3RWPA

Discovery of a novel, potent and selective inhibitor of 3-phosphoinositide dependent kinase (pdk1)
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
287
structure length
277
Chain Sequence
QPRKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEYLIFQKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTPPKLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-phosphoinositide-dependent protein kinase 1
publication title Discovery of Novel, Potent, and Selective Inhibitors of 3-Phosphoinositide-Dependent Kinase (PDK1).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 82
structure length 277
sequence length 287
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2011-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3rwpA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3rwpA01
5EM5A 3D4QA 1OL2A 3V5JA 3HRBA 2E9NA 4RC3A 2C6TA 5TF9A 5AR3A 3C0GA 4ALUA 4BFMA 5M44A 4L9IA 1WBPA 2CGVA 3WBLA 4E6CA 2F2CB 4I0RA 4BDJA 3UOHA 4IVAA 3OBJA 2Y6MA 3TI1A 3P86A 2JDRA 2XKCA 1PKDA 4E20A 2ZV7A 3WF6A 1Q5KA 4JG6A 4HVDA 5EYKA 4O0XA 4U3ZA 2GTNA 3AMYA 4CGAA 5KCVA 3DAKA 2YWVA 4UMTA 3SXSA 4II5A 2V7AA 4BI1A 3KRJA 4BDGA 4YTFA 1LUFA 4J96A 5CTPA 4XRJA 3N4VA 3GQIA 3EFWA 1H1PA 3D7TA 3KXNA 3MIYA 4LOOA 5E8ZA 1OL6A 1WZYA 4AW2A 2X8IA 3VJNA 4YURA 5ETFA 4CYIA 4G6OA 3WF8A 3QTXA 4QQJA 2PVMA 2WU6A 2O65A 3Q5IA 4AN9A 5BVEA 1JQHA 4J52A 4MD8E 4KINA 4JI9A 2E9UA 4AACA 3KK8A 2OK1A 5CAVA 4W4VA 5G1XA 3L9LA 4E6AA 2PZYA 3CKWA 3TG1A 4YO4A 3EQPA 4NIFA 1YXUA 3EFLA 3FXWA 3ZRMA 4AW0A 3FV8A 3HA8A 4HCTA 4U8ZA 3QD4A 4W4XA 2WTCA 3BLRA 4CNHA 4EH9A 5C4KA 4EUTA 2UVZA 3FHRA 3ZLXA 1J1BA 4BRXA 4M97A 4DT9A 2CCIA 5GIPE 4M8TA 5JFWA 5EYDA 3F5GA 3OBGA 3GFWA 5J1WA 3IW5A 3E5AA 4O0YA 4E26A 3HA6A 1U54A 4A4LA 4EOKA 5FTQA 5AV1A 2C3JA 5FDPA 2XJ0A 4K6ZA 4UBAA 2HZIA 3AC8A 4LOQA 4BKZA 3K2LA 5DIAA 1Q24A 4XUFA 4YLKA 1P4OA 2UUEA 2O63A 5DT4A 1DAWA 3LMHA 3HNGA 1W7HA 5HLWA 3T3VA 1OL7A 2YZLA 2C0OA 3G0EA 3UOKA 2YCFA 4H3QA 2OIBA 4IC8A 3R7EA 2JGZA 3CCNA 3R9DA 3C0IA 1Q8UA 3GQLA 3SVVA 2BZKB 3R8ZA 2WOTA 1P4FA 3FMDA 3HRCA 3GXLA 3CY3A 1ATPE 4TYIA 4FVRA 3WF5A 