3TNHA

Cdk9/cyclin t in complex with can508
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
321
structure length
288
Chain Sequence
VECPFCDEVSKYEKLAKIGQGTFGEVFKARHRKTGQKVALKKVLMENEKEGFPITALREIKILQLLKHENVVNLIEICRTSIYLVFDFCEHDLAGLLSNVLVKFTLSEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLITRDGVLKLADFGLARAFSNRYNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLALISQLCGSITPEVWPNVDNKVKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWSDPMPSDLKGML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Cyclin-dependent kinase 9
publication title The CDK9 C-helix Exhibits Conformational Plasticity That May Explain the Selectivity of CAN508.
pubmed doi rcsb
source organism Homo sapiens
total genus 80
structure length 288
sequence length 321
ec nomenclature ec 2.7.11.22: Cyclin-dependent kinase.
pdb deposition date 2011-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3tnhA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3tnhA01
1GNGA 4XLIA 3SOCA 2Z60A 3QHRA 3DB8A 2HZ4A 4QT1A 2IWIA 2OJGA 4G6LA 4LRMA 3QWJA 1MUOA 2Y6OA 1OECA 3Q04A 5J95A 1CDKA 2JIUA 2PUIA 2PMLX 3FLZA 4F1OA 3UZRA 1R3CA 4ANSA 4WHZA 2C4GA 3MB7A 4OTQA 3MB6A 4MQ1A 2X2KA 3HX4A 3ZTXA 2DYLA 3DV3A 2VTAA 4TNDA 3DKFA 3KRJA 3BWFA 5KMLA 3LLAA 3PDTA 1YOMA 4E20A 3OCTA 2JC6A 3F7WA 4Q9SA 4ACDA 4GUEA 3RHKA 4NCTC 2RFSA 5L6WL 3AC3A 4Y72A 4E6CA 5FEDA 2YM7A 3CKWA 3O8PA 4DGOA 1QPJA 1YDSE 3ELJA 3COHA 4LG4A 2XUUA 4LRJA 2QOFA 3LCDA 4FTLA 4BGHA 3KK8A 4CMTA 4F09A 4BCJA 1Q4LA 2J2IB 3VW8A 4C0TA 4ZY5A 5LMKA 3OEFX 2HYYA 4QMWA 4TYEA 4YZBA 5LCKA 4ASXA 3DXNA 4MWIA 3PFQA 4UMPA 3IQ7A 4FKUA 5BYLA 3BKBA 2UW6A 4QYFA 4CZTA 1Y8YA 3DBDA 4JVGA 5FM3A 5HIBA 3IW5A 2FSLX 4EWHA 3DAEA 4FTUA 5IZFA 5LMBA 2X4FA 5KBQA 4BDDA 4DFNA 2FUMA 5LVOA 3FI8A 2O8YA 3E8DA 2VWWA 2W1ZA 4RZWA 4AZVA 3HV5A 1UU3A 3W10A 3BZ3A 2WFYA 4YJTA 3G6GA 3R9HA 4QMXA 1T46A 4AU8A 2WMVA 4E4MA 2ITZA 3LIJA 5C26A 3LKMA 4CZUA 3UIMA 4ACHA 5LQFA 2WAJA 2YAKA 3K3JA 2CCIA 5TT7A 2PUPA 5K0XA 4XG8A 3E62A 3QQKA 3ZFMA 3ZZEA 4NFNA 1JSVA 1SVEA 3O23A 4IM3A 4MAOA 4OBPA 3SXSA 2WIPA 3TT0A 5EQEA 3F66A 4BRXA 5I3RA 4RWJA 4Y8DA 2PZ5A 5EHYA 1PXNA 3WF5A 3TZ8A 3R7EA 3R73A 1QPDA 2J51A 3PJ2A 4IBMA 4ZTNA 1KV2A 4AT5A 4DAWA 5HU3A 2QOIA 4O0SA 1JKLA 2RKUA 3BEAA 4FTRA 4QTCA 5EM5A 2HAKA 5HE3A 4FIHA 4O91A 3ZYAA 4DH5A 2UVXA 2ZDUA 1TKIA 3NUNA 3PZHA 3ODYX 3QZGA 3GOKA 2JDSA 3I79A 5HOAA 4OTDA 4XG9A 1ZXEA 5E7RA 3N4TA 3G0FA 4YSMA 3F88A 5C27A 4G3FA 4FTAA 2YLFA 1A9UA 4I0TA 4ARKA 4E1ZA 4C57A 2W5BA 3QRIA 4I23A 2Z02A 4FR4A 2AYPA 3UDBA 3VS0A 5J9YA 4ANBA 3GC8A 2WU7A 4B8LA 4PDPA 1PXJA 1VYZA 3F5PA 3NX8A 4R5YA 3MY0A 4KINA 5AUWA 3GCQA 2QU5A 3GXLA 3KU2A 3QGYA 4GT5A 3OG7A 4NTSA 3KXHA 1PXLA 4JQ8A 3RP9A 4BDHA 4HVIA 1VEBA 5KMKA 3OWJA 3UZTA 1W8CA 5AUVA 4AW1A 3NYOA 1ZAOA 1KSWA 4Q5HA 5IG1A 2CN8A 2VO6A 2EB2A 2W9FB 4PMSA 2GHMA 3I81A 4F7SA 4RQVA 4WG3A 3FPQA 5T3QA 1TQMA 2YIXA 3LXPA 1Q97A 3UP2A 2WTKC 2XNEA 3I0QA 3R9RA 4HPTE 2PVLA 3OTUA 1UVRA 3QUDA 2F7EE 2Y0AA 2GMXA 4R7BA 2C5XA 3D7TB 3AGMA 2OZAA 2XNNA 1XH5A 4JBVA 3ANQA 4D4VA 4JDJA 3DZQA 4BZNA 3JPVA 3KEXA 4I6FA 2YCRA 5CQUA 2GU8A 3NUYA 3C4XA 4LUDA 4YJSA 3LJ2A 5C8KA 2NP8A 2Z7QA 1UKHA 3FAAA 4M68A 1WVXA 3PVWA 5AV4A 3R7GA 4JBPA 4L46A 4ASDA 1JBPE 5BMSA 5KE0A 3UNZA 3LFSA 3TTIA 4WSYA 2C6IA 1O6KA 2VO7A 4GS6A 2B7AA 2CLXA 5IEVA 4BZDA 3MYGA 4DN5A 2UW3A 5M08A 4FV6A 3OOGA 3F9NA 3GCUA 3QF9A 4IMYA 2ERKA 4C02A 4C3RA 5L2SA 3UE4A 1FVRA 2UVYA 4D55A 2XJ1A 4PDSA 2R3NA 4HNFA 5J9LA 4I0RA 1JQHA 3RM6A 3PE2A 3D0EA 5HHWA 2PULA 5H8GA 4QMSA 5DH3A 3S0OA 5C8NA 3TKHA 2P3GX 4E93A 3W8LA 5D7VA 3UPXA 2XNMA 2HW7A 2H34A 5LJJA 5E8VA 5EYDA 5LXMA 2BVAA 2O0UA 2VGPA 4YMJA 4PDOA 4CGAA 3WF9A 4PNIA 5K5XA 2VTRA 2ACXA 4MXZA 4DEDA 4B7TA 3QQJA 4BZOA 3D2KA 4FV2A 2OJ9A 5HTCA 4U8ZA 4G9CA 1BUHA 2HK5A 2XNBA 4IAIA 3ZXZA 4BIDA 3MVHA 4F08A 3ATTA 3NGAA 3FKLA 4HCVA 2C6LA 5K0KA 3R21A 5LCJA 1ZZLA 1HOWA 4YZDA 4D2VA 5CALA 3VBYA 4PX6A 4C38A 4K1BA 3ZUVA 1J3HA 1ZYJA 2HCKA 3QD4A 1X8BA 3CGOA 4CRSA 4NW6A 3R04A 3VIDA 5EDRA 4FSWA 4LGGA 2VTIA 4MQ2A 4NM3A 3PP0A 4M12A 5B0XA 3UIUA 3Q3BA 3QQUA 4QMOA 4BDFA 3BYMA 5HD4A 5DWRA 3MJ1A 3B8RA 4YNOA 3CY2A 3HRCA 5JH6A 3FI3A 3TNPC 2I1MA 4FKIA 4EI4A 4WRGA 4C34A 3R8ZA 1H27A 3PVGA 4NL0A 2UW0A 4NK9A 2YITA 5DVRA 3POOA 4LV5A 4W9XA 3QL8A 4FSMA 3Q60A 4KSPA 3NW7A 4BDIA 4GRBA 5CXHA 3FDNA 4BY9E 1H26A 3AD4A 3M11A 2YN8A 4EOLA 3DS6A 5CQWA 5FEEA 4BWPA 5I4NA 4XOZA 3VC4A 3F3WA 5J87A 4C61A 3FLQA 1E1XA 3FZ1A 4O2PA 1M52A 4D1XA 5A14A 2OZAB 4O21A 5ANJA 4DH7A 3VUMA 4ERWA 3FLNC 4KA3A 3GC0A 3H10A 1E9HA 1UU9A 2O64A 4IVAA 4RWKA 2GNIA 4YZNA 5CAUA 2YJRA 2XCHA 4C4HA 2WMRA 3FXWA 4I94A 3ERKA 4ZSJA 4AGCA 2UZDA 5DMZA 1E1VA 3BYUA 3QCXA 3RCDA 3D2IA 3TJDA 5M56A 2JD5A 2OKRA 3THBA 5E9EA 1H25A 3CJFA 4A06A 1PW2A 2R5TA 1FVVA 5IA3A 3DPKA 2OF4A 5I9WA 4ZS4A 5ANGA 4Y73A 3DK3A 4MEDA 2A2AA 3RAHA 4DFBA 2X6DA 2XP2A 3NZ0A 4K77A 3VBTA 4C33A 3FL4A 3QXOA 1HCKA 3S95A 4DFXE 4EOQA 5KHXA 1MRYA 1ZYSA 4FV9A 2R0IA 5CF6A 4IAFA 3ATSA 3UTOA 5AUUA 1Y6AA 4BHZA 3EIDA 5BVDA 5CU4A 3ACJA 3PSCA 4K11A 4TPTA 3LLTA 3RGFA 1XH8A 2G9XA 5AX9A 3GFWA 5HESA 3ZM4A 1H4LA 4U3YA 2YFXA 4AS0A 2GNFA 3O7LB 4O83A 4O1PA 4PPCA 