3TNHA

Cdk9/cyclin t in complex with can508
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
321
structure length
288
Chain Sequence
VECPFCDEVSKYEKLAKIGQGTFGEVFKARHRKTGQKVALKKVLMENEKEGFPITALREIKILQLLKHENVVNLIEICRTSIYLVFDFCEHDLAGLLSNVLVKFTLSEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLITRDGVLKLADFGLARAFSNRYNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLALISQLCGSITPEVWPNVDNKVKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWSDPMPSDLKGML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cyclin-dependent kinase 9
publication title The CDK9 C-helix Exhibits Conformational Plasticity That May Explain the Selectivity of CAN508.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 80
structure length 288
sequence length 321
ec nomenclature ec 2.7.11.22: Cyclin-dependent kinase.
pdb deposition date 2011-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3tnhA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3tnhA01
4TW9A 1YVJA 5EQPA 3R7UA 4AQCA 3N4TA 2JDOA 1OL7A 3W1FA 2VTMA 4R6VA 3ZDUA 4AZFA 4BCPA 4FV8A 1YHSA 3QQFA 4M67A 3PJ1A 3RMFA 2I0HA 2R3LA 3UVRA 4E6DA 4RG0A 3PXKA 4FX3A 4TRLA 4FKJA 2Z7QA 4GIIA 4UB7A 3EQIA 3LJ0A 3P79A 5GJDA 4BZNA 3AMAA 3PSDA 3KEXA 3W8LA 2B53A 4J52A 4LUDA 2YITA 3WF7A 4BCNA 4ZMFA 4GSBA 3QQLA 1TQPA 3FZTA 3FMEA 4IIRA 5D12A 3FI3A 4YNOA 4RFMA 4OLIA 4M7IA 1NVQA 4U6RA 4AZEA 3ZFMA 4M12A 3PXFA 3ZHPC 1NW1A 1OUKA 1ZOHA 3LIJA 4PMPA 4M84A 1WBPA 2H34A 4XG8A 3QBNA 3ANQA 3D7ZA 5D41A 5M4UA 5L2SA 1OIYA 2DWBA 5IF1A 2GNJA 3LFEA 3MFRA 3MI9A 4FA2A 2JKMA 3QYWA 4WG3A 3QAME 2OFUA 3PVGA 3UNKA 3BCEA 2PZIA 3ZSIA 3U6JA 2C69A 4ALWA 3R21A 1Z57A 3E62A 2XNGA 3WOWA 5CVGA 4MXYA 3LXPA 1YXXA 4EHVA 1DI9A 1OIQA 2XNOA 2QURA 4GYIA 3CTHA 4UMTA 4GIHA 3UYTA 4RMZA 4RIXB 3EIDA 3WI6A 4H1JA 4FSZA 4QMWA 4ANOA 2C0TA 2VWXA 5GZAA 4O7WA 3PXQA 1URWA 3C13A 3BZ3A 3UJGA 3OOGA 5A4LA 3IKAA 4G2FA 3LCTA 2QU6A 4ACMA 3NAYA 4FE2A 3BV3A 5A46A 4F65A 4LRMA 3ZOSA 5KBRA 5IA3A 4QMTA 4GG7A 3OBGA 3DB6A 4R8QA 4L42A 4U5JA 3ZUUA 3R83A 3UMWA 4FKOA 3R28A 5HBEA 3ZBXA 3ZO4A 5CY3A 3D7TA 4YJPA 4I23A 3IS5A 1YDTE 4CCBA 1LEZA 2X8EA 5KHWA 1V0BA 2YERA 3DZQA 4I0TA 4UEUA 4ANSA 4PPBA 4OAVB 4BDKA 3LW0A 4FSRA 2YLEA 4PDSA 1HOWA 5A6NA 2ZM3A 1ZZLA 5IEVA 4WSYA 4I0RA 2XH5A 2F2CB 4S33A 2H8HA 3G9LX 1V1KA 2P2IA 3FMHA 4NIFA 5C9CA 2QR7A 4R3CA 2BCJA 4D2TA 2CN8A 4USFA 4L01A 3R30A 2QOOA 4L8MA 5HX6A 5AUUA 1Q24A 1ZARA 3F9NA 3P1AA 3KULB 4FL1A 3EN5A 3MY1A 2QHMA 3GC0A 1CKPA 4FKRA 3VVHA 4AS0A 4BZDA 2GU8A 3OXTA 4GKIA 4EOJA 3GB2A 1LR4A 3QC9A 4G6OA 5IA5A 4C3PA 4Y5QA 3Q9ZA 3GQLA 1JAMA 4HVIA 4WG5A 3UZPA 2WOUA 3NYNA 3VS7A 5ANIA 3W2RA 4BWXA 5CNNA 3UE4A 2IO6A 4OBPA 4E8AA 3NPCA 4D0XA 3FXZA 4L52A 2UVZA 1OL1A 1Q4LA 4C3FA 4ONAA 1MRUA 3Q4ZA 4XS2A 2J51A 1URCA 3K2LA 2J90A 3U87A 1PXMA 4ERWA 3H9OA 4WBOA 2C5VA 1XKKA 4AX8A 2XK7A 3BHYA 4ZY5A 3GU6A 4I4FA 5FEEA 3UO6A 3HAMA 2XK6A 4QTAA 1PKGA 4YPDA 1L3RE 4O0VA 4W8EA 2P55A 2QLQA 4FBXA 4QTDA 4ZK5A 4BVUA 4KKHA 4U0IA 2WMRA 3ZLWA 3DXPA 2E9PA 4N6YA 4C35A 2VNWA 2W4JA 5EKNA 4HNIA 4DTAA 2IZSA 3FLQA 1JLUE 4BTKA 4ZTLA 3ZO2A 2G15A 2V0DA 3CGOA 3EH9A 1Q99A 1B38A 2XKFA 3ET7A 4I3ZA 4MWHA 3V5PA 4BDGA 3OZ6A 1IASA 4X2KA 1JSUA 4YTCA 3ZM9A 5AV3A 5AM7A 2ETKA 1WBOA 2XJ1A 1XH9A 3OP5A 3GU7A 2C6IA 2ITQA 3I6UA 4C4JA 3RKBA 5FXQA 4MF0A 4R1VA 2ITXA 5IQIA 4FSYA 4R3RA 4IAZA 5IQEA 2W05A 4UZDA 4FGRA 4I5HA 4O1PA 1S9IA 3C7QA 4DH8A 4EJ7A 1BLXA 2XIXA 1R0EA 4AUAA 4XYFA 5T68A 3DJ7A 3CCNA 3TN8A 3BU6A 2YEXA 3D5VA 4QTEA 4NFMA 4O7RA 3F2AA 4LL0A 4CKJA 2BIYA 4AOIA 4MQ2A 4AA5A 1PMEA 3K5VA 4CFUA 2QO7A 3IGOA 4TN6A 5FWKK 3CC6A 4XP2A 4O38A 3HNGA 4MX9A 3ZUVA 5GIOE 2YIYA 3CXWA 4H39A 4PP9A 5CZIA 4TPTA 3VUMA 1U54B 5HQ0A 4KIQA 5L8LA 3VO3A 1O6YA 4IW0A 3PG1A 3NIZA 4KIKA 2NP8A 3RZBA 3V6SA 4AU8A 2YCSA 4CTBA 3DK6A 4FSUA 4BBEA 4FG7A 4FG9A 1PF8A 2C5OA 3ZRMA 3CR0A 3UG2A 5ITAA 4PDPA 3PG3A 2VTAA 2YA9A 2VU3A 4ZTRA 3UVQA 3PA3A 3DV3A 4PMSA 1W98A 4CV8A 3UP2A 2WMVA 3DS6A 4OTIA 4BB4A 3D83A 4ALUA 3QGYA 2UVYA 3AC3A 3LCOA 3FKNA 3LHJA 4DG3E 4DFUA 4E1ZA 3C0GA 4C4FA 3TL8A 3VUKA 3COIA 3A7JA 3L8SA 3RINA 4D9UA 5JZNA 3A4OX 1W8CA 4JDIA 5IUGA 1BKXA 4QMXA 4IJ9A 4IB0A 3DK3A 2GS6A 3FMKA 3O8PA 4JR3A 4D5HA 2X4ZA 3ENMA 2XB7A 3V3VA 3W2QA 3NYOA 4BCFA 5KUPA 3QKMA 3ZDIA 2J0MB 2OJJA 5AP5A 5F1ZA 2JKKA 3R8ZA 1ZYDA 4HYUA 1G8SA 2QC6A 5JN2A 3P0MA 3E8DA 3PA4A 3U4UA 4BFMA 3M2WA 4EOQA 5J9LA 3PP0A 3NVMB 3KA0A 5HIEA 3FYJX 1YDSE 2YIXA 2I1MA 3CTJA 5CF4A 5HOAA 4EOIA 4R7BA 5AMNA 4BCJA 5IZFA 1WCCA 4L53A 3ORXA 4EBVA 2UZOA 2JITA 5FDXA 4MNEB 5CENA 3VUIA 1PXPA 3E93A 2JKOA 4U8ZA 4IM0A 4PX6A 3RVGA 1ZRZA 4FNYA 4ANQA 3O17A 4DH1A 4CEGA 4A4XA 5HLNA 3CLYA 2P33A 5CEIA 3CGFA 3PP1A 4XG2A 3MJ2A 3FQSA 3KXNA 4X3FA 2PMIA 4E4LA 1XQZA 3ERKA 4FKVA 2EXMA 3PRIA 1LPUA 3NUNA 4D4RA 4APPA 3G33A 4E5BA 4EOOA 1WZYA 3IDBA 3NW6A 3OOMA 4NM7A 4ACDA 3BGPA 1YDRE 4Y73A 5L6WL 4UY9A 4AT4A 4A9YA 2C5XA 4GU9A 2R0IA 3O23A 3Q4CA 3UG1A 5HTIA 4HGEA 5KO1A 4RWKA 4JS8A 5AIKA 4C4EA 2BIKB 2ZOQA 1EH4A 2XBAA 4EZ5A 1CTPE 2J0KA 3BLRA 4JBOA 1Q8ZA 3BV2A 3F3UA 3BX5A 4XOZA 3EKKA 4XHKB 2BZIB 3F5UA 5EM6A 4O0XA 4FMQA 4HYHA 3CKXA 4ZAUA 2OZOA 1PMVA 1SVHA 5C4LA 3RWQA 1JVPP 4EC9A 2C0OA 