4F6WA 4QMUA 5M4UA 1BX6A 2YDJA 5FTGA 5T6KA 1PXPA 3AXWA 3FBVA 4AT3A 4C2WA 2WMAA 4D4YA 2WMQA 4V04A 4CFWA 4PTGA 3TTIA 1HCLA 3B8QA 3E3BX 4DTKA 5A4LA 4RIWB 5EFQA 3F3TA 3VF8A 4O38A 4IAZA 3AT3A 2AC3A 3ACKA 4CT1A 3EN6A 5ANEA 2PU8A 2WMVA 2BKZA 3GEQA 4K9YA 4AZWA 5LOHA 3O17A 4MNFA 1H1RA 1Y6BA 4RX7A 1ZMWA 5AAGA 4RJ5A 4EOSA 4PNIA 3TXOA 3QQHA 3KCKA 1T45A 1R0EA 2IZRA 3K3IA 4UYNA 4IB3A 2QKRA 5CU3A 5DWRA 4CFFA 3UOJA 2A4LA 3HV4A 3ZUVA 3WYYA 4FEXA 3PIYA 4RRVA 4TW9A 5CVGA 1MRYA 5H3QA 3VS5A 4BCJA 2C47A 2C3LA 4PWNA 2X8DA 4RWIA 5B2LA 1ZXEA 4L67A 2IVSA 2BFXA 5FD2A 4P5ZA 3EN7A 1OVEA 4IFCA 5CQUA 3VWAA 4W8DA 3TZ8A 2W4OA 4ITJA 3D15A 4ZTNA 5AUZA 3DU8A 1WCCA 3R04A 5KMIA 4IE9A 3VUGA 1ZOEA 3R1YA 4ORKA 3U9NA 3PA3A 1V0BA 1SZMA 1UV5A 2UW8A 4M68A 2GHMA 5CXZA 5AUUA 2JD5A 3R8PA 4C2VA 4ZTLA 4FSNA 1CKPA 5HBJA 4DEBA 3LFAA 4NK9A 1ZZLA 2FVDA 3KU2A 5GHVA 4HYSA 5GZ8A 5KNJA 3EN5A 2EXEA 2GU8A 3AC1A 2OU7A 3IO7A 5C9CA 5BVNA 5HIEA 4RG0A 4KBCA 4EOPA 2ETMA 2FA2A 3FY2A 5B2MA 2X9EA 3QHRA 5K0KA 4XHKB 4A7CA 3KK9A 4AOJA 3PPKA 4HVHA 2HXLA 3MH2A 3UVRA 4C0TA 4PPBA 5LMAA 4H3PA 4BB4A 2J51A 3I7CA 3CQEA 1NA7A 5E1EA 2CGXA 4ZS4A 4BDAA 3QLGA 4H36A 3FSFA 3CTJA 3ORMA 1STCE 5L2WA 4BCMA 2R3RA 3C51A 4FTOA 1NVRA 3VW8A 2IVVA 4DGNA 3NRMA 4IWQA 3D9VA 1YDSE 3BKBA 2WNTA 5CEPA 4QTBA 2HZ0A 5ICPA 5A6NA 2QU6A 5AV2A 4Y5QA 2FB8A 3QTRA 1SNUA 3RHXA 3LLTA 3KXMA 4ZJJA 5H8GA 5EW9A 1M14A 1PXKA 4I0TA 3KA0A 4QYGA 2HW7A 3F66A 2XK4A 4XBUA 4EOIA 2HYYA 5LQFA 3GT8A 5IU2A 3TL8A 1GIJA 2C5YA 1T46A 4LFIA 4NH1A 3GC9A 4O2PA 3VVHA 2PE0A 5IUIA 2I6LA 2QQ7A 3UP7A 4ENYA 3SRVA 4IDTA 3PSBA 3Q3BA 4C02A 2C6KA 3MVLA 4HPUE 4OUCA 2PZIA 2WTJA 3FC2A 3ORKA 4ZSGA 3R9HA 4O1OA 5M53A 4ID7A 5BYLA 3MV5A 2EXCX 3KN5A 4GSBA 5ANKA 2XCHA 3UODA 3O7LD 5CU0A 3TJCA 4D4VA 1YW2A 3Q9WA 1Z57A 3PZEA 3LFFA 4XP3A 2JKQA 4JX7A 4RLLA 2OF4A 4DEIA 4F7SA 4G6NA 4IZYA 4ZZMA 3MI9A 5KBQA 5IQHA 3UMWA 4O7TA 3E64A 3JY0A 4JT3A 3MBLA 2Z7LA 5ITAA 3D7TB 4QMWA 5CNOA 2FSOX 4LGDA 5E92A 5HO6A 2HY81 4D1ZA 2XIXA 3IONA 3RI1A 4MYGA 1JAMA 2BIYA 2YN8A 4HGSA 2C0IA 4IACA 3ALNA 4I6BA 1CKIA 3SOCA 2ITWA 5JRSA 4D1XA 4C7TA 1Y57A 4QYHA 1PXLA 4G5JA 5E4HA 4FZ7A 