4KNBA 3OBJA 5G6VA 4EJNA 1H0VA 3QRTA 4DGLC 4N4SA 5FDPA 3T9IA 3DLSA 2BR1A 4WBOA 3ID6C 3LHJA 3Q53A 5J5SA 2YIQA 2LAVA 4EOKA 5EI2A 2JIVA 4X0MA 4PL5A 5KHWA 1OL7A 3F2RA 4OTIA 4F9YA 4DEHA 5AV1A 2B9IA 3ORLA 3AC8A 3FMMA 4U7ZA 3ZUTA 3GFEA 3IKAA 1Q8TA 1F5QA 5B2LA 4NM5A 4NH1A 3MA3A 3HAMA 2XK7A 1OIYA 5CZHA 4JLCA 5AV0A 3SRVA 1BX6A 3PTGA 4YLKA 2GFCA 4J71A 1H01A 2ITVA 2B55A 3KA0A 2BIKB 4IZAA 2VTOA 5KMJA 4ZLOA 3KRLA 4ITHA 3Q32A 2XIXA 3DTWA 5HE1A 2PVJA 4FBXA 4EUUA 3U4WA 5CXZA 3LM5A 3LCOA 2YDIA 3OW3A 1KOAA 3Q2MA 3TNIA 4F1MA 3AMYA 4S33A 5K4IA 4GFMA 4X6RA 4DHFA 4GG7A 4KRDA 3LXNA 2XNOA 4IX6A 4IH8A 5DI1A 3CIKA 3EQPA 5CVHA 3WF7A 3PIYA 3P79A 5KKRB 1A48A 5L2IA 5HO6A 3IW8A 2CLQA 4FT7A 3DJ7A 1Q99A 4K2RA 2BKZA 4TWOA 5HGIA 5L2TA 2OG8A 5DR6A 4U45A 2J5EA 4MWHA 5LMKC 4GK4A 3Q4TA 5ETIA 4QP1A 4BKZA 5HVYA 4O0UA 3A2CA 4DINA 2UVZA 4W4WA 1ZOEA 3EN6A 5HBEA 2UW9A 2QR8A 2ZMCA 3OEZA 4F64A 4OT6A 1PF8A 3KF4A 4IW0A 2DS1A 4EHEA 4MTAA 2F2UA 3OW4A 1LR4A 2YWPA 3HMNA 3JVSA 3FY2A 2YIRA 1IG1A 2WMAA 3FI2A 4FL2A 3IONA 2CMWA 2G2FA 3W55A 2XM8A 3CQEA 4U80A 5AP5A 2X8DA 3EFLA 4NTTA 3W2PA 3ORXA 4I5HA 4PWNA 4O82A 3VS6A 3SG8A 1STCE 1CKPA 1IEPA 3ZU7A 2WHBA 5AIRA 4XG2A 4CTCA 3D83A 3DBFA 4D4YA 4P2KA 3QTSA 3QA0A 4BDCA 3S2PA 4F63A 4PMTA 4FZDB 5HTBA 2YZLA 4BVUA 2OXYA 4RQKA 3NYXA 2WTIA 2A27A 4A9UA 4FGBA 4CLJA 5FBNC 5DN3A 4MX9A 3G2FA 4EOOA 3QLGA 4IE9A 4PRJA 1H1QA 3UO5A 2YCFA 4DGNA 2BAKA 2C5YA 2QO9A 4ZS0A 4E6DA 2X7OA 3PXYA 2OF2A 4CKIA 3DA6A 2R0UA 2VV9A 3MY1A 1WCCA 1W84A 3E7VA 4OW8A 4O38A 4S34A 2LGCA 1ZMWA 3QYZA 2PK9A 4HJOA 2VD5A 4YLLA 4YJNA 3HMIA 4C4GA 3L9LA 5IA4A 1SVGA 1YQJA 2C47A 2HW6A 3HUBA 5HICA 4O7WA 4QPSA 4BCKA 5IH4A 4FIFA 3R30A 3JS2A 3F3VA 1FOTA 2WELA 3HZTA 3TZMA 4PL4A 1LEZA 5IUHA 3SRVB 3FL5A 5HTIA 3U9NA 1CTPE 1H00A 2WU6A 3VS2A 4R7HA 2VTJA 4MD9E 4BF2A 3MIYA 3FC1X 4Z7HA 4P5QA 4ZLYA 4FODA 5CEMA 3RAWA 3QQLA 3OROA 2FH9A 1M17A 4G3GA 3QBNA 2XKEA 5AR5A 5G1XA 1FQ1B 4N6YA 4RVMA 3NUAA 3R9OA 5IDNA 3OWKA 4NJ3A 4HPUE 4KBKA 5AWMA 2NRYA 2ZOQA 3QX4A 4HYHA 4G17A 3DQXA 4LRKA 4D1ZA 1T45A 2GPHA 1NXKA 2OI4X 4IZ7A 3NPCA 4ZY6A 2XNGA 4H3PA 3S00A 2PVKA 4RMZA 4GT3A 5DFPA 4AFJA 1VJYA 2XKDA 2ZJWA 2GNHA 2Z7LA 4I5PA 2ESMA 5KO1A 4NYEA 4O7TA 4HZRA 2XH5A 4RLKA 3VQUA 3TM0A 3N4UA 1W83A 1H1PA 5M4UA 4CCUA 4EC8A 3IDCA 5DPVA 2ZM1A 2GHGA 3OVVA 4A9RA 4I21A 4EBVA 3R8UA 3L1SA 2E9NA 3PXFA 2PVFA 3OC1A 4ERKA 4BR3A 2RL5A 1MQ4A 3SHEA 4F9BA 3N51A 4HGLA 2IW8A 3RK9A 1XBBA 4N0SA 5EM6A 3TUBA 3BLQA 2WQMA 5HG8A 3OXTA 3LFEA 4I4EA 1PXMA 3O96A 1OM1A 3MH0A 4L7SA 3FZSA 3OD6X 3QTQA 2PSQA 3KMWA 3BHHA 3DK7A 4ZTRA 5KZIA 3QQHA 2XIKA 3OUNB 2FVDA 1JKSA 2R3PA 4MXXA 4WO5A 1OUYA 3SW7A 4FA2A 2VN9A 1M2PA 5TO8A 2O63A 4L68A 4IB0A 2XJ0A 3OT8A 3NCGA 4EH9A 4RFMA 1M7NA 3MDYA 2Y9QA 1KE6A 3KRXA 3HMPA 3NAYA 3ORNA 4GYGA 3RZFA 1KUTA 3A8XA 3KVXA 5IMEA 5F1ZA 3PYYA 4QP8A 3MTLA 4E4LA 4X2JA 2VRXA 3GU5A 2VX3A 4WG5A 4BIEA 2PZRA 1KE9A 1NA7A 2VTSA 2PE1A 4WNKA 3VQHA 4CVAA 4BTMA 5K4JA 4W8DA 3R7VA 4XNEA 4KRCA 5ANKA 4KIOA 5FGKA 1L3RE 4EC9A 5F9EA 3IW4A 4HOKA 4FGRA 1Q5KA 2J5FA 4QMVA 5IQEA 3R2YA 3NYVA 3ZFXA 3E8CA 5JFWA 5DT3A 5C9CA 2WQOA 5JKGA 3PLAE 4GKIA 4ENXA 1PMUA 2EVAA 5AP2A 2BILB 2QG5A 3O0GA 4LM5A 3PA5A 3BE9A 5B2KA 4HVSA 5M4FA 3CQUA 5GINE 3HMOA 4EH2A 3D7ZA 2BTSA 1UU7A 2PUNA 2CKQA 4EL9A 2XJ2A 4ORKA 4E5BA 2VX1A 3KY2A 4JR3A 1OL6A 4F0IA 2FB8A 3C0IA 4A9YA 1ZY4A 2IZUA 4I4FA 3CC6A 3GCPA 3R9DA 4R3RA 1UWHA 3FZTA 5FM2A 2Y4IB 3I0OA 5FLFA 4G3EA 3GCVA 2VWZA 3RWQA 5KKRC 3V5PA 3UMXA 2Y8OA 1SNUA 4FTCA 2A1AB 2HIWA 1XKKA 2YACA 3IG7A 4LI5A 3WE8A 4AP7A 1S9JA 4D0WA 5EG3A 2CDZA 1Q8WA 2XEYA 1LP4A 3IW6A 4JG7A 3P1AA 4JQEA 4W4XA 4YU2A 4EHZA 2QOHA 3OF0A 3QTUA 4FL1A 4RX9A 2WMBA 1LPUA 1AQ1A 1YXTA 4FMQA 4KAOA 1ZZ2A 3P08A 4U42A 3COMA 3REPA 1CKIA 2QVSE 5GJDA 3V5QA 3NVKI 3PA3A 4BDJA 4L3PA 4TNBA 5A4QA 4FV0A 3MBLA 4R77A 4RIXA 2QHMA 5BVWA 3DBCA 3PP1A 2BZIB 3GUBA 5L3AA 2P55A 1ZYDA 1TVOA 2A0CX 3QFVA 4FSZA 3QC9A 2NNWB 3MVMA 4GEOA 4DCAA 4DFYA 2Z2WA 4YZCA 3AGLA 3EH9A 4JBOA 3V8WA 4CCBA 3LJ1A 4AE9A 4RX5A 2BRBA 2R3IA 3DT1A 3G33A 4JI9A 3KL8A 2ZDTA 5LARA 1NVRA 4BWKA 4DLJA 3GCSA 4QMLA 5JFSA 4FOCA 4XV2A 5AM7A 4L01A 5IA1A 2VO3A 3BGZA 3BYSA 3DBEA 3L8PA 2OFVA 4AOIA 3WYYA 2PZYA 3CBLA 4LFIA 1J1CA 3UMWA 2BUJA 2PZIA 3AXWA 3ET7A 3ORIA 3AD5A 3ZUUA 3KKVA 5TOZA 3UP7A 1H07A 4DG2E 3R8PA 2QLQA 3F5XA 2XBAA 2VTTA 2JAMA 5CVFA 2C0OA 4EEVA 3WF6A 3DKCA 3LFQA 5ICPA 4IX3A 3TKIA 4I3ZA 2JBOA 1ZYLA 1GZOA 3DJ5A 3RTPA 1OL2A 2EXCX 3NNXA 4QP7A 2BPMA 3A7FA 2R2PA 4ZTQA 3FXZA 3ZEPA 3ROCA 4C4JA 5HX8A 3E64A 1WBSA 5JQ5A 4WKQA 5E8SA 5FBOA 3MFSA 4AACA 5C03A 3V01A 1PKGA 3HL7A 4ZTSA 5HG9A 5DEWA 4FSNA 3MW1A 4FNZA 5L2QA 4GIIA 5J1VA 4IWOA 4MXAA 3WZJA 1OL1A 3GP0A 4FG9A 4IB1A 4EOSA 3QXPA 2V0DA 5C4KA 1H1WA 1UWJA 2V22A 5AV3A 3FZOA 3PA4A 3PPZA 1V0PA 3L8VA 2R64A 2YCSA 4BCIA 3OWPA 3MN3A 1UU8A 2ZMDA 4ZSLA 3UO4A 3W18A 1IAJA 4GKHA 3KXNA 5M06A 4YSJA 5I9XA 4GK3A 3RM7A 3EQRA 1IA8A 5JSMA 2X4ZA 1P5EA 4XEYA 1OBDA 5HVKA 3OCBA 4DFZE 4FTIA 3KXZA 3UC3A 3UYTA 4CQEA 2QD9A 2CGVA 4EH5A 3D7TA 5IF1A 2V5QA 2CKPA 3H30A 3D14A 4YHTA 4B99A 4BDKA 3ZRKA 3H3CA 1R1WA 2JDTA 3HA8A 4LOQA 2DWBA 4UALA 3UOJA 3ZSIA 5CSWA 5HX6A 4NKAA 2IO6A 3I4BA 4ZIMA 2IJMA 3LQ5A 1WBVA 