3RWPA

Discovery of a novel, potent and selective inhibitor of 3-phosphoinositide dependent kinase (pdk1)
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
287
structure length
277
Chain Sequence
QPRKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEYLIFQKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTPPKLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords 3-phosphoinositide-dependent protein kinase 1
publication title Discovery of Novel, Potent, and Selective Inhibitors of 3-Phosphoinositide-Dependent Kinase (PDK1).
pubmed doi rcsb
source organism Homo sapiens
total genus 82
structure length 277
sequence length 287
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2011-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3rwpA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3rwpA01
2IVSA 3TJCA 2LGCA 3S3IA 1LEZA 3PZHA 3MGYA 4CYJA 2X39A 3C0GA 3P7BA 4UZDA 3PY3A 3RPVA 2Z60A 2P0CA 3NUUA 4LFIA 4IAKA 2XS0A 2JAMA 5K5NA 4M3QA 4R7BA 3QWJA 3I5ZA 3IGGA 5J9ZA 3ZO2A 2C4GA 2XCKA 5DG5A 2PVFA 1BI7A 3BHYA 4FK3A 3FI2A 4HGSA 4IAIA 4KS7A 3RPSA 2BHEA 4U81A 5DH3A 2VWVA 3IG7A 3ACKA 4FODA 3TCPA 4EK6A 3TZ7A 3R1YA 4JIKA 2BZKB 4IX6A 3SW7A 2GSFA 3F6XA 3KULB 4JX3A 4RWKA 4XP3A 4AX8A 3LQ5A 5BNJA 4MCVA 4I0TA 2ITOA 3QQUA 4R7IA 5GZAA 4AS0A 2OZOA 4YO4A 3LFFA 3OWLA 2H6DA 4LOQA 4N70A 3GGFA 5H8GA 1XH5A 3DK7A 5BVKA 4IWPA 4MF1A 3CJFA 3C4ZA 4HPTE 4CMUA 3LKMA 4AGWA 4OGRA 4JAIA 4RQVA 4F7SA 2EU9A 1Q62A 3H9OA 3L8PA 3ZUUA 2RG5A 1SYKA 2Z7LA 3DAJA 1YXUA 4M84A 4RZWA 3ZOSA 3HAMA 3DZQA 2ZAZA 2BALA 2R3IA 2YA9A 4LG4A 4XG4A 2OF2A 1FMOE 3SV0A 2YM4A 3WF6A 4R1VA 4YLKA 3H3CA 4CYIA 5HVKA 5K9IA 3ZSIA 4E4MA 5J1VA 3SVVA 3A2CA 2WQMA 3GNIB 3EQPA 3VC4A 3VF9A 3VULA 4M15A 3R01A 5IUIA 4IB0A 2B9JA 2QKWB 2X6EA 3C13A 3G6HA 4X3FC 1IG1A 5DI1A 4ZS0A 1JSVA 4QPMA 4O21A 4QTAA 3C4FA 3TNQB 5BPYA 4KAOA 3HNGA 2A27A 3AC5A 5TOZA 3VAPA 2WMUA 4NH1A 4BCQA 2HXQA 4PDSA 1AQ1A 3TNHA 4FL2A 3C5UA 4PP9A 2W1HA 1XBAA 3MFRA 4LRKA 4M69A 3VHKA 5CF4A 4IM2A 3DT1A 4AW5A 3RWPA 3AMBA 4AZWA 3SG9A 4I5HA 2UZVA 3KXXA 3R7YA 3F61A 3VJNA 4M8TA 2QOKA 1M2RA 3GOPA 4XP2A 5LJJA 2Z7SA 3KCKA 3F7ZA 4TZRA 3A99A 3OROA 4D0WA 3WZDA 5DLSA 2W17A 4XEYA 3PZEA 1NA7A 4JR7A 3KGAA 5AR5A 5TR6A 3UG2A 4HW7A 5JSMA 5JZJA 5K4IA 2C0TA 1G5SA 1UNHA 1UNLA 2QO2A 5EKOA 3SW4A 3LIJA 3F66A 3LJ1A 4A4XA 1URWA 4KKEA 4MNEB 2WO6A 3L9PA 4O1PA 5CLPA 1RW8A 5KX8A 2GU8A 3MH3A 3NW5A 3A62A 4IH8A 4IC8A 1YHSA 2VTQA 2R3GA 2VTAA 2P55A 3M11A 4NCTC 5J5TA 2Y4IC 4GFMA 4JR3A 3UVQA 4AT4A 3T9IA 2JIIA 4IWOA 3DBFA 5HE1A 2WOTA 3BYUA 3NNUA 2BZHB 4PTEA 4TL0A 4KBAA 5HHWA 2VWUA 1G8AA 1H0WA 4LRJA 4RRVA 4TYHA 5CXHA 3DFAA 4KRDA 5HEZA 2X6DA 4BCGA 5L8KA 5T3QA 1PJKA 3KY2A 2BFYA 4F1MA 3KKVA 2YDKA 4PTCA 3EMGA 4ZSJA 3V8WA 4AUAA 5IEVA 2GMXA 4JQEA 5HKMA 3FMMA 2Y7JA 3ZUTA 5F1ZA 4YLLA 3HV3A 2HWOA 4MYGA 3TV7A 4ZTMA 4NL0A 4FV7A 4AN3A 4YJTA 4FTRA 2AYPA 3GC8A 3U8WA 4H3BA 5IH5A 1FVTA 4FZ6A 5AAGA 3QUEA 4JXFA 3HECA 3ATTA 4KINA 3M1SA 5D11A 3RVGA 5FM3A 1YI4A 3NWWA 4ZLOA 4FT0A 4P5ZA 2OSCA 2RFEA 3W2SA 1OKZA 4E6CA 2ERKA 3T3VA 3SOAA 3D5UA 3WF7A 4M14A 4C0TA 4C57A 1PKDA 3PXRA 4IAFA 4YJQA 3GB2A 3TACA 4UZHA 4BDIA 5KMJA 4O1OA 1PXIA 3KB7A 4KBCA 4TTHB 4DT8A 5IZFA 1Q41A 2BZJA 4YPSA 5HQ0A 1YWRA 1R0EA 3NLBA 4BDBA 2QOHA 3PFQA 4NFMA 4LMUA 4D9TA 1OITA 4Q9SA 3EOCA 4CT2A 5HG8A 5FDXA 2ITQA 4PL3A 2C6OA 4YR8A 3QALE 2FVDA 5IQEA 2OIDA 3LJ0A 2XYNA 4O0YA 3D5XA 2UUEA 2CPKE 3NSZA 1PXMA 4J8MA 3RAWA 2QG5A 4FEUA 3D0EA 5IKWA 1BX6A 1Q8ZA 3FPQA 4AZSA 4BWXA 4IX3A 4DFYA 2B53A 2C5OA 4O2PA 3FDNA 5HBEA 5HICA 3R7EA 4EK3A 1R3CA 1OKWA 3AD6A 4IVDA 1Q61A 2HWPA 4YZ9A 4AGUA 2O3PA 2VTIA 3OBJA 4J1RA 2C30A 2JIUA 5L8JA 3U87A 1GJOA 3PWDA 3ZCLA 3N9XA 3CD3A 1ZWSA 2X0GA 3NAXA 4NSTA 5FRIA 2CLXA 4UEUA 3O8PA 4WUNA 4C3RA 2AC3A 3KXZA 4AAAA 4BIDA 2ZV7A 4AA4A 5IPJA 4G9CA 4FIEA 4PMMA 5DT4A 3KK9A 3UVPA 5EDRA 4ANMA 3V04A 5BVDA 2WEVA 4MH7A 4M97A 3RBWA 4MF0A 2QR7A 2E9VA 3S00A 1W82A 2WNTA 2ITXA 4U0IA 5DR6A 3AXWA 1K3AA 3B2WA 3E3PA 1B39A 1W84A 3CLYA 4FBXA 5D41A 4C35A 4XOYA 3DCVA 3FZTA 3QQJA 4AFEA 1Q3DA 5E8XA 4D1SA 2IVTA 3TG1A 3RZBA 1CKIA 4MHAA 3W8QA 2ZV8A 2P2IA 2BMCA 4LV8A 3DQXA 3Q2JA 3FWQA 3QRTA 4CD0A 3P79A 4L45A 4W4YA 3HUCA 5HI2A 3WF5A 3MH2A 2PVRA 4YNEA 2R7IA 2OWBA 3BU5A 2J0LA 3NZ0A 5FWKK 2J2IB 2J90A 5EI6A 4LGHA 2ITZA 2JKQA 3VS4A 5IQGA 3M42A 3QFVA 3BBTB 3O51A 3F2RA 3TNPC 2FSMX 5EHOA 4EHVA 5JGBA 4RIYB 4FVQA 1ZZ2A 4FNXA 4ZZNA 2UZUE 3DU8A 4J7BA 4AP7A 3HL7A 3PJCA 2GS2A 2JAVA 2YM7A 3GXLA 3L8VA 3O8TA 4FKGA 3FC2A 3KRLA 3GUBA 4RG0A 3T3UA 4O7VA 5L2IA 3C4CA 4RZVA 2QU6A 1VEBA 1LP4A 2UW3A 3TUBA 2VRXA 4W9WA 5DVRA 4LI5A 3ZLWA 2PMNX 3IW4A 4X7QA 4Z16A 4USFA 4YTFA 4ALUA 1Q99A 2GFSA 2QOBA 4DLJA 5IA3A 3P4KA 4ZS4A 1BLXA 2F2UA 3AT2A 3DFCB 5EW8A 5IDPA 1L3RE 3TJDA 4AT5A 4ENYA 2X1NA 3PPZA 3MJ1A 2XK8A 3Q4ZA 1YDRE 5DEYA 5E8WA 3V01A 3PXZA 2CGWA 4IX4A 4IWDA 3ORMA 4QNYA 1WBOA 1OM1A 4Z7GA 2BKZA 5EQYA 1CKPA 2UZWE 5AR3A 1NT2A 5IH6A 4M66A 3RWQA 1CDKA 4C02A 3MIAA 2WMRA 4Y72A 3SLSA 2HYYA 4S32A 2OJGA 3P9JA 4KSPA 5EOBA 1SVEA 3FMEA 4GV1A 3OXTA 4FTCA 3H30A 4L3JA 3GENA 4QYHA 4YC3A 2QOFA 4R1YA 3W2QA 5CYIA 5IUHA 5KBRA 4CCBA 2WXVA 