2VWXA 2BHEA 1U4DA 1RQQA 2BAJA 4NIFB 4M84A 4I5PA 4EBVA 3V04A 1IA9A 4QMXA 3T3UA 4S33A 2F9GA 3A7JA 1OI9A 3HL7A 3O8TA 4I92A 4RQVA 5FEDA 5HO8A 3TKHA 4EOMA 3GGFA 5C8KA 1F3MC 4G17A 3VF9A 4EKLA 4D55A 1A9UA 2QOCA 3EYHA 2IVUA 5HX8A 3ORTA 1U54B 3PLSA 2OZAA 2ZDUA 3WILA 3UO6A 5F9EA 3FLSA 5HG8A 2QR7A 1IG1A 2UV2A 5JGDA 4FYNA 1S9JA 4NFMA 4FICA 4PY1A 5LMKA 2PHKA 1GNGA 2VTSA 2GQRA 4KBAA 4DEAA 2VTNA 4G31A 4TNDA 3BV2A 4YZNA 3D5XA 3AG9A 3CLYA 3SXFA 4U45A 1Q8YA 2VTIA 1GZNA 3RALA 2ETRA 2VU3A 3BBTB 1BLXA 4AW5A 5GZ9A 4BIDA 2JLDA 3G6HA 3Q32A 5EDQA 5AFVA 5E8SA 4F7LA 5IUHA 1WVXA 4YP8A 1ZOGA 3EL8A 3PJ1A 4LRJA 3W2PA 2ZYBA 1ZY4A 4QYFA 4YZMA 4G9RA 3KRWA 2OFUA 4IAKA 3A99A 2BAKA 5IH6A 4DEDA 1CTPE 1FVRA 4GU9A 4R8QA 4BWPA 3GP0A 4I21A 4DYMA 3MN3A 2WMXA 3HX4A 4A4OA 2C30A 4DH1A 4C4HA 3W16A 5FXSA 4D5HA 2QCSA 5BYZA 3R63A 3BHTA 2YAKA 3DK6A 2PVLA 5TOZA 5AAEA 3LE6A 3WZJA 3MFUA 3ZEPA 4BTJA 5AR8A 4F70A 3MTFA 4UXLA 4PPCA 4XG8A 4PP9A 4MXYA 4O7NA 3A4OX 3ENHA 4LM5A 2VO0A 4NJDA 2XUUA 1UU3A 3LCTA 4TYGA 5AP1A 5BUJA 4FSMA 5M56A 2Y4IC 1WMKA 2X6DA 3U55A 4YNEA 2X7FA 4YJPA 4B0GA 3NYXA 4KWPA 4CSVA 5EKNA 3QD3A 3R1QA 4AXAA 5HVJA 4CRLA 4FV7A 3WYXA 3FJQE 4GJ2A 2V0DA 4NCTA 2HCKA 5LWNA 2QOHA 3LVPA 3RGFA 3V8SA 2QURA 1SVEA 2HELA 2PMNX 3DBQA 2YERA 3G6GA 3MH0A 3CD8A 3MFTA 1ZLTA 3NS9A 3QCQA 4X3FA 1MUOA 3GB2A 3VBYA 4QPMA 1O6YA 3GNIB 3QU0A 5J9LA 4EK6A 3DCVA 2ERZE 4PDSA 5CSXA 5CANA 3KMUA 1KE8A 4H05A 3F3VA 3BWJA 4Z55A 4Q5HA 5LJJA 1FVVA 3TNPC 3UPXA 3LFDA 4FK3A 4ERWA 3FC1X 4F6UA 2CHLA 3BELA 4QP9A 3KF4A 1A06A 4YZDA 4RIYA 3V5QA 4FSRA 1H01A 3JPVA 4NKSA 1M52A 5E8WA 2GNJA 1PXJA 4UMRA 1Z5MA 1KUTA 4IMYA 4WG5A 4XG9A 4CG8A 1GIHA 2W1FA 3NX8A 4FSYA 3HRFA 4UMPA 3PPZA 3RAHA 3LKMA 3FZOA 3IOKA 3TKIA 3NNWA 4EWQA 4LV5A 3VS3A 3LHJA 4FTLA 2QOFA 2Y4PA 5DR2A 5BX0A 4FIHA 3MJ1A 4QP2A 4BTFA 4FNWA 4YBJA 4ACHA 2I0VA 4ASEA 4PUZA 4Z7HA 3UG1A 2W7XA 4MNEB 4BDKA 4F0FA 2VNYA 4JBPA 5IPJA 4FC0A 4D28A 3ZHPC 1OPKA 4IAFA 2CNUA 3PYYA 2R3NA 1ZMUA 4JDIA 4U79A 3G51A 4USFA 3EIDA 2C68A 1CDKA 3NVMB 2WQOA 2GNHA 3WF7A 3KFAA 4RIOA 3PTGA 2OJ9A 5AP6A 4R1YA 2W96B 1TQIA 2R3LA 2ZM3A 3I6UA 3GU4A 3RWPA 4FUXA 3NSZA 