL9A 1FGIA 2LAVA 4EOJA 1MP8A 1I44A 4MNFA 3GT8A 3IOPA 5IEXA 4DFUA 3WF9A 4DT8A 4L53A 2WQEA 1TQMA 4WUNA 2OKRA 2IZTA 4BCQA 1J7LA 2W1ZA 1NVRA 3AQVA 3C4EA 4H39A 4NJDA 2HW7A 4D9TA 3R7IA 4AXFA 2OXXA 3QRIA 3RP9A 4L52A 4EORA 1LEWA 1URCA 3C4ZA 4CMUA 1E1XA 5E8XA 3DQWA 4XG8A 1UNHA 2YZAA 4YJVA 3S2PA 4GT3A 3VULA 1ZWSA 2GFSA 2Y7JA 3NYOA 4M69B 3V8SA 1XH9A 4XG7A 4BCKA 3HMPA 3FE3A 3A62A 3IOKA 2JIVA 2Y4IB 1LEZA 2WNTA 3R00A 4L01A 3DJ6A 4M84A 3W2CA 3SRVB 4RIXB 4O7LA 4DAWA 3O8TA 3ZOSA 3FI4A 3BHHA 4NUSA 4YZ9A 5CU4A 3ZUTA 3ZRMA 3P7BA 2EXEA 4ZS4A 4FTQA 5CWZA 5JQ5A 2BFYA 5GIOE 4WO5A 1UNGA 2UVYA 4K2RA 3R7YA 2P3GX 4RJ4A 4O21A 4RMZA 4ZZOA 5AFVA 3L9MA 3PE2A 2PTKA 3RPOA 4QMQA 2QOIA 1WZYA 3RAWA 3DJ7A 5L6WL 5CNOA 1Q8YA 4YTHA 3SA0A 1NT2A 2VTSA 3TTJA 1WBNA 3RZBA 3TKUA 4MXZA 5EM6A 2PVKA 3KCFA 4PX6A 3PXRA 4I5MA 2XCHA 2PVLA 2QO9A 4GUBA 4MAOA 5ANGA 4DFXE 1WAKA 3TIZA 5HD4A 3S0OA 4ALUA 4F7LA 2QNJA 4L42A 3DAJA 4ZTSA 5E4HA 4JAIA 5HG5A 2G9XA 2UVZA 4JJRA 3A4PA 3E8CA 3NS9A 3O0GA 4FTIA 4OTRA 5M09A 1CKJA 5DFPA 2ITTA 2BHEA 4M15A 3W0MA 4KBKA 2CN8A 3G9LX 5J9YA 3GUBA 4GCJA 3R9NA 4QMSA 4DDIA 4RJ8A 2R64A 4TKSA 4DTKA 2Z8CA 3PWDA 4J8MA 5CAVA 3WIGA 3U6IA 1YI4A 2B0QA 2O63A 1UU3A 3HMMA 3JPVA 2QU6A 3FMMA 4DTAA 3RAHA 2JLDA 4FV9A 5H9BA 5AR4A 1H1PA 4DH1A 4MXYA 5HU9A 5FTOA 4D1SA 1CKPA 4AG8A 1XHAA 4FIFA 3S4QA 3MVMA