2W1DA 2O64A 2PUIA 3R1QA 3O17A 2I7QA 2BRMA 2WB8A 1H8FA 3UQCA 1U46A 4RPVA 3VUHA 4JI9A 3WZKA 2YLEA 3VWAA 4GRBA 4DTBA 4UWYA 1URCA 2PK9A 3D4QA 3KN6A 3MFUA 4WNMA 2OJ9A 3ORKA 4AWIA 1JBPE 5BVWA 5GJGA 4G3GA 4BTKA 2XRWA 2BDJA 4QT1A 4AE6A 3F3VA 5EW3A 3EN5A 3RK7A 4FZDB 2CLQA 4FSTA 4IADA 3A8WA 4V04A 4XLIA 2ONLA 3GCPA 5TE0A 2YHVA 4F4PA 4O7SA 3BHVA 2CNUA 3U51A 2FSTX 2UW8A 2QD9A 5E8TA 2PMLX 3I1AA 3PXQA 3QYWA 4A4LA 1UU7A 4G5PA 4C4IA 2I0YA 4GEOA 1ATPE 4FV1A 4E5WA 2RL5A 3R7GA 3I4BA 4O0WA 3BRBA 3QKKA 4L43A 1VYWA 4FK6A 3RINA 3DXPA 2BIKB 4CRLA 3EQIA 3R8ZA 5JKGA 4QYEA 3S2PA 5CAVA 4ZK5A 3FHRA 2OH0E 4MXOA 4CFFA 4OTDA 3WE8A 3R9RA 1JVPP 2J6MA 2J0MB 3VS6A 3NEWA 3ENMA 4X21A 5A46A 3UYTA 4BGHA 4ASXA 1UWHA 3DXQA 3RMFA 4RVKA 4QMNA 3BIZA 5FBNC 3WARA 4PPCA 1FVRA 2BRHA 4HCVA 1PXLA 3O71A 2EB2A 2VTLA 2FB8A 3DS6A 4PPAA 4F6UA 2WQEA 4P2KA 2YM5A 5FGKA 3PLSA 4XJ0A 3IO7A 4FT5A 5F20A 3CBLA 4TYIA 5FD2A 5BQ0A 1IA8A 3NRMA 3HP5A 4LYNA 5AM7A 3W33A 4CNHA 2C68A 3VUDA 4AZVA 3ELJA 3HA6A 1NVQA 4FTLA 3SAYA 2XZSA 2PZIA 3RTPA 5KNJA 1XH9A 3PLAE 3FL4A 3FQEA 2WTDA 3LOKA 3NYNA 4I94A 5JZNA 3UODA 4QMWA 2C0OA 4NJDA 2VWIA 3K3JA 2VTMA 4RJ3A 1Q8TA 4ZSAA 4ANLA 3ZS5A 4FV0A 3F69A 3MY1A 5JGAA 3LVPA 4FTMA 3AC3A 3ZYAA 5DT0A 4AN9A 2XNMA 3NIZA 4B8MA 2V55A 2O65A 3EFJA 3ZBXA 4BKYA 3F5XA 4I5MA 4BI1A 4FTJA 3V5JA 4BL1A 3PE2A 4DC2A 3UIMA 5AR2A 5IA2A 3ZDUA 4BC6A 4F0IA 3COHA 3LMIA 4BCNA 4YJPA 3UBDA 2F9GA 4X6QC 5HIDA 3RPYA 4FKJA 5KCVA 4WG5A 5ITAA 3R8LA 3R2YA 5EG3A 3OT8A 4GH2A 4I24A 5DMZA 4C4FA 3A7HA 4EI4A 5A9UA 3MN3A 5AP7A 4GKIA 3EN4A 3HMOA 2VGOA 3CC6A 4G16A 1OIYA 4DFLA 1VR2A 4QMLA 5IU2A 4RWJA 4C33A 4U3YA 3CKWA 2VTJA 3ZEWA 2ETMA 1B38A 3U9NA 2O63A 3I81A 4E6QA 3G9NA 5BYZA 5ACBC 4XG7A 2B9IA 4L7FA 4I5PA 4WNOA 2PYWA 3O23A 3VNTA 4YHFA 3NUSA 4LM5A 4J97A 5HGIA 4C3FA 4F9AA 4Z7HA 1KE5A 3CQWA 1OPJA 2OICA 3EL8A 3OOGA 1ZY4A 2DUVA 4FG7A 4MD9E 4YJRA 1ZAOA 4E5AX 3I0OA 4QP8A 3MB6A 4DCEA 1UV5A 3TUCA 5E1SA 2QOLA 3B2TA 3FXWA 4BFMA 5A4CA 4GMYA 2XA4A 3C50A 3HEGA 2JFLA 2XKFA 1SVHA 3PRIA 2IZRA 3EQDA 1KE9A 3R30A 1MP8A 3DTCA 4GG7A 4L7SA 4NTSA 3SRVA 3V5WA 1OVEA 5B2KA 2OU7A 4C61A 1ZYDA 1J1BA 3Q5ZA 1BL7A 2V7OA 4G3FA 3DDPA 4JIAA 5E8SA 1YOMA 2X9FA 3HV5A 5J1WA 1YHVA 2VO7A 3A7GA 4QYFA 5AP5A 5KBQA 2WD1A 3QUPA 3DAEA 4HVHA 3CP9A 3ZRKA 5M4IA 2V62A 4FSRA 4C34A 3P5KA 2OJFE 4QMUA 3D9VA 4FV3A 2XIRA 3VJOA 1OL7A 3DAKA 4KRCA 3VQHA 3Q9WA 3E8EA 3SKCA 3K5VA 5CZHA 1YVJA 5E7RA 5EDQA 4O7TA 4DITA 4FX3A 2YIQA 4J95A 4KKGA 4C36A 3ZEPA 4ASEA 2YIWA 1QPEA 1WBPA 2FGIA 3RAIA 5JFSA 4TT7A 4WD5A 2YJSA 2B7AA 2YABA 4EKKA 4CG8A 2C69A 3LFBA 4G6LA 3L9LA 5DA3A 2JC6A 1IRKA 2OXDA 3IGOA 3ZDIA 3R8PA 2HAKA 4QOXA 3NMUF 3E62A 3KL8A 2PZRA 4IAZA 3N4TA 4I22A 3HRBA 4R5SA 4F99A 2HXLA 3HA8A 3S0OA 5J7HA 4G2FA 3QKMA 3II5A 1OIQA 2GTMA 3QXOA 4C62A 3MVLA 4FZFB 4L3PA 3QHWA 4QYYA 2ZM3A 4UWCA 4YURA 5CEKA 4BWKA 3ZUVA 4MXAA 4DEEA 3RM7A 3O7LD 3OOMA 4B7TA 1GZKA 5AX3A 3P78A 2QOIA 2G9XA 2O5KA 1E9HA 3GFWA 5AV0A 1O6KA 4ENXA 5M08A 4GJ2A 4K6ZA 4U43A 5E91A 1IAJA 3AMAA 2PUNA 3FMLA 5IA5A 3LFQA 3UNJA 1JOWB 3EN6A 5M53A 2XP2A 1WVXA 3R04A 3PVWA 2XVDA 2DQ7X 4GS6A 2Z7QA 2CJMA 2OF4A 2WMAA 4LRMA 4WUAA 4BB4A 4CT1A 4DBXA 2OG8A 1JNKA 4JS8A 5EHLA 3DNDA 4BDKA 3UNKA 4DH1A 4PP7A 5HG9A 1QPJA 2GTNA 4FT9A 5D10A 4NJ3A 3SXSA 2VUWA 1Q97A 2F2CB 4JDIA 1JSTA 4RT7A 3R7IA 4AW1A 3VO3A 1UNGA 4IE9A 4GKHA 4RJ8A 1OB3A 1KWPA 4XG3A 3LFDA 2W4OA 2XF0A 5HCZA 3UDBA 3PJ3A 2IN6A 4N0SA 1TQPA 3OCBA 3RP9A 3UOJA 4YC6A 4EUUA 1NVSA 3FMHA 4G5JA 4GIHA 4QRCA 4F7JA 5L6OA 3QXPA 4ZMFA 5AFVA 2XK9A 2XBJA 4HYUA 4EQUA 3V3VA 3BHHA 3IK3A 4R3RA 3FUPA 3B8RA 3R63A 4MQ2A 4ZOGA 3UVRA 1W7HA 3B8QA 3LCOA 3CTHA 3CTQA 1H1RA 3W2CA 3DK6A 1FVVA 4JG8A 1Z5MA 1J1CA 3ZO4A 4CFMA 5JH6A 4HVIA 3QF9A 4J8NA 2XYUA 3QTIA 4MTAA 4X2KA 2QO7A 3GQLA 2HZ4A 3DKFA 4FUXA 3UYSA 2YN8A 3MY5A 2OH4A 3V8SA 4L46A 4YPDA 4NT4A 4ANQA 5I9YA 1Y6BA 4GK3A 1H1QA 2PVJA 2JDTA 3D2IA 5KE0A 5AAEA 3SG8A 2OJIA 3OW3A 4FVPA 2F7ZE 5F4NA 3W2OA 4JL9A 1H4LA 3WF8A 3W16A 2PTKA 4CV8A 2G2FA 3P23A 3P7CA 4D9UA 3UPZA 4JOAA 1XH6A 3VW6A 4F64A 4HJOA 1M7QA 2O0UA 2WGJA 3ZONA 3LQ3A 4CCUA 5CVFA 2JIVA 4K0YA 4XP0A 5EOLA 5HG7A 1WFCA 2CKQA 4BKZA 4O0XA 3VUIA 1JKKA 2V22A 5JN2A 3TKHA 4L67A 3JS2A 2H9VA 3SX9A 4S2ZA 3U4WA 3HDNA 4ZY4A 5DHJA 4BTFA 2XNEA 5IQBA 4AN2A 2GNJA 3LW0A 3R22A 3RHXA 3DV3A 4L9IA 3C5IA 3SOCA 1STCE 3PVGA 4X3FA 4O86A 3S1HA 1QCFA 3HMNA 4F09A 2ZB0A 4BBFA 4NZWB 5HVJA 2F4JA 4I20A 3KFAA 4TNDA 5F94A 3EQGA 3RK9A 4QTDA 2UW0A 4W4XA 2OIQA 3WZUA 4AFJA 4O91A 2GFCA 2VTTA 3C1XA 4ZY6A 5CASA 4YSMA 3BGZA 4NM0A 4XCUA 2XNBA 3G5DA 3TV4A 4FL3A 2YERA 5T6KA 2P4IA 4PL5A 4DLIA 4KIQA 2J4ZA 4EH3A 5CVHA 3BGPA 2PZ5A 4QQ5A 3I5NA 1OL6A 4EBVA 4DH5A 3QTWA 3P1AA 5HE3A 4H1MA 3ZO1A 1OIRA 3GQIA 2C5YA 3DK3A 4EH2A 2CDZA 1GY3A 4MWIA 4J99A 2IO6A 3C4XA 3RJCA 3BLHA 4RFMA 3KU2A 2XEZA 4EH5A 3JVSA 4GYIA 4CXAA 3Q4CA 3E8DA 4E6AA 2IW9A 3PVBA 2RGPA 3GU7A 2E9PA 3ALOA 4IWQA 2QQ7A 4H3QA 3FV8A 1RDQE 4RLLA 4TYJA 1J7LA 5J8IA 2PVMA 4UYAA 3I60A 4ZTLA 4RWLA 4UMRA 2HW7A 4FEWA 5G1XA 5I9UA 1M7NA 1LR4A 4NCTA 1PXKA 1U4DA 2J51A 4FKIA 3MTLA 5CU4A 4YNOA 3RK5A 2BPMA 4LMNA 4CKJA 1Y8YA 3BYVA 1V1KA 1UA2A 3WIKA 2HENA 1JKLA 3EFWA 2IW8A 2R3NA 