2NNWB 5C26A 1KOBA 2GHGA 3O50A 3TNIA 2QOBA 2OIDA 2R64A 5HTIA 4MWHA 3DDPA 3D2KA 4I93A 3PPJA 4IAAA 4YJRA 2X2MA 5HESA 4AZVA 4ZLYA 4QP8A 2X2LA 3ZEWA 3FI2A 1GY3A 5HIDA 4FGRA 2G01A 4E5AX 4PV0A 4USDA 4GRBA 4O7VA 5HKMA 3GENA 3KREA 1IEPA 4KBKA 1H24A 4O84A 4FV1A 2PVKA 5JKGA 2YM6A 4A9SA 1H8FA 4JIAA 3GCPA 2IZSA 4EH4A 4S2ZA 4GFGA 3SRVB 2XJ2A 4WBOA 3FLNC 4FKVA 4C4JA 4R7IA 4FK6A 3Q6WA 4PDPA 3ACJA 4BKYA 1YKRA 3WOWA 3VUHA 3QQFA 4EWHA 4FZFB 4IEBA 3N4TA 5J7BA 3GUBA 5HG7A 1R0PA 2GCDA 1I44A 1H1WA 4BWKA 2PSQA 3OT3A 4WUNA 5AAFA 3UNKA 1TQPA 2ERKA 2W1IA 4XYFA 4ZP5A 3B2WA 5EHLA 4CKIA 3GOPA 4BC6A 3R0TA 3EQIA 2VWBA 2C3IB 3R9NA 5HU3A 3PZHA 1B38A 4E4MA 2XMYA 5CAOA 4D4RA 3C13A 1WBTA 4QP1A 4JS8A 1YWNA 1XQZA 4UEUA 1Q8ZA 5H8EA 5E90A 5FG8A 4AZSA 4D2VA 5IQGA 4FVQA 3VBXA 3PSDA 3PY1A 4C61A 4MF0A 2OIQA 3O8UA 3ZLYA 5ANOA 2HK5A 2VTRA 3QRTA 2YM8A 2ZV9A 1PYEA 4CMTA 4WRGA 3ZLSA 4RZVA 3QUPA 5TKDA 3BPRA 4FGBA 4GW8A 4I22A 5HO7A 3P23A 3LAUA 2C1BA 4YNOA 4G34A 4G3EA 3UE4A 2CLQA 4AGUA 4BCOA 5J7HA 4FTIA 3F2NA 3EKKA 5C01A 4NM3A 1H08A 5F94A 2WZJA 4IADA 2V5QA 1H28A 3R7UA 2DS1A 3V5PA 3F2AA 1XKKA 4PRJA 3O96A 4IQ6A 4I24A 5M57A 2ITPA 5K4JA 3DFAA 3E8NA 3Q52A 3IDCA 3BX5A 3QAME 5CZIA 3NYVA 5LWMA 2GSFA 3BZ3A 3DA6A 4NM7A 3MVMA 2W1ZA 4DEHA 2R0IA 2VV9A 4RIWA 4L45A 5HI2A 4CV9A 4B6LA 5H2UA 4AAAA 4UZDA 2WMUA 3JXWA 3IOPA 2BROA 5CF8A 2BFYA 2J7TA 5I4NA 5HOAA 3VHEA 5EOBA 5HTCA 2XNOA 4NKAA 3ZRKA 2GNLA 4BWXA 4R7HA 4I20A 3NLBA 1G3NA 3F82A 4PL4A 3RAWA 5ETCA 4FIJA 4K33A 2QR8A 4XV9A 4Z9LA 3RAKA 3PXFA 1REKA 3HUCA 4ZTSA 5GJDA 1YRPA 1PXMA 1KOAA 3MB6A 5A9UA 4KRCA 2I0YA 4KRDA 4O83A 5KUPA 2IO6A 4K0YA 3BEGA 2Z02A 4GMYA 4ANLA 4XNEA 4E3CA 2GS6A 3C50A 4MH7A 4BCQA 3DNDA 4RWKA 4RGJA 3UOLA 2YCSA 3PIZA 3EQHA 3FI3A 4WNMA 3A60A 4F0GA 2OJJA 3UZTA 3AC4A 1HOWA 4BZDA 4FKPA 1H27A 3QTWA 4XG6A 2JKOA 3E7VA 3T9TA 3RHKA 5IMXA 4FNXA 4FL2A 4PL3A 3NUUA 4R1VA 5JZNA 3DK3A 3LCOA 2PULA 4FODA 5KMMA 3EN4A 3KXZA 4ZAUA 4YC3A 4DN5A 3D83A 4CTCA 5CYIA 2UVXA 4FV6A 4X3FB 4KSPA 1V1KA 3TZMA 1FPUA 4HVSA 3CY2A 3PXZA 3IW8A 3AC3A 5EOLA 5EI6A 3ORNA 2B54A 4FSWA 4PDOA 4GT5A 2OKRA 3DS6A 2A1AB 4TPTA 4C38A 5J9YA 