4I0SA 4FT9A 4IWDA 4UYNA 5DR2A 3TDVA 4EHGA 4DFUA 4IB3A 3CD3A 4HCTA 2WMUA 4H36A 2QKRA 3NUPA 4LUEA 4FVRA 4JX7A 4MH7A 3FHRA 5HKMA 2HZ0A 4DCEA 4PNKA 3Q2JA 3S4QA 5IQAA 5AP4A 3D5VA 3KRRA 3QWKA 4RIXB 3OFMA 4C35A 4CKRA 2P33A 4GH2A 3NRMA 4A7CA 5CX9A 3CTQA 2IVVA 2F9GA 2BCJA 3A4OX 4I41A 5HE2A 4I22A 1G8SA 4Y5HA 2NO3A 4C7TA 5CF4A 3FUPA 4EZ3A 4DA5A 2BZKB 2WTDA 3MI9A 2QHNA 4FV1A 4M3QA 4MKCA 4NJDA 4FSRA 3W32A 5KX8A 4HCUA 2YDKA 4JDHA 3IOKA 4RJ4A 2YM3A 4RC2A 4ZJJA 2WTCA 3AT2A 2OICA 3EMGA 3ORTA 4QTDA 4IZYA 4DEBA 5J8IA 4EQCA 4ZSAA 3CPCA 2YCQA 5IQHA 2Z7SA 4AZWA 3RK7A 4BTFA 1ZOGA 4OTPA 4XP2A 5IEXA 4RX7A 4BCFA 4WOVA 2ITNA 5ETAA 4YUQA 1Y6BA 4XLVA 1YI4A 4RC4A 5EOLA 3P0MA 3VO3A 3TUCA 3FEGA 1WBPA 5CEQA 4O27B 3DFCB 3VUHA 3FQEA 4EQUA 1H1SA 3UVPA 3VF8A 4I92A 4L67A 5HVJA 5A46A 1JPAA 2C3IB 5A9UA 5J9ZA 1MRVA 5HORA 3PIXA 3FLWA 1Q61A 4FTTA 5M09A 4OTRA 4ANNA 1WAKA 4A07A 4A4XA 4ITIA 3WARA 2YJSA 4QTBA 2W9ZB 3FMKA 3V5LA 3FSKA 4BCHA 1MRUA 5H2UA 3DCVA 1ZMVA 3RPOA 2HWPA 2FA2A 2B9HA 4NKSA 5CSXA 5FXRA 5EQYA 4EJ7A 1PHKA 3C4WA 4E3CA 2UZTA 4BC6A 3CXWA 3ORZA 4RGJA 2W17A 4FF8A 1GAGA 2Y4IC 4G3CA 4JNWA 3TNWA 2A4LA 3KF7A 2OBJA 2OWBA 3DY7A 3LCTA 5HQ0A 1NVQA 3ZOSA 4I1ZA 4CFFA 4V05A 3QKMA 4QP2A 4F6SA 2GSFA 3BV3A 5JFXA 1ZOHA 4GT4A 3EQIA 4F6WA 1O6LA 4PV0A 4ASEA 3UBDA 3GB2A 5IEYA 2OXDA 3R83A 2VNYA 4QMTA 4UEUA 2HY0A 3EQFA 2YERA 3NS9A 3R00A 2YWVA 4O86A 2OH4A 4FVPA 5HCXA 2C6DA 4Z7GA 3VBVA 2IW6A 5CEIA 4I6QA 5CANA 1OKYA 3BWJA 2HZIA 4OBQA 2R4BA 5FRIA 1A06A 4XG7A 4A9SA 2WXVA 1Q41A 3QZHA 3MPMA 2CGWA 5EHLA 4QD6A 2J50A 1XHAA 3CP9A 1UNLA 3PY0A 3VW6A 1O9UA 1BL6A 1VZOA 3QAME 4M14A 2I0EA 3PSDA 4FKWA 2JGZA 3QQFA 4PL3A 5JZNA 4ZMFA 3QTZA 4QP9A 4M66A 4FKPA 4X6QC 5HCYA 3ULZA 1GY3A 2UV2A 5A4TA 3RNIA 2F2CB 1RE8A 4RVTA 5C1QB 1W0XC 3CCNA 5JFVA 3LFAA 1WZYA 3JYAA 1YXUA 4NIFA 5T68A 1SZMA 2JKQA 5I9YA 2CJMA 3PUPA 4ZOGA 5L8LA 2XK4A 4QTEA 4B6LA 5FTGA 5BUEA 1K3AA 3C1XA 2I40A 3EL7A 3ZLWA 4UMQA 3PPJA 2A19B 1YHSA 2H8HA 4BKJA 4F70A 4HZSA 1Q3DA 4W8EA 4AG8A 2YZAA 3GU4A 3NW6A 1XR1A 4U44A 5I0BA 3RCJA 3F61A 4MYGA 4JDKA 4TZRA 3W8QA 5AIKA 4GK2A 3BHUA 3LXKA 4L00A 3W33A 4B0GA 4GVAA 4BYJA 4G3DA 3DOGA 1K2PA 1XWSA 3C4CA 4G5PA 1OL5A 3MA6A 1JKKA 4ENYA 3B2TA 3EKKA 4FEUA 4DF3A 4BDEA 4Y95A 3OCGA 4QP6A 2YDJA 4UYAA 4U9AA 4GUBA 5DBXA 5HLWA 2CGUA 3SLSA 3KK9A 4CFVA 3BYVA 1W82A 3UC4A 4G16A 1U46A 4O22A 4D28A 4D9UA 4F1TA 4C2WA 4OTWA 3E3PA 3RAKA 3PWYA 3C13A 4OLIA 3MH1A 4D2TA 4TRLA 2WIHA 1VYWA 2I0YA 4IM2A 4EK4A 2OJIA 2XK8A 3VBQA 1BL7A 2GCDA 4LGDA 1YHVA 4GSBA 4A4LA 1R0EA 4CFMA 3FBVA 1OKZA 3OXZA 5CWZA 5IQBA 5JRSA 3UJGA 4DEGA 3WZUA 4DE4A 3COIA 5DNRA 1YI6A 3BPRA 3D9VA 1NY3A 3SGCA 1PKDA 3A7IA 3P9JA 4Y5QA 4FZ6A 4FV3A 4C62A 2BDFA 1V1KA 3WZDA 3C9WA 3LOKA 3V6SA 4MXOA 2R3OA 3RKBA 3NNUA 3PE1A 5CZIA 3R22A 2XK3A 5F4NA 4BHNA 4DT8A 4FI1A 3SD0A 5CU0A 3AC5A 2W4JA 4AW2A 3FE3A 3MPTA 5DHJA 5EM7A 3KXMA 3RPVA 2OU7A 3PRFA 4NEUA 4O7ZA 3VJOA 4R1YA 2VWIA 3G6HA 4WG4A 2XEZA 5M44A 2CN5A 2WGJA 3FY0A 3N4VA 2G15A 4F9AA 2IVSA 4CRLA 2ZB1A 3FMEA 4QMPA 4HVGA 5JK3A 4RVLA 5EM8A 4ASZA 2W1HA 2NPQA 3H0YA 2E9OA 4GYIA 3UVQA 4WD5A 5A6OA 3UO6A 3ZSGA 4UWBA 2BIYA 4AA0A 2QCSA 5AMNA 3PG3A 4FVQA 3DAKA 2PMNX 4PF4A 3V6RA 4FV7A 3DAJA 3EN5A 4IWPA 4NIFB 5BVKA 1OBGA 1LUFA 2IZRA 2X0GA 3U6HA 2JBPA 5M4IA 4YZMA 4CFNA 5HO8A 4EORA 2JAVA 5IDPA 3NVMB 1QPEA 2RFEA 4FT5A 4GG5A 5AX3A 3SW4A 1AD5A 3SXFA 3TACA 5CS6A 4CYIA 4E5WA 3DB6A 2FO0A 3S1HA 5E8XA 3Q5ZA 5A4LA 2QQ7A 1YI3A 3BCEA 4FIGA 2OZOA 4ZZOA 5AAFA 3U55A 3C0HA 3NNWA 3BEGA 2BAJA 2BRMA 2W7XA 3ULIA 4E6QA 1XH6A 3IS5A 4RJ7A 4XJ0A 3TIYA 1XH4A 4FG8A 4YZ9A 1QL6A 3RINA 3ORPA 3L9NA 3NW5A 4CQGA 3O2MA 4AX8A 1Z9XA 2B53A 3FYJX 3NUUA 4G1WA 3WZKA 3CGFA 3QKKA 4JQ7A 3B2WA 5IKWA 3R8MA 4WBBB 3ACKA 5E8UA 2FGIA 4USFA 2ZM3A 1FINA 2FSMX 3OUKA 3OXIA 3P7BA 3Q6UA 4V04A 5CSPA 4UV0A 4YJRA 4KIPA 2YABA 1Z57A 4QQJA 5HLPA 3DKGA 5GZ9A 3NUSA 4MBLA 4C3FA 4F4PA 1P2AA 4PTEA 4QNAA 3QUEA 3BIZA 5D41A 4FK6A 3GC7A 3VUKA 4C37A 5IISA 4O7NA 1RJBA 2EUFB 5IQCA 3K5UA 4V0GA 2RG5A 3COKA 2G2HA 2X8EA 4IVBA 3OOMA 2CNQA 4XP0A 2ZYBA 3ANRA 2OH0E 3CJGA 4D1SA 2WMXA 5J1WA 2ITPA 3CTJA 2WQNA 3E5AA 5AP6A 2ITOA 3FXXA 2E9UA 2CCHA 1WFCA 2H6DA 5A3XA 1W7HA 3UYSA 3ZEWA 4FKTA 2ZM4A 5HI2A 3M1SA 3HNGA 4CEGA 4CKJA 2J0LA 4FYOA 4BFMA 2GS6A 3FYKX 4J8NA 4JRVA 4M67A 5AFVA 1GZKA 2FSTX 3FWQA 1FMKA 2UZOA 4L8MA 4CTBA 3BX5A 5FWKK 4PTGA 4QPMA 2YLEA 2XVDA 3PPKA 3QALE 4L3LA 4JBQA 4D5KA 5JRQA 3ZSHA 4MD8E 4AA4A 4XV3A 5CVGA 1YRPA 2W1FA 4KKHA 1PMVA 4W9WA 4FTQA 3BBWA 3VS1A 2JDOA 3K2LA 3CQWA 3LZBA 3R01A 5CT7A 4APCA 3Q52A 3CSVA 4CG9A 3AD6A 3A99A 4G2FA 1Y91A 1FBNA 2C6OA 2OGVA 5HNIX 3RMFA 2JKMA 2XRWA 1QPCA 5CSHA 2CGXA 1GJOA 2PUUA 2PZPA 2VTMA 4IB5A 3BQRA 5CI7A 4YBKA 5CY3A 2C6TA 5TE0A 2WMQA 3G90X 1JAMA 2XRUA 5F94A 2Q0NA 3C5UA 4M13A 3MVJA 4GW8A 1OVEA 2W1DA 5BUJA 4MCVA 5DOSA 4ACMA 1OITA 2XM9A 4EBWA 4O7YA 1ERKA 2BFXA 4EZ7A 3C4EA 5DG5A 5FEQA 3UIBA 3EQDA 3ZXTA 2GS2A 4DITA 5BVOA 2PE2A 4KS7A 5I9UA 3I6UA 4FTKA 3NEWA 3QCQA 3HRFA 2QU6A 5CAVA 4JJRA 4AN3A 5BX0A 3HA6A 1GZNA 3W1FA 3AC1A 2PWLA 4W4YA 1PXOA 4D4RA 3HDMA 1OZ1A 3UODA 4HNIA 3PVUA 3BU6A 4WUAA 4ZXTA 1GOLA 4CT2A 3TV4A 5DYJA 2WOUA 4GJ3A 5ETFA 1TQIA 5BVEA 5K3YA 