4WSQA 1OECA 4FA2A 3GT8A 4DA5A 1GIJA 4IZ5A 4U40A 5M55A 4WBOA 2UW5A 1KOBA 3PWYA 2E9NA 2R3OA 4RX9A 2G2IA 5DWRA 5H8EA 4AZTA 4IVCA 5I3OA 3N4UA 4C7TA 4Z3VA 5M4CA 5TT7A 3PXYA 4ZXTA 4F9CA 4IAAA 5FEDA 3N4VA 2ZV2A 2C1BA 3LXPA 4I23A 2CKOA 4BZOA 4L6QA 4AU8A 2YCRA 3PE1A 3MPAA 2HK5A 2BILB 1OL2A 2R64A 3KA0A 3KMWA 3MVMA 5I9XA 3LZBA 4E20A 2IWIA 3R9DA 4AE9A 1M52A 1RE8A 1V0BA 2RSVA 3FPMA 4R78A 2C6TA 2PE1A 1J7IA 2W5BA 1FGKA 2UW6A 3Q52A 2XIZA 4F63A 2BAQA 1IASA 1YWNA 3ZO3A 3R9NA 4K9YA 4DG0E 2EXEA 2WMQA 4ITIA 2V5QA 4G3EA 2YM8A 3AC2A 3ZSHA 3DPKA 4CFWA 4A9YA 4CFVA 3VRZA 1MQBA 3V6RA 3COMA 3D7TA 3BGQA 1ZYSA 3PG3A 3Q53A 3CD8A 5M56A 2WOUA 2GS7A 4O27B 2YZLA 2XK4A 4YP8A 5FP6A 5IA1A 3LFAA 3MWUA 2JBOA 2B55A 4OTWA 2W7XA 3EQFA 4GVJA 3FHIA 2B54A 3QTSA 2CN8A 5BYYA 2WHBA 4A07A 4O7LA 4NWMA 3KCFA 2WELA 4IAYA 4RA5A 2QO9A 2WTVA 5A4LA 2VNYA 4XV1A 4M7IA 3UO4A 3ODZX 4S34A 3ATSA 1IR3A 3WZJA 5EDPA 2FSOX 4R3CA 4LQMA 5FEEA 2IW6A 4G34A 3QLFA 4QP9A 4FUYA 4RIXA 3CCNA 1ZMUA 3F5GA 4PMPA 3JXWA 4WRSA 4DGOA 3L9MA 2CNQA 1PXNA 4YZDA 3G2FA 3I0QA 1KSWA 5L2SA 4EK5A 4D2VA 3G9LX 3DBEA 3MA3A 4YTCA 3PPJA 1R1WA 3EIDA 3UO6A 5JFXA 5AV2A 1YOJA 4XV9A 3RZFA 4DEDA 4PV0A 4QO9A 3C7QA 4BCFA 4DE4A 2XK6A 4IJPA 3PTGA 1YDTE 3MH0A 2HW6A 4XRLA 4EOKA 4F1TA 2QCSA 1TQIA 3CR0A 3LFNA 2XK7A 5C8KA 2RFNA 3FY2A 5A4QA 3V5QA 4K33A 3F3UA 2J0KA 3R0TA 3VF8A 3TN8A 4DEAA 1I44A 2CSNA 4DG2E 1ZMWA 2WQBA 4HVGA 3T8OA 1RJBA 3BQCA 3DTWA 3QZHA 3R73A 5E1EA 4DFXE 5I4NA 1FPUA 5I3RA 2FH9A 4ZTHA 3TTJA 3NR9A 2GPHA 4ZSLA 4RC3A 4F08A 4QQTA 4OBPA 1KV1A 2F49A 3NYXA 4BCMA 3F3TA 5AP2A 5FBOA 4FVRA 3A4OX 1IEPA 1X8BA 3IOKA 3LAUA 3BELA 5HCYA 4CVAA 5C4LA 5EI2A 4EBWA 1ND4A 2VGPA 4IM0A 4X0MA 5CZIA 3PXFA 5EM5A 3ERKA 1DAYA 3ANRA 2DS1A 3GC0A 4TWOA 2YCQA 4JDHA 2BTRA 4D4SA 4EQMA 2Y8OA 5EH0A 4FSMA 4FYNA 3BLRA 2Y6OA 2A0CX 5CNOA 3CS9A 2C3KA 3UIBA 3U6IA 3JY0A 3FKLA 4KB8A 2BRBA 4D55A 4FF8A 3V6SA 1L8TA 5HESA 2YIXA 4RJ4A 5KZ0A 1OPLA 4JQ8A 1WAKA 4IBMA 5AP6A 4ZZOA 5AV1A 2QNJA 4RJ5A 4QTBA 2J5EA 5B2MA 2UZDA 3DQWA 2XJ2A 3LM5A 3RHKA 3SD0A 3OWPA 3QZGA 2YISA 3HAVA 1GZNA 5BVOA 5CSPA 4FV8A 4XX9A 5L2WA 5KHWA 5E92A 5C4KA 3LCKA 2KULA 3AC1A 4USDA 4RIWB 2P33A 4I0RA 2GNLA 2BZIB 3W8LA 2QONA 4FGBA 4U5JA 3TXOA 4OTFA 2VO3A 2OZAA 5CWZA 5FXSA 4GT4A 5CU6A 3LPBA 3GCSA 1FOTA 1YXVA 2YAKA 4TYGA 5CQUA 1YWVA 2G2HA 4FZ7A 5AM6A 3GI3A 3UQFA 3FQSA 4NW6A 4HYIA 3KXHA 4A9RA 3Q9XA 3BI6A 3FMDA 5IUGA 1MRYA 5L2QA 3IOPA 1IA9A 3KRJA 4IEBA 4D0XA 1Q4LA 4FKLA 3QQLA 5BVEA 4FR4A 2VTRA 5CT0A 1CMKE 4YO6A 4JG6A 4V01A 5HE2A 5J87A 3TEIA 2XRUA 2GCDA 4G17A 4BCIA 4L8MA 2WQNA 3WE4A 5CT7A 3Q9YA 4DGLC 4EH9A 2W06A 3QRJA 4QTEA 2PY3A 3A7IA 3Q2MA 1PXOA 5E8VA 4HNIA 3K3IA 4FE2A 3ZFMA 2AC5A 4U42A 3DOGA 5A14A 1F3MC 5ACKA 1GAGA 4PTGA 3LXNA 5EW9A 4F0GA 2YZAA 4TRLA 2GQSA 4CKIA 2EB3A 4ORKA 4YZBA 4DEHA 2YDJA 4WRGA 2C1AA 2ITTA 2C5VA 4Q9ZA 3HUBA 4BZDA 2SRCA 2YJRA 2JDOA 3VS2A 1QPCA 1R39A 4RMZA 3H0YA 5H8BA 5FUTA 1B6CB 2O2UA 1FQ1B 3KQ7A 4PL4A 3NYOA 2PWLA 2HY81 5DRDA 5AUYA 4EOPA 5FQDC 1H1PA 4PPBA 4HPUE 5A3XA 4BHZA 4O84A 5LVOA 5GHVA 5HD7A 4F65A 4II5A 4RJ6A 2PUUA 2BAKA 5J5SA 4BTMA 4BDAA 3BWJA 4D2SA 3MESA 4Z55A 3DB8A 2VTPA 3NGAA 4XG8A 5CQWA 2PE0A 5I9ZA 4AOJA 3FYJX 3NDMA 4YJUA 3E8CA 2ZDTA 2P2HA 4GL9A 4A7CA 2PMIA 3QKLA 3PJ1A 3BBWA 3ZC5A 5L2TA 2C6DA 3G6GA 1YKRA 1J3HA 1DS5A 3FLSA 3IECA 5CEMA 2HCKA 2RF9A 2VX1A 2OO8X 1MRUA 5AP4A 2V7AA 5E8UA 3W2PA 5GZ8A 3DLZA 1XH7A 4YJOA 4BF2A 1M17A 3GVUA 2PU8A 3MB7A 4R3PA 4DYMA 1TVOA 4AA0A 3FEGA 4EJ7A 2BAJA 3FJQE 4C37A 5F9EA 5DRBA 4I6BA 3D5VA 2UZTA 5FDPA 1NVRA 4IZYA 4H36A 4Y85A 1R0PA 1J7UA 5AV4A 4PWNA 1H0VA 4QMXA 2CCHA 2OW3A 4BBMA 1XQZA 5CAQA 1ERKA 3A7FA 3E92A 4IM3A 1OBGA 4X3FB 5AUVA 4H39A 4JG7A 5CF6A 2X4FA 1OUKA 2ZDUA 1CKJA 2BCJA 3IQ7A 4XBRA 5EYKA 2VTSA 2WTIA 5HVYA 2QOCA 5AR4A 2JFMA 4BGQA 4GK4A 4AW0A 3FZRA 1CTPE 4ZJVA 4ACCA 3R8VA 3ORZA 3FLNC 3NUAA 4YZCA 5LMKC 4FG9A 3IPHA 4KBKA 3UIXA 2BUJA 2QR8A 5HNGA 3VQUA 5LQFA 3LFCA 4C58A 4GYGA 2FSLX 4XMOA 4E6DA 3IW6A 4E1ZA 3ZMMA 2ZV9A 4ZSGA 3KMUA 2XMYA 3DGKA 2W1ZA 4F1OA 4YJSA 1PRYA 1TQMA 4WO5A 2VAGA 3NNXA 5C27A 4FKRA 1EH4A 4DINA 3DZOA 5TO8A 3FLZA 5AP3A 4RVMA 3PPKA 3UMWA 4BHNA 3EYHA 1NW1A 4IVBA 2IJMA 3CGOA 4EZ7A 4F9WA 4PMTA 4XOZA 4EEVA 3FMNA 1W98A 4ACHA 3OY3A 4RQKA 1E1VA 5EM8A 1U5QA 3ZM4A 4QP7A 4S31A 1A48A 4OTGA 4IVAA 4MBLA 2C0IA 4IANA 2IZSA 3NX8A 5ETAA 4BI2A 4YC8A 3IDPA 5KHXA 4D2PA 2YACA 5EHYA 4AW2A 3T9TA 4K18A 5M57A 2W4KA 5K5XA 3FI8A 4YHJA 1H26A 2JKMA 2OK1A 3KRWA 4WNKA 4RFZA 2WQOA 4Y83A 3BKBA 5HIEA 5TF9A 4ZAUA 4O81A 1XH8A 1H1WA 2AUHA 3E88A 4LOPA 3H9FA 1Z9XA 3MTFA 4M67A 4OTHA 1BUHA 5H9BA 3REPA 3RPOA 3FC1X 2RIOA 1Y57A 4I3ZA 2I0HA 4G9RA 1RQQA 4J53A 4RIOA 3FKOA 2C3IB 2ITWA 4DEGA 4MXZA 5FTQA 4CTBA 3FSKA 3GCQA 4OUCA 3E7OA 3ZFXA 4ERKA 3G0EA 1OBDA 1G3NA 4EOQA 2PE2A 4NW5A 4AG8A 4BICA 3VS0A 4U6RA 4KIPA 2OI4X 4V0GA 5K4JA 2BKKA 2IVVA 2HZNA 4ASZA 3LXLA 4IHPA 4CMOA 5HG5A 2W5AA 4UMQA 5G6VA 5HD4A 4DAWA 4M12A 2YIYA 3KN5A 4FT7A 4MXCA 4BCOA 3U9CA 5A6OA 2VD5A 3QRIA 2E9UA 3VBXA 3ORXA 1SM2A 5M51A 4F0FA 5AV3A 3D7TB 2JD5A 3OT3A 3O0GA 4M69B 1TKIA 2Q83A 2B9HA 3FMKA 5CALA 4K2RA 3EQCA 2YWVA 4KA3A 5GJDA 4NFNA 2BRGA 5CI7A 5HTBA 4I4FA 