4X6RA 4Y72A 4U42A 5M4CA 4CFNA 5EG3A 1QMZA 1B6CB 3NUYA 3OROA 5LVLA 1M2QA 4ASDA 5M07A 2IPXA 4IVCA 5CX9A 5JMSA 5ETIA 4OT5A 3E88A 3VS6A 4MXZA 5D11A 4F9BA 3M2WA 3LXNA 1YXVA 3HMPA 4L3JA 3R73A 5FWKK 2BDWA 2ETKA 2E9VA 2HXQA 4IWOA 5A4QA 1GIIA 3UDBA 3N4UA 5IQCA 5F1ZA 4BI0A 4QMNA 2R2PA 3UC3A 3LCKA 4ZJVA 2ZB0A 4WD5A 4JDJA 5BVKA 1ZOHA 4JX3A 2UVYA 2PE1A 3QKLA 2CKPA 3OCSA 1H4LA 2A27A 2C6MA 4TN6A 4IZ5A 3UG2A 4KS7A 4V05A 3TV6A 4GIIA 3BHUA 5BUEA 4G3DA 3KEXA 3NEWA 1F5QA 3TNQB 4DTBA 4KAOA 4RC4A 2UZLA 4JDHA 1Y6AA 5DHJA 2RKUA 5I9VA 3BYUA 5EI8A 4PDYA 2C6IA 2UW9A 4FSZA 2XK9A 3AD4A 2X4FA 5L6WL 3RZBA 3DKFA 2WIHA 2J5EA 3DJ7A 4MEDA 4TT7A 4KNBA 2J6MA 3ET7A 4ACCA 4TYEA 5E8VA 4ZS0A 3DJ6A 1W98A 2VX1A 5CVFA 5IQDA 2R3KA 3ENMA 3KXXA 3TJDA 4KKEA 5TE0A 3DTWA 2YWPA 4PP7A 3DKOA 2HWOA 1Q97A 2VD5A 3Q4CA 5E8UA 4XBRA 4RC2A 3T9IA 3BEAA 4FVPA 2YLFA 5KMJA 4FR4A 4HGLA 4DCAA 2UZWE 4IM2A 3K3JA 4J95A 2J9MA 4EC9A 4BHNA 1Y8GA 4G9CA 2GDOA 4XS2A 4J8MA 4YTIA 5HVKA 3HDNA 4O22A 2BZHB 3BYOA 4DGMA 2BHHA 2YITA 3E8CA 3GC0A 5F20A 3ODZX 4G3FA 3FKOA 2O8YA 4B8MA 4IX6A 3RK7A 3PJCA 2Q83A 4R7BA 4BCGA 3EOCA 4CCUA 3L8SA 5FLFA 5A14A 4PNKA 3AC5A 3E8DA 4FL1A 4BHZA 2WO6A 4N4SA 4L3PA 2XKEA 3BWFA 1RDQE 2F2UA 4CRSA 4ENXA 2AC5A 3H10A 4NUSA 3QTQA 2ZM1A 5AP7A 4ZTRA 2UZBA 3ZLWA 3EYGA 3LOKA 3C4EA 5KMKA 3GI3A 3MH3A 5CZHA 3AD6A 3DAEA 5EYMA 5CEOA 1YXXA 4P4CA 3FMKA 5HBHA 3PA4A 2CKOA 4JQ8A 4P2KA 4ACMA 2W1CA 4EEVA 3ATSA 4MK0A 3EHAA 5JZJA 5EM6A 4A06A 3MESA 3CC6A 4ZTHA 1R78A 2WMTA 3EMGA 2GTMA 3BLHA 4IWPA 1PMEA 3C9WA 3GVUA 2WELA 1UU8A 4BN1A 4O7RA 4E4XA 4NW5A 2YZAA 4QTCA 3D5UA 4B8LA 3BYSA 3KRXA 4O0WA 3T8OA 4JOAA 2WQBA 2YACA 1K9AA 4R6VA 4FG7A 2RL5A 3LJ2A 5CSHA 2QNJA 3L1SA 4FE2A 4MCVA 5HORA 3DFCB 3TUBA 1QL6A 3ATTA 2YIYA 3LJ0A 3NMUF 3ORXA 3LJ1A 5HE0A 4F9AA 5KMNA 2ZDTA 4J97A 3MB7A 2R7BA 1FMKA 3PVGA 3VULA 3WARA 5DE2A 3LM5A 5EW3A 2JDTA 1F0QA 2YM7A 5M51A 5KX8A 4L3LA 4QTAA 3R28A 4L7FA 1ZYLA 4APCA 1GOLA 4QYEA 5FXQA 5IQEA 4N6ZA 4R3RA 5AV4A 1FGIA 1J3HA 2VTMA 3LQ3A 4L68A 4C59A 4OTWA 5HNGA 4EZ3A 3HDMA 1WBNA 2J0JA 3LFSA 4FOCA 4TWPA 4BYJA 4R5YA 5LMKC 1FVTA 1OB3A 3JY9A 3SV0A 1OPLA 2JFLA 4GT3A 