4D2WA 3BELA 3ZUTA 2FSLX 3EYGA 4AA0A 2B1PA 5DFPA 4L68A 3MGYA 2YM3A 4FF8A 4RIOA 5FEDA 1RJBA 3PXZA 4RJ6A 3ATSA 1M2QA 4KWPA 5FUTA 4RA5A 3JUHA 2OIQA 2ZB1A 3PE1A 4XV2A 4ZJJA 4C33A 1JNKA 2VZ6A 3FZSA 5DIAA 2ETRA 5BYLA 1HCKA 5CF5A 3LVPA 5D9HA 5GINE 4RJ5A 4HGLA 2R3OA 5CSXA 5E7RA 3R9OA 1A9UA 3F2RA 1IG1A 3CTQA 4HGTA 3TZ7A 4BN1A 2UV2A 2J0LA 1S9JA 4LGGA 1JSVA 4LRJA 2WTDA 2HENA 3EB0A 4FKWA 4RZVA 3HV3A 3R63A 2W1IA 4CFVA 5K4IA 3Q2JA 5I9ZA 4RPVA 3NNWA 1Q8TA 2JEDA 4L3JA 3MWUA 3PUPA 2JDRA 3PFQA 4WOVA 5CSWA 2W99B 2QCSA 3AG9A 3VS6A 4ORKA 2FUMA 3KXMA 3WF8A 4RX5A 3LFBA 4C4HA 3F6XA 4YJUA 4YZNA 3E63A 2X2MA 3ZZEA 4YSMA 3GVUA 4KBKA 3LFQA 4QP2A 3QKLA 4CVAA 5T3QA 1XH5A 4YBJA 5EI6A 2EWAA 3WIKA 5IH4A 3R04A 3QD4A 2CN5A 3ZSGA 5EM7A 4F09A 1XBCA 2VTHA 2PMLX 4AOJA 5C8NA 3MFUA 3R8LA 4JDKA 3BBWA 2ERZE 4H3PA 4MK0A 1YI4A 2BR1A 3DXQA 2ITNA 3ORZA 5CVFA 4NYEA 4MD8E 4UYNA 4KS8A 4BCGA 2YAKA 4ZSAA 2PUUA 2OO8X 4JRNA 3IQ7A 4UMPA 5HBJA 3G6HA 1XBBA 3AQVA 3VUTA 5AP6A 4EH9A 1YOMA 4O7VA 4L3LA 3NW7A 2XCKA 2HZ0A 3BQCA 3OFMA 3QQHA 4DH3A 3TDVA 4RWJA 4HPTE 3S4QA 5IQCA 2WKMA 3Q4TA 4P4CA 2WD1A 3A7GA 5J95A 5JFSA 3QU0A 4I5PA 4F1MA 3EQGA 5CS6A 4BDFA 1YXUA 3FSFA 2OICA 2W17A 5L8KA 5KHXA 3PA5A 4FEUA 1IRKA 2B9JA 1BUHA 2JDSA 2YCRA 5CF8A 2PVHA 4GKHA 4Z7GA 4IX4A 4J7BA 5JSMA 3UO4A 2PK9A 2OSCA 4F9CA 3UZRA 3DBDA 4QPSA 2B9HA 4H05A 2RIOA 4E4XA 1E1XA 3BBTB 3FXWA 3CJGA 4X3FC 2BTSA 2XK3A 2AC5A 3HYHA 3UMXA 3UTOA 1B6CB 4FYOA 1SM2A 3B2WA 5DG5A 1TQIA 3GFEA 1M2PA 3KN5A 3Q9XA 2YM7A 3RM7A 2WELA 1SMHA 3QRUA 3UGCA 2R64A 4EZ7A 1UNLA 2PZRA 3FLYA 3WE8A 2VUWA 4IQ6A 4J98A 3PVUA 3F61A 3RM6A 4DEEA 2KTYA 3JVRA 4M69A 5JKGA 4PMMA 3F69A 1BMKA 1YW2A 1YWNA 3N4VA 4FIJA 1R39A 5LVOA 3G0FA 4BBMA 3E87A 4RVTA 1Z9XA 2XIYA 4XRLA 2C6MA 2XBJA 2Y4IC 3AMBA 3BIZA 4E5AX 1XO2B 2G2IA 2ITTA 5KNJA 3LM5A 4IANA 2JIVA 2WMQA 4LMUA 4X2FA 5AUZA 2VGOA 2VTSA 3NYVA 4HW7A 2VO0A 2XA4A 2IZTA 3PSCA 3HVCA 2FVDA 5EHLA 5CU6A 5AP1A 1V0OA 3I0OA 4O0SA 1IAJA 2X1NA 4IAYA 2ITOA 3E7OA 4S31A 4F1TA 3PZEA 5CNOA 1OKZA 4IAIA 3A7HA 2IZRA 3PZHA 2FA2A 4AG8A 3TM0A 1KV1A 5BYYA 5L4QA 2UZTA 5HE3A 4WO5A 2PUNA 4CZUA 3C9WA 2J5EA 4A4LA 3BHTA 3MB7A 2C0IA 2JFMA 5AV0A 2WXVA 4E26A 5LVMA 5CAQA 4R7IA 4R7HA 5DH3A 2FH9A 4G17A 2RFEA 5FBNC 3KMMA 3DOGA 2NPQA 4L7SA 2BRHA 3TKHA 5A4QA 3WYXA 4A9SA 4PPCA 4BDJA 4BIBA 3PJ8A 2WMTA 4GUBA 3V8TA 3DCVA 4XP3A 3OF0A 5E91A 3VRYA 3EFJA 3RHKA 3QA0A 1H1PA 2A0CX 3A2CA 4I1ZA 4L44A 4TYHB 3UC3A 4QNYA 3R8VA 5CAVA 4PWNA 2R3RA 3PVBA 2GSFA 2XKCA 2G2HA 3IO7A 3MS9A 4O6LA 4OTWA 2GHMA 3CBLA 2XEZA 3QD2B 1ATPE 2V62A 4AW5A 2CLXA 3HP5A 2ZAZA 4WRGA 5HZNA 4U41A 3R7GA 4HZRA 4FTOA 3NS9A 5BVFA 3GFWA 2ONLC 3OEZA 3DBQA 3FXXA 5ETFA 3EMGA 4P90A 4TY1A 5B2MA 4H3QA 3M1SA 5HCZA 2FSOX 2QG7A 3EN9A 2JAMA 4OT6A 4JT3A 4TT7A 4YHFA 3L9NA 3P7BA 5FP6A 3IGGA 2F7XE 2CCHA 2HIWA 3FV8A 3GCUA 4XV3A 5HE1A 4QRCA 4KUJA 4O7ZA 1YKRA 3Q52A 3DY7A 2QKWB 4PTGA 4CFWA 4EOSA 4I22A 5TO8A 2IW9A 4EL9A 2OKRA 3U4WA 5FP5A 4YZDA 4ZEGA 5F4NA 4ZLZA 5M4CA 1ZXEA 4OAUC 2JIUA 4DFYA 1JBPE 5BVWA 3NZ0A 4QYYA 3WZUA 4AXAA 5BVOA 2E9VA 5CXZA 3TWJA 1U4DA 2GNIA 5EI8A 2R2PA 3CPBA 4WNMA 2OG8A 4XCUA 3C4FA 2CHLA 3ZXTA 3G9NA 3KU2A 2AYPA 4XV9A 5I0BA 5HG7A 3BLQA 3CY2A 4FNWA 3JXWA 4AGDA 3W10A 5F95A 1OECA 3PYYA 4KSQA 5HGIA 3SRVA 2A4LA 3COHA 3F7WA 3R02A 4NTSA 2B4SB 4Q2AA 4WHZA 5FEQA 4C7TA 5LCJA 5C27A 3KMUA 5G6VA 3UIUA 2VNYA 5AAEA 4G3CA 3MSSA 4BWPA 2WQBA 1CDKA 3KY2A 3LZBA 3FMMA 4G9CA 4O84A 2B55A 4FVRA 5DE2A 5HE0A 3SOAA 3ZEWA 4FTRA 2IVTA 2WO6A 3U9NA 4CMOA 4QQTA 3FY2A 2QO9A 5JZJA 4H58A 3T8OA 5BVEA 1OPJA 4FT0A 3OCTA 3BE9A 5C26A 1ZYJA 2GPHA 2PHKA 3OY3A 3RJCA 4F9YA 2LAVA 4QMLA 3SV0A 1GZKA 4F6WA 1ZY5A 1KE9A 1W84A 5EDPA 4L67A 3QCYA 3MH2A 5DVRA 3V04A 4TYJA 4IVBA 4IB3A 4UMRA 3VBTA 2PZPA 4I94A 4L45A 1U5QA 3TTJA 4QP9A 3R2YA 4FZ6A 4C2WA 3ATTA 2UZUE 5EDRA 3PJ3A 4G9RA 4OR5A 3QRTA 4ZOGA 3E5AA 3LFCA 1PY5A 4IHPA 5AUXA 4FKUA 4EUUA 3QQUA 3PWYA 5D7AA 4BIDA 3FZRA 4BKZA 3CQWA 4JQ8A 3N51A 1WVXA 4KSPA 3IW4A 2C30A 3HV7A 2VX1A 4DG2E 5HX8A 2VO7A 4EK8A 2WPAA 2ZJWA 3I79A 2ZMDA 3AGLA 3ELJA 5J7HA 1GZNA 4BIEA 2IPXA 1WVWA 1YXSA 4DHFA 3NUAA 4O0TA 1P4FA 3P23A 1J7UA 2I0YA 4NM3A 2P0CA 4EORA 4DEAA 3NMUF 3QQKA 3Q2MA 4IBMA 1UVRA 3F5PA 4EK4A 4PPAA 2QONA 4GT3A 5HIDA 2UW9A 3PVWA 4I92A 4WIHA 3VQUA 3FMNA 5JQ8A 1OPKA 4IDVA 3V5LA 3ROCA 3QX4A 2HZ4A 1GIIA 3K3JA 5EHYA 1ZYCA 4K0YA 3OBJA 2C4GA 1PRYA 4NH1A 3V01A 2OZAA 4EK6A 4ZLYA 4NT4A 3QWJA 5EH0A 2WMBA 2ITUA 3QCXA 3OTVA 5CASA 5TOZA 4IVDA 1Q97A 4ZZNA 3UQFA 2PTKA 3VJOA 4IWPA 2HW6A 2WZJA 1OL2A 4QP1A 3KF4A 4I20A 2PE1A 3DGKA 2C5YA 4HYSA 4ZTNA 3EQFA 3K5UA 2Q0BA 4DLJA 3U54A 3L9PA 3DDPA 3KVWA 3E92A 3BU3A 2OW3A 2X39A 4RJ8A 4AE6A 5A4EA 4APCA 3S1HA 3DK7A 5J5SA 5BVKA 5KKRC 1RDQE 1OITA 5AR3A 5ANJA 2B0QA 3C4EA 1FOTA 3OC1A 4HOKA 4QP3A 4RFZA 3VBWA 1XH8A 3ZLSA 3EFWA 4EHEA 4A06A 4AN3A 1DS5A 2XRUA 3RK5A 3NUUA 1CSNA 2OH0E 3DPKA 4LMNA 4DGGA 4E6QA 5HLWA 3NAXA 4HVDA 3S95A 1H08A 2YM5A 3QHWA 5B7VA 5TT7A 5BX0A 2VO6A 4EI4A 4E5WA 3UNJA 1P2AA 4ASEA 5KX8A 2W96B 5LJJA 3GCQA 4C38A 4O27B 4AW2A 2XP2A 4UWBA 4DGNA 4FEVA 4QYEA 2QLUA 2VV9A 4GCJA 3MW1A 2C1BA 3UZTA 5DRDA 3LOKA 3TTIA 2X8IA 4X2GA 3I5NA 3DKOA 3JYAA 2W1HA 3QWKA 4X7QA 5DT0A 