3WBLA 4U79A 4PNKA 4X6RA 2R9SA 3FBVA 3UO5A 5BUEA 5LVNA 4FG8A 2BROA 4DEIA 1QL6A 4U8ZA 2R3MA 2Y6MA 3D2KA 3E7VA 3A4PA 5LWNA 3LFSA 2VTOA 3FXXA 4NEUA 2JKKA 5FTOA 4EOIA 5AA8A 4EC9A 4EORA 4P7EA 5KMKA 4W9XA 3CE3A 4J96A 4IX5A 2F7EE 3MIYA 5BMMA 3NVKI 4RIXB 1PMNA 5HU3A 1NXKA 4ZSEA 2XH5A 4N6YA 3UZPA 3C4WA 4BYJA 2ETKA 3UPXA 2XUUA 5EYMA 3GC7A 2G1TA 4GFOA 3POZA 4GK2A 2X2KA 2UVXA 4WG4A 3L9NA 5L3AA 2R3PA 5LCJA 4O7RA 3HYHA 4NIFA 5IQIA 4R77A 3DKGA 3CKXA 2W1CA 1Q8UA 5HO7A 3QD3A 3NNVA 4U3ZA 4TYHB 3BLQA 5D7VA 2R3QA 4BDEA 1R78A 3BZ3A 2H96A 2YAAA 2BFXA 4FKVA 2C5XA 4M0YA 4GU9A 4O7WA 1T46A 1Y91A 4ZJJA 3CQEA 1M2QA 3CGFA 2ZVAA 2GHMA 5J7BA 3O96A 3R7UA 4BKJA 2O8YA 1SVGA 2EXMA 3MYGA 3QD2B 1FMKA 1YI3A 2KTYA 3WF9A 3QBNA 2F7XE 1KE7A 2BHHA 4U41A 5HCXA 4ACGA 4EZ3A 1BMKA 4IDTA 3VUKA 4BI0A 5J9LA 2WPAA 5C01A 3KVXA 2RKUA 4UBAA 4HZSA 1PMUA 5DR9A 2VWXA 3F88A 1DI9A 3EQHA 3ZTXA 4QMTA 5L6PA 3SA0A 3LLAA 3OCGA 1XKKA 3LMGA 4G3CA 1F5QA 3CEKA 3H9RA 2W0JA 5E8ZA 3ZRLA 2PULA 2CKEA 4U45A 2YCSA 5HIBA 3HLLA 3W2RA 4I6FA 4D2TA 2HIWA 3Q04A 5JRQA 4G31A 4Q5EA 4TXCA 1AGWA 4LUEA 1QMZA 4EK8A 3OP5A 1U54A 3HMPA 4MXYA 1ZYLA 4G3DA 3F3ZA 3DDQA 5JQ8A 4CZTA 3WI6A 1ZYCA 2ACXA 3MS9A 4EOOA 2I40A 2BR1A 4EOJA 5ETCA 2X7OA 1IAHA 2WTCA 3I79A 3MH1A 3R7VA 5HNIX 2ITUA 2GHGA 3FE3A 4ZTQA 4IXPA 5EKNA 3PG1A 5BYLA 3GCVA 5DEWA 4XHKB 4BN1A 4EQCA 4ALWA 4L01A 3FZOA 4HGLA 3TKUA 4FI1A 4JDJA 4FKUA 3EH9A 5DOSA 4ITHA 2W9FB 3Q96A 4RJ7A 2OZAB 3P0MA 1CM8A 3F2AA 3IDBA 2X4ZA 4O38A 4F9YA 4DHFA 3GC9A 4KNBA 4RBLA 4A9SA 3QA0A 2REIA 3ZU7A 3VN9A 1H07A 2R3FA 3ZRMA 1ZZLA 5ANIA 4B4LA 3IW8A 3FZPA 3GEQA 4F7LA 1UWJA 1Q8YA 3HV4A 3QTXA 1K2PA 5DPVA 4LUDA 4Y95A 4FEXA 4B99A 4DTKA 1HCLA 3BPRA 1Q24A 5J9YA 5M06A 3ROYA 1JPAA 3G33A 2UZOA 4DCAA 3QCXA 3QA8A 4V05A 3C9WA 2C6LA 2FUMA 4OAVB 5AUTA 3LE6A 2Z7RA 4MVFA 3ROCA 4DH7A 5AADA 4PY1A 4S30A 1YHWA 2WMVA 5GINE 4A4OA 3ETAA 4FKPA 4ZTSA 2A4LA 4EWHA 4A9TA 4DT9A 3EQBA 4NM7A 4Y5HA 5J95A 5CENA 4Q5HA 2B0QA 4A9UA 4ANBA 4DF3A 4U44A 4ZIMA 1V0PA 1Z57A 4X2GA 2XM9A 5CAPA 3LJ2A 5AR7A 3C0IA 3DXNA 4RC2A 4EH7A 4WSYA 4J52A 3TV6A 5JQ5A 2J9MA 2YFXA 3HDMA 3O2MA 3CY2A 2HY0A 3F9NA 4IFGA 2W1IA 4ZJIA 3AC8A 3GU5A 4FL1A 1OPKA 1G8SA 3KK8A 3AC4A 2B1PA 4OTQA 2FYSA 2RG6A 5CSHA 1KE8A 2Y9QA 4QPSA 3BEGA 2I6LA 5KMLA 5E4HA 3VS1A 2X81A 3ZXZA 1GZ8A 2UW9A 1S9JA 3BYSA 4BDGA 4CKRA 2I0EA 2XIXA 4WT6A 3PVUA 1MUOA 1WBWA 4C2VA 4GT3A 4XLVA 2A19B 2OKRA 3LFEA 4TYEA 4AGCA 3AD4A 4MBJA 3V5TA 3UG1A 3PA5A 4QMSA 3VUMA 1KUTA 3HMMA 3O50A 2YLFA 2A2AA 4B0GA 4H3PA 1ZRZA 5K0KA 3COKA 4D1XA 5I0BA 5BVFA 5C9CA 4BZNA 3E64A 3OXIA 4MK0A 4O82A 4BBEA 4LGGA 3FL5A 2ZJWA 3JR1A 2QHNA 4TWPA 2XNOA 2QG7A 4NTTA 3PSBA 2NNWB 3FLWA 3IW7A 4FIIA 2EXCX 5CSVA 3DBCA 5L4QA 2J5FA 3GU8A 3R6XA 4C4GA 3Q9ZA 5LWMA 5IQDA 1BI8A 2X2LA 3F82A 5CF8A 3BCEA 4E4NA 3TDVA 2XEYA 4QP6A 4XH6A 4JX7A 1UKIA 4TNBA 4QD6A 3I6WA 3E8NA 3G51A 2FO0A 4NU1A 4P5QA 4KUJA 1I09A 3U54A 3AGMA 4D58A 5FM2A 3ZHPC 2YCFA 4WA9A 3UC4A 5CF5A 3FI4A 4HGTA 4U97A 4L53A 2R3RA 4QMOA 3W32A 4C2WA 4EOSA 3A61A 4JQ7A 4OW8A 4YLJA 5T68A 4DTAA 3L8XA 3I6UA 3R8UA 4E8AA 5IDNA 3CY3A 3QD4A 2C3JA 1YW2A 1MRVA 1XWSA 4NUSA 4O0VA 4ZMEA 2QVSE 3MA6A 3OXZA 4DBNA 1PYXA 3QX2A 4YZNA 4GT5A 5A54A 5HNBA 2Z02A 4K1BA 5LARA 1VYZA 3ZBFA 3VBWA 3BEAA 4LL0A 4TKSA 4RX5A 2VX3A 3G90X 1E1XA 3GU4A 4FV6A 4O0SA 5FXQA 5CEOA 4APCA 4GSBA 5M4FA 5EI8A 4IDVA 4IZ7A 3EWHA 1Q5KA 5HOAA 3SDJA 5ANKA 3EFLA 1OGUA 2W05A 3Q4TA 2UW4A 4IMYA 2YDIA 4QMPA 5JT2A 2W1GA 3ACJA 4RC4A 3RPRA 4FIHA 3RM6A 1YI6A 3R71A 2ZM1A 2W96B 4KD1A 4CQEA 3R02A 3BU6A 4GIIA 4FV9A 5HE0A 1PMEA 3R1NA 4YUQA 3NUPA 4EYJA 3AQVA 4KWPA 5L6WL 3NW7A 3VRYA 5CU0A 2PVNA 3TZ9A 4AZEA 2VWBA 3ORIA 1A06A 4OLIA 4L52A 2VV9A 2V0DA 4LGDA 3UIUA 5M09A 5ETIA 3UP7A 4QMMA 4QMYA 3UOLA 3OC1A 3TNWA 4CFNA 4DGMA 4MQ1A 5DFPA 3QHRA 4Y5QA 4HCUA 3W10A 2ESMA 2VTHA 1Q8WA 3P08A 4FSNA 3BHTA 2GNHA 4UXQA 1P14A 5CSWA 5AIKA 3IDCA 1PKGA 3Q5IA 3JYAA 4YGAA 5C26A 4TN6A 4FEQA 3R8MA 3Q3BA 4HZRA 4OT6A 5KO1A 4L3LA 5KZIA 4OTIA 4AQCA 2W1FA 3IS5A 1HCKA 1ZOHA 4E7WA 1LUFA 5GNKA 4DGNA 3M2WA 5J79A 3LM0A 3QC4A 4MEDA 4ZLYA 4M0ZA 4EHZA 3PUPA 4V0GB 2J50A 3DJ6A 3H4JA 4LOOA 5AX9A 2YIRA 5DR2A 4G6OA 2QOOA 3VIDA 2QLQA 4PQNA 4BTJA 2XBAA 3KXNA 2GS6A 2PVKA 2ITVA 3ZH8A 4C4JA 2W9ZB 4QTCA 1XHAA 4E5BA 4ITJA 5ANDA 3V51A 2C47A 3IKAA 3CPCA 4ANSA 2WZJA 2YEXA 4YJVA 3V5LA 4DFNA 3OBGA 1WVWA 4OTPA 2XB7A 2RFSA 3QZFA 3QQHA 4W4VA 3WOWA 3KEXA 3L8SA 3QC9A 3GU6A 4ANNA 2WTKB 4CZUA 1UKHA 2YM3A 2NP8A 1OKYA 4AGDA 3EN9A 4EK4A 5C1QB 5HORA 4U7ZA 2J0JA 4GU6A 2CCIA 4MXXA 2WU7A 4K8AA 1AD5A 3TIZA 5KMOA 4DG3E 3BE9A 2ZMCA 3DKCA 3F5UA 4BCHA 3DKOA 3ORPA 3EJ1A 3EKKA 3R2BA 1KE6A 5LVPA 1H1SA 3PJ2A 2BRNA 4GJ3A 3PP1A 4PDYA 3QRUA 2R2PA 3ALNA 5HX8A 4I41A 2ZM4A 1WMKA 4BDJA 3COIA 5FXRA 3ORTA 4E93A 4EH8A 2W1EA 4N6ZA 3OVVA 3NVMB 4C4EA 4RA4A 5IG1A 3R9OA 4NIFB 2VU3A 2OFVA 4KIOA 3RCJA 3VBYA 3BHUA 2XK3A 1UU3A 3GCUA 3AT4A 1JAMA 4I6HA 2FA2A 2JDRA 3QCSA 4MKCA 2Q0BA 1ZOEA 2W99B 5ANOA 3ZM9A 3G0FA 3K2LA 3P7AA 4OTRA 4X2JA 1KV2A 3ULIA 1W0XC 3ZLXA 1XR1A 4C4HA 3E5AA 4PMSA 1PXJA 2WEIA 3SRVB 2HZ0A 4IQ6A 3LCDA 3PIXA 2P3GX 3KXGA 4FTKA 4ZLZA 1OI9A 3LHJA 3QTRA 2PUPA 3UP2A 2W4JA 2I0VA 4DFUA 