4E8AA 3HV3A 4FG9A 3QCXA 4GCJA 3ZO1A 4KA3A 2KULA 4G6LA 4S32A 1XBBA 1L3RE 3OG7A 2BPMA 4J71A 1CKJA 2W1EA 2BDFA 5EM7A 2RGPA 4OT6A 4RQKA 3W10A 2WKMA 5KO1A 4YZBA 1J91A 3C1XA 3PJ8A 3AMBA 4E7WA 5DN3A 1Z9XA 2B4SB 2EXMA 4GK3A 4MVFA 5DEWA 3ROYA 3CJFA 1Q3WA 1JBPE 1NY3A 3C4WA 4JLCA 5CAUA 3DT1A 3V5TA 1UNHA 2F57A 2VZ6A 3KVXA 3P08A 4MTAA 1OL1A 2BMCA 2G15A 4TRLA 2QU5A 3F3UA 4YO6A 1ZYCA 4O96A 4FUYA 4D2PA 4DA5A 3LQ8A 4TWNA 3C4XA 3EQGA 4FX3A 4L7SA 4M7IA 4RLKA 4X6QC 2VO7A 2Z7SA 5ANGA 3OWPA 3BYVA 2J50A 4M12A 2X2KA 5C03A 3R8VA 3U4WA 3IDBA 2Z8CA 3NYOA 4AA0A 4CMUA 3LCSA 2O64A 3I60A 3JUHA 4KSQA 3L9NA 3NNXA 4BCKA 3G9LX 4FEVA 2C5XA 3PG3A 3VN9A 4EJ7A 3CGFA 4CFMA 1H07A 4S31A 4YZ9A 3VBVA 1FBNA 2VWYA 3R6XA 3NYNA 3SOAA 3TEIA 3TDWA 3LXPA 4O2ZA 4DAWA 5HTBA 2UZUE 2CGWA 1PF8A 3MJ2A 5E1SA 3V8TA 3FMEA 4V0GB 2G2IA 2W9ZB 5AUVA 3W18A 1FQ1B 2ONLA 4YSMA 2CCHA 2P55A 5TO8A 3L8PA 3U8WA 2J0KA 3R7GA 3OY1A 4MNEA 1FINA 4IFGA 5IEVA 2PVNA 3Q04A 4JVGA 5A3XA 4O91A 4KS8A 3NUSA 3MTLA 4EK5A 2H6DA 2ITVA 4AT5A 1JSTA 2UW5A 3VBTA 3VQUA 3CPCA 4RJ4A 2ITNA 3FXXA 3O0GA 4FG8A 4XG4A 4DGOA 2YABA 5FM2A 4F6SA 3CE3A 2OFVA 4YPSA 3DTCA 3OD6X 1YQJA 3OW4A 3ZTXA 2A19B 3F61A 5CENA 1OGUA 3C4FA 4D1SA 4NFNA 5EHYA 4FA2A 3E92A 2J90A 3O51A 5AIKA 4AOIA 3BGZA 2Z7QA 4EI4A 2W5BA 2WQNA 2XK8A 4XOZA 3EZRA 4JR7A 5BMSA 3BQRA 2RSVA 4RX9A 5CWZA 4O82A 3FWQA 3KGAA 4LOPA 2R3FA 3VIDA 3UBDA 1URCA 1UNLA 4RVTA 2GS7A 1W84A 3FKLA 1AD5A 1ZARA 3DBCA 5JGAA 4U44A 1GZKA 5IQBA 4EH2A 3OHTA 1OKZA 3I5ZA 1YOMA 4I6HA 4CXAA 4QMQA 4ALVA 2GNFA 3ORLA 4ITHA 3QRJA 3PJ3A 1K2PA 1OKYA 2ZOQA 4FZAB 5AR4A 4D0XA 4E5BA 5HCXA 2H96A 3FQHA 4H58A 2LAVA 4EH7A 3U9CA 5TT7A 4GU6A 4RJ3A 2WQEA 4IJ9A 3VO3A 2ZVAA 3SD0A 2OXXA 1XH5A 3LQ5A 4OTFA 5DG5A 1IA8A 4J53A 2UW0A 4I41A 4TZRA 3ZSHA 1OIYA 2RFSA 4CKJA 3IPHA 4FF8A 5CF5A 3FMHA 4EQUA 3UO5A 2ITTA 5CY3A 5G6VA 3HUBA 4BTKA 2OO8X 4BBEA 3PP1A 3ALOA 4MD7E 3QKKA 3QKMA 4IBMA 4XMOA 3DXQA 5E7RA 3U54A 3OOMA 1V0PA 3PE2A 4Q5EA 3ZONA 4K11A 4HYHA 5C27A 5LVOA 2YIQA 3FL4A 3LXLA 3H9RA 3W2SA 4AP7A 5A54A 4AE9A 5KHXA 1J7LA 5C4LA 2PMLX 2YJRA 5IQAA 4UYAA 3MY1A 1Q62A 4LL0A 4UWYA 5DYJA 4M67A 5DRBA 3VQHA 