3R7UA 3BGPA 2X2MA 4R1VA 4Z3VA 3SKCA 5KNJA 4DTKA 2PPQA 1IASA 3R02A 4II5A 3AC2A 4N57A 4TYHA 5KMNA 1PYEA 2CNUA 3EB0A 3R2BA 4XCUA 5CAQA 3U4UA 1MQBA 4R6VA 3HRBA 4QYEA 5HCZA 4F9WA 3DJ6A 5DT4A 3HV6A 5EK7A 3LFDA 3SV0A 3HECA 4O6LA 2WNTA 4OUCA 2VWYA 3R9NA 3T9TA 4DGMA 4V0GB 4TYGA 3FQHA 2CNVA 4XS2A 4RX8A 2PVYA 2C0IA 2J7TA 4FZAB 5CYIA 3LPBA 3VVHA 2BHHA 1BMKA 3OZ6A 1QCFA 3C7QA 4O0WA 3F6XA 3SA0A 2GQSA 1DI9A 4M97A 5HZNA 4EWQA 5C8MA 5H9BA 5M57A 5GJFA 2CHLA 4FT0A 5AR8A 4OBOA 5IU2A 5HU9A 2Z8CA 3QCSA 3WILA 4DG0E 5GIPE 3I5NA 3OY1A 3VUIA 3ZBFA 4BICA 2VWVA 4DFLA 2QNJA 4RG0A 3EN9A 3ENMA 4TYJA 4I24A 4C36A 4O81A 4FTOA 4A4OA 4L42A 1MP8A 3KVWA 3ZZWA 3QX2A 1U5RA 4M7IA 3NAXA 4G6NA 4DH1A 2I0HA 4DH3A 3JY0A 2Q0BA 3RAIA 4ZMEA 4GJ2A 5CNNA 3M2WA 1AGWA 4XYFA 4X7QA 3C0GA 4Y83A 4EKKA 3TCPA 3U54A 5C4LA 5E8YA 2HXQA 3GENA 1Q62A 3A7HA 2C3LA 5GIOE 4NSTA 3KREA 2WZJA 4O7RA 2R3HA 2XK6A 3FMNA 4FEQA 5CU2A 3WZEA 5E4HA 3HV4A 1TQPA 5AAEA 2C6MA 1PYXA 4EOMA 3A61A 1F3MC 5EDQA 1WBNA 4YTHA 1M7QA 4IFGA 5ANEA 2XBJA 3Q96A 2JFLA 2PVRA 3AC4A 2E9VA 3GQLA 3VRZA 2R3MA 3VS4A 3V8SA 3D94A 1H8FA 1P14A 4G9RA 3QRUA 1UNGA 4CMOA 2QOCA 5FP6A 1H08A 4YJUA 5EYKA 4F7LA 2W5HA 4EYJA 2G01A 4BCGA 5ITAA 3MTFA 4QPAA 3AT4A 3CD8A 4M0ZA 5EOBA 1URCA 2OLCA 4C3PA 4FKLA 2PTKA 3E93A 4R5SA 5C01A 4AN2A 3KB7A 4IVDA 4L7FA 5CEPA 2W05A 3OMVA 3CLYA 4O1OA 4RIOA 4J7BA 2XZSA 4LL0A 4PQNA 4RLLA 2W1IA 5AP7A 2GNJA 4ZTLA 3UQGA 1OIRA 4D4SA 2ZV7A 4O7LA 3TTJA 4QTAA 2WB8A 4U97A 3U87A 3KXGA 4DT9A 3D15A 5H8BA 4MXCA 3W2RA 3W2SA 2QONA 1M14A 3ODZX 1ZARA 1M2QA 2ERZE 3OCSA 4LMUA 4TYHB 3IDBA 5HG5A 4ALUA 1Y8GA 3R71A 4L52A 3RPYA 2R7BA 4BI2A 4N70A 2UZEA 2HELA 2C1AA 4TWPA 3E8NA 3IOPA 4AOTA 4BYIA 4U5JA 3HVCA 3GU6A 1JLUE 4HYUA 5CU6A 1UA2A 2FSOX 3MSSA 3UOHA 4QQ5A 5D1JA 2X7GA 3EQHA 4RA4A 4EOJA 1XQZA 2F7ZE 1OGUA 2AC5A 2J6MA 2PVMA 2HOGA 2BRHA 3WI6A 4EQMA 4K6ZA 5I3OA 4YC8A 3RI1A 2WOTA 3II5A 4O0VA 4D2WA 2BDJA 5AUYA 2EXMA 4AQCA 3KRWA 2QI8A 4EH6A 4JX3A 3BU3A 4IZ5A 1BYGA 2UZLA 3NDMA 2F49A 4FNWA 3ZH8A 4ZY4A 5KMOA 3PXRA 4TW9A 4BGGA 2XKCA 4XRJA 3FC2A 3WF8A 4XX9A 4AOJA 1FGIA 2QOLA 3P78A 5IA2A 4CZYB 4FYNA 4IJPA 3PG1A 3UOLA 3VF9A 1R0PA 5GJGA 5EKNA 3UIXA 3K3IA 5AR2A 3E63A 4ZEGA 3QHWA 5J7BA 4AA5A 3ZONA 4EYMA 3H9RA 3UQCA 3F2AA 3EJ1A 2OO8X 4ANOA 3ZM9A 4M0YA 5IH6A 4U43A 5CEOA 5AP1A 1YXXA 3ZLYA 4DH8A 4L43A 2W1GA 4Z16A 4FSTA 3WYXA 3QZIA 2B4SB 1BI7A 4L44A 2W4OA 1Y57A 4IAZA 4D2SA 3E92A 2H96A 4H3BA 3DXPA 3BLRA 3Q4ZA 4KIKA 4EH7A 3P23A 3OWLA 4YC3A 3R6XA 2E2BA 2HZNA 2BDWA 2JDRA 3H0ZA 2BKKA 1O6YA 3E87A 2PVHA 4O0RA 3TN8A 2W5AA 2BZJA 5HBJA 4O0TA 3TWJA 2VGOA 4PPBA 4F7JA 4IDVA 3QU0A 5E1SA 4YO6A 2X8IA 1NW1A 1PJKA 2ITXA 2IVUA 2UW8A 2X1NA 4NFMA 4HVHA 5DIAA 4M69A 3FMHA 3CPBA 3OBGA 1DS5A 1G8AA 1XH9A 2I7QA 5L4QA 2PYWA 1BKXA 2B1PA 2WTWA 5LMAA 4BTJA 1G3NA 2QOOA 2J9MA 2IPXA 5DEYA 3QQGA 3FMLA 4XMOA 4AF3A 4FSUA 5EKOA 3UZPA 1KE7A 3CEKA 4IX4A 1PXPA 3MFUA 2HENA 4GU9A 4D2PA 3LMGA 4AN9A 4GIHA 5FD2A 2VU3A 5CTPA 3O50A 4A9TA 5HE0A 3LQ3A 3FI4A 4FK3A 4X3FA 3IK3A 1IAHA 2RIOA 5M51A 4QMQA 1JOWB 2G2IA 4MK0A 3WIKA 3V04A 1PXIA 3H9FA 1OPLA 4DEIA 5L8KA 4J99A 2XIZA 4G31A 1BI8A 3LCSA 5H3QA 2PU8A 2PMIA 4L53A 4XHKB 5J5TA 4IC7A 3ZC5A 4F65A 3U6IA 4EOPA 4IAAA 3ZO4A 3R1YA 5AR7A 3ZRLA 3F3ZA 3DNDA 3RK5A 3LMIA 2XYNA 3Q9YA 3BGQA 3HV7A 4FKJA 4BIBA 5AA8A 1G5SA 4ZSGA 3QRJA 2RF9A 2SRCA 5CENA 3R7IA 4P5ZA 3DZOA 2C3KA 3BU5A 4TY1A 2F4JA 2VAGA 2VWUA 3E8EA 3PXKA 4D2RA 2KULA 3IECA 3PZEA 4RIWA 1JSTA 3HLLA 3DXQA 2GFSA 4LOOA 4GFOA 3FLYA 1R39A 4O96A 5FG8A 3SXRA 5IQIA 2OJFE 4BDAA 4NM7A 3KFAA 3Q9WA 3UNJA 3AMBA 4JG6A 4H1JA 4BCMA 3EL8A 1OI9A 4WIHA 4ALVA 4ZJVA 4RWIA 4DGGA 2ITTA 5J7HA 2B54A 3GVUA 4Q5EA 4XP3A 4C4EA 5FTQA 5B7VA 2PE0A 1FVTA 3QD0A 3QLFA 4JDIA 4X2GA 3AT3A 3ZLSA 1ND4A 3L8SA 4P7EA 5CSVA 4AAAA 3O71A 2VTLA 2R9SA 4TN6A 4WNOA 4EHVA 3TZ9A 4WUNA 4ANLA 5LWMA 3ORMA 2OJJA 4FV5A 5A54A 4FOBA 5EYMA 3NSZA 4W4VA 4AUAA 1Q3WA 2BFYA 2ZV8A 4IEBA 4C4IA 5J79A 2JITA 2UZUE 2C5NA 2WKMA 4WRSA 3OHTA 4D9TA 5HLNA 2BTRA 2C1BA 2HY81 5AEPA 5BVNA 4AZSA 4DC2A 1OUKA 4KSQA 1YHWA 3E7OA 3OS3A 4CFUA 4KIKB 3GI3A 4X2KA 3T8OA 1Q24A 4KD1A 4UB7A 5DRDA 2R3KA 4AXAA 3PIZA 4KS8A 4MD7E 2RSVA 4TWCA 4Z9LA 3MJ2A 5DLSA 3ZBXA 2ETKA 2J4ZA 2Z7RA 4F99A 4J52A 2VWXA 4HGSA 4Y46A 4YJQA 3EYHA 4PMPA 5CEKA 3SG9A 5BQ0A 2VX0A 1KWPA 3O8TA 4AZEA 1DAYA 4FKRA 4QMZA 2QURA 3FSFA 1M2RA 3AMAA 5D9HA 2BHEA 4JR7A 4RJ3A 3LW0A 3QGWA 4M69B 4QRCA 2WEIA 4O0YA 3KC3A 3PWDA 3TG1A 2ZAZA 5IQFA 4FUYA 4RWLA 2YM5A 5A4CA 3P5KA 3LJ0A 5LVMA 3C5IA 5LWNA 2BRNA 3IGGA 3PXZA 3DBQA 1DAWA 5H8EA 4C58A 3K54A 3EFKA 2GNLA 1YOLA 5CF5A 5JGAA 3LFNA 3WOWA 4J96A 4BTKA 5BMMA 4GVJA 4RFYA 4FIIA 4S2ZA 3U8WA 4FZ7A 5LVPA 4ACCA 4F6UA 3PJCA 3MGYA 4BGQA 4JOAA 3NLBA 4RJ6A 3DU8A 4X3FB 2QR7A 4I5CA 3TI1A 4YHJA 4BDBA 2CKOA 2KTYA 3P86A 4IDTA 4WA9A 2OSCA 3FMDA 4RRVA 3O51A 3P7CA 2B9FA 4EK3A 4XOYA 5DE2A 2YHVA 1J91A 4ZLZA 4FEXA 2XNPA 4IAYA 1OKWA 2UW7A 3C4ZA 1UNHA 5E92A 3FQSA 4M84A 4YTIA 3RBWA 4TL0A 2YAAA 3NCZA 2XIRA 4RJ5A 5EFQA 4PP7A 2IG7A 2REIA 2R3QA 5D10A 3LQ8A 4IANA 5IUGA 3K5VA 4WSQA 5GZAA 3ALOA 5BUIA 2UZVA 5HG7A 3BELA 4TYIA 4DEAA 3A8WA 5AADA 3UGCA 4RIWB 4FSQA 2C5VA 3R0TA 4QP4A 4FNYA 1WBWA 2QLUA 2X9EA 