5KKRB 4O83A 1FBNA 4APPA 4AZFA 2QU5A 3FKNA 3OMVA 2XNGA 5FTGA 4EH6A 4XUFA 4JBPA 1K9AA 2R5TA 4I0SA 4C38A 4QMVA 2ETRA 3U6HA 3VBQA 3HKOA 1ZYJA 2RFDA 4JBQA 4ZTRA 1DAWA 2UZNA 3F5PA 4EHGA 3EFKA 2R7BA 4BCJA 2IZUA 2YM6A 2JEDA 4CV9A 3MFSA 3OW4A 4PUZA 1DM2A 4PNIA 1UU9A 4ZTNA 4ZZMA 4RX7A 4HVDA 5AUXA 4KIKA 5ANEA 4ALVA 5A6NA 2R3KA 1U54B 3OCSA 5BVNA 2J0IA 4WKQA 2X7FA 3GP0A 5HTCA 4Q2AA 2UZLA 1ZOGA 5KMMA 4FEVA 2WIPA 4BCKA 4QP1A 2H34A 3OHTA 4IIRA 4UB7A 5FP5A 5HLWA 1MQ4A 5JMSA 4L68A 2VWZA 4FKWA 3KF4A 3F7WA 3K5UA 3U4UA 5EYDA 5M07A 5JEBA 4IW0A 3MY0A 4O0RA 4R8QA 5EM6A 3HP2A 3OD6X 2E2BA 4F70A 4BR3A 3AG9A 4JJRA 1APME 3BQRA 5CY3A 1UVRA 3FZSA 4FV2A 4KKHA 4GCJA 4NK9A 2XKDA 3HV6A 4A06A 4IB1A 1OZ1A 1REKA 5IA4A 2X8DA 3DJ5A 3QCQA 4BWPA 2WMTA 2ITPA 2X8IA 5AP1A 3LCTA 4RLKA 4X3JA 5AUUA 5EQPA 2JDSA 4X2FA 2R3LA 2Z2WA 3OF0A 5DT3A 5LMKA 1DI8A 4CZYB 4FGRA 1OL1A 2UVYA 3ZC6A 3QD0A 4JRNA 3RAKA 3QQKA 3E63A 5AP0A 5IQAA 3DLSA 1NY3A 2R4BA 3TL8A 3EKNA 1JKTA 2IVUA 1OIUA 3KRXA 1PYEA 3PA4A 3OFMA 1OKVA 3D83A 5CU3A 4WIHA 3EHAA 3NYVA 3R28A 1CSNA 4B8LA 4M68A 4UMUA 3P86A 2Z8CA 3PXKA 4U9AA 5CVGA 2BVAA 3QQFA 4XBUA 4FOCA 3RGFA 4ZP5A 5CAOA 1XJDA 1H01A 1JSUA 1H24A 3R83A 2JGZA 1VZOA 4FIFA 4UXLA 3TWJA 5M4UA 1GIIA 4FSUA 1ZXEA 1WVYA 3EZRA 5K3YA 1BYGA 4EUTA 4QP2A 4QP3A 3QYZA 4CQGA 3VBVA 4D4RA 4DGGA 1PHKA 4HGEA 3QTQA 4QP4A 3OTVA 3A60A 3MW1A 3PP0A 3MPTA 4G1WA 4IC7A 4ANOA 2ZOQA 2PVLA 3HX4A 2JDVA 4FTQA 4Z9LA 1XBBA 2WMWA 3CTJA 4FTTA 3ET7A 4B9DA 5EM7A 4K11A 1T45A 4FKQA 3W18A 4GG5A 3QCYA 4NKSA 5HTIA 4QMQA 5ICPA 3UTOA 5AUWA 3KC3A 4EC8A 4EYMA 4CG9A 4BDDA 2NRYA 2I1MA 1H25A 3W55A 3NIEA 3PRFA 1XH4A 3FMJA 4TW9A 2R0UA 2LAVA 3BWFA 5CAUA 4FV5A 2OGVA 4YZMA 4DH8A 3ITZA 3C0HA 3FLYA 1WBTA 3R00A 3I7CA 5HBJA 2X8EA 3E87A 2C6IA 2R3HA 4R5YA 3HV7A 4D28A 5BUJA 3U55A 4NKAA 5B2LA 5GJFA 2C6MA 4XV3A 3AD5A 4H58A 1BL6A 2PSQA 4YU2A 4CEGA 4I21A 5EQEA 3Q6WA 5CNNA 1W8CA 5E90A 2X9EA 3ZLSA 4ACDA 2GQRA 1JKSA 3JPVA 3HGKA 1A9UA 3OEFX 5LOHA 4UYNA 4LL5A 1FINA 1O6LA 2E9OA 4FICA 4CLJA 3D15A 3EQRA 5AMNA 3OWJA 3FLQA 1QPDA 4XNEA 3PY0A 5D7AA 5IEYA 5IQFA 2BIYA 2UZBA 4CGAA 2PMOX 1Y8GA 4FYOA 3MPMA 3ODYX 2ZMDA 3ZZWA 2QHMA 4GUEA 3TTIA 2WMXA 4FC0A 2PL0A 5AEPA 5JFWA 3DA6A 4L42A 3UZRA 3ORLA 4IACA 2VTNA 1U59A 4NM3A 3MV5A 1P4FA 3JY9A 4P90A 5BUIA 2CGXA 4CFUA 4MX9A 4EOMA 4DFZE 4RX8A 2QLUA 4B6LA 4O2ZA 4D1ZA 4GW8A 2JLDA 3TNIA 1M2PA 4J98A 4YTHA 2EWAA 4FZAB 4D4VA 4F7NA 1H00A 4ONAA 3OY1A 4XRJA 4AF3A 4AOTA 3PIZA 3NPCA 1Q3WA 3L1SA 3TT0A 4MAOA 4PX6A 4IJ9A 3TZ8A 2Y4IB 3A7JA 5AJQA 3TI1A 3UC3A 3DBQA 3ZFYA 4ACMA 5JFVA 4C59A 3CSVA 4YJNA 3E3BX 4WBBB 5B0XA 3R9HA 2G01A 3UJGA 2XKEA 4RWIA 4WNPA 4FOBA 4JBOA 4FV4A 4YTIA 3RAHA 4AT3A 4CFXA 3MSSA 3GOKA 3K54A 2VWWA 2WTJA 4KS8A 3ORNA 5I9WA 4U80A 3QX4A 2DWBA 3HZTA 1SMHA 4I5CA 4AOIA 3AGLA 3KRRA 4USEA 2EVAA 3CQUA 2XIYA 5CS6A 2VX0A 3RNYA 4DH3A 3DJ7A 5BX0A 4F6WA 3KULA 4JNWA 3QWKA 4LV5A 3DY7A 4FTOA 1WBSA 2OXXA 5AIRA 2J7TA 4GUBA 2ZB1A 1Y6AA 4AXAA 5IMEA 4F6SA 3FY0A 1YOLA 2BDFA 2QKRA 5CTPA 5HLPA 5CEQA 1GZOA 2PHKA 3ZXTA 1O6YA 5AAFA 1ZLTA 2OLCA 3AOXA 4YHTA 2PVHA 5DIAA 2C6EA 2W5HA 4W4WA 4BGGA 4EJNA 4FTNA 4J71A 3PYYA 1H27A 5E8YA 4EHEA 3QAME 4XYFA 3THBA 2GQGA 1WCCA 3GFEA 5A4TA 3Q32A 3BV3A 4W8EA 4BDFA 1P5EA 3QU0A 4UX9A 2UVZA 2YITA 3VW8A 5D12A 2Y0AA 5AR8A 4DEBA 5FEQA 4QNAA 3RALA 5KMIA 5LMAA 5LVMA 3BYOA 5DGZA 1OL5A 3VS5A 3ZSGA 4E3CA 4JAJA 4R6VA 3QZIA 4O6LA 3CJGA 4FSWA 2R3JA 1GOLA 4O0TA 4UMTA 4FMQA 3AMYA 3OUNB 4S33A 4YSJA 3UOHA 5HLNA 4JRVA 3FQHA 3ZLYA 3ZZEA 4MD8E 2ITNA 4AACA 3KREA 3FSFA 3NNWA 1U5RA 2ITYA 3A8XA 2A1AB 1WZYA 1GNGA 1PXPA 3I7BA 2JBPA 4IB5A 5H3QA 1YRPA 2QC6A 2C6KA 4FT3A 5HZNA 1PMVA 2ERZE 3FI3A 3GBZA 3HMIA 4P4CA 4O6EA 5IQHA 4TWNA 3KMMA 5F95A 2XJ0A 5LVLA 3CIKA 2CHLA 4BDCA 3QLGA 4KSQA 3TZMA 3JVRA 3WZEA 4PF4A 4EH4A 2Q0NA 4I4EA 4E26A 4UALA 4IB3A 4CRSA 2B52A 1REJA 4MNEA 3D14A 4NM5A 2CKPA 3V8TA 3FXZA 2C5NA 3S4QA 5ANGA 4BDHA 3RNIA 3KVWA 2JITA 2H8HA 4O7NA 2VO6A 5CU2A 4CLIA 3OWKA 5L8LA 3D7ZA 4UV0A 5EYCA 1PF8A 2ONLC 4R7HA 3ANQA 5LXMA 5AUZA 4UMPA 2VZ6A 5CEIA 1H28A 1UU8A 3FYKX 3S95A 2OJJA 1OMWA 3NW6A 4FKOA 4O7YA 4FNYA 5D1JA 3NCZA 2OXYA 4N57A 3G15A 2CN5A 4ZEGA 4QMZA 4ZY5A 5HX6A 5EK7A 5IF1A 4O96A 5AA9A 4BVUA 4DN5A 5GIPE 4JT3A 4TY1A 2IPXA 3VS3A 4TPTA 1LEWA 4FTIA 2WIHA 4WG3A 1O9UA 1GIHA 5IEXA 3OEZA 1VJYA 2GHLA 5LCKA 4C3PA 3VUTA 3Q60A 4MBIA 4N4SA 4H05A 1M14A 3R7OA 2XKCA 3OTUA 2XM8A 3MJ2A 5TKDA 2JKOA 3Q4UA 4IFCA 4QYGA 3TKIA 5IQCA 3OZ6A 4FNWA 2HELA 2WFYA 4FTAA 4JVGA 2WTWA 2XNPA 4UY9A 4D5HA 3CPBA 4O0UA 5IMXA 4FNZA 2GDOA 3DNEA 5DN3A 2EUFB 1W83A 4D4YA 4YBJA 5IISA 3NUYA 4X2NA 3PSCA 3F2NA 5CX9A 4DFBA 4KIKB 1KOAA 1LPUA 4HCTA 2PVYA 5DNRA 4OBQA 1J91A 2QI8A 2G15A 3OS3A 4Y46A 5C8MA 2XNNA 5CI6A 4MWHA 2WMSA 2Y4PA 5BMSA 1PW2A 5JK3A 5CSXA 2XJ1A 2UZEA 1ZY5A 5IA0A 4I1ZA 2WAJA 2PPQA 1SNUA 1ZARA 3UGCA 3QUDA 5KUPA 5DYJA 3RCDA 4FTUA 3SXRA 3LXKA 4D2WA 2CGUA 4HVSA 4M13A 1YDSE 2QURA 3BV2A 3D94A 4H1JA 5FG8A 3SC1A 3UNZA 2XCHA 3TIYA 3RI1A 4CMTA 5I5ZA 4RFYA 4ASDA 4E4LA 2WTKC 4O22A 3SHEA 5I9VA 4EWQA 4FSZA 2F57A 2CNVA 4RIWA 4EKLA 3SXFA 2PZPA 4JBVA 4XV2A 4BRXA 2BTSA 3CXWA 4HOKA 4WHZA 3VVHA 4FSYA 5HU9A 4AA5A 4YMJA 