4FSUA 2GS2A 3R8LA 3LLAA 4WIHA 3VS7A 4RWJA 1SVGA 4YZCA 5DFPA 3ITZA 3P9JA 4FEQA 1PJKA 3EFJA 2IVTA 3KB7A 2VWWA 4FSTA 1J1CA 2UZTA 3FLZA 3HGKA 5E8XA 4UN0C 5CSPA 3D5WA 3DQXA 4Z7GA 3VAPA 3R83A 1PRYA 4O21A 4E5WA 3NNUA 3NCGA 3W8LA 2VUWA 5AWMA 1CM8A 2R5TA 2EVAA 2VTQA 3MW1A 4QP6A 5AX3A 1URWA 2RG5A 3KCFA 1MP8A 1WBOA 4BKJA 3ZZWA 5IDPA 2REIA 1OKWA 3P7CA 1JNKA 4IM3A 3U51A 4OTQA 3QQLA 2IN6A 3QD0A 4FT9A 2XIZA 3P0MA 4JXFA 5HD4A 4ASZA 2OH4A 5EW8A 4DF3A 4ZMEA 3LXKA 2I40A 3TNHA 4AA4A 3C0HA 3MVJA 4IX3A 4OR5A 5KKRB 4D2SA 1H1SA 3DKGA 4P5QA 4OTGA 3FI4A 4MF1A 5EM8A 2PE2A 4FTCA 5M09A 4CYJA 3I7BA 4HVIA 3N51A 4HJOA 1XH6A 5IQIA 1OMWA 3CPBA 1W82A 4YJVA 4FTKA 2BRMA 4UMQA 5IA2A 1K3AA 3WZEA 3NDMA 4W4YA 2QONA 4MXXA 5HNBA 3WIGA 5J95A 2XYUA 4QMPA 5BMMA 3BU6A 1UNGA 3G9NA 4BCHA 5L2SA 1VR2A 2EUFB 4RVKA 3GFEA 3D2IA 4I94A 2JDSA 5K9IA 4RFYA 4ZEGA 3VNTA 4ANOA 5FTOA 3COHA 3ZCLA 1PXNA 4M0YA 3RPOA 3UZRA 2XVDA 3DZOA 2H34A 3QX2A 4ITIA 3A2CA 5B0XA 1DI9A 3FE3A 2YFXA 3BI6A 3PY0A 4FTUA 2PZPA 4L46A 4ZSEA 3QRKA 4CFXA 2UW6A 3UQFA 2WTKB 4M3QA 2WMWA 3IG7A 3NIEA 3EZVA 2OLCA 5IA0A 5JK3A 5CXHA 4AGDA 4JAIA 2VO6A 2F7ZE 4M13A 2IW9A 4JRNA 5E9EA 2JKMA 4QMTA 4O7WA 3W55A 1WBVA 4FKJA 4FTRA 3RM7A 2WPAA 2WMBA 4RIXB 3KC3A 5L8JA 3ZXZA 1BYGA 1RJBA 3AC2A 5I9UA 4A9RA 4JR3A 4MXCA 1DI8A 3W2OA 1PY5A 3NUPA 5AA9A 5GIOE 2JAMA 2R3GA 2QOIA 4RPVA 2B9JA 4IWDA 1YHWA 3QYZA 2BIKB 4XP0A 1PMVA 2C0TA 3OY3A 2Y0AA 3EFKA 3VS4A 1YI3A 4EK3A 4ZTQA 1XR1A 5C1QB 2QVSE 3GU5A 4NTSA 4QYYA 4RVLA 4ASXA 4DFLA 1YHVA 5AM6A 3TDVA 1Q61A 4MBJA 4IX4A 3SG8A 2XH5A 4DFNA 4BR3A 4OLIA 2WTVA 3MSSA 3TKUA 2VWVA 3UNZA 1OKVA 4BI2A 5FP6A 4FKWA 3AT4A 4BBFA 3JS2A 2BUJA 3KY2A 4H1MA 2VWZA 5ACKA 3O71A 4IZ7A 4D0WA 2NRUA 2F49A 3BLQA 4CZYB 3ELJA 2R3HA 5CT0A 3UJGA 4CZTA 5CEMA 4DTAA 3R8MA 1VYWA 3AGMA 4MD9E 1KWPA 2ZMDA 3D14A 2VX0A 3TNWA 4DH8A 3DB8A 5IG1A 3FLQA 4DBXA 2HZ4A 3RVGA 4U5JA 3G0FA 3OS3A 4IVBA 4J99A 5DOSA 4ZSLA 5FQDC 3UVPA 4YHJA 3P1AA 3UZPA 2PPQA 3MGYA 4FL3A 3E3PA 3B8RA 1IAJA 1ZYSA 3GU7A 3ORIA 2B55A 3QYWA 4NW6A 3QCSA 3GU8A 4M69A 3EB0A 4B9DA 2UW4A 5K5NA 4FKLA 4R3PA 4BVUA 3OW3A 4FV0A 4UMUA 1U5RA 2YIXA 2OXDA 