5HO7A 2CNQA 3IW8A 3PY0A 3N4UA 2Y4PA 5KZ0A 3CPCA 2CNVA 3EHAA 4TKSA 4ACHA 2C3KA 3EYHA 3IW7A 4J96A 4C59A 4DEGA 4EHGA 4CRLA 4YHJA 4Y8DA 3WF6A 3TKIA 4Z7HA 4U42A 2PVFA 1ZMUA 2R7IA 2WTIA 2O5KA 4KKGA 4B6LA 5GJGA 4DEHA 2IVVA 2F57A 4IWOA 3UOJA 3UIXA 4CG8A 2UZVA 3QLGA 3ZO3A 3OY1A 3II5A 3NRMA 5HORA 4IM2A 3NCGA 4K77A 4KIPA 3SDJA 3VS3A 4BWKA 4BICA 1BYGA 3TG1A 2ERKA 2C6DA 2ZVAA 5CVHA 4A9UA 5LMKC 2OLCA 3D14A 4FV5A 4RIXA 4WUNA 2WAJA 4F08A 4M0ZA 5AUWA 3EN4A 5K9IA 1BI8A 5HIBA 4AFEA 2E2BA 3QYZA 4MBIA 4X6RA 5B0XA 3R7EA 5JFVA 1JQHA 3LJ1A 4D4YA 4DGLC 4B99A 5JFXA 3UIBA 2F7ZE 3QTXA 4AAAA 4GJ2A 3OS3A 3HMPA 2PL0A 3CD8A 3EL7A 2BAJA 1OBGA 4E20A 4DG0E 2UZNA 3TNPC 3AXWA 3N9XA 4C37A 1R1WA 2I0EA 2FO0A 1SZMA 2REIA 3C4CA 3D7TB 4FUYA 4LG4A 3HX4A 4NCTA 5LVLA 2VWIA 2QHNA 2OFVA 2XIRA 5IQGA 5GIPE 5CU0A 3HMMA 5HVKA 5FTQA 3TACA 3D15A 2RG6A 3LQ5A 3EFLA 3LFSA 2CLQA 2R3MA 3QQJA 1SNUA 4FZDB 3OUNB 4YO6A 5FRIA 2VWYA 3HA6A 4NIFB 1BL7A 3MPMA 3V8SA 4IZ7A 4WG4A 3C51A 2C6OA 4KD1A 3VJNA 5CEOA 2HOGA 5D7VA 3I7CA 4U79A 2ITYA 3QUDA 4QOXA 4FODA 5IU2A 3V8WA 3UDBA 5JQ5A 5G1XA 4MXOA 2ITPA 3UVPA 5AA9A 1GJOA 3KXXA 4FV1A 4QD6A 4PY1A 2W5BA 4CFNA 2XK8A 4ZS0A 4BR3A 3V6RA 3LMGA 1L8TA 2XUUA 2X7OA 2QODA 4ZMEA 2O63A 3V5WA 3R00A 4ZSGA 4JRVA 1OIUA 3ZBFA 5CTPA 3C5UA 4IB5A 1Y6AA 5CU3A 3EQRA 3QQGA 3DTWA 5CEQA 4EH3A 2BZJA 2XNBA 4PUZA 5EI2A 2RG5A 3ZEPA 2XK9A 3TNWA 5HE2A 3QRIA 5KMLA 3FC1X 3D9VA 5CAPA 3TV7A 4PRJA 1XBAA 3T9IA 3DKGA 3FI4A 4JVGA 5HCXA 2VAGA 5LXMA 4OTHA 3S0OA 3KQ7A 3NW5A 4DFZE 3IDPA 3NUYA 3FL4A 4EC8A 2GQSA 2C3JA 3LXLA 4GMYA 4ZSJA 5BMSA 5JK3A 5M57A 3TUBA 3FC2A 4W9XA 4IM3A 4MD7E 3OWJA 1YOJA 4YLLA 4O96A 3R01A 4FKSA 4IACA 4K2RA 5CT7A 5HG8A 1UNGA 4FT7A 4BCOA 4GVJA 3A99A 1H0VA 4WKQA 5DR9A 2UW6A 1X8BA 2W4KA 4RQVA 4OW8A 4UMQA 1QPEA 3LE6A 1OZ1A 4JG8A 4ERKA 3U6IA 5DA3A 3R9RA 2IN6A 3FLWA 4C57A 2VTIA 1A06A 4FTCA 5C8MA 3UC4A 3A8XA 2PUPA 3KREA 3AT2A 4BDEA 4I93A 4YC6A 4BI1A 4QMPA 3O0GA 3ORIA 4EQMA 4FICA 5CF6A 2XCHA 4M15A 3KN6A 3BWJA 2HZIA 3EL8A 5HO6A 2F2UA 4YLJA 4BGHA 4ZLOA 5T6KA 4IWDA 4FG8A 3SX9A 4QMVA 4FT9A 2EU9A 3LAUA 2YWPA 1Y57A 4M66A 4Q9SA 4X0MA 4PNIA 5AR4A 3P7CA 2ZYBA 3QUEA 4L9IA 5I3OA 4EZ3A 3IOKA 2VTJA 5H8GA 4ZY6A 4RJ3A 3AD6A 4EKKA 3G2FA 2EXEA 4O0YA 2VWWA 4Q5EA 2WQMA 4DEBA 4E93A 2R9SA 5LOHA 3R8MA 4CQEA 4Q9ZA 5CEPA 4AFJA 3W2PA 5J7BA 1IR3A 4NSTA 1UKHA 1WVYA 4JL9A 4DEDA 4JIKA 1IA8A 3KXHA 3LM0A 5FTOA 4C34A 4CQGA 4F99A 4HCUA 3TIZA 5L2WA 3FI8A 1TVOA 2O0UA 4I41A 3DBEA 5CU2A 5ANGA 5K5XA 3JVSA 5I4NA 2ZM4A 1KOBA 4IB1A 4BI0A 4NCTC 1JWHA 3MFTA 4G6NA 2YN8A 4YJRA 2C3IB 3DNDA 5J9YA 5JGBA 2FSTX 3ID6C 3VHKA 1Y6BA 4N70A 1PYXA 2QR8A 4QTCA 3BHVA 1H24A 3RPOA 1OKVA 4FEQA 1STCE 3IK3A 5E90A 4RIYA 3ACKA 2RSVA 4ZSEA 3R8PA 2OF4A 4O2PA 2NRYA 3VULA 3TJDA 3C0HA 5EG3A 4GEOA 4NUSA 3NNVA 1Y8YA 5HU3A 3GP0A 3OCSA 1OB3A 3NDMA 3U51A 3R7OA 1SYKA 3QRJA 4C61A 2DYLA 1BL6A 5E8UA 2BUJA 5IEYA 3OEFX 1WBWA 3POZA 2WTWA 3CEKA 3HA8A 3QD3A 4EOLA 4U97A 3TCPA 3FZOA 3Q04A 4C36A 4BY9E 5CQUA 3QXOA 2W1ZA 5CEMA 4Y83A 3MA3A 1ZMWA 3CD3A 5AR5A 2GTNA 3CKWA 4ZS4A 1UWJA 4IAFA 5A3XA 5FM2A 4KINA 5M53A 3R6XA 3UOLA 3H9RA 1REKA 5JRQA 4RIWA 3MN3A 5DPVA 3WYYA 4B9DA 2RFNA 4F4PA 4TWNA 2HK5A 4ENXA 2X9EA 4MXAA 3G15A 4RA4A 2UW4A 5HI2A 3GEQA 4CZTA 1JOWB 2PWLA 2C1AA 3HDNA 3MIAA 4CNHA 3AOXA 3DBFA 5HU9A 1DI8A 1YI3A 2RL5A 3W2OA 4U3YA 4F7JA 5L2IA 3WZEA 4BCIA 5ANOA 2RKUA 2JAVA 2O65A 2OIBA 2C47A 1VJYA 2VTLA 3R7YA 4EYJA 3R9HA 3ENHA 3L9MA 2WIHA 4X3FB 5DLSA 4R3PA 5M55A 5EYMA 5K5NA 3GC7A 2HXQA 4QMYA 2Z60A 3O7LB 3I5ZA 1A48A 5I9UA 3HMOA 1MP8A 3KXGA 4GT5A 2WB8A 4QP8A 2R3NA 3DZOA 4LGHA 3MJ1A 5C4KA 2F7EE 4BCHA 3W33A 5E8ZA 4C2VA 3R1NA 2GS7A 4XUFA 4TWCA 5DNRA 4YJOA 3BYMA 3VBYA 4EH4A 4TL0A 1AQ1A 1ZZ2A 4RGJA 3R7VA 3R9DA 2CKPA 4FL3A 3OCGA 1G8AA 2YIWA 3RNYA 4DH7A 3GCVA 2X2KA 2JKQA 1M17A 5HICA 4EHZA 2GQRA 3AC5A 3OCBA 4AGWA 4O22A 4DGOA 3GU5A 4X2NA 3MVJA 4IVCA 1NVRA 4PTEA 1H07A 3PPJA 3DKCA 4I5MA 4S34A 2VTQA 4R1YA 2R5TA 5AIRA 3V5QA 3IG7A 4YZCA 4F7SA 3OT8A 2W06A 3NUPA 3WF9A 4FOCA 4JNWA 4JQEA 1MRYA 3HECA 3MVLA 4KKEA 4V0GA 4YTHA 4E4NA 3DDQA 2VD5A 5F9EA 1UA2A 1WBTA 3EQBA 4FIEA 4FTUA 4RVKA 2X2LA 2CSNA 3COMA 3W2CA 1G3NA 2PSQA 3D0EA 3OMVA 4DH5A 5CI7A 4D0WA 1Q8YA 2GMXA 3FDNA 5TR6A 4EWHA 3HV4A 2HXLA 2XZSA 3FLZA 2PMOX 3MPTA 4C02A 4YU2A 1GNGA 2C6EA 4HCTA 3RCJA 4W4YA 3DLSA 4YJTA 5K0XA 1OUYA 4JOAA 3A61A 2HYYA 4XRJA 3RK9A 2YCFA 3L8VA 4QTBA 3F3ZA 5AR8A 4GK3A 4EWQA 3TV4A 1YXVA 4BCKA 1WAKA 5D1JA 3CE3A 4FK6A 2ITWA 1O6LA 1VZOA 5AP3A 2YWVA 3FZ1A 5JRSA 3ZZWA 4EUTA 5FQDC 2W9FB 4S32A 2BKZA 2IJMA 3NCZA 5AAFA 3OW3A 4ANMA 5DR2A 4BGQA 1T45A 1OMWA 3BGQA 3QALE 3W8QA 5IH6A 3LQ3A 3DAEA 3C5IA 3ORKA 4YC8A 2Y0AA 1CKIA 4I0SA 1Q62A 4I24A 3PWDA 1KE5A 3SGCA 1RE8A 5H8EA 3AMYA 3MH3A 5E9EA 1PXNA 2BDFA 3PIXA 4EH8A 2B9FA 4WNPA 4TZRA 4XH6A 2WEVA 4FV7A 2QOKA 2GNGA 3GBZA 1I09A 3GU4A 2Z7SA 4FSQA 5IG1A 3VHEA 2GHGA 4O83A 1WBNA 4QPMA 1OL5A 2W1EA 1PJKA 4BTMA 3ZRLA 4PMTA 4BTFA 2FYSA 2BZHB 3OTUA 4ITHA 4MH7A 3DFAA 4NM5A 4BDDA 3OUKA 4HVSA 2WMSA 4FOBA 5AV2A 1OPLA 2JBOA 3L9LA 3ZFXA 3KXZA 4QP6A 1FPUA 3EFKA 4GL9A 4EOKA 4D5KA 3FLSA 3UYSA 4J53A 4FKIA 1VYWA 5GHVA 4MXCA 2QG5A 3KF7A 4XV1A 5EK7A 4XOYA 2VWZA 3CQUA 