5AP3A 4KKEA 4UWCA 3NWWA 1ZYCA 2O2UA 4FIEA 4R78A 3FMJA 3UOKA 1GIJA 4IFCA 1OPKA 3EYGA 1F0QA 2XIYA 3BYOA 2CSNA 2HXLA 3IW7A 4DYMA 4MBIA 5JEBA 3UNKA 2ETRA 3LCKA 3R1SA 4FG7A 4U6RA 2YM4A 3FZRA 3PJ1A 1JNKA 4ZZMA 4RBLA 4FKQA 2YIWA 4JRNA 4OT5A 4O2ZA 4KBAA 3JUHA 3QTWA 3I60A 3A62A 2R3GA 4H58A 4KWPA 3CY3A 4QMMA 3SAYA 3OP5A 3TV7A 4BCPA 2JIIA 4YBJA 3O17A 2ZVAA 4ZK5A 3FHIA 3BV2A 3EFJA 4I6BA 2OXXA 1YWRA 3SX9A 4EH4A 4HGEA 4D58A 4KABA 2WMWA 3MFRA 3R7YA 3R1NA 4ACGA 3LFBA 3NMUF 3R8LA 2VTQA 5AAGA 2GNGA 4IXPA 3KCFA 5EI8A 4UXQA 3JXWA 5ACBC 3S3IA 4IADA 3QYWA 4CXAA 4UY9A 1OMWA 1U5QA 4X21A 4DG3E 3MWUA 1H28A 1PY5A 2X9FA 4I93A 4L9IA 4YLJA 5LVNA 3DK6A 2XYUA 5HBHA 3VN9A 2QC6A 3F5GA 2RFDA 3G9NA 3W2OA 4QOXA 4TKSA 3ZO1A 4BL1A 3M42A 1U4DA 4Y85A 5IQGA 3A60A 4UZHA 4AE6A 1UKIA 4QNYA 3RHXA 3UQFA 4CG8A 5TKDA 2XCKA 4PDYA 4KKGA 4LGHA 5FUTA 4F9CA 4I5MA 4L3JA 5M53A 2YM8A 1KV1A 3E88A 4LL5A 2BRGA 4U0IA 3EQGA 5D12A 4C2VA 3SQQA 5JZJA 3GQIA 2VUWA 5FQDC 3QUPA 4ZP5A 3BE2A 3HMMA 1W98A 4GV1A 4CFWA 4YTFA 4M15A 4AFEA 5HIEA 4U79A 2EWAA 4IHPA 3TXOA 2W1EA 3VNTA 4G5JA 1XO2B 3FJQE 4N6ZA 5F20A 5EW8A 4CMUA 3HKOA 4ZJIA 4BCNA 4FV4A 3LE6A 4LQMA 3SC1A 2YEXA 2RFNA 3E3BX 2B0QA 1HCLA 3PY3A 5EH0A 2QG7A 2C69A 3D5XA 3TUDA 3QC4A 3HEGA 3VS7A 5KBRA 1WVWA 2IZSA 1YW2A 2X6EA 4CV8A 1REKA 3CTHA 4GCJA 2J0MB 3DLZA 5CT0A 3Q9ZA 4H1MA 5ANDA 5EW3A 3SDJA 4NWMA 3EFWA 3AOXA 4TTHB 1YOJA 3ENHA 4P4CA 1YXVA 5HEZA 3V5JA 4AGUA 5GZ8A 1YWVA 2UZWE 3TIZA 4FE2A 4E5AX 4S31A 4MF1A 3ITZA 3P4KA 3PXQA 3SOAA 2G1TA 4NM0A 3ZO2A 5L6OA 3D5WA 4UWYA 2Y6MA 4BWXA 2VZ6A 2W96B 1WBTA 5E90A 2QKWB 4QO9A 4X2FA 5BNJA 3HUCA 3F7ZA 3IGOA 4Q9ZA 4PMMA 2W4KA 2UZNA 1WVYA 4RT7A 5EI6A 2F7XE 3R28A 3MVLA 4DTAA 5IPJA 1GIHA 2EU9A 3NIZA 3ZS5A 3RWPA 4DEEA 3QCYA 2OK1A 2P0CA 1CKJA 3C51A 3GC9A 3L9PA 4HGTA 4YURA 3QTRA 3NR9A 4QYHA 5BYZA 5IUIA 4AGWA 1SYKA 3NNVA 2EXEA 3PSBA 3R7OA 4IM0A 5GNKA 3VULA 2ZV9A 4YJVA 2PY3A 1FGKA 2WD1A 3DDQA 4GL9A 3U51A 2W99B 4OAUC 4U81A 4ITJA 2X39A 4ANMA 3A4PA 2VTNA 4EK5A 1PMNA 5D7AA 4F7NA 1S9IA 5EDPA 2YISA 1QMZA 3BHTA 5DR9A 4ID7A 4XG3A 4RZVA 3OT3A 3ZDIA 3QKLA 5AV2A 2YA9A 5I5ZA 3F3TA 4IQ6A 4FNXA 4B9DA 4XUFA 2XS0A 4J53A 3MV5A 5KCVA 1H24A 2WTVA 5HNGA 4GU6A 5AM6A 1JSUA 5DT0A 3KULA 5JT2A 1P4OA 5HD7A 4AT4A 4O7SA 3RJCA 2VO0A 3LFFA 4C4FA 5CF8A 3G51A 4X3FC 2VTHA 3LXLA 3UG1A 2IZTA 2JEDA 4FSYA 3TKUA 4E26A 5KMMA 1Q8ZA 4ONAA 1RW8A 4MNEA 3C50A 2WPAA 3G5DA 5HNBA 2BAQA 2V62A 2V55A 3FKOA 3EHAA 3QD2B 1YDTE 3B8QA 2P4IA 5IMXA 1URWA 1JVPP 3P7AA 4AZTA 2V7AA 3VUGA 4USDA 3LMHA 2ONLA 3U9CA 4FEVA 4S30A 4EONA 3ZDUA 2UZBA 4JS8A 3R63A 3TEIA 3TDWA 4O7VA 1SNXA 5L6PA 4FX3A 5I9VA 3Q4CA 4YC6A 1YDRE 3O8UA 4O84A 4S32A 4IX5A 3EZRA 3TV6A 3VHKA 4BDGA 5JQ8A 3LVPA 3Q4UA 3V51A 2XF0A 3ORKA 1CM8A 4C59A 2UW4A 1YWNA 3AQVA 4XBUA 1R78A 4FICA 3TL8A 5K5NA 4APPA 2PL0A 5DRBA 4U41A 4YGAA 1B39A 3MESA 1Q8YA 4DTBA 4NZWB 2C30A 4NW5A 3RPRA 4LMNA 3TNHA 4UN0C 5AJQA 1KOBA 4NCTA 3Q9XA 2UW5A 3A7GA 4BI1A 3F69A 1JWHA 1UV5A 4QYGA 3BLHA 3HV3A 4CLIA 3OY3A 1BLXA 4QQCA 1EH4A 5E8WA 5JGBA 5IA5A 5CAPA 1OPJA 4J8MA 1DM2A 2AUHA 5LOHA 2BALA 1IA9A 3VWAA 2JKOA 2O5KA 5AP0A 3R1QA 4DBXA 3W16A 4IWQA 4KIQA 4C8BA 4RVKA 4EUTA 5E8ZA 3MS9A 5ANOA 4PPAA 3PVBA 5JMSA 1IRKA 4O0XA 5CLPA 3O7LD 4IACA 5K9IA 4HW7A 4YNEA 1CSNA 2P2IA 5JN2A 4MBJA 3LM0A 4TWNA 4WNPA 3T3UA 1J7LA 2BMCA 4CSVA 3FV8A 5EQPA 3VUTA 4EH3A 4FKVA 4FTMA 3CS9A 1SM2A 2GTMA 3F3UA 3ZHPC 3DDPA 3VRYA 3VS3A 3GNIB 3BBTB 4OGRA 3HP5A 5ANIA 4ZTMA 3RZBA 3KXXA 1V0BA 4BCQA 3KN6A 4NUSA 4J1RA 4R3PA 4I6HA 3TJCA 3HAVA 4UMUA 1DI8A 2JFMA 4MNFA 4QMYA 3D4QA 4U3ZA 5AA9A 5BPYA 1KE5A 2VTPA 2VNWA 2XKFA 2R7IA 5BVFA 2ETMA 3LFCA 4QQTA 1XJDA 4XG6A 2BROA 3VHEA 3I7CA 3MIAA 4PTCA 5F95A 3KULB 4UMTA 3H9OA 4MHAA 1YXSA 2O3PA 3V8TA 3ZLXA 4BN1A 4H39A 3FLSA 4P90A 2GS7A 4RFZA 4RIYA 4XRLA 3GT8A 1OIUA 2JKKA 4RSSA 5EW9A 5HO7A 3QRKA 3RALA 3BQCA 4BKYA 2W06A 4MNEB 4ALWA 5A6NA 1NVSA 4MF0A 3ZMMA 1RQQA 2C6EA 4J98A 4MVFA 2W0JA 2R3JA 1XH7A 1B6CB 1U54A 3DNEA 3SVVA 2WEVA 4FTNA 3A7JA 3VS5A 2R3LA 4EZ5A 1XBAA 3IPHA 4JAIA 2WTJA 1Q8UA 3VUDA 3D5UA 2QOBA 2W1CA 3VBWA 1I44A 4IIRA 2RGPA 2F57A 3KCKA 3W2QA 5I9ZA 3BI6A 4CNHA 4ZTHA 4K18A 5IA0A 2X2LA 5EYCA 4O6EA 5EHOA 2GDOA 4JL9A 4RPVA 4WT6A 1PMEA 2H9VA 2C6KA 2C5OA 2R3FA 2JLDA 3I7BA 4E8AA 2GQRA 2WO6A 3DQWA 4YTCA 1JKTA 2OW3A 3I5ZA 3PJ8A 4QYYA 4BB4A 2HWOA 4NU1A 3V5TA 2EB3A 4K33A 3ZC6A 4GFGA 5KUPA 3CE3A 4ZSEA 4PY1A 2WMSA 2NRUA 3NIEA 2YM6A 4G6OA 4K0YA 1KE8A 2C0TA 5E8TA 4BI0A 4GMYA 1PRYA 4YJOA 2C3JA 1SMHA 1ZWSA 4FL3A 3BHVA 3F2NA 4IVCA 5E1EA 3PY1A 4R3CA 2IN6A 4XV9A 3V3VA 4R7IA 3VAPA 4D5HA 3C4FA 3QA8A 4XG4A 2J90A 4K8AA 4M8TA 1GZ8A 3Q5IA 4J95A 5CNOA 4IAKA 3MH2A 3HDNA 4E73A 2RG6A 3ALNA 3ZCLA 3H4JA 4PUZA 1ZLTA 3EN4A 2C68A 3GGFA 2V7OA 4CD0A 3WBLA 4MXYA 5AR3A 3EN7A 2E9PA 4R8QA 4TXCA 4EOIA 4JAJA 3DFAA 5AUTA 5BYYA 2WQBA 2XK9A 4YJPA 4YPDA 3LAUA 3MPAA 3ZRMA 1LEWA 1SVHA 4YP8A 5HIDA 3T3VA 4UX9A 1WMKA 1Z5MA 3JY9A 1OKVA 5CU3A 3ZFYA 4AGDA 4AWIA 4FT3A 5JGDA 4ZAUA 3JR1A 2CKEA 3MY5A 5AUZA 1J1BA 4G34A 5KZ0A 3RNYA 3RPSA 5L2WA 4AT3A 1XBCA 3QZFA 3IO7A 3FPMA 1H0WA 4WNMA 3TZ7A 4CYJA 5FXQA 3UPZA 4FKGA 3WE4A 1OB3A 2J0IA 3FKNA 3NUXA 3I6WA 4RA5A 5TF9A 2IW9A 4UZDA 3VBXA 