1JQHA 2X7GA 4YBKA 4I92A 3O7LB 2X2MA 3QTUA 4JLCA 4RSSA 3ENHA 3VS7A 3O8UA 3QRKA 4L00A 1JWHA 5GIOE 4XG9A 3ID6C 4QQJA 2DYLA 2PZYA 3AT3A 5ETFA 4MNFA 2HOGA 2OFUA 5LMBA 4KABA 3SQQA 3TM0A 2OBJA 1JLUE 2VWYA 2BDWA 4BIBA 4EOLA 4MD7E 2CGVA 2R0IA 3LQ8A 1SZMA 3POOA 3UOKA 2IZTA 4RVLA 3LCSA 4GFGA 3MDYA 4I6QA 2YWPA 1H08A 4XS2A 5B7VA 3KF7A 4HYHA 2HZIA 4BY9E 2WKMA 3H10A 3BX5A 4CTCA 4TWCA 3JUHA 4PDOA 3EZVA 5HBHA 4XG6A 3MI9A 3V5PA 1FGIA 4D2RA 3QGWA 3C51A 4UN0C 2VN9A 3R21A 4NYEA 4IZAA 4Y73A 4I93A 5M44A 2VNWA 5HO8A 3EYGA 2C3LA 3F3WA 4QPAA 5C8NA 4FIGA 4BYIA 4RVTA 2UW7A 1XO2B 4EL9A 1OUYA 4E73A 4FIJA 3MVJA 4FKTA 4PRJA 4EONA 2WMBA 1S9IA 5C03A 5KKRC 3KXMA 2IG7A 3HRCA 3H0ZA 3W1FA 3PDTA 1YXTA 5DE2A 3QL8A 2B9FA 4OR5A 3TUDA 1YXSA 5EFQA 4Y8DA 5AWMA 3DB6A 1V0OA 4W8DA 3VUGA 4OBOA 2NRUA 4PDPA 3EB0A 2ZYBA 3HRFA 3NCGA 4BIEA 4JDKA 3RKBA 5D9HA 3QTZA 3BU3A 5ANJA 3BYMA 1SNXA 2B4SB 3ULZA 5JGDA 2QOQA 1WBVA 4RIYA 5A4EA 4FSQA 4HNFA 3PSDA 1XBCA 2CMWA 4E4XA 3WYYA 5CANA 3NAYA 3C4EA 5IH4A 1WBNA 3U6JA 3WIGA 4UWBA 1BKXA 4XG2A 5H2UA 2NPQA 3N51A 3PA3A 1P2AA 4CSVA 3E93A 3PY1A 3FZ1A 4OAUC 3VHEA 3OUKA 3R1SA 5HO6A 3EN7A 1P4OA 2WU6A 4L44A 2VO0A 4F9BA 4ID7A 3NS9A 5DBXA 5CEPA 3IW5A 2GNGA 2XIKA 4K77A 4ARKA 3VBTA 5K0XA 2OIBA 3PJ8A 4HYSA 2QODA 3UQGA 5JRSA 5FLFA 5KMNA 5CXZA 3MFTA 3HVCA 4ERWA 3NUNA 3SGCA 1HOWA 1PY5A 3QGYA 3OCTA 3WILA 4OT5A 3EL7A 3IONA 1YXXA 4G6NA 1ZMVA 4QQCA 2NO3A 4C8BA 3QQGA 2UV2A 3UZTA 3DBDA 4D5KA 3LMHA 5GZ9A 3PIYA 2GNFA 3WYXA 4FKSA 3D5WA 3OG7A 3FAAA 3LLTA 2GNIA 1YQJA 3TDWA 4EZ5A 3BE2A 3NUXA 4O7ZA 4RGJA 4BCPA 3MVHA 4GVAA 5E9EA 4WOVA 3UMXA 3UE4A 3Q6UA 3MBLA 1F0QA
chains in the Genus database with same CATH superfamily
2IVSA 3TJCA 2LGCA 3S3IA 1LEZA 3PZHA 3MGYA 4CYJA 2X39A 3C0GA 3P7BA 4UZDA 3PY3A 3RPVA 4LV7A 2Z60A 2P0CA 3NUUA 4LFIA 4IAKA 2XS0A 2JAMA 5K5NA 4M3QA 4R7BA 3QWJA 3I5ZA 3IGGA 5J9ZA 3ZO2A 2C4GA 2XCKA 2XALA 5DG5A 2PVFA 1BI7A 3BHYA 4FK3A 3FI2A 4HGSA 4IAIA 4KS7A 3RPSA 2BHEA 4U81A 5DH3A 2VWVA 3IG7A 3ACKA 4FODA 3TCPA 4EK6A 3TZ7A 3R1YA 4JIKA 2BZKB 4IX6A 3SW7A 2GSFA 3F6XA 3KULB 4JX3A 4RWKA 4XP3A 4AX8A 3LQ5A 5BNJA 4MCVA 4I0TA 2ITOA 3QQUA 4R7IA 5GZAA 4AS0A 2OZOA 4YO4A 3LFFA 3OWLA 2H6DA 4LOQA 4N70A 3GGFA 5H8GA 1XH5A 3DK7A 5BVKA 4IWPA 4MF1A 3CJFA 3C4ZA 4HPTE 4CMUA 3LKMA 4AGWA 4OGRA 4JAIA 4RQVA 4F7SA 2EU9A 1Q62A 3H9OA 3L8PA 3ZUUA 2RG5A 1SYKA 2Z7LA 3DAJA 1YXUA 4M84A 4RZWA 3ZOSA 3HAMA 3DZQA 2ZAZA 2BALA 2R3IA 2YA9A 4LG4A 4XG4A 2OF2A 1FMOE 3SV0A 2YM4A 3WF6A 4R1VA 4YLKA 3H3CA 4CYIA 5HVKA 5K9IA 3ZSIA 4E4MA 5J1VA 3SVVA 3A2CA 2WQMA 3GNIB 3EQPA 3VC4A 3VF9A 3VULA 4M15A 3AKLA 3R01A 5IUIA 4IB0A 2B9JA 2QKWB 2X6EA 3C13A 3G6HA 4X3FC 1IG1A 5DI1A 4ZS0A 1JSVA 4QPMA 4O21A 4QTAA 3C4FA 3TNQB 5BPYA 4KAOA 3HNGA 2A27A 3AC5A 5TOZA 3VAPA 2WMUA 4NH1A 4BCQA 2HXQA 4PDSA 1AQ1A 3TNHA 4FL2A 3C5UA 4PP9A 2W1HA 1XBAA 3MFRA 4LRKA 4M69A 3VHKA 5CF4A 4IM2A 3DT1A 4AW5A 3RWPA 3AMBA 4AZWA 3SG9A 4I5HA 2UZVA 3KXXA 3R7YA 3F61A 3VJNA 4M8TA 2QOKA 1M2RA 3GOPA 4XP2A 5LJJA 2XARA 2Z7SA 3KCKA 3F7ZA 4TZRA 3A99A 3OROA 4D0WA 3WZDA 5DLSA 2W17A 4XEYA 3PZEA 1NA7A 4JR7A 3KGAA 5AR5A 5TR6A 3UG2A 4HW7A 5JSMA 5JZJA 5K4IA 2C0TA 1G5SA 1UNHA 1UNLA 2QO2A 5EKOA 3SW4A 3LIJA 3F66A 3LJ1A 4A4XA 1URWA 4KKEA 4MNEB 2WO6A 3L9PA 4O1PA 5CLPA 1RW8A 5KX8A 2GU8A 3MH3A 3NW5A 3A62A 4IH8A 4IC8A 1YHSA 2VTQA 2R3GA 2VTAA 2P55A 3M11A 4NCTC 5J5TA 2Y4IC 4GFMA 5BV3A 4JR3A 3UVQA 4AT4A 3T9IA 2JIIA 4IWOA 3DBFA 5HE1A 2WOTA 3BYUA 3NNUA 2BZHB 4PTEA 4TL0A 4KBAA 5HHWA 2VWUA 1G8AA 1H0WA 4LRJA 4RRVA 4TYHA 5CXHA 1OGYA 3DFAA 4KRDA 5HEZA 2X6DA 4BCGA 5L8KA 5T3QA 1PJKA 3KY2A 2BFYA 4F1MA 3KKVA 2YDKA 4PTCA 3EMGA 4ZSJA 3V8WA 4AUAA 5IEVA 2GMXA 4JQEA 5HKMA 3FMMA 2Y7JA 3ZUTA 5F1ZA 4YLLA 3HV3A 2HWOA 4MYGA 3TV7A 4ZTMA 4NL0A 4FV7A 4AN3A 4YJTA 4FTRA 2AYPA 3GC8A 3U8WA 4H3BA 5IH5A 1FVTA 4FZ6A 5AAGA 3QUEA 4JXFA 3HECA 3ATTA 4KINA 3M1SA 5D11A 3RVGA 5FM3A 1YI4A 3NWWA 4ZLOA 4FT0A 4P5ZA 2OSCA 2RFEA 3W2SA 1OKZA 4E6CA 2ERKA 3T3VA 3SOAA 3D5UA 3WF7A 4M14A 4C0TA 4C57A 1PKDA 3PXRA 4IAFA 4YJQA 3GB2A 3TACA 4UZHA 4BDIA 5KMJA 4O1OA 1PXIA 3KB7A 4KBCA 4TTHB 4DT8A 5IZFA 1Q41A 2BZJA 4YPSA 5HQ0A 1YWRA 1R0EA 3NLBA 4BDBA 2QOHA 3PFQA 4NFMA 4LMUA 4D9TA 1OITA 4Q9SA 3EOCA 4CT2A 5HG8A 5FDXA 2ITQA 4PL3A 2C6OA 4YR8A 3QALE 2FVDA 5IQEA 2OIDA 3LJ0A 2XYNA 4O0YA 3D5XA 2UUEA 2CPKE 3NSZA 1PXMA 4J8MA 3RAWA 2QG5A 4FEUA 3D0EA 5IKWA 1BX6A 1Q8ZA 3FPQA 4AZSA 4BWXA 4IX3A 4DFYA 2B53A 2C5OA 4O2PA 3FDNA 5HBEA 5HICA 3R7EA 4EK3A 4AXFA 1R3CA 1OKWA 3AD6A 4IVDA 2ZFYA 1Q61A 2HWPA 4YZ9A 4AGUA 2O3PA 2VTIA 3OBJA 4J1RA 2C30A 2JIUA 5L8JA 3U87A 1GJOA 3PWDA 3ZCLA 3N9XA 3CD3A 1ZWSA 2X0GA 3NAXA 4NSTA 5FRIA 2CLXA 4AQKA 4UEUA 3O8PA 4WUNA 4C3RA 2AC3A 3KXZA 4AAAA 4BIDA 2ZV7A 4AA4A 5IPJA 4G9CA 4FIEA 4PMMA 5DT4A 3KK9A 3UVPA 5EDRA 4ANMA 3V04A 5BVDA 2WEVA 4MH7A 4M97A 3RBWA 4MF0A 2QR7A 2E9VA 3S00A 1W82A 2WNTA 2ITXA 4U0IA 5DR6A 3AXWA 1K3AA 3B2WA 3E3PA 1B39A 1W84A 3CLYA 4FBXA 4O4FA 5D41A 4C35A 4XOYA 3DCVA 3FZTA 3QQJA 4AFEA 1Q3DA 5E8XA 4D1SA 2IVTA 3TG1A 3RZBA 1CKIA 4MHAA 3W8QA 2ZV8A 2P2IA 2BMCA 4LV8A 3DQXA 3Q2JA 3FWQA 3QRTA 4CD0A 3P79A 4L45A 4W4YA 3HUCA 5HI2A 3WF5A 3MH2A 2PVRA 4YNEA 4QDEA 2R7IA 2OWBA 