3JY9A 4ZTHA 4E6CA 5KMOA 3GI3A 3G6GA 4AZSA 3R71A 3MTFA 4EONA 5F94A 3JR1A 4J95A 4AW0A 4JI9A 2YM8A 2ZB0A 4Z55A 3TJCA 2YLFA 4GT4A 4QYGA 2DUVA 2BFYA 5E8VA 5HVYA 3NGAA 5KMKA 3KK9A 5IMXA 3IW5A 2J2IB 4MD9E 5HG9A 2PZYA 4YTFA 1JKLA 4PF4A 2XIKA 3FMJA 4M69B 3VNTA 4RFYA 4JJRA 3QL8A 4P5ZA 2VN9A 3FMLA 4Y46A 3DB8A 3REPA 5BQ0A 5FG8A 4FEWA 4YHTA 3SXSA 4CMTA 1H8FA 2YZAA 5CX9A 3Q3BA 3TEIA 2H6DA 4CZYB 4ZTMA 4F64A 4J8MA 3UQGA 1P5EA 4I5CA 5E8XA 2VWBA 3D5WA 4RSSA 2ZV7A 5CWZA 3KGAA 2JBPA 3TNQB 2XVDA 4G5JA 2I0VA 2JC6A 2HY81 3OW4A 1Q3WA 2BKKA 3BKBA 3EJ1A 4AZWA 5AAGA 4PL5A 3FKLA 1U5RA 1OKYA 3BQRA 2FSMX 1KV2A 1W83A 3E7VA 5AR7A 4PNKA 4YBKA 3ZRKA 1H28A 3HMIA 3F2NA 1NT2A 3F3TA 4FKTA 3SXRA 4DLIA 5ANEA 4LOOA 3T3VA 2V22A 3HUBA 3E64A 3GOKA 2CPKE 2X7GA 5KMNA 2YIRA 1K2PA 2X7FA 3NEWA 4MNFA 4YC3A 3P86A 3RAKA 2C3LA 2Z8CA 4IC8A 3ETAA 4FV0A 5AP0A 1QMZA 4C62A 3MA6A 5CT0A 4BZOA 4ACGA 3RPYA 4CT2A 3VIDA 1PMNA 3O71A 2HW7A 2VTOA 3RALA 3LKMA 5ANKA 4K6ZA 5FDPA 1GZ8A 1PHKA 3BEAA 2OGVA 2PE2A 2UZDA 2CKEA 3OWPA 3PIYA 5IPJA 2WHBA 4RT7A 3A7FA 2ZDTA 5IEXA 5E1SA 4YP8A 2PE0A 4M97A 5KCVA 5HD4A 4EH7A 4L3PA 4O86A 4F9WA 1FVRA 2VTTA 3DFCB 3L1SA 2EUFB 3ODZX 4TXCA 5FTGA 3TUCA 4GK2A 2G1TA 3ITZA 1GAGA 4M3QA 3E8NA 1O9UA 2V7AA 5EYDA 4F0FA 4CYIA 1Q61A 2R3JA 1FBNA 2J4ZA 4GFMA 4RVLA 4BGGA 4CCUA 2FGIA 3KRJA 4W4WA 4FC0A 3W16A 5BNJA 4J8NA 4O7SA 3SKCA 3VBQA 2P4IA 4BKYA 2J50A 2YM4A 2J0JA 3MTLA 3ULIA 4AF3A 4HZSA 1LUFA 4UMUA 4HVGA 4IVAA 3E8EA 4RX9A 4XX9A 4A9RA 3DAKA 3LCKA 4RZWA 2A27A 1E1VA 4W4XA 2GFCA 4PDOA 4LRKA 3ZYAA 3GCSA 3LMIA 4TTHB 2Z7LA 4AWIA 3CP9A 4GRBA 2OXYA 1J3HA 3GXLA 2UZBA 5GZ8A 2WEIA 3Q9WA 4IFCA 5AX3A 1R3CA 1QPJA 3C1XA 3H3CA 4GFGA 3ZSHA 4AN9A 5IA2A 4FNZA 4YJSA 5K4JA 4JX7A 5E8WA 2WQNA 4D1XA 3P4KA 5M56A 2VGPA 3ALOA 3NIEA 3PLAE 1RW8A 2PVYA 4XLIA 1ZAOA 5EHOA 4D9TA 5KKRB 3R1YA 5AA8A 5H8BA 4DAWA 4IE9A 4U9AA 2CDZA 4NTTA 5KMIA 5LVNA 3NR9A 2R3KA 3TUDA 2Y7JA 3U9CA 3S00A 4XBRA 2H9VA 4JR7A 4YSJA 4R78A 4F1OA 3I1AA 4LFIA 4DA5A 3QZGA 4HJOA 2UW5A 4TNDA 5L8JA 2EVAA 2HZNA 1FMOE 5CXHA 4B7TA 4CLJA 4D4SA 4CXAA 5EW3A 1QCFA 5FXSA 3ORLA 1JPAA 4Y95A 4FTIA 3ZO1A 4KRCA 3W2SA 4QMZA 5AADA 2WGJA 3BHUA 5HD7A 2ESMA 4F7NA 5B2KA 3QX2A 4CLIA 4FSWA 4DINA 5JH6A 3UNZA 2B52A 4JDHA 3H9FA 3E3PA 1CKJA 3KB7A 4W9WA 4XEYA 2R7BA 3VUDA 2UW7A 5J87A 2CKQA 2H96A 3VBVA 5A6OA 4YGAA 5AFVA 4F9AA 1WMKA 4E7WA 4FSMA 2BILB 1W7HA 3JY0A 4KAOA 2YJRA 1Z5MA 2PVKA 4WA9A 1PXLA 2P3GX 3VF8A 4DGMA 3PJ2A 2W1FA 4F7LA 3GU8A 4HGSA 4WD5A 3AD5A 4DFLA 4AT5A 1O6KA 3C0IA 4EKLA 3HV6A 1JSTA 2OH4A 4IJPA 5HNBA 4DT8A 1GIJA 4L00A 3GC9A 3NYXA 5IQDA 2X9FA 4ZP5A 1E9HA 3LLTA 1H1QA 4NJDA 4BDHA 2GTMA 5DT3A 5KMMA 4NWMA 5CANA 4R5YA 3SXFA 3H0YA 2PVRA 3FUPA 3NUSA 2JDVA 4CYJA 1ZMVA 4NZWB 3TV6A 4F70A 3P5KA 4CRSA 2XKDA 2PZ5A 2XF0A 3R22A 4MEDA 1GOLA 4IX3A 5KE0A 1Q41A 3FQEA 3MBLA 3RTPA 4EK5A 5JEBA 2YFXA 3O7LD 5LWMA 1OM1A 4G16A 2YDIA 4XG7A 3UQCA 3RBWA 1RQQA 2YJSA 4BCMA 3VN9A 4A07A 4ZY4A 2CGXA 2R3QA 3OXZA 4QMOA 1XWSA 4CFFA 5CSPA 3HRFA 4GW8A 4GK4A 2IW6A 4MQ1A 4U40A 3PSBA 4HPUE 4QMSA 3BE2A 2PUIA 2W1DA 2OZAB 3RAWA 3SOCA 4GJ3A 3ZXZA 2J0IA 3TZ8A 4V05A 1FQ1B 1ZOGA 4YURA 2PVNA 4RC2A 4O81A 4JXFA 3L8XA 4HVHA 3ZLYA 3PJCA 3IW6A 1K9AA 2IWIA 4QMQA 1IA9A 4BYIA 3Q96A 4QYHA 3RK7A 5EDQA 1NVSA 4OT5A 5H2UA 5IKWA 3HLLA 4FV6A 2WU6A 2BDWA 4FGBA 2F9GA 4UV0A 3FJQE 1NY3A 3MH1A 3THBA 4CSVA 2FB8A 2WTKC 2HY0A 2GNLA 2NRUA 3E3BX 5BYZA 2W9ZB 3EQHA 3TKUA 4C58A 4JBQA 5M06A 3RGFA 2WTJA 3SW7A 3UO5A 3KFAA 1ZY4A 5HLPA 3V51A 3W55A 4DT9A 5IQHA 1M14A 3FHIA 2PVLA 5J1VA 1W82A 1Y8GA 3BPRA 4ASDA 5LQFA 3AT4A 5E8TA 3KMWA 3H0ZA 5IQAA 3DTCA 4KBCA 4Q5HA 2RGPA 3D4QA 3OWLA 5E1EA 5GZ9A 5HKMA 3TNIA 1YOLA 5CAUA 4NFNA 5EOBA 5IDNA 3SQQA 3PY3A 2QOIA 1UU7A 2QOLA 3SHEA 4DN5A 4EJNA 2WMUA 4LV8A 2UW0A 3ORNA 4LYNA 3VWAA 3O2MA 3FQHA 3HL7A 5HVJA 4ZZOA 3QZHA 4FNXA 1OL6A 4RLLA 5FGKA 2IVSA 4FL2A 5TF9A 5F20A 2QKRA 5DR6A 2QVSE 4DFBA 1FGIA 4NJ3A 4LL5A 3UIMA 4A9TA 2OF2A 5BUJA 5J5TA 1OBDA 5IA1A 4JIAA 4MF1A 3VS1A 4D4VA 3A7IA 3K54A 3E88A 5M07A 3O50A 3POOA 3QZIA 4FKPA 5IQFA 4LQMA 4CG9A 1XH6A 3SD0A 3VS2A 1REJA 3HZTA 4O0UA 4UBAA 3EKNA 1H25A 1F3MC 3DXNA 2BRMA 4AP7A 1J7LA 5E4HA 4MBLA 3QTWA 4N4SA 5E8YA 4GVAA 3UOHA 4CD0A 2P2HA 5C01A 4FT5A 4FV3A 4H36A 5AX9A 4FEXA 3BU5A 5AR2A 4C4GA 2OJIA 2E9NA 1KWPA 3R0TA 1QPDA 5ETAA 2R4BA 5AP7A 4ZXTA 3T3UA 4O21A 3DKFA 2R3GA 3BYSA 3ZMMA 4F9BA 3FBVA 4A4OA 1M52A 2HWPA 4ZIMA 1KUTA 4FV4A 3Q32A 4PL4A 4EQUA 3EN6A 1YWVA 4D1ZA 2F49A 3QRKA 1UV5A 3QKKA 5AWMA 4OGRA 1IEPA 1SVEA 4LUEA 4YLKA 4ZJIA 4AZVA 4B8MA 4BBFA 4DYMA 2C6TA 2F4JA 2YABA 4YZ9A 1SNXA 2CGUA 3ODYX 5J1WA 4IX5A 3I0QA 2BHHA 3RZFA 5FBOA 3SLSA 2BAKA 3GCPA 3PXYA 2GNHA 2PVJA 3GC8A 4I6BA 2OXXA 1JKSA 2WOTA 3F5GA 4X3JA 5I9VA 2OU7A 2O3PA 3B2TA 3ANRA 2WMAA 2Y6MA 5A54A 3UOKA 5CU4A 2QO2A 4QQCA 2IW8A 2BRNA 1GY3A 2RFSA 4X21A 3FYKX 4XG6A 4BDCA 3B8QA 3KULA 3O96A 4D1SA 5AUTA 4UX9A 3AGMA 2XNNA 4EEVA 1YI6A 3PIZA 1UWHA 2BPMA 4N6ZA 4ENYA 2QOCA 4FIFA 4U7ZA 4RWLA 5IISA 5BVDA 5DEWA 4Z9LA 3QC4A 2VTRA 3EQCA 4RLKA 5C1QB 4E3CA 5AJQA 4GS6A 4YR8A 4B8LA 2X4FA 2G9XA 1R78A 2WU7A 2GNFA 3QFVA 4GFOA 2BMCA 4G6LA 4R77A 3RPRA 4BI2A 2O64A 1WFCA 4F6UA 5KBQA 4ZTSA 2UZLA 3FE3A 4FI1A 