3L9MA 4I20A 2J0JA 4FKOA 1CMKE 2ITYA 1REJA 4JXFA 5FTOA 4BBFA 4RIYB 4J97A 4UBAA 3EZVA 3KN5A 1VR2A 4IC8A 4LYNA 4U40A 1YKRA 2CPKE 2Y7JA 2ZB0A 4XV1A 5AR4A 4EH8A 3HGKA 4JIAA 4EK6A 2R3RA 1ZY5A 2PHKA 4YR8A 3TNQB 1NT2A 2Y4PA 3Q6WA 5IQDA 4Q2AA 4Z55A 4EK8A 4UMRA 4L6QA 4USEA 2ITQA 3MFTA 4FTJA 1L8TA 1U54B 2FYSA 3EWHA 3G9LX 3ZO3A 4PP9A 4QP3A 2DUVA 4H3QA 4OAVB 4ANQA 3EQCA 1OIQA 4E7WA 1GIIA 2ITUA 2QOQA 5FP5A 3NYNA 5E91A 4JG8A 5B2MA 5KMIA 1ATPE 2GTNA 2WMTA 2XA4A 3OTVA 4BBEA 4YO4A 4H05A 3QD3A 1ZMUA 1P4FA 1WBOA 2XMYA 3GU8A 2X7FA 4FIJA 4F0FA 3F5UA 4YHFA 3GU7A 2VWBA 3GBZA 2ITWA 4QMUA 1V0OA 1RDQE 3BRBA 2QODA 2ZV2A 3KMUA 4X3JA 4QMNA 2OFUA 4JIKA 2GHLA 2I6LA 4OR5A 2OIQA 4EKLA 3CKXA 3EQBA 1B38A 4YPSA 1H1RA 4E4XA 4FZFB 4B4LA 3L8XA 2WTKB 3RVGA 2QO7A 3GOPA 2UUEA 2B52A 4UXLA 3AG9A 3UG2A 4HYIA 3DKOA 2J0KA 4BBMA 4KBCA 5M07A 5AUXA 5ACKA 5FXSA 3EKNA 3U6JA 3QTIA 4CV9A 4FEWA 2QO2A 4X2NA 2B9JA 3POZA 4B8MA 2YIYA 3R8VA 3PLSA 4FC0A 3HP2A 4OTGA 3KMMA 2IVTA 3N9XA 4AW5A 5CAOA 3GEQA 3JVRA 5DGZA 5T6KA 3KQ7A 3VJNA 2P2HA 4E6AA 1APME 2X81A 4L45A 3G15A 2I0VA 3PJ3A 3V5WA 3F82A 1ZRZA 5LVLA 1J7UA 4FKSA 5TR6A 4K9YA 1J7IA 1IR3A 1PXKA 2OIBA 3HYHA 2AC3A 3WIGA 5CASA 2Q83A 3BHYA 1U59A 4OTFA 4CFXA 4XH6A 4XBRA 3KGAA 4CT1A 3UVRA 1I09A 4FV8A 4AZFA 4ZZNA 5IH5A 2PMOX 5FDXA 4OTHA 3QTXA 3W2CA 3G0EA 3I1AA 4DLIA 1FPUA 2WQEA 3EOCA 3ETAA 4IJ9A 3ROYA 2QOKA 4LOPA 4E4NA 4F0GA 4KUJA 3DTCA 4AW0A 3PRIA 1FMOE 2GQGA 2BZHB 4DBNA 2PVNA 4BCOA 2O65A 3MH3A 5A4EA 5CI6A 3IDPA 5ETCA 1K9AA 5GHVA 4JT3A 2DQ7X 4HYSA 4TT7A 4HVDA 3CR0A 3DGKA 4D0XA 4RJ8A 4NT4A 3FZPA 2OIDA 5DA3A 5M55A 2JDVA 4KB8A 4RC3A 5D11A 4LV8A 4FUXA 1YVJA 5L8JA 5M4CA 2ONLC 4V01A 2XB7A
chains in the Genus database with same CATH superfamily
1GNGA 4XLIA 3SOCA 2Z60A 3QHRA 3DB8A 2HZ4A 4QT1A 2IWIA 2OJGA 4G6LA 4LRMA 3QWJA 1MUOA 2Y6OA 1OECA 3Q04A 5J95A 1CDKA 2JIUA 2PUIA 2PMLX 3FLZA 4F1OA 3UZRA 1R3CA 4ANSA 4WHZA 2C4GA 3MB7A 4OTQA 3MB6A 4MQ1A 2X2KA 3HX4A 3ZTXA 2DYLA 3DV3A 3VONA 2VTAA 4TNDA 3DKFA 3KRJA 3BWFA 5KMLA 3LLAA 3PDTA 1YOMA 4E20A 3OCTA 2JC6A 3F7WA 4Q9SA 4ACDA 4GUEA 3RHKA 4NCTC 2RFSA 1W2DA 3AC3A 5L6WL 4Y72A 4E6CA 5FEDA 2YM7A 3CKWA 3O8PA 4DGOA 1QPJA 1YDSE 3ELJA 3COHA 4LG4A 2XUUA 4LRJA 2QOFA 3LCDA 4FTLA 4BGHA 3KK8A 4CMTA 4F09A 4BCJA 1Q4LA 2J2IB 3VW8A 4C0TA 4ZY5A 5LMKA 3OEFX 2HYYA 4QMWA 4TYEA 4YZBA 5LCKA 4ASXA 3DXNA 4MWIA 3PFQA 4UMPA 4QEBA 3IQ7A 4FKUA 5BYLA 3BKBA 2UW6A 4QYFA 4CZTA 1Y8YA 3DBDA 4JVGA 5FM3A 5HIBA 3IW5A 2FSLX 4EWHA 3DAEA 4FTUA 5IZFA 5LMBA 1VLRA 2X4FA 5KBQA 4BDDA 4DFNA 2FUMA 5LVOA 3FI8A 2O8YA 3E8DA 2VWWA 2W1ZA 4RZWA 4AZVA 3HV5A 1UU3A 3W10A 3BZ3A 2WFYA 4YJTA 3G6GA 3R9HA 4QMXA 1T46A 4AU8A 2WMVA 4E4MA 2ITZA 3LIJA 5C26A 3LKMA 4CZUA 3UIMA 4ACHA 5LQFA 2WAJA 2YAKA 3K3JA 2CCIA 5TT7A 2PUPA 5K0XA 4XG8A 3E62A 3QQKA 3ZFMA 3ZZEA 4NFNA 1JSVA 1SVEA 3O23A 4IM3A 4MAOA 4OBPA 2X0PA 2WIPA 3SXSA 3TT0A 5EQEA 3F66A 4BRXA 5I3RA 4RWJA 4Y8DA 2PZ5A 5EHYA 1PXNA 3WF5A 3TZ8A 3R7EA 3R73A 1QPDA 2J51A 3PJ2A 4IBMA 4ZTNA 1KV2A 4AT5A 4DAWA 5HU3A 2QOIA 4O0SA 1JKLA 2RKUA 3BEAA 4FTRA 4QTCA 5EM5A 2HAKA 5HE3A 4FIHA 4O91A 3ZYAA 4DH5A 2UVXA 2ZDUA 1TKIA 3NUNA 3PZHA 3ODYX 3QZGA 3GOKA 2JDSA 3I79A 5HOAA 4OTDA 3PUFC 4XG9A 1ZXEA 5E7RA 3N4TA 3G0FA 4YSMA 3F88A 5C27A 4G3FA 4FTAA 2YLFA 1A9UA 4I0TA 4ARKA 4E1ZA 4C57A 2W5BA 3QRIA 4I23A 2Z02A 4FR4A 2AYPA 3UDBA 3VS0A 5J9YA 4ANBA 3GC8A 2WU7A 4B8LA 4PDPA 1PXJA 1VYZA 5BV3A 3F5PA 3NX8A 4R5YA 3MY0A 4KINA 5AUWA 3GCQA 2QU5A 3GXLA 3KU2A 3QGYA 4GT5A 3OG7A 4NTSA 3KXHA 1PXLA 4JQ8A 3RP9A 4BDHA 4HVIA 1VEBA 5KMKA 3OWJA 3UZTA 1W8CA 5AUVA 4AW1A 3NYOA 1ZAOA 1KSWA 4Q5HA 5IG1A 2CN8A 2VO6A 2EB2A 2W9FB 4PMSA 2GHMA 3I81A 4F7SA 4RQVA 4AAYA 4WG3A 3FPQA 5T3QA 4AXFA 1TQMA 2YIXA 3LXPA 1Q97A 2XARA 3UP2A 2WTKC 2XNEA 3I0QA 3R9RA 4HPTE 2PVLA 3OTUA 1UVRA 3QUDA 2F7EE 2Y0AA 2GMXA 4R7BA 2C5XA 3D7TB 3AGMA 2OZAA 2XNNA 1XH5A 4JBVA 3ANQA 4D4VA 4JDJA 2XAMA 3DZQA 4BZNA 3JPVA 3KEXA 4I6FA 2YCRA 5CQUA 2GU8A 3NUYA 3C4XA 4LUDA 4YJSA 3LJ2A 5C8KA 2NP8A 2Z7QA 1UKHA 3FAAA 4M68A 1WVXA 3PVWA 5AV4A 3R7GA 4JBPA 4L46A 4ASDA 1JBPE 5BMSA 1ST0A 5KE0A 3UNZA 3LFSA 3TTIA 1XMMA 4WSYA 2C6IA 1O6KA 2VO7A 4GS6A 2B7AA 2CLXA 5IEVA 4BZDA 3MYGA 4DN5A 2UW3A 3W0QA 5M08A 4FV6A 3OOGA 3F9NA 3GCUA 3QF9A 4IMYA 2ERKA 4C02A 4C3RA 5L2SA 3UE4A 1FVRA 2UVYA 4D55A 2XJ1A 4PDSA 2R3NA 4HNFA 5J9LA 4I0RA 1JQHA 3RM6A 2A98A 3PE2A 3D0EA 5HHWA 2PULA 5H8GA 4QMSA 5DH3A 3S0OA 5C8NA 3TKHA 2P3GX 4E93A 3W8LA 5D7VA 3UPXA 2XNMA 2HW7A 2H34A 5LJJA 5E8VA 5EYDA 5LXMA 3PFYA 2BVAA 2O0UA 2VGPA 4YMJA 4PDOA 4CGAA 3WF9A 4PNIA 5K5XA 2VTRA 2ACXA 4MXZA 4DEDA 4B7TA 3QQJA 4BZOA 3D2KA 4FV2A 2OJ9A 5HTCA 4U8ZA 4G9CA 1BUHA 2HK5A 2XNBA 4IAIA 3ZXZA 4BIDA 3MVHA 4F08A 3ATTA 3NGAA 3P5JC 3FKLA 4HCVA 2C6LA 5K0KA 3R21A 5LCJA 1ZZLA 1HOWA 4YZDA 4D2VA 5CALA 3VBYA 4PX6A 4C38A 4K1BA 3ZUVA 1J3HA 1ZYJA 2HCKA 3QD4A 1X8BA 3CGOA 4CRSA 4NW6A 3R04A 3VIDA 5EDRA 4FSWA 4LGGA 2VTIA 4MQ2A 4NM3A 3PP0A 4M12A 5B0XA 3UIUA 3Q3BA 3QQUA 4QMOA 4BDFA 3BYMA 5HD4A 5DWRA 3MJ1A 3B8RA 4YNOA 3CY2A 3HRCA 5JH6A 3FI3A 3TNPC 2I1MA 4FKIA 4EI4A 4WRGA 4C34A 3R8ZA 1H27A 3PVGA 4NL0A 2UW0A 4NK9A 2YITA 5DVRA 3POOA 4LV5A 4W9XA 3QL8A 4FSMA 3Q60A 4KSPA 3NW7A 4BDIA 4GRBA 