3BU5A 2J0LA 3NZ0A 5FWKK 2J2IB 2J90A 5EI6A 4LGHA 2ITZA 2JKQA 3VS4A 5IQGA 3M42A 3QFVA 3BBTB 3O51A 3F2RA 3TNPC 2FSMX 5EHOA 4EHVA 5JGBA 4RIYB 4FVQA 1ZZ2A 4FNXA 4ZZNA 2UZUE 3DU8A 4J7BA 4AP7A 3HL7A 3PJCA 2GS2A 2JAVA 2YM7A 3GXLA 3L8VA 3O8TA 4FKGA 3FC2A 3KRLA 3GUBA 4RG0A 3T3UA 4O7VA 5L2IA 3C4CA 4RZVA 2QU6A 1VEBA 1LP4A 2UW3A 3TUBA 2VRXA 4W9WA 5DVRA 4LI5A 3ZLWA 2PMNX 3IW4A 4X7QA 4Z16A 4USFA 4YTFA 4ALUA 1Q99A 2GFSA 2QOBA 4DLJA 5IA3A 3P4KA 4ZS4A 1BLXA 2F2UA 3AT2A 3DFCB 5EW8A 5IDPA 1L3RE 3TJDA 4AT5A 4ENYA 2X1NA 3PPZA 3MJ1A 2XK8A 3Q4ZA 1YDRE 5DEYA 5E8WA 3V01A 3PXZA 2CGWA 4IX4A 4IWDA 3ORMA 4QNYA 1WBOA 1OM1A 4Z7GA 2BKZA 5EQYA 1CKPA 2UZWE 5AR3A 1NT2A 5IH6A 4M66A 3RWQA 1CDKA 4C02A 3MIAA 2WMRA 4Y72A 3SLSA 2HYYA 4S32A 2OJGA 3P9JA 4KSPA 5EOBA 1SVEA 3FMEA 4GV1A 3OXTA 4FTCA 3H30A 4L3JA 3GENA 4QYHA 4YC3A 2QOFA 4R1YA 3W2QA 5CYIA 5IUHA 5KBRA 4CCBA 2WXVA 2W1DA 2O64A 2PUIA 3R1QA 3O17A 2I7QA 2BRMA 2WB8A 1H8FA 3UQCA 1U46A 4RPVA 3VUHA 4JI9A 3WZKA 2YLEA 3VWAA 4GRBA 4DTBA 4UWYA 1URCA 2PK9A 3D4QA 3KN6A 3MFUA 4WNMA 2OJ9A 3ORKA 4AWIA 1JBPE 5BVWA 5GJGA 4G3GA 4BTKA 2XRWA 2BDJA 4QT1A 4AE6A 3F3VA 5EW3A 3EN5A 3RK7A 4FZDB 4BJJA 2CLQA 4FSTA 4IADA 3A8WA 4V04A 4XLIA 2ONLA 3GCPA 5TE0A 2YHVA 4F4PA 4O7SA 3BHVA 2CNUA 3U51A 2FSTX 2UW8A 2QD9A 5E8TA 2PMLX 3I1AA 3PXQA 3QYWA 4A4LA 1UU7A 4G5PA 4C4IA 2I0YA 2X0PA 1ATPE 4FV1A 4GEOA 4E5WA 2RL5A 3R7GA 3I4BA 4O0WA 3BRBA 3QKKA 4L43A 1VYWA 4FK6A 3RINA 4QDVA 3DXPA 2BIKB 4CRLA 3EQIA 3R8ZA 5JKGA 4QEBA 4QYEA 3S2PA 5CAVA 4ZK5A 3FHRA 2OH0E 4MXOA 4CFFA 4OTDA 3WE8A 3R9RA 1JVPP 2J6MA 2J0MB 3VS6A 3NEWA 3ENMA 4X21A 5A46A 3UYTA 4BGHA 4ASXA 1UWHA 3DXQA 3RMFA 4RVKA 4QMNA 3BIZA 5FBNC 3BL9A 3WARA 4PPCA 1FVRA 2BRHA 4HCVA 1PXLA 3O71A 2EB2A 2VTLA 2FB8A 3DS6A 4PPAA 4F6UA 2WQEA 4P2KA 2YM5A 5FGKA 3PLSA 4XJ0A 3IO7A 4FT5A 5F20A 3CBLA 4TYIA 5FD2A 5BQ0A 1IA8A 3NRMA 3HP5A 4LYNA 5AM7A 3W33A 4CNHA 2C68A 3VUDA 4AZVA 3ELJA 3HA6A 1NVQA 4FTLA 3SAYA 2XZSA 2PZIA 3RTPA 5KNJA 1XH9A 3PLAE 3FL4A 3FQEA 2WTDA 3LOKA 3NYNA 4I94A 5JZNA 3UODA 4QMWA 2C0OA 4NJDA 2VWIA 3K3JA 2VTMA 4RJ3A 1Q8TA 4ZSAA 4ANLA 3ZS5A 4FV0A 3F69A 3MY1A 5JGAA 3LVPA 4FTMA 3AC3A 3ZYAA 5DT0A 4AN9A 2XNMA 3NIZA 4B8MA 2V55A 2O65A 3EFJA 3ZBXA 4BKYA 3F5XA 4I5MA 4BI1A 4FTJA 3V5JA 4BL1A 3PE2A 4DC2A 3UIMA 5AR2A 5IA2A 3ZDUA 4BC6A 4F0IA 3COHA 3LMIA 4BCNA 4YJPA 3UBDA 2F9GA 4X6QC 5HIDA 3RPYA 4FKJA 5KCVA 4WG5A 5ITAA 3R8LA 3R2YA 5EG3A 3OT8A 4GH2A 4I24A 5DMZA 4C4FA 3A7HA 4EI4A 5A9UA 3MN3A 4DHZA 5AP7A 4GKIA 3EN4A 3HMOA 2VGOA 3CC6A 4G16A 1OIYA 4DFLA 1VR2A 4QMLA 5IU2A 4RWJA 4C33A 4U3YA 3CKWA 2VTJA 3ZEWA 2ETMA 1B38A 3U9NA 2O63A 3I81A 4E6QA 3G9NA 5BYZA 5ACBC 4XG7A 2B9IA 4L7FA 4I5PA 4WNOA 2PYWA 3O23A 1W2DA 3VNTA 4YHFA 3NUSA 4LM5A 4J97A 5HGIA 4C3FA 4F9AA 4Z7HA 1KE5A 3CQWA 1OPJA 2OICA 3EL8A 3OOGA 1ZY4A 2DUVA 4FG7A 4MD9E 4YJRA 1ZAOA 4E5AX 3I0OA 4QP8A 3MB6A 4DCEA 1UV5A 3TUCA 5E1SA 2QOLA 3B2TA 3FXWA 4BFMA 5A4CA 4GMYA 2XA4A 3C50A 3HEGA 2JFLA 2XKFA 1SVHA 3PRIA 2IZRA 3EQDA 1KE9A 3R30A 1MP8A 3DTCA 4GG7A 4L7SA 4NTSA 3SRVA 3V5WA 1OVEA 5B2KA 2OU7A 4C61A 1ZYDA 1J1BA 3Q5ZA 1BL7A 2V7OA 4G3FA 3DDPA 4JIAA 5E8SA 1YOMA 2X9FA 3HV5A 5J1WA 1YHVA 2VO7A 3A7GA 4QYFA 5AP5A 5KBQA 2WD1A 3QUPA 3DAEA 4HVHA 3CP9A 3ZRKA 5M4IA 2V62A 4FSRA 4C34A 3P5KA 2OJFE 4QMUA 3D9VA 4FV3A 2XIRA 3VJOA 1OL7A 3DAKA 4KRCA 3VQHA 3Q9WA 3E8EA 3SKCA 3K5VA 5CZHA 1YVJA 5E7RA 5EDQA 4O7TA 4DHIB 4DITA 4JMQA 4FX3A 2YIQA 4J95A 4KKGA 4C36A 3ZEPA 4ASEA 2YIWA 1QPEA 1WBPA 2FGIA 3RAIA 5JFSA 4TT7A 4WD5A 2YJSA 2B7AA 2YABA 4EKKA 4CG8A 2C69A 3LFBA 4G6LA 3L9LA 5DA3A 2JC6A 1IRKA 2OXDA 3IGOA 3ZDIA 3R8PA 2HAKA 4QOXA 3NMUF 3E62A 3KL8A 2PZRA 4IAZA 3N4TA 4I22A 3HRBA 4R5SA 4F99A 2HXLA 3HA8A 3S0OA 5J7HA 4G2FA 3QKMA 3II5A 1OIQA 2GTMA 3QXOA 4C62A 2AQXA 3MVLA 4FZFB 3QHWA 4L3PA 2ZM3A 4QYYA 4UWCA 4YURA 4BWKA 5CEKA 3ZUVA 4MXAA 4DEEA 3RM7A 3O7LD 3OOMA 4B7TA 1GZKA 5AX3A 3P78A 2QOIA 2G9XA 2O5KA 1E9HA 3GFWA 5AV0A 1O6KA 4ENXA 5M08A 4GJ2A 1TFFA 4K6ZA 4U43A 5E91A 1IAJA 3AMAA 2PUNA 3FMLA 5IA5A 3LFQA 3UNJA 1JOWB 3EN6A 5M53A 2XP2A 1WVXA 3R04A 3PVWA 2XVDA 2DQ7X 4GS6A 2Z7QA 2CJMA 2OF4A 2WMAA 4LRMA 4WUAA 4BB4A 4CT1A 4DBXA 2OG8A 1JNKA 4JS8A 5EHLA 3DNDA 4BDKA 3UNKA 4DH1A 4PP7A 5HG9A 1W2FA 1QPJA 2GTNA 4FT9A 5D10A 4NJ3A 3SXSA 2VUWA 1Q97A 2F2CB 4JDIA 1JSTA 4RT7A 3R7IA 4AW1A 3VO3A 1UNGA 4IE9A 4GKHA 4RJ8A 1OB3A 1KWPA 4XG3A 3LFDA 2W4OA 2XF0A 5HCZA 3UDBA 3PJ3A 2IN6A 4N0SA 1TQPA 3OCBA 3RP9A 3UOJA 4YC6A 4EUUA 1NVSA 3FMHA 4G5JA 4GIHA 4QRCA 4F7JA 5L6OA 3QXPA 4ZMFA 5AFVA 4AXDA 2XK9A 2XBJA 4HYUA 4EQUA 3V3VA 3BHHA 3IK3A 4R3RA 3FUPA 3B8RA 3R63A 4MQ2A 4ZOGA 3UVRA 1W7HA 3B8QA 3LCOA 3CTHA 3CTQA 1H1RA 3W2CA 3DK6A 1FVVA 4JG8A 1Z5MA 1J1CA 3ZO4A 4CFMA 5JH6A 4HVIA 3QF9A 4J8NA 2XYUA 3QTIA 4MTAA 4X2KA 2QO7A 3GQLA 2HZ4A 3DKFA 4FUXA 3UYSA 2YN8A 3MY5A 2OH4A 3V8SA 4L46A 4YPDA 4NT4A 4O4CA 4ANQA 5I9YA 1Y6BA 4GK3A 1H1QA 2PVJA 2JDTA 3D2IA 5KE0A 5AAEA 3SG8A 2OJIA 3OW3A 4FVPA 2F7ZE 5F4NA 3W2OA 4JL9A 1H4LA 3WF8A 3W16A 2PTKA 4CV8A 2G2FA 3P23A 3P7CA 4D9UA 3UPZA 4JOAA 1XH6A 3VW6A 4F64A 4HJOA 1M7QA 2O0UA 2WGJA 3ZONA 3LQ3A 4CCUA 5CVFA 2JIVA 4K0YA 4XP0A 5EOLA 5HG7A 1WFCA 2CKQA 4BKZA 4O0XA 3VUIA 1JKKA 2V22A 5JN2A 