3TIYA 1YHVA 2CGWA 4P7EA 4NL0A 4YJVA 2CCIA 5DWRA 2BDJA 2X8DA 4JQ7A 4I6QA 4BYJA 3DBCA 2DS1A 4I4EA 5GNKA 5ETIA 4AOTA 4O6EA 2Q0NA 5CLPA 5HNGA 4AACA 2VO3A 3CJFA 3T9TA 5DMZA 2ZM1A 4C4IA 2B54A 4AGUA 5IH5A 5BVNA 3HP2A 3MVHA 4WSQA 5M4FA 5L3AA 4XMOA 3DAJA 3G51A 2JIIA 4AE9A 3TI1A 5HTCA 3TXOA 2R3HA 3PRFA 4QQ5A 3QTQA 3S2PA 3I60A 5M4IA 1H27A 1J7IA 3WZJA 2W4OA 4D58A 1Q8WA 3OHTA 4DC2A 2XJ2A 2C5NA 4L46A 4CMUA 5ACBC 5D10A 3FY0A 2JD5A 1TQMA 3I4BA 4O91A 4BCQA 3SG9A 5EM8A 2AC3A 3I81A 4UZHA 4KB8A 3C4XA 5TE0A 5BMMA 2BZKB 1LEWA 4U3ZA 4WUAA 4YO4A 5EQYA 4F0GA 3EQDA 3OT3A 5K0KA 1F0QA 2R3IA 3Q60A 4ACCA 2W7XA 3FAAA 3CSVA 3TZ9A 3MYGA 3VS5A 3WARA 5ETCA 4NW5A 4FZFB 2IZUA 3NWWA 3PPZA 4O1OA 2YCQA 3ORMA 2J5FA 2WQEA 4PTCA 2QQ7A 1U54A 1H1WA 5I9XA 4LGDA 4WT6A 1LP4A 3VBXA 5I5ZA 4KIKB 2Z02A 2DQ7X 4MXXA 1BX6A 2UZEA 4N0SA 3GUBA 3OG7A 4O7TA 4C0TA 2Z2WA 1G5SA 5HBHA 4ASZA 5EQEA 4NK9A 1WBVA 3KCKA 3QXPA 3ROYA 4WRSA 2BHEA 3HDMA 3R1SA 4GV1A 3MESA 2QOBA 5AP4A 5CAOA 2RF9A 2E9UA 2OBJA 4FKQA 5EOLA 2IG7A 1UNHA 5DT4A 2YAAA 5GJFA 2GS2A 4E4MA 3KRXA 3R1QA 3TDWA 3Q5ZA 4JG6A 3FL5A 4I6HA 2BROA 4RX8A 3RI1A 5IUHA 2XNMA 3MIYA 2W0JA 3DJ6A 4WNKA 4R5SA 5LCKA 5I9YA 5IQBA 1PKDA 2OIDA 2OJGA 3JS2A 3WILA 4UYAA 1JKTA 4QP7A 1KE6A 1M7QA 4HYIA 4RIYB 3U8WA 1FVVA 3AT3A 5FD2A 4KS7A 4WBBB 5LARA 2V7OA 4GU6A 3RAIA 4FKLA 2QD9A 3D94A 2XNPA 2YACA 3HGKA 3IECA 4XJ0A 4U43A 3F3WA 4DE4A 3C50A 3LFFA 2XKEA 2V5QA 3IDCA 3OVVA 4ITIA 4D2VA 4W8DA 1PXKA 2UZWE 1PW2A 3ZFYA 5H9BA 3HMNA 1OGUA 4BL1A 4EH6A 4BDBA 2NO3A 2WQOA 4AW1A 4O7NA 4BDIA 3P78A 4IZ5A 2A19B 4Y5HA 2CKOA 3L8PA 4PV0A 3LCSA 3WE4A 5AV4A 4I21A 4M14A 3FPMA 3RPVA 4MNEA 3W18A 4OBQA 4CKIA 1BI7A 1DM2A 3FHRA 4ZZMA 3HV5A 2XK4A 1GIHA 4IADA 4EH5A 1T46A 4RIWB 4EOPA 3VUHA 1OKWA 5B2LA 3GGFA 5IA4A 2GQGA 2PVMA 5I9WA 3QTUA 3COKA 4G3GA 3VW6A 5JMSA 4DF3A 1AD5A 5M51A 3FMDA 1PXIA 4FTQA 3ZS5A 4CFXA 4C8BA 1J1BA 4FTJA 3FEGA 1YQJA 4O2ZA 3TNHA 3DLZA 3F3VA 4JG7A 3SC1A 1P14A 5HCYA 2BRGA 3QTRA 4BDAA 3G90X 3UODA 5A9UA 3UPZA 2LGCA 3GT8A 3OD6X 1K3AA 4K11A 4TYGA 5HEZA 3Q53A 1B39A 5IUIA 1Y91A 5K3YA 4QP4A 4RWIA 4I6FA 3RAHA 3BYOA 2YZLA 1QPCA 4BHNA 2VWUA 4FTKA 3VS4A 2VX3A 5DOSA 3VF9A 3PPKA 5HESA 2PMNX 4D28A 3IPHA 4GG5A 3U6HA 1KSWA 5DBXA 2Y4IB 4JAJA 2UW8A 2OK1A 4KABA 4QO9A 3BGZA 3BYVA 3PXRA 4FKGA 1J1CA 1M7NA 1JKKA 4FVQA 5AUYA 4E6AA 2JFLA 3KC3A 4G5PA 1FVTA 1KE7A 1YHWA 2CMWA 1IAHA 4CKRA 4DTBA 4TWOA 3ZC5A 4EBWA 3I7BA 3UPXA 2HELA 3QZFA 2Y6OA 5BUEA 4OTFA 4YJQA 4EOMA 5JFWA 4USDA 2VTNA 3NVKI 1MRVA 3WZKA 2G2FA 3VAPA 2Z7RA 4ARKA 4EQCA 2WFYA 4OUCA 4V0GB 4FSNA 3UBDA 4PL3A 4FTAA 4ITJA 4J71A 5ANDA 2PU8A 4DBXA 4MBJA 4D55A 3O8TA 5LMBA 4FTLA 4FV2A 3PDTA 1ZYSA 2ZMCA 2WMXA 4UN0C 4UWYA 3HEGA 4PQNA 2R3FA 2BTRA 1U46A 2R3PA 3UP7A 3OWKA 2A1AB 2C6KA 2XEYA 5M44A 2XM8A 4OBOA 2VRXA 5EFQA 2RFDA 5J8IA 3FI2A 3W32A 4M0YA 4Y85A 4O0RA 4RC4A 4XG3A 1DAWA 4PP7A 4JBVA 3FWQA 3CQEA 3VS0A 2WTCA 3ZC6A 2WMWA 4NW6A 3FZPA 5KZIA 3RP9A 3LMHA 3KK8A 4UXLA 3JPVA 2UUEA 4J99A 4G1WA 2W5HA 1Q5KA 1TKIA 3A60A 5ICPA 3QTSA 5L6OA 2W1CA 3MV5A 4RJ4A 3HAVA 3LCDA 4MTAA 4AZTA 5D11A 1MUOA 3AC1A 2AUHA 2GCDA 4GUEA 4MHAA 1YWRA 2XYUA 5CI6A 5I3RA 2ONLA 3NSZA 1H26A 1R0PA 4IH8A 2JLDA 3NX8A 4O0WA 4DTKA 4S30A 5IDPA 2BFXA 4ANLA 2B9IA 3QD0A 2EB2A 3BLHA 2KULA 4JDJA 1OVEA 4U80A 4JX3A 1QL6A 5EW8A 1VR2A 2OJFE 2X6EA 4MKCA 1MQBA 4CGAA 5CSHA 4ZJVA 5DRBA 3HRBA 4YMJA 3PLSA 3IOPA 4FK3A 5FXRA 4G34A 3DU8A 3BYUA 3ORPA 3D2IA 3GENA 4KNBA 3DJ5A 1OI9A 1UU3A 4ALVA 1OIRA 5IMEA 4ZTQA 3ZLXA 4X6QC 3BHHA 3WBLA 4BC6A 5HTBA 1ND4A 2ITVA 2Y8OA 3SAYA 4USEA 3DNEA 3IONA 5FLFA 3WIGA 4XNEA 2CGVA 3PY1A 4IZYA 4YPSA 3V5TA 4MYGA 3ZCLA 2C68A 5KMJA 2XM9A 3TT0A 4CT1A 3QGWA 4H3BA 4TWPA 5DEYA 3SVVA 2WNTA 4RC3A 1KOAA 3ZM4A 3LFAA 4O7YA 2OI4X 4M8TA 4FIIA 4G3DA 4TNBA 4XG9A 3ZH8A 3EOCA 3D2KA 5J79A 2ZV9A 3A8WA 3AC4A 1M2RA 5AM6A 4BF2A 5DGZA 4FT3A 3MB6A 5A14A 3RCDA 3EZVA 3LQ8A 3F66A 3Q6UA 2BALA 4UXQA 2ACXA 5EYKA 3R7IA 4ANNA 5AEPA 1UU9A 4IC7A 1H4LA 2V55A 3FLNC 3QTZA 4UALA 4V04A 1H0WA 4QMNA 3A62A 1PMUA 3S3IA 1V0PA 4FIGA 4J97A 4DEIA 3VRZA 3DA6A 3V5JA 4AT3A 3KRWA 4O82A 5DYJA 1VYZA 3LJ2A 3LXKA 4B4LA 3RPSA 4QMUA 2CNUA 3AD4A 1PYEA 2HWOA 3QTIA 4GH2A 5CZHA 5E92A 1W0XC 1FINA 3G0EA 4DBNA 2HCKA 5HG5A 4EK3A 4K9YA 2WIPA 2GHLA 3C4ZA 4IEBA 3Q4UA 4FV9A 3MDYA 4KRDA 1MQ4A 1DAYA 2YDJA 3AC2A 4Z16A 5DI1A 3MY5A 3H4JA 4RRVA 4DCEA 4CFMA 4Z3VA 3O8UA 4YNEA 5LMAA 2PULA 3MH0A 4GYGA 2XNEA 5L2TA 3SG8A 5BUIA 4TYHA 5EW9A 4IWQA 4JAIA 3ORTA 4FYNA 3PTGA 3M42A 4QNAA 4TYEA 4XG4A 5L2QA 3GNIB 4CTCA 4D2PA 4TYIA 2XJ0A 3NNXA 4IDTA 2QOHA 4ID7A 4YZBA 3R73A 4AGCA 2PY3A 5HHWA 5BPYA 3SA0A 3R2BA 4JBPA 4ANBA 3HRCA 2JDTA 2QI8A 4M68A 4MCVA 4FZAB 2WTVA 4MWIA 4OTDA 1XHAA 3ZU7A 3RWPA 3HUCA 3QCQA 4V01A 3LLAA 2VTPA 2OWBA 4FTMA 3H30A 3H10A 4IMYA 4QQJA 2ZV8A 3PE2A 2R0UA 4QYFA 2G01A 2CJMA 4OTRA 1ZOEA 4AN2A 1GZOA 2ETMA 3NLBA 3LFNA 4YZMA 2ITZA 3B8RA 4RJ7A 2I7QA 5EKOA 1P4OA 2YM6A 3F88A 5ACKA 3AC8A 5CALA 1J91A 4ASXA 3F5XA 5FM3A 4P2KA 2J7TA 4K18A 4LV5A 4IXPA 5DHJA 2Q83A 4K33A 4KBAA 3EQPA 4Y72A 2VX0A 2XRWA 4LOPA 5HNIX 2GDOA 2NNWB 4E73A 3FPQA 3MPAA 4DFNA 4AA4A 4FZ7A 4DFXE 2HAKA 2JGZA 2OXDA 3FSKA 3CIKA 4FSTA 2EXCX 3F82A 5A4TA 3DQWA 2QNJA 1VEBA 