5CXHA 3FDNA 4BY9E 1H26A 3AD4A 3M11A 2YN8A 4EOLA 3DS6A 5CQWA 5FEEA 4BWPA 5I4NA 4XOZA 3VC4A 3F3WA 5J87A 4C61A 3FLQA 1E1XA 3FZ1A 4O2PA 1M52A 4D1XA 1W2CA 5A14A 2OZAB 4O21A 5ANJA 4DH7A 3VUMA 4ERWA 3FLNC 4KA3A 3GC0A 3H10A 1E9HA 1UU9A 2O64A 4IVAA 4RWKA 2GNIA 4YZNA 5CAUA 2YJRA 2XCHA 4C4HA 2WMRA 3FXWA 4I94A 3ERKA 4ZSJA 4AGCA 2UZDA 5DMZA 1E1VA 3BYUA 3QCXA 3RCDA 3D2IA 3TJDA 5M56A 2JD5A 2OKRA 3THBA 5E9EA 1H25A 3CJFA 4A06A 1PW2A 2R5TA 1FVVA 5IA3A 3DPKA 2OF4A 5I9WA 3O5AA 4ZS4A 5ANGA 4Y73A 3DK3A 4MEDA 2A2AA 3RAHA 4DFBA 2X6DA 2XP2A 3NZ0A 4K77A 3VBTA 4C33A 3FL4A 3QXOA 1HCKA 3S95A 4DFXE 4EOQA 5KHXA 1ST4A 1MRYA 1ZYSA 4FV9A 2R0IA 5CF6A 3NFFB 4IAFA 3ATSA 3UTOA 5AUUA 1Y6AA 4BHZA 3EIDA 5BVDA 5CU4A 3ACJA 3PSCA 4K11A 4TPTA 3LLTA 3RGFA 1XH8A 2G9XA 5AX9A 3GFWA 5HESA 3ZM4A 1H4LA 4U3YA 2YFXA 4AS0A 2GNFA 3O7LB 4O83A 4O1PA 4PPCA 4KNBA 3OBJA 5G6VA 4EJNA 1H0VA 3QRTA 4DGLC 4N4SA 5FDPA 3T9IA 3DLSA 2BR1A 4WBOA 3ID6C 3LHJA 3Q53A 5J5SA 2YIQA 2LAVA 4EOKA 5EI2A 2JIVA 4X0MA 4PL5A 5KHWA 1OL7A 3F2RA 4OTIA 4F9YA 4DEHA 5AV1A 2B9IA 3ORLA 3AC8A 3FMMA 4U7ZA 3ZUTA 3GFEA 3IKAA 1Q8TA 1F5QA 5B2LA 4NM5A 4NH1A 3MA3A 3HAMA 2XK7A 1OIYA 5CZHA 4JLCA 5AV0A 3SRVA 1BX6A 3PTGA 4YLKA 2GFCA 4J71A 1H01A 2ITVA 2B55A 3KA0A 2BIKB 4IZAA 2VTOA 5KMJA 4ZLOA 3KRLA 4ITHA 3Q32A 2XIXA 3DTWA 5HE1A 2PVJA 4FBXA 4EUUA 3U4WA 5CXZA 3LM5A 3LCOA 2YDIA 3OW3A 1KOAA 3Q2MA 3TNIA 4F1MA 3AMYA 4S33A 5K4IA 4GFMA 4X6RA 4DHFA 4GG7A 4KRDA 3LXNA 2XNOA 4IX6A 4IH8A 5DI1A 3CIKA 3EQPA 5CVHA 3WF7A 3PIYA 3P79A 5KKRB 1A48A 5L2IA 5HO6A 3IW8A 2CLQA 4FT7A 3DJ7A 1Q99A 4K2RA 2BKZA 4TWOA 5HGIA 5L2TA 2OG8A 5DR6A 4U45A 2J5EA 4MWHA 5LMKC 4GK4A 3Q4TA 5ETIA 4QP1A 4BKZA 5HVYA 4O0UA 3A2CA 4DINA 2UVZA 4W4WA 1ZOEA 3EN6A 5HBEA 2UW9A 2QR8A 2ZMCA 3OEZA 4F64A 4OT6A 1PF8A 3KF4A 4IW0A 2DS1A 4EHEA 4MTAA 2F2UA 3OW4A 1LR4A 2YWPA 3HMNA 3JVSA 3FY2A 2YIRA 1IG1A 2WMAA 3FI2A 4FL2A 3IONA 2CMWA 2G2FA 3W55A 2XM8A 3CQEA 4U80A 5AP5A 2X8DA 3EFLA 4NTTA 3W2PA 3ORXA 4I5HA 4PWNA 4O82A 3VS6A 3SG8A 1STCE 1CKPA 1IEPA 3ZU7A 2WHBA 5AIRA 4XG2A 4CTCA 3D83A 3DBFA 4D4YA 4P2KA 3QTSA 3QA0A 4BDCA 3S2PA 4F63A 4PMTA 4FZDB 5HTBA 2YZLA 4BVUA 2OXYA 4RQKA 3NYXA 2WTIA 2A27A 4A9UA 4FGBA 4CLJA 5FBNC 5DN3A 4MX9A 3G2FA 4EOOA 4LDTA 3QLGA 4IE9A 4PRJA 1H1QA 3UO5A 2YCFA 4DGNA 2BAKA 2C5YA 2QO9A 4ZS0A 4E6DA 2X7OA 3PXYA 2OF2A 4CKIA 3DA6A 2R0UA 2VV9A 3MY1A 1WCCA 1W84A 3E7VA 4OW8A 4O38A 4S34A 2LGCA 1ZMWA 3QYZA 2PK9A 4HJOA 2VD5A 4YLLA 4YJNA 3HMIA 4C4GA 3L9LA 5IA4A 1SVGA 1YQJA 2C47A 2HW6A 3HUBA 5HICA 4O7WA 4AXEA 4QPSA 4BCKA 5IH4A 4FIFA 3R30A 3JS2A 3F3VA 1FOTA 2WELA 3HZTA 3TZMA 4PL4A 1LEZA 5IUHA 3SRVB 3FL5A 5HTIA 3U9NA 1CTPE 1H00A 2WU6A 3VS2A 4R7HA 2VTJA 4MD9E 4BF2A 3MIYA 3FC1X 4Z7HA 4P5QA 4ZLYA 4FODA 5CEMA 3RAWA 3QQLA 3OROA 2FH9A 1M17A 4G3GA 3QBNA 2XKEA 5AR5A 5G1XA 1FQ1B 4N6YA 4RVMA 3NUAA 3R9OA 5IDNA 3OWKA 4NJ3A 4HPUE 4KBKA 5AWMA 2NRYA 2ZOQA 3QX4A 4HYHA 4G17A 3DQXA 4LRKA 4D1ZA 1T45A 2GPHA 1NXKA 2OI4X 4IZ7A 3NPCA 4FRFA 2XNGA 4H3PA 4ZY6A 2PVKA 3S00A 4RMZA 4GT3A 5DFPA 4AFJA 1VJYA 2XKDA 2ZJWA 2GNHA 2Z7LA 4I5PA 2ESMA 5KO1A 4NYEA 4O7TA 4HZRA 2XH5A 4RLKA 3VQUA 3TM0A 3N4UA 1W83A 1H1PA 5M4UA 4CCUA 4EC8A 3IDCA 5DPVA 2ZM1A 2GHGA 3OVVA 4A9RA 4I21A 4EBVA 3R8UA 3L1SA 2E9NA 3PXFA 2PVFA 3OC1A 4ERKA 4BR3A 2RL5A 1MQ4A 3SHEA 4F9BA 3N51A 4HGLA 2IW8A 3RK9A 1XBBA 4N0SA 5EM6A 3TUBA 3BLQA 2WQMA 5HG8A 3OXTA 3LFEA 4I4EA 1PXMA 3O96A 1OM1A 3MH0A 4L7SA 3FZSA 3OD6X 3QTQA 2PSQA 3KMWA 4F78A 3BHHA 3DK7A 4ZTRA 5KZIA 4LV7A 3QQHA 2XIKA 3OUNB 2FVDA 1JKSA 2R3PA 4MXXA 4WO5A 1OUYA 3SW7A 4FA2A 2VN9A 1M2PA 5TO8A 2O63A 4L68A 4IB0A 2XJ0A 3OT8A 3NCGA 4EH9A 4RFMA 1M7NA 3MDYA 4O4BB 2Y9QA 1KE6A 3KRXA 3HMPA 3NAYA 3ORNA 4GYGA 3RZFA 1KUTA 3A8XA 3KVXA 5IMEA 5F1ZA 3PYYA 4QP8A 3MTLA 4E4LA 4X2JA 2VRXA 3GU5A 2VX3A 4WG5A 4BIEA 4BJJA 2PZRA 1KE9A 1NA7A 2VTSA 2PE1A 4WNKA 3VQHA 4CVAA 4BTMA 5K4JA 4W8DA 3R7VA 4XNEA 4KRCA 5ANKA 4KIOA 5FGKA 1L3RE 4EC9A 5F9EA 3IW4A 4HOKA 4FGRA 1Q5KA 2J5FA 4QMVA 5IQEA 3R2YA 3NYVA 3ZFXA 3E8CA 5JFWA 5DT3A 5C9CA 2WQOA 5JKGA 3PLAE 4GKIA 4ENXA 1PMUA 2EVAA 5AP2A 2BILB 2QG5A 3O0GA 4LM5A 3PA5A 3BE9A 5B2KA 4HVSA 5M4FA 3CQUA 5GINE 3HMOA 4EH2A 3D7ZA 2BTSA 1UU7A 2PUNA 2CKQA 4EL9A 2XJ2A 4ORKA 4E5BA 2VX1A 3KY2A 4JR3A 1OL6A 4F0IA 2FB8A 3C0IA 4A9YA 1ZY4A 2IZUA 4I4FA 3CC6A 3GCPA 3R9DA 4R3RA 1UWHA 3FZTA 5FM2A 2Y4IB 3I0OA 5FLFA 4G3EA 3GCVA 3W0PA 2VWZA 3RWQA 5KKRC 3V5PA 3UMXA 2Y8OA 1SNUA 4FTCA 2A1AB 2HIWA 1XKKA 2YACA 3IG7A 4LI5A 3WE8A 4AP7A 1S9JA 4D0WA 5EG3A 2CDZA 1Q8WA 2XEYA 1LP4A 3IW6A 4JG7A 3P1AA 4JQEA 4W4XA 4YU2A 4EHZA 2QOHA 3OF0A 3QTUA 4FL1A 4RX9A 2WMBA 1LPUA 1AQ1A 1YXTA 4FMQA 4KAOA 1ZZ2A 3P08A 4U42A 3COMA 3REPA 1CKIA 2QVSE 5GJDA 3V5QA 3NVKI 3PA3A 4BDJA 4L3PA 4TNBA 5A4QA 4FV0A 3MBLA 4R77A 4RIXA 2QHMA 5BVWA 3DBCA 3PP1A 2BZIB 3GUBA 5L3AA 2P55A 1ZYDA 1TVOA 2A0CX 3QFVA 4FSZA 3QC9A 2NNWB 2AQXA 3MVMA 4GEOA 4DCAA 4DFYA 2Z2WA 4YZCA 3AGLA 3EH9A 4JBOA 3V8WA 4CCBA 3LJ1A 4AE9A 4RX5A 2BRBA 2R3IA 3DT1A 3G33A 4JI9A 3KL8A 2ZDTA 5LARA 1NVRA 4BWKA 4DLJA 3GCSA 4QMLA 5JFSA 4FOCA 4XV2A 5AM7A 4L01A 5IA1A 3BL7A 2VO3A 3BGZA 3BYSA 3DBEA 3L8PA 2OFVA 4AOIA 3WYYA 2PZYA 3CBLA 4LFIA 4I6LA 1J1CA 3UMWA 2BUJA 2PZIA 3AXWA 3ET7A 3ORIA 