3TKHA 4L67A 3JS2A 2H9VA 3SX9A 4S2ZA 3U4WA 3HDNA 4ZY4A 5DHJA 4BTFA 2XNEA 5IQBA 4AN2A 2GNJA 3LW0A 3R22A 3RHXA 3DV3A 4L9IA 3C5IA 3SOCA 1STCE 3PVGA 4X3FA 4O86A 3S1HA 1QCFA 3HMNA 4F09A 2ZB0A 4BBFA 4NZWB 5HVJA 2F4JA 4I20A 3KFAA 4TNDA 5F94A 3EQGA 3RK9A 4QTDA 2UW0A 4W4XA 2OIQA 3WZUA 4AFJA 4O91A 2GFCA 2VTTA 3C1XA 4ZY6A 5CASA 4YSMA 3BGZA 4NM0A 4XCUA 2XNBA 3G5DA 3TV4A 4FL3A 2YERA 5T6KA 2P4IA 4PL5A 4DLIA 4KIQA 2J4ZA 4EH3A 5CVHA 3BGPA 2PZ5A 4QQ5A 3I5NA 1OL6A 4EBVA 4DH5A 3QTWA 3P1AA 5HE3A 4H1MA 3ZO1A 1OIRA 3GQIA 2C5YA 3DK3A 4EH2A 2CDZA 1GY3A 4MWIA 4J99A 2IO6A 3C4XA 3RJCA 3BLHA 4RFMA 3KU2A 2XEZA 4EH5A 3JVSA 4GYIA 4CXAA 3Q4CA 3E8DA 4E6AA 2IW9A 3PVBA 2RGPA 3GU7A 2E9PA 3ALOA 3ML1A 4IWQA 2QQ7A 4H3QA 2A98A 3FV8A 1RDQE 4RLLA 4TYJA 1J7LA 5J8IA 2PVMA 4UYAA 3I60A 4ZTLA 4RWLA 4UMRA 2HW7A 4FEWA 5G1XA 5I9UA 1M7NA 1LR4A 4NCTA 1PXKA 1U4DA 1W2CA 2J51A 4FKIA 3MTLA 5CU4A 4YNOA 3RK5A 2BPMA 4LMNA 4CKJA 1Y8YA 3BYVA 1V1KA 1UA2A 3WIKA 2HENA 1JKLA 3EFWA 2IW8A 2R3NA 4WSQA 1OECA 4FA2A 3GT8A 4DA5A 1GIJA 4IZ5A 4U40A 5M55A 4WBOA 2UW5A 1KOBA 3PWYA 2E9NA 2R3OA 4RX9A 2G2IA 5DWRA 5H8EA 4AZTA 4IVCA 5I3OA 3N4UA 4C7TA 4Z3VA 5M4CA 5TT7A 3PXYA 4ZXTA 4F9CA 4IAAA 5FEDA 3N4VA 2ZV2A 2C1BA 3LXPA 4I23A 2CKOA 4BZOA 4L6QA 4AU8A 2YCRA 3PE1A 3MPAA 2HK5A 2BILB 1OL2A 2R64A 3KA0A 3KMWA 3MVMA 5I9XA 3LZBA 4E20A 2IWIA 3R9DA 4AE9A 1M52A 1RE8A 1V0BA 2RSVA 3FPMA 4R78A 2C6TA 2PE1A 1J7IA 2W5BA 1FGKA 2UW6A 3Q52A 2XIZA 4F63A 2BAQA 1IASA 1YWNA 3ZO3A 3R9NA 4K9YA 4DG0E 2EXEA 2WMQA 4ITIA 2V5QA 4G3EA 2YM8A 3AC2A 3ZSHA 3DPKA 4CFWA 4A9YA 4CFVA 3W0PA 3VRZA 1MQBA 3V6RA 3COMA 3D7TA 3BGQA 1ZYSA 3PG3A 3Q53A 3CD8A 5M56A 2WOUA 2GS7A 4MUQA 4O27B 2YZLA 2XK4A 4YP8A 5FP6A 5IA1A 3LFAA 3MWUA 2JBOA 2B55A 4OTWA 2W7XA 3EQFA 4GVJA 3FHIA 2B54A 4DHJA 3QTSA 2CN8A 5BYYA 2WHBA 4A07A 4O7LA 4NWMA 3KCFA 3W0OA 2WELA 4IAYA 4RA5A 2QO9A 2WTVA 5A4LA 2VNYA 4XV1A 4M7IA 3UO4A 3ODZX 4S34A 3ATSA 1IR3A 3WZJA 5EDPA 2FSOX 4R3CA 4LQMA 5FEEA 2IW6A 4G34A 3QLFA 4QP9A 4FUYA 4RIXA 3CCNA 1ZMUA 3F5GA 4PMPA 3JXWA 4WRSA 4DGOA 3L9MA 2CNQA 1PXNA 4YZDA 3G2FA 3I0QA 1KSWA 5L2SA 4EK5A 4D2VA 3G9LX 3DBEA 3MA3A 4YTCA 3PPJA 1R1WA 3EIDA 3UO6A 5JFXA 5AV2A 1YOJA 4XV9A 3RZFA 4DEDA 4PV0A 4QO9A 3C7QA 4BCFA 4DE4A 2XK6A 4IJPA 3PTGA 1YDTE 3MH0A 1TZDA 2HW6A 4XRLA 4EOKA 2QCSA 4F1TA 1TQIA 3CR0A 3LFNA 2XK7A 5C8KA 2RFNA 3FY2A 5A4QA 3V5QA 4K33A 3F3UA 2J0KA 3R0TA 3VF8A 3TN8A 4DEAA 1I44A 2CSNA 4DG2E 1ZMWA 2WQBA 4HVGA 3T8OA 1RJBA 3BQCA 3DTWA 3QZHA 3R73A 5E1EA 4DFXE 5I4NA 1FPUA 5I3RA 2FH9A 4ZTHA 3TTJA 3NR9A 2GPHA 4ZSLA 4RC3A 4F08A 4QQTA 4OBPA 1KV1A 2F49A 3NYXA 4BCMA 3F3TA 5AP2A 5FBOA 4FVRA 3A4OX 1IEPA 1X8BA 3IOKA 3LAUA 3BELA 5HCYA 4CVAA 5C4LA 5EI2A 4EBWA 1ND4A 2VGPA 4IM0A 4X0MA 5CZIA 3PXFA 5EM5A 3ERKA 1DAYA 3ANRA 2DS1A 3GC0A 4TWOA 2YCQA 4JDHA 2BTRA 4D4SA 4EQMA 2Y8OA 5EH0A 4FSMA 4FYNA 3BLRA 2Y6OA 2A0CX 5CNOA 3CS9A 2C3KA 3UIBA 3U6IA 3JY0A 3FKLA 4KB8A 2BRBA 4D55A 4FF8A 3V6SA 1L8TA 5HESA 2YIXA 4RJ4A 5KZ0A 1OPLA 4JQ8A 1WAKA 4IBMA 5AP6A 4ZZOA 5AV1A 2QNJA 4RJ5A 4QTBA 2J5EA 5B2MA 2UZDA 3DQWA 2XJ2A 3LM5A 3RHKA 3SD0A 3OWPA 3QZGA 2YISA 3HAVA 1GZNA 5BVOA 5CSPA 4FV8A 4XX9A 5L2WA 5KHWA 5E92A 5C4KA 3LCKA 2KULA 3AC1A 4USDA 4RIWB 2P33A 4I0RA 2GNLA 2BZIB 3W8LA 2QONA 4FGBA 4U5JA 3TXOA 4OTFA 2VO3A 2OZAA 5CWZA 5FXSA 4GT4A 5CU6A 3LPBA 3GCSA 1FOTA 1YXVA 2YAKA 4TYGA 5CQUA 1YWVA 2G2HA 4FZ7A 5AM6A 3GI3A 3UQFA 3FQSA 4NW6A 4HYIA 3KXHA 4A9RA 3Q9XA 3BI6A 3FMDA 5IUGA 1MRYA 3W0RA 5L2QA 3IOPA 1IA9A 3KRJA 4IEBA 4D0XA 3VONA 1Q4LA 4FKLA 3QQLA 5BVEA 4FR4A 2VTRA 5CT0A 1CMKE 4YO6A 4JG6A 4V01A 5HE2A 5J87A 3TEIA 2XRUA 2GCDA 4G17A 4BCIA 4L8MA 2WQNA 3WE4A 5CT7A 3Q9YA 4DGLC 4EH9A 2W06A 3QRJA 4QTEA 2PY3A 3A7IA 3Q2MA 1PXOA 5E8VA 4HNIA 3K3IA 4FE2A 4F78A 3ZFMA 2AC5A 4U42A 3DOGA 5A14A 1F3MC 5ACKA 1GAGA 4PTGA 3LXNA 5EW9A 4F0GA 2YZAA 4TRLA 2GQSA 4CKIA 2EB3A 4ORKA 4YZBA 3KIOC 4DEHA 2YDJA 4WRGA 2C1AA 2ITTA 2C5VA 4Q9ZA 3HUBA 4BZDA 2SRCA 2YJRA 2JDOA 3VS2A 1QPCA 3BLAA 1R39A 4RMZA 3H0YA 5H8BA 5FUTA 1B6CB 2O2UA 1FQ1B 3KQ7A 4PL4A 3NYOA 2PWLA 2HY81 5DRDA 5AUYA 4EOPA 5FQDC 1H1PA 4PPBA 4HPUE 5A3XA 4BHZA 4O84A 5LVOA 5GHVA 5HD7A 4F65A 4II5A 4RJ6A 2PUUA 2BAKA 5J5SA 4BTMA 4BDAA 3BWJA 4D2SA 3MESA 4Z55A 3DB8A 2VTPA 3NGAA 4XG8A 5CQWA 2PE0A 5I9ZA 4AOJA 3FYJX 3NDMA 4YJUA 3E8CA 2ZDTA 2P2HA 4GL9A 4A7CA 2PMIA 3QKLA 3PJ1A 3BBWA 3ZC5A 5L2TA 2C6DA 3G6GA 1YKRA 1J3HA 1DS5A 3FLSA 3IECA 5CEMA 2HCKA 2RF9A 2VX1A 2OO8X 1MRUA 5AP4A 2V7AA 5E8UA 3W2PA 5GZ8A 3DLZA 1XH7A 4YJOA 4BF2A 1M17A 3GVUA 2PU8A 3MB7A 4R3PA 4DYMA 1TVOA 4AA0A 3FEGA 4EJ7A 2BAJA 3FJQE 4C37A 5F9EA 5DRBA 4I6BA 3D5VA 2UZTA 5FDPA 1NVRA 4IZYA 4H36A 4Y85A 1R0PA 1J7UA 5AV4A 4PWNA 1H0VA 4QMXA 2CCHA 2OW3A 4BBMA 1XQZA 5CAQA 1ERKA 3A7FA 3E92A 4IM3A 1OBGA 4X3FB 5AUVA 4H39A 4JG7A 5CF6A 2X4FA 1OUKA 2ZDUA 1CKJA 2BCJA 3IQ7A 4XBRA 5EYKA 2VTSA 2WTIA 5HVYA 2QOCA 5AR4A 2JFMA 4BGQA 4GK4A 4AW0A 3FZRA 1CTPE 4ZJVA 4ACCA 3R8VA 3ORZA 3FLNC 3NUAA 4YZCA 5LMKC 4FG9A 3IPHA 4KBKA 3UIXA 2BUJA 2QR8A 5HNGA 3VQUA 3PUFC 5LQFA 3LFCA 4C58A 4GYGA 2FSLX 4XMOA 4E6DA 3IW6A 4E1ZA 3ZMMA 2ZV9A 4ZSGA 3KMUA 2XMYA 3DGKA 2W1ZA 4F1OA 4YJSA 1PRYA 1TQMA 4WO5A 2VAGA 3NNXA 5C27A 4FKRA