3GOPA 1H01A 1H1SA 2Y9QA 4QMMA 3Q6WA 4D2RA 4II5A 4NM0A 3F7ZA 4L6QA 4RBLA 4B0GA 1XH4A 3EZRA 4XLVA 1Q8UA 4IFGA 1UU8A 2WTKB 3TZMA 2YHVA 3DT1A 3BI6A 4CV9A 4IAKA 2UVXA 2YDKA 2PYWA 3SRVB 3E8CA 4IAAA 3VUGA 4OTPA 4BTJA 2BAQA 3WF5A 4G3FA 4J1RA 4A7CA 4O7LA 4WNOA 3LXNA 4XP0A 4UWCA 3ACJA 1XH7A 4XBUA 5AP2A 3KKVA 4FVPA 5JT2A 2I40A 5CYIA 5AV1A 1FGKA 3KRLA 4X2JA 4G3EA 4IX6A 4KIOA 4YUQA 3QF9A 4FTNA 4MAOA 4S2ZA 2X6DA 5JGDA 4BHZA 3Q9YA 3NUXA 2X0GA 1F5QA 3KVXA 4LM5A 1H00A 3SW4A 2ZDUA 5DN3A 4U44A 3KRRA 2OJ9A 4F6SA 5C8KA 1UKIA 2XYNA 4HNFA 3ULZA 5LWNA 5E8SA 4MVFA 5EYCA 5CQWA 2IVUA 5C03A 4L43A 4MXZA 2YISA 1YRPA 4P5QA 4EYMA 5H3QA 3GQIA 3BRBA 1HCLA 2ZV2A 3LPBA 4JLCA 4L7FA 4RVMA 3QCSA 2PPQA 3P7AA 4RX7A 2GFSA 5EM5A 2BVAA 2XS0A 3CY3A 2O8YA 4D2SA 1AGWA 1Q3DA 4H1MA 4N57A 4YJNA 2W1GA 4QPAA 5IA0A 1APME 5HO8A 2A2AA 1CM8A 2QOFA 3K3IA 3M11A 4RQKA 3I6WA 3VQHA 2VWVA 3OXIA 2SRCA 3VW8A 3ZTXA 4FTTA 3Q5IA 3RHXA 4EH2A 2XMYA 4F63A 1PXJA 5LMKA 2O2UA 1I44A 2W5AA 4BRXA 3R9NA 4IZAA 5AUVA 3O51A 5TKDA 2X81A 4YTIA 3U55A 1KE8A 4LOQA 4U81A 4W4VA 3WZDA 2C6LA 4C3RA 5LVPA 3MVMA 1ZWSA 4HCVA 3QLFA 3MFSA 1NXKA 3BEGA 2J9MA 1SVGA 5M09A 4KA3A 1PXOA 3C4WA 5CEKA 1FMKA 4NU1A 5CSVA 3QUPA 4U45A 3ZONA 2QU5A 4NEUA 4ZSLA 3D5UA 3EWHA 3HKOA 4BKJA 4PDYA 1U59A 1ERKA 4DITA 3NNUA 4OTQA 5L6PA 3DQXA 4NKSA 3G5DA 1H1RA 3ALNA 1NA7A 1XJDA 2QOQA 3CS9A 3D5XA 4F0IA 5M08A 4K8AA 2I6LA 4FUXA 2BRBA 3KCFA 3FKOA 4OTGA 4NKAA 2YIQA 1CMKE 4LI5A 3QHRA 5A4CA 1YXTA 3R8UA 3EN7A 4G31A 4K1BA 4DCAA 1ZLTA 3A4PA 4QT1A 4FIHA 4FR4A 3LFDA 3P9JA 3BWFA 2XIZA 1WBSA 3MY0A 3VC4A 5J9ZA 5JGAA 3RNIA 3P08A 2UW3A 3KL8A 3OROA 2J6MA 2B7AA 2E9OA 1ZYLA 4M13A 2EB3A 1XR1A 3QA8A
chains in the Genus database with same CATH superfamily
4TW9A 1YVJA 5EQPA 3R7UA 2NYAA 4AQCA 3N4TA 2JDOA 1OL7A 3W1FA 2VTMA 4R6VA 3ZDUA 4AZFA 4BCPA 4FV8A 1YHSA 3QQFA 4M67A 3PJ1A 3RMFA 2I0HA 2R3LA 3UVRA 4E6DA 4RG0A 3PXKA 4FX3A 4TRLA 4FKJA 2Z7QA 4GIIA 4UB7A 3EQIA 3LJ0A 3P79A 5GJDA 4BZNA 3AMAA 3PSDA 3KEXA 3W8LA 2B53A 4J52A 4LUDA 2YITA 3WF7A 4BCNA 4ZMFA 4GSBA 3QQLA 1TQPA 3FZTA 3FMEA 4IIRA 5D12A 3FI3A 4YNOA 4RFMA 4OLIA 4M7IA 1NVQA 4U6RA 4AZEA 3ZFMA 4M12A 3PXFA 3ZHPC 1NW1A 1OUKA 1ZOHA 3LIJA 4PMPA 4M84A 1WBPA 2H34A 4XG8A 3QBNA 3ANQA 3D7ZA 5D41A 5M4UA 5L2SA 1OIYA 2DWBA 5IF1A 2GNJA 3LFEA 3MFRA 3MI9A 4FA2A 2JKMA 3QYWA 4WG3A 3QAME 2OFUA 3PVGA 3UNKA 3BCEA 2PZIA 3ZSIA 3U6JA 2C69A 4ALWA 3R21A 1Z57A 3E62A 2XNGA 3WOWA 5CVGA 4MXYA 3LXPA 1YXXA 1TZDA 4EHVA 1DI9A 1OIQA 2XNOA 2QURA 4GYIA 3CTHA 4UMTA 4GIHA 3UYTA 4RMZA 4RIXB 3EIDA 3WI6A 4H1JA 4FSZA 4QMWA 4ANOA 2C0TA 2VWXA 5GZAA 4O7WA 3PXQA 1URWA 3C13A 3BZ3A 3UJGA 3OOGA 5A4LA 3IKAA 4AXDA 4G2FA 3LCTA 2QU6A 4ACMA 3NAYA 4FE2A 3BV3A 5A46A 4F65A 4LRMA 3ZOSA 5KBRA 5IA3A 4QMTA 4GG7A 3OBGA 3AKKA 3DB6A 4R8QA 4L42A 4U5JA 3ZUUA 3R83A 3UMWA 4FKOA 3R28A 5HBEA 3ZBXA 3ZO4A 5CY3A 3D7TA 4YJPA 4I23A 3IS5A 1YDTE 4CCBA 1LEZA 2X8EA 5KHWA 1V0BA 2YERA 3DZQA 4I0TA 4UEUA 4ANSA 4PPBA 4OAVB 4BDKA 3LW0A 4FSRA 2YLEA 4PDSA 1HOWA 5A6NA 2ZM3A 1ZZLA 5IEVA 4WSYA 4I0RA 2XH5A 2F2CB 4S33A 2H8HA 3G9LX 1V1KA 2P2IA 3FMHA 4NIFA 5C9CA 2QR7A 4R3CA 2BCJA 4D2TA 2CN8A 4USFA 4L01A 3R30A 2QOOA 4L8MA 5HX6A 5AUUA 1Q24A 1ZARA 3F9NA 3P1AA 3KULB 4FL1A 3EN5A 3MY1A 2QHMA 3GC0A 1CKPA 4FKRA 3VVHA 4AS0A 4BZDA 2GU8A 3OXTA 4GKIA 4EOJA 3GB2A 1LR4A 3QC9A 4G6OA 5IA5A 4C3PA 4Y5QA 3Q9ZA 3GQLA 1JAMA 4HVIA 4WG5A 3UZPA 2WOUA 3NYNA 3VS7A 5ANIA 3W2RA 4BWXA 5CNNA 3UE4A 2IO6A 4OBPA 4E8AA 3NPCA 4D0XA 3FXZA 4L52A 2UVZA 1OL1A 1Q4LA 4C3FA 4ONAA 1MRUA 3Q4ZA 4XS2A 2J51A 1URCA 3K2LA 2J90A 3U87A 1PXMA 4ERWA 3H9OA 4WBOA 2C5VA 1XKKA 4AX8A 2XK7A 3BHYA 4ZY5A 3GU6A 4I4FA 5FEEA 3UO6A 3HAMA 4AXFA 2XK6A 4QTAA 1PKGA 4YPDA 1L3RE 4O0VA 4W8EA 2P55A 2QLQA 4FBXA 4QTDA 4ZK5A 4BVUA 4KKHA 4U0IA 2WMRA 3ZLWA 3DXPA 2E9PA 4N6YA 4C35A 4DHJA 2VNWA 2W4JA 5EKNA 4HNIA 4DTAA 2IZSA 3FLQA 1JLUE 4BTKA 4ZTLA 3ZO2A 2G15A 2V0DA 3CGOA 3EH9A 1Q99A 3KIOC 1B38A 2XKFA 3ET7A 4I3ZA 4MWHA 3V5PA 4BDGA 3OZ6A 1IASA 4X2KA 1JSUA 4YTCA 3ZM9A 5AV3A 5AM7A 2ETKA 1WBOA 2XJ1A 1XH9A 3OP5A 3GU7A 2C6IA 2ITQA 3I6UA 4C4JA 3RKBA 5FXQA 4MF0A 4R1VA 2ITXA 5IQIA 4FSYA 4R3RA 4IAZA 5IQEA 2W05A 4UZDA 4FGRA 4I5HA 4O1PA 1S9IA 3C7QA 4DH8A 4EJ7A 1BLXA 2XIXA 1R0EA 4AUAA 4XYFA 5T68A 3DJ7A 3CCNA 3TN8A 3BU6A 2YEXA 3D5VA 4QTEA 4NFMA 4O7RA 3F2AA 4LL0A 4CKJA 2BIYA 4AOIA 4MQ2A 4AA5A 1PMEA 3K5VA 4CFUA 2QO7A 3IGOA 4TN6A 5FWKK 3CC6A 4XP2A 4O38A 3HNGA 4MX9A 3ZUVA 5GIOE 2YIYA 3CXWA 4H39A 4PP9A 5CZIA 4TPTA 3VUMA 1U54B 5HQ0A 4KIQA 5L8LA 3VO3A 1O6YA 4IW0A 3PG1A 3NIZA 4KIKA 2NP8A 3RZBA 3V6SA 4AU8A 2YCSA 4CTBA 3DK6A 4FSUA 4BBEA 4FG7A 4FG9A 1PF8A 2C5OA 3ZRMA 3CR0A 3UG2A 5ITAA 4PDPA 3PG3A 2VTAA 2YA9A 2VU3A 4ZTRA 3UVQA 3PA3A 3DV3A 4PMSA 1W98A 4CV8A 3UP2A 3W0NA 2WMVA 3DS6A 4OTIA 4BB4A 3D83A 4ALUA 3QGYA 2UVYA 3AC3A 3LCOA 3FKNA 3LHJA 4DG3E 4DFUA 4E1ZA 3C0GA 4C4FA 3TL8A 3VUKA 3COIA 3A7JA 3L8SA 3RINA 4D9UA 5JZNA 3A4OX 1W8CA 4JDIA 5IUGA 1BKXA 4QMXA 4IJ9A 4IB0A 3DK3A 2GS6A 3FMKA 3O8PA 4JR3A 4D5HA 2X4ZA 3ENMA 2XB7A 3V3VA 3W2QA 3NYOA 4BCFA 5KUPA 3QKMA 3ZDIA 2J0MB 2OJJA 5AP5A 5F1ZA 2JKKA 3R8ZA 1ZYDA 4HYUA 1G8SA 2QC6A 5JN2A 3P0MA 3E8DA 3PA4A 3U4UA 4BFMA 3M2WA 4EOQA 5J9LA 