3AD5A 3UDSA 3ZUUA 3KKVA 5TOZA 3UP7A 1H07A 4DG2E 3R8PA 2QLQA 3F5XA 2XBAA 2VTTA 2JAMA 5CVFA 2C0OA 4EEVA 3WF6A 3DKCA 3LFQA 5ICPA 4IX3A 3TKIA 4I3ZA 2JBOA 1ZYLA 1GZOA 3DJ5A 3RTPA 1OL2A 2EXCX 4JMQA 3NNXA 4QP7A 2BPMA 3A7FA 2R2PA 4ZTQA 3FXZA 3ZEPA 3ROCA 4C4JA 5HX8A 3E64A 1OGYA 4BJJB 1WBSA 5JQ5A 4WKQA 5E8SA 5FBOA 3MFSA 4AACA 5C03A 3V01A 1PKGA 3HL7A 4ZTSA 5HG9A 5DEWA 4FSNA 3MW1A 4FNZA 5L2QA 4GIIA 5J1VA 4IWOA 4MXAA 3WZJA 1OL1A 3GP0A 4FG9A 4IB1A 4EOSA 3QXPA 2V0DA 5C4KA 1H1WA 1UWJA 2V22A 5AV3A 3FZOA 3PA4A 3PPZA 1V0PA 3L8VA 2R64A 2YCSA 4BCIA 3OWPA 3MN3A 1UU8A 2ZMDA 4ZSLA 3UO4A 3W18A 1IAJA 4GKHA 3KXNA 5M06A 4YSJA 5I9XA 4GK3A 3RM7A 3EQRA 1IA8A 5JSMA 2X4ZA 1P5EA 4XEYA 1OBDA 5HVKA 3UDTA 3OCBA 4DFZE 4FTIA 3KXZA 3UC3A 3UYTA 4CQEA 2QD9A 2CGVA 4EH5A 3D7TA 5IF1A 2V5QA 2CKPA 3H30A 3D14A 4YHTA 4B99A 4BDKA 3ZRKA 3H3CA 1R1WA 2JDTA 3HA8A 4LOQA 2DWBA 4UALA 3UOJA 3ZSIA 5CSWA 5HX6A 4NKAA 2IO6A 3I4BA 4ZIMA 2IJMA 3LQ5A 1WBVA 4I0SA 4FT9A 4IWDA 4UYNA 5DR2A 3TDVA 4EHGA 4DFUA 4IB3A 3CD3A 4HCTA 2WMUA 4H36A 2QKRA 3NUPA 4LUEA 4FVRA 4JX7A 4MH7A 3FHRA 5HKMA 2HZ0A 4DCEA 4PNKA 3Q2JA 3S4QA 5IQAA 5AP4A 3D5VA 3KRRA 3QWKA 4RIXB 3OFMA 4C35A 4CKRA 2P33A 4GH2A 3NRMA 4A7CA 5CX9A 3CTQA 2IVVA 2F9GA 2BCJA 3A4OX 4I41A 5HE2A 4I22A 1G8SA 4Y5HA 2NO3A 4C7TA 5CF4A 3FUPA 4EZ3A 4DA5A 2BZKB 2WTDA 3MI9A 2QHNA 4FV1A 4M3QA 4MKCA 4NJDA 4FSRA 3W32A 5KX8A 4HCUA 2YDKA 4JDHA 3IOKA 4RJ4A 2YM3A 4RC2A 4ZJJA 2WTCA 3AT2A 2OICA 3EMGA 3ORTA 4QTDA 4IZYA 4DEBA 5J8IA 4EQCA 4ZSAA 3CPCA 2YCQA 5IQHA 2Z7SA 4AZWA 3RK7A 4BTFA 1ZOGA 4OTPA 4XP2A 5IEXA 4RX7A 4BCFA 4WOVA 2ITNA 5ETAA 4YUQA 1Y6BA 4XLVA 1YI4A 4RC4A 5EOLA 3P0MA 3VO3A 3TUCA 3FEGA 1WBPA 5CEQA 4O27B 3DFCB 3VUHA 3FQEA 4EQUA 1H1SA 3UVPA 3VF8A 4I92A 4L67A 5HVJA 5A46A 1JPAA 2C3IB 5A9UA 5J9ZA 1MRVA 5HORA 3PIXA 3FLWA 3AKKA 1Q61A 4FTTA 5M09A 4OTRA 4ANNA 2XAOA 1WAKA 4A07A 4A4XA 4ITIA 3WARA 2YJSA 4QTBA 2W9ZB 3FMKA 3V5LA 3FSKA 4BCHA 1MRUA 5H2UA 3DCVA 1ZMVA 3RPOA 2HWPA 2FA2A 2B9HA 4NKSA 5CSXA 5FXRA 5EQYA 4EJ7A 1PHKA 3C4WA 4E3CA 2UZTA 4BC6A 3CXWA 3ORZA 4RGJA 2W17A 4FF8A 1GAGA 2Y4IC 4G3CA 4JNWA 3TNWA 2A4LA 3KF7A 2OBJA 2OWBA 3DY7A 3LCTA 5HQ0A 1NVQA 3ZOSA 4I1ZA 4CFFA 4V05A 3QKMA 4QP2A 4F6SA 2GSFA 3BV3A 5JFXA 1ZOHA 4GT4A 3EQIA 4F6WA 1O6LA 4PV0A 4ASEA 3UBDA 3GB2A 5IEYA 2OXDA 3R83A 2VNYA 4QMTA 4UEUA 2HY0A 3EQFA 2YERA 3NS9A 3R00A 2YWVA 4O86A 2OH4A 4FVPA 5HCXA 2C6DA 4Z7GA 3VBVA 2IW6A 5CEIA 4I6QA 5CANA 1OKYA 3BWJA 2HZIA 4OBQA 2R4BA 5FRIA 1A06A 4XG7A 4A9SA 2WXVA 1Q41A 3QZHA 3MPMA 2CGWA 5EHLA 4QD6A 2J50A 1XHAA 3CP9A 1UNLA 3PY0A 3VW6A 1O9UA 1G8JA 1BL6A 1VZOA 3QAME 4M14A 2I0EA 3PSDA 4FKWA 2JGZA 3QQFA 4PL3A 5JZNA 4ZMFA 3QTZA 4QP9A 4M66A 4FKPA 4X6QC 5HCYA 3ULZA 1GY3A 2UV2A 5A4TA 3RNIA 2F2CB 1RE8A 4RVTA 5C1QB 1W0XC 3CCNA 5JFVA 3LFAA 1WZYA 3JYAA 1YXUA 4NIFA 5T68A 1SZMA 2JKQA 5I9YA 2CJMA 3PUPA 2IEWA 4ZOGA 5L8LA 2XK4A 4QTEA 4B6LA 5FTGA 5BUEA 1K3AA 3C1XA 2I40A 3EL7A 3ZLWA 4UMQA 3PPJA 2A19B 1YHSA 2H8HA 4BKJA 4F70A 4HZSA 1Q3DA 4W8EA 4AG8A 2YZAA 3GU4A 3NW6A 1XR1A 4U44A 5I0BA 3RCJA 3F61A 4MYGA 4JDKA 4TZRA 3W8QA 5AIKA 4GK2A 3BHUA 3LXKA 4L00A 3W33A 4B0GA 4GVAA 4BYJA 4G3DA 3DOGA 1K2PA 4DHJA 1XWSA 3C4CA 4G5PA 1OL5A 3MA6A 1JKKA 4ENYA 3B2TA 3EKKA 4FEUA 4DF3A 4BDEA 4Y95A 3OCGA 4O4CA 4QP6A 2YDJA 4UYAA 4U9AA 4GUBA 5DBXA 5HLWA 2CGUA 3SLSA 3KK9A 4CFVA 3BYVA 1W82A 3UC4A 4G16A 1U46A 4O22A 4D28A 4D9UA 4F1TA 4C2WA 4OTWA 3E3PA 3RAKA 3PWYA 3C13A 4OLIA 3MH1A 4D2TA 4TRLA 2WIHA 1VYWA 2I0YA 4IM2A 4EK4A 2OJIA 2XK8A 3VBQA 1BL7A 2GCDA 4LGDA 1YHVA 4GSBA 4A4LA 1R0EA 4CFMA 3FBVA 1OKZA 3OXZA 5CWZA 5IQBA 5JRSA 3UJGA 4DEGA 3WZUA 4DE4A 3COIA 5DNRA 1YI6A 3BPRA 3D9VA 1NY3A 3SGCA 1PKDA 3A7IA 2ZFYA 3P9JA 4Y5QA 4FZ6A 4FV3A 4C62A 2BDFA 1V1KA 3WZDA 3C9WA 3LOKA 3V6SA 4MXOA 2R3OA 3RKBA 3NNUA 3PE1A 5CZIA 3R22A 2XK3A 5F4NA 4BHNA 4DT8A 4FI1A 3SD0A 5CU0A 3AC5A 2W4JA 4AW2A 3FE3A 3MPTA 5DHJA 5EM7A 3KXMA 3RPVA 2OU7A 3PRFA 4NEUA 4O7ZA 3VJOA 4R1YA 2VWIA 3G6HA 4WG4A 1G8KA 2XEZA 5M44A 2CN5A 2WGJA 3FY0A 3N4VA 2G15A 4F9AA 2IVSA 4CRLA 2ZB1A 3FMEA 4QMPA 4HVGA 5JK3A 4RVLA 5EM8A 4ASZA 2W1HA 2NPQA 3H0YA 2E9OA 4GYIA 4FJVA 3UVQA 4WD5A 5A6OA 3UO6A 3ZSGA 4UWBA 2BIYA 4AA0A 2QCSA 5AMNA 3PG3A 4FVQA 3DAKA 2PMNX 4PF4A 3V6RA 4FV7A 3DAJA 3EN5A 4IWPA 4NIFB 5BVKA 1OBGA 1LUFA 2IZRA 2X0GA 3U6HA 2JBPA 5M4IA 4YZMA 4CFNA 5HO8A 4EORA 2JAVA 5IDPA 3NVMB 1QPEA 2RFEA 4FT5A 4GG5A 5AX3A 3SW4A 1AD5A 3SXFA 3TACA 5CS6A 4CYIA 4E5WA 3DB6A 2FO0A 3S1HA 5E8XA 3Q5ZA 5A4LA 2QQ7A 1YI3A 3BCEA 4FIGA 2OZOA 4ZZOA 5AAFA 3U55A 3C0HA 3NNWA 3BEGA 2BAJA 2BRMA 2W7XA 3ULIA 4E6QA 1XH6A 3IS5A 4RJ7A 4XJ0A 3TIYA 1XH4A 4FG8A 4YZ9A 1QL6A 3RINA 3ORPA 3L9NA 3NW5A 4CQGA 3O2MA 4AX8A 1Z9XA 2B53A 3FYJX 3NUUA 4G1WA 3WZKA 3CGFA 3QKKA 4JQ7A 3B2WA 5IKWA 3R8MA 4WBBB 3ACKA 5E8UA 2FGIA 4USFA 2ZM3A 1FINA 2FSMX 3OUKA 3OXIA 3P7BA 3Q6UA 4V04A 5CSPA 4UV0A 4YJRA 4KIPA 2YABA 1Z57A 4QQJA 5HLPA 3DKGA 5GZ9A 3NUSA 4MBLA 4C3FA 4F4PA 1P2AA 4PTEA 4QNAA 3QUEA 3BIZA 5D41A 4FK6A 3GC7A 3VUKA 4C37A 5IISA 4O7NA 1RJBA 2EUFB 5IQCA 3K5UA 4V0GA 2RG5A 3COKA 2G2HA 2X8EA 4IVBA 3OOMA 2CNQA 4XP0A 2ZYBA 3ANRA 2OH0E 3CJGA 4D1SA 2WMXA 5J1WA 2ITPA 3CTJA 2WQNA 3E5AA 5AP6A 2ITOA 1TZDA 3FXXA 2E9UA