3PP0A 3NVMB 3KA0A 5HIEA 3FYJX 1YDSE 2YIXA 2I1MA 3CTJA 5CF4A 5HOAA 4EOIA 4R7BA 5AMNA 4BCJA 5IZFA 1WCCA 4L53A 3ORXA 4EBVA 2UZOA 2JITA 5FDXA 4MNEB 5CENA 3VUIA 1PXPA 3E93A 2JKOA 4U8ZA 4IM0A 4PX6A 3RVGA 1ZRZA 4FNYA 4ANQA 3O17A 2IF8A 4DH1A 4CEGA 4A4XA 5HLNA 3CLYA 2P33A 5CEIA 3CGFA 3PP1A 4XG2A 3MJ2A 3FQSA 3KXNA 4X3FA 2PMIA 4E4LA 1XQZA 3ERKA 4FKVA 2EXMA 3PRIA 1LPUA 3NUNA 4D4RA 4APPA 3G33A 4E5BA 4EOOA 1WZYA 3IDBA 3NW6A 3OOMA 4NM7A 4ACDA 3BGPA 1YDRE 4Y73A 5L6WL 4UY9A 4AT4A 4A9YA 2C5XA 4GU9A 2R0IA 3O23A 3Q4CA 3UG1A 5HTIA 4HGEA 5KO1A 4RWKA 4JS8A 5AIKA 4C4EA 2BIKB 2ZOQA 1EH4A 2XBAA 4EZ5A 1CTPE 2J0KA 3BLRA 4JBOA 1Q8ZA 3BV2A 3F3UA 3BX5A 4XOZA 3EKKA 4XHKB 2BZIB 3F5UA 5EM6A 4O0XA 4FMQA 4HYHA 3CKXA 4ZAUA 2OZOA 1PMVA 1SVHA 5C4LA 3RWQA 1JVPP 4EC9A 2C0OA 4D2WA 3BELA 3ZUTA 2FSLX 3EYGA 4AA0A 2B1PA 5DFPA 4L68A 3MGYA 2YM3A 4FF8A 4RIOA 5FEDA 1RJBA 3PXZA 4RJ6A 3ATSA 1M2QA 4KWPA 5FUTA 4RA5A 3JUHA 2OIQA 2ZB1A 3PE1A 4XV2A 4ZJJA 3O5AA 4C33A 1JNKA 2VZ6A 3FZSA 5DIAA 2ETRA 5BYLA 1HCKA 5CF5A 3PUFC 3LVPA 5D9HA 5GINE 4RJ5A 4HGLA 2R3OA 5CSXA 5E7RA 3R9OA 1A9UA 3F2RA 1IG1A 3CTQA 4HGTA 3TZ7A 4BN1A 2UV2A 2J0LA 1S9JA 4LGGA 1JSVA 4LRJA 2WTDA 2HENA 3EB0A 4FKWA 4RZVA 3HV3A 3R63A 2W1IA 4CFVA 5K4IA 3Q2JA 5I9ZA 4RPVA 3NNWA 1Q8TA 2JEDA 4L3JA 3MWUA 3PUPA 2JDRA 3PFQA 4WOVA 5CSWA 2W99B 2QCSA 3AG9A 3VS6A 4ORKA 2FUMA 3KXMA 3WF8A 4RX5A 3LFBA 4C4HA 3F6XA 4YJUA 4YZNA 3E63A 2X2MA 3ZZEA 4YSMA 3GVUA 4KBKA 3LFQA 4QP2A 3QKLA 4CVAA 5T3QA 1XH5A 4YBJA 5EI6A 2EWAA 3WIKA 5IH4A 3R04A 3QD4A 2CN5A 3ZSGA 5EM7A 4F09A 1XBCA 2VTHA 2PMLX 4AOJA 5C8NA 3MFUA 3R8LA 4JDKA 3BBWA 2ERZE 4H3PA 4MK0A 1YI4A 2BR1A 3DXQA 2ITNA 3ORZA 5CVFA 4NYEA 4MD8E 4UYNA 4KS8A 4BCGA 2YAKA 4ZSAA 2PUUA 2OO8X 4JRNA 3IQ7A 4UMPA 5HBJA 3G6HA 1XBBA 3AQVA 3VUTA 5AP6A 4EH9A 1YOMA 4O7VA 4L3LA 3NW7A 2XCKA 2HZ0A 3BQCA 3OFMA 3QQHA 4DH3A 3TDVA 4RWJA 4HPTE 3S4QA 5IQCA 2WKMA 3BLAA 3Q4TA 4P4CA 2WD1A 3A7GA 5J95A 5JFSA 3QU0A 4I5PA 4F1MA 3EQGA 5CS6A 4BDFA 1YXUA 3FSFA 2OICA 2W17A 5L8KA 5KHXA 3PA5A 4FEUA 1IRKA 2B9JA 1BUHA 2JDSA 2YCRA 5CF8A 2PVHA 4GKHA 4Z7GA 4IX4A 4J7BA 5JSMA 3UO4A 2PK9A 2OSCA 4F9CA 4FJVA 3UZRA 3DBDA 4QPSA 2B9HA 4H05A 2RIOA 4E4XA 1E1XA 3BBTB 3FXWA 3CJGA 4X3FC 2BTSA 2XK3A 2AC5A 3HYHA 3UMXA 3UTOA 1B6CB 4FYOA 1SM2A 3B2WA 5DG5A 1TQIA 3GFEA 1M2PA 3KN5A 3Q9XA 2YM7A 3RM7A 2WELA 1SMHA 3QRUA 3UGCA 2R64A 4EZ7A 1UNLA 2PZRA 3FLYA 3WE8A 2VUWA 4IQ6A 4J98A 3PVUA 3F61A 3RM6A 4DEEA 2KTYA 3JVRA 4M69A 5JKGA 3UDZA 4PMMA 3F69A 3ML1A 1BMKA 1YW2A 1YWNA 3N4VA 4FIJA 4DHIB 1R39A 5LVOA 3G0FA 4BBMA 3E87A 4RVTA 1Z9XA 2XIYA 4XRLA 2C6MA 2XBJA 2Y4IC 3AMBA 3BIZA 4E5AX 1XO2B 2G2IA 2ITTA 5KNJA 3LM5A 4IANA 2JIVA 2WMQA 4LMUA 4X2FA 5AUZA 2VGOA 2VTSA 3NYVA 4HW7A 2VO0A 2XA4A 2IZTA 3PSCA 3BL9A 3HVCA 2FVDA 5EHLA 5CU6A 5AP1A 1V0OA 3I0OA 4O0SA 1IAJA 2X1NA 4IAYA 2ITOA 3E7OA 4S31A 4F1TA 3PZEA 5CNOA 1OKZA 4IAIA 3A7HA 2IZRA 3PZHA 2FA2A 4AG8A 3TM0A 1KV1A 5BYYA 5L4QA 2UZTA 5HE3A 4WO5A 2PUNA 4CZUA 3C9WA 2J5EA 4A4LA 3BHTA 3MB7A 2C0IA 2JFMA 5AV0A 2WXVA 4E26A 5LVMA 5CAQA 4R7IA 4R7HA 5DH3A 2FH9A 4G17A 2RFEA 5FBNC 3P5JC 3KMMA 3DOGA 3W0PA 2NPQA 4L7SA 2BRHA 3TKHA 5A4QA 3WYXA 4A9SA 4PPCA 4BDJA 4BIBA 3PJ8A 2WMTA 4GUBA 3V8TA 3DCVA 4XP3A 3OF0A 5E91A 3VRYA 3EFJA 3RHKA 3QA0A 1H1PA 2A0CX 3A2CA 4I1ZA 4L44A 4TYHB 3UC3A 4QNYA 3R8VA 5CAVA 4PWNA 2R3RA 3PVBA 2GSFA 2XKCA 2G2HA 3IO7A 3MS9A 4O6LA 4OTWA 2GHMA 3CBLA 2XEZA 3QD2B 1ATPE 2V62A 4AW5A 2CLXA 3HP5A 2ZAZA 4WRGA 5HZNA 4U41A 3R7GA 4HZRA 4FTOA 3NS9A 5BVFA 3GFWA 2ONLC 3OEZA 3DBQA 3FXXA 5ETFA 3EMGA 4P90A 4TY1A 5B2MA 4H3QA 3M1SA 5HCZA 2FSOX 2QG7A 3EN9A 2JAMA 4OT6A 4JT3A 4TT7A 4YHFA 3L9NA 3P7BA 5FP6A 3IGGA 2F7XE 2CCHA 2HIWA 3FV8A 3GCUA 4XV3A 5HE1A 4QRCA 4KUJA 4O7ZA 1YKRA 3Q52A 3DY7A 2QKWB 4PTGA 4CFWA 4EOSA 4I22A 5TO8A 2IW9A 4EL9A 2OKRA 3U4WA 5FP5A 4YZDA 4ZEGA 5F4NA 4ZLZA 5M4CA 1ZXEA 4OAUC 2JIUA 4DFYA 1JBPE 5BVWA 3NZ0A 4QYYA 3WZUA 4AXAA 5BVOA 2E9VA 5CXZA 3TWJA 1U4DA 2GNIA 5EI8A 2R2PA 3CPBA 4WNMA 2OG8A 4XCUA 3C4FA 2CHLA 3ZXTA 3G9NA 3KU2A 2AYPA 4XV9A 5I0BA 5HG7A 3BLQA 3CY2A 4FNWA 3JXWA 4AGDA 3W10A 5F95A 1OECA 3PYYA 4KSQA 5HGIA 3SRVA 2A4LA 3COHA 3F7WA 3R02A 4NTSA 2B4SB 4Q2AA 4WHZA 5FEQA 4C7TA 5LCJA 5C27A 3KMUA 5G6VA 3UIUA 2VNYA 5AAEA 4G3CA 3MSSA 4BWPA 2WQBA 1CDKA 3KY2A 3LZBA 3FMMA 4G9CA 4O84A 2B55A 4FVRA 5DE2A 5HE0A 3SOAA 3ZEWA 4FTRA 2IVTA 2WO6A 3U9NA 4CMOA 4QQTA 3FY2A 2QO9A 5JZJA 4H58A 3T8OA 5BVEA 1OPJA 4FT0A 3OCTA 3BE9A 5C26A 1ZYJA 2GPHA 2PHKA 3OY3A 3RJCA 4F9YA 2LAVA 4QMLA 3SV0A 1GZKA 4F6WA 1ZY5A 1KE9A 1W84A 5EDPA 4L67A 3QCYA 3MH2A 5DVRA 3V04A 4TYJA 4IVBA 4IB3A 4UMRA 3VBTA 2PZPA 4I94A 4L45A 1U5QA 3TTJA 4QP9A 3R2YA 4FZ6A 4C2WA 3ATTA 2UZUE 5EDRA 3PJ3A 4G9RA 4OR5A 3QRTA 4ZOGA 3E5AA 3LFCA 1PY5A 4IHPA 5AUXA 4FKUA 4EUUA 3QQUA 3PWYA 5D7AA 4BIDA 3FZRA 4BKZA 3CQWA 4JQ8A 3N51A 1WVXA 4KSPA 3IW4A 2C30A 3HV7A 2VX1A 4DG2E 5HX8A 2VO7A 4EK8A 2WPAA 2ZJWA 3I79A 2ZMDA 3AGLA 3ELJA 5J7HA 1GZNA 4BIEA 2IPXA 1WVWA 1YXSA 4DHFA 3NUAA 4O0TA 1P4FA 3P23A 1J7UA 2I0YA 4NM3A 2P0CA 4EORA 4DEAA 3NMUF 3QQKA 3Q2MA 4IBMA 1UVRA 3F5PA 4EK4A 4PPAA 2QONA 4GT3A 5HIDA 2UW9A 3PVWA 4I92A 4WIHA 3VQUA 3UDSA 3FMNA 5JQ8A 1OPKA 4IDVA 3V5LA 3ROCA 3QX4A 2HZ4A 1GIIA 3K3JA 5EHYA 1ZYCA 4K0YA 3OBJA 2C4GA 1PRYA 4NH1A 3V01A 2OZAA 4EK6A 4ZLYA 4NT4A 3QWJA 5EH0A 2WMBA 2ITUA 3QCXA 3OTVA 5CASA 5TOZA 4IVDA 1Q97A 4ZZNA 3UQFA 2PTKA 3VJOA 4IWPA 2HW6A 2WZJA 1OL2A 4QP1A 3KF4A 4I20A 2PE1A 3DGKA 2C5YA 4HYSA 4ZTNA 3EQFA 3K5UA 2Q0BA 4DLJA 3U54A 3L9PA 3DDPA 3KVWA 3E92A 3BU3A 2OW3A 2X39A 4RJ8A 4AE6A 5A4EA 4APCA 3S1HA 3DK7A 5J5SA 5BVKA 5KKRC 1RDQE 1OITA 5AR3A 5ANJA 2B0QA 3C4EA 1FOTA 3OC1A 4HOKA 4QP3A 4RFZA 3VBWA 1XH8A 3ZLSA 3EFWA 4EHEA 4A06A 4AN3A 1DS5A 2XRUA 3RK5A 3NUUA 1CSNA 2OH0E 3DPKA 4LMNA 4DGGA 4E6QA 5HLWA 3NAXA 4HVDA 3S95A 1H08A 2YM5A 3QHWA 5B7VA 5TT7A 5BX0A 2VO6A 4EI4A 4E5WA 3UNJA 1P2AA 4ASEA 5KX8A 2W96B 5LJJA 3GCQA 4C38A 3W0MA 4O27B 4AW2A 2XP2A 4UWBA 4DGNA 4FEVA 4QYEA 2QLUA 2VV9A 4GCJA 3MW1A 2C1BA 3UZTA 5DRDA 3LOKA 3TTIA 2X8IA 4X2GA 3I5NA 3DKOA 3JYAA 2W1HA 3QWKA 4X7QA 5DT0A 5HO7A 2CNQA 3IW8A 3PY0A 3N4UA 2Y4PA 5KZ0A 3CPCA 2CNVA 3EHAA 4TKSA 4ACHA 2C3KA 3EYHA 3IW7A 4J96A 4C59A 4DEGA 4EHGA 4CRLA 4YHJA 4Y8DA 3WF6A 3TKIA 4Z7HA 4U42A 2PVFA 1ZMUA 2R7IA 2WTIA 2O5KA 4KKGA 4B6LA 5GJGA 4DEHA 2IVVA 2F57A 4IWOA 3UOJA 3UIXA 4CG8A 2UZVA 3QLGA 3ZO3A 3OY1A 3II5A 3NRMA 5HORA 4IM2A 3NCGA 4K77A 4KIPA 2A98A 3SDJA 3VS3A 4BWKA 4BICA 1BYGA 3TG1A 1XMMA 2ERKA 2C6DA 2ZVAA 5CVHA 4A9UA 5LMKC 2OLCA 3D14A 4FV5A 4RIXA 4WUNA 2WAJA 4F08A 4M0ZA 5AUWA 3EN4A 5K9IA 1BI8A 5HIBA 4AFEA 2E2BA 3QYZA 4MBIA 4X6RA 5B0XA 3R7EA 5JFVA 1JQHA 3LJ1A 4D4YA 4DGLC 4B99A 5JFXA 3UIBA 2F7ZE 3QTXA 4AAAA 4GJ2A 3OS3A 3HMPA 2PL0A 3CD8A 3EL7A 2BAJA 1OBGA 4E20A 4DG0E 2UZNA 3TNPC 3AXWA 3N9XA 4C37A 1R1WA 2I0EA 2FO0A 1SZMA 2REIA 3C4CA 3D7TB 4FUYA 4LG4A 3HX4A 4NCTA 5LVLA 2VWIA 2QHNA 2OFVA 2XIRA 5IQGA 5GIPE 5CU0A 3HMMA 5HVKA 5FTQA 3TACA 3D15A 2RG6A 3LQ5A 3EFLA 3LFSA 2CLQA 2R3MA 3QQJA 1SNUA 4FZDB 3OUNB 4YO6A 5FRIA 2VWYA 3HA6A 4NIFB 1BL7A 3MPMA 3V8SA 4IZ7A 4DHZA 4WG4A 3C51A 2C6OA 4KD1A 3VJNA 5CEOA 2HOGA 5D7VA 3I7CA 4U79A 4QDEA 2ITYA 3QUDA 4QOXA 4FODA 5IU2A 3V8WA 3UDBA 5JQ5A 5G1XA 4MXOA 2ITPA 3UVPA 5AA9A 1GJOA 3KXXA 4FV1A 4QD6A 4PY1A 2W5BA 4CFNA 2XK8A 4ZS0A 4BR3A 3V6RA 3LMGA 1L8TA 2XUUA 2X7OA 2QODA 4ZMEA 2O63A 3V5WA 3R00A 4ZSGA 4JRVA 1OIUA 3ZBFA 5CTPA 3C5UA 4IB5A 1Y6AA 5CU3A 3EQRA 3QQGA 3DTWA 5CEQA 4EH3A 2BZJA 2XNBA 4PUZA 5EI2A 2RG5A 3ZEPA 2XK9A 3TNWA 5HE2A 3QRIA 5KMLA 3FC1X 3D9VA 5CAPA 3TV7A 4PRJA 1XBAA 3T9IA 3DKGA 3FI4A 4JVGA 5HCXA 2VAGA 5LXMA 4OTHA 3S0OA 3KQ7A 3NW5A 4DFZE 3IDPA 3NUYA 3FL4A 4EC8A 2GQSA 2C3JA 3LXLA 4GMYA 4ZSJA 5BMSA 5JK3A 5M57A 3TUBA 3FC2A 4W9XA 4IM3A 4MD7E 3OWJA 1YOJA 4YLLA 4O96A 3R01A 4FKSA 4IACA 4K2RA 5CT7A 5HG8A 1UNGA 4FT7A 4BCOA 4GVJA 3A99A 1H0VA 4WKQA 5DR9A 1G8KA 2UW6A 1X8BA 2W4KA 4RQVA 4OW8A 4UMQA 1QPEA 3LE6A 1OZ1A 4JG8A 4ERKA 3U6IA 5DA3A 3R9RA 2IN6A 3FLWA 4C57A 2VTIA 1A06A 4FTCA 5C8MA 3UC4A 3A8XA 2PUPA 3KREA 3AT2A 4BDEA 4I93A 4YC6A 4BI1A 4QMPA 3O0GA 3ORIA 4EQMA 4FICA 5CF6A 2XCHA 4M15A 3KN6A 3BWJA 2HZIA 3EL8A 5HO6A 2F2UA 4YLJA 4BGHA 4ZLOA 5T6KA 4IWDA 4FG8A 3SX9A 4QMVA 4FT9A 2EU9A 3LAUA 2YWPA 1Y57A 4M66A 4Q9SA 4X0MA 4PNIA 5AR4A 3P7CA 2ZYBA 3QUEA 4L9IA 5I3OA 4EZ3A 3IOKA 2VTJA 5H8GA 4ZY6A 4RJ3A 3AD6A 4EKKA 3G2FA 2EXEA 4O0YA 2VWWA 4Q5EA 2WQMA 4DEBA 4E93A 2R9SA 5LOHA 3R8MA 4CQEA 4Q9ZA 5CEPA 4AFJA 3W2PA 5J7BA 1IR3A 4NSTA 1UKHA 1WVYA 4JL9A 4DEDA 4JIKA 1IA8A 3KXHA 3LM0A 5FTOA 4C34A 1W2DA 4CQGA 4HCUA 3TIZA 4F99A 5L2WA 3FI8A 1TVOA 2O0UA 4I41A 3DBEA 5CU2A 5ANGA 5K5XA 3JVSA 5I4NA 2ZM4A 1KOBA 4IB1A 4BI0A 4NCTC 1JWHA 3MFTA 4G6NA 2YN8A 4YJRA 2C3IB 3DNDA 5J9YA 4LDTA 5JGBA 2FSTX 3ID6C 3VHKA 1Y6BA 4N70A 1PYXA 2QR8A 4QTCA 3BHVA 1H24A 3RPOA 1OKVA 4FEQA 1XMLA 1STCE 3IK3A 5E90A 4RIYA 3ACKA 2RSVA 4ZSEA 3R8PA 2OF4A 4O2PA 2NRYA 3VULA 3TJDA 3C0HA 5EG3A 4GEOA 4NUSA 3NNVA 1Y8YA 5HU3A 3GP0A 3OCSA 1OB3A 3NDMA 3U51A 3R7OA 1SYKA 3QRJA 4C61A 2DYLA 1BL6A 5E8UA 2BUJA 5IEYA 3OEFX 1WBWA 3POZA 2WTWA 3CEKA 3HA8A 3QD3A 4EOLA 4U97A 3TCPA 3FZOA 3Q04A 4C36A 4BY9E 5CQUA 3QXOA 2W1ZA 5CEMA 4DDGA 4Y83A 3MA3A 1W2FA 1ZMWA 3CD3A 2GTNA 3CKWA 5AR5A 1UWJA 4IAFA 5A3XA 5FM2A 4KINA 5M53A 4ZS4A 3R6XA 3UOLA 3H9RA 1REKA 5JRQA 4RIWA 3MN3A 5DPVA 3WYYA 4B9DA 2RFNA 4F4PA 4TWNA 2HK5A 4ENXA 2X9EA 4O4BB 4MXAA 3G15A 4RA4A 2UW4A 5HI2A 3GEQA 4CZTA 1JOWB 2PWLA 2C1AA 3HDNA 3MIAA 4CNHA 3AOXA 3DBFA 5HU9A 1DI8A 1YI3A 2RL5A 3W2OA 4U3YA 4F7JA 5L2IA 3WZEA 4BCIA 5ANOA 2RKUA 2JAVA 2O65A 2OIBA 2C47A 1VJYA 2XALA 2VTLA 3R7YA 4EYJA 3R9HA 3ENHA 3L9MA 2WIHA 4X3FB 5DLSA 4R3PA 5M55A 5EYMA 5K5NA 3GC7A 2HXQA 4QMYA 2Z60A 3O7LB 3I5ZA 1A48A 5I9UA 3HMOA 1MP8A 3KXGA 4GT5A 2WB8A 4QP8A 2R3NA 3DZOA 4LGHA 3MJ1A 5C4KA 2F7EE 4BCHA 3W33A 5E8ZA 4C2VA 3R1NA 2GS7A 4XUFA 3W0SA 4TWCA 5DNRA 4YJOA 3BYMA 3VBYA 4EH4A 4TL0A 1AQ1A 1ZZ2A 4RGJA 3R7VA 3R9DA 2CKPA 4FL3A 3OCGA 1G8AA 2YIWA 3RNYA 4DH7A 3GCVA 2X2KA 2JKQA 1M17A 5HICA 4EHZA 2GQRA 3AC5A 3OCBA 4AGWA 4O22A 4DGOA 3GU5A 4X2NA 3MVJA 4IVCA 1NVRA 4PTEA 1H07A 3PPJA 4BJJA 3DKCA 4I5MA 4S34A 2VTQA 4R1YA 2R5TA 4O4CA 5AIRA 3V5QA 3IG7A 4YZCA 4F7SA 3OT8A 2W06A 3NUPA 3WF9A 4FOCA 4JNWA 4JQEA 1MRYA 3HECA 3MVLA 4KKEA 4V0GA 4YTHA 4E4NA 3DDQA 2VD5A 5F9EA 1UA2A 1WBTA 3EQBA 4FIEA 4FTUA 4RVKA 2X2LA 2CSNA 3COMA 3W2CA 1G3NA 2PSQA 3D0EA 3OMVA 4DH5A 5CI7A 4D0WA 1Q8YA 2GMXA 3FDNA