2XNBA 3UVQA 4RBLA 4EJNA 1Y8YA 4JL9A 3M1SA 3SC1A 3K5UA 2XIYA 3QQJA 4U9AA 4DINA 4QPSA 2OJIA 3HV6A 4HGEA 4RSSA 2YEXA 4FNYA 5JEBA 3VRYA 1E1VA 2XM8A 4PPAA 2XYNA 3AMAA 4J7BA 5AUWA 4FV2A 4BIBA 3O2MA 4W9XA 4GK4A 2RF9A 5K0XA 3I5NA 3CTHA 5T3QA 3OCBA 1YI6A 3WI6A 1APME 3O8PA 4WNOA 4R78A 2QO9A 1BMKA 4KUJA 2W06A 3DKCA 3QFVA 1YWRA 4PTEA 2WMSA 4CD0A 4FI1A 4QNAA 1EH4A 4XLVA 3Q53A 4YLJA 4USEA 3QUDA 5LVPA 4GG7A 4FTQA 4AT4A 2JAVA 3QCYA 4BGHA 1OBDA 5AR5A 5JGBA 4IIRA 3Q5ZA 2EWAA 5I3OA 3RINA 4BCIA 4W8EA 3Q9YA 3BU5A 1PKGA 3CKXA 3CQWA 4J1RA 4QD6A 2J5FA 4BCNA 4XV1A 3MPTA 2ZJWA 4X2JA 4PTCA 4KD1A 3SQQA 1WFCA 4M66A 4FTTA 3K5VA 3W1FA 3H30A 1Q8WA 2YM4A 4KB8A 4XG7A 1NW1A 5CEKA 4WSYA 4OGRA 4YTCA 4IVDA 3IECA 4BGGA 3K54A 3WF9A 2Z7RA 3QUEA 3G2FA 4DITA 2WFYA 2W05A 5D12A 2O2UA 4YBKA 1KE7A 3KKVA 4C4FA 4C8BA 4CV8A 3OC1A 3QZFA 5IEYA 5CVHA 4BDBA 3PIXA 4IJPA 3QL8A 2YCQA 3PY3A 2OJGA 3PRFA 5L2TA 3PXRA 5IA4A 5HE1A 3OXZA 2WHBA 1XH9A 1W8CA 5AMNA 4O0RA 4CFUA 2CN5A 5HZNA 4MQ1A 4L8MA 3RK9A 2W4JA 4TNBA 4CKRA 1KE6A 2ZMCA 4TXCA 4EH6A 2YLEA 3KF7A 3FLWA 2WEIA 1MQ4A 4YC6A 3MIAA 4CVAA 4FEWA 4EC8A 2PMIA 3HVCA 3FAAA 3CBLA 1G5SA 1RW8A 4AF3A 4AE6A 2VTJA 3R2BA 5LARA 4BGQA 3ZFMA 4E4LA 4B4LA 5AEPA 3V5WA 3ROCA 4IM0A 3F7WA 2NPQA 2YM3A 2P2IA 1OUKA 2R3OA 1FOTA 1ZYDA 3LM0A 3OTVA 4BCFA 5A4EA 2FGIA 3FUPA 3F5UA 4M15A 2XCKA 2XNNA 1PW2A 4WKQA 5IA3A 5L8KA 4YJUA 3V51A 4RT7A 4FIEA 3F6XA 5JSMA 2WOUA 3AQVA 5HD7A 3KRLA 2OBJA 4L00A 5M08A 4XLIA 4F63A 4F9WA 3ZDUA 3LPBA 4FV9A 2XIRA 1X8BA 2IW8A 4J8NA 3KRRA 1PHKA 2YDIA 4FV8A 1OM1A 3LFEA 2W4KA 1LR4A 4O7ZA 4O7YA 4CQEA 2X7GA 4EKKA 5I0BA 1O6LA 2ZV2A 3A8XA 5E8YA 3BHVA 3FHIA 3AGLA 3OWJA 2ITUA 1SYKA 5ANDA 2YJSA 1U59A 4ZTMA 3QA0A 3FZ1A 2I0HA 3P7BA 2BALA 2X4ZA 4PL5A 4UWBA 4ARKA 3NVKI 2CGUA 4PX6A 3KMMA 4RFMA 4ZY6A 3R9OA 4WO5A 3UC4A 5IH4A 2VTPA 3FYKX 2ESMA 4KKGA 4P90A 4TTHB 4LQMA 4BL1A 5IDNA 1ERKA 3DBEA 5KBRA 3UPZA 3OFMA 3ZZEA 2OW3A 2P2HA 4MKCA 2X0GA 4TKSA 4WT6A 1IRKA 1LEWA 3ZSIA 4DCEA 4CQGA 1H26A 3PJ2A 4JG8A 4KKHA 3I4BA 3SW7A 2BTSA 2VAGA 4JIKA 4LI5A 4RVMA 5L2QA 4ALWA 4F99A 2HIWA 3GCQA 5GJFA 4BDCA 3E63A 4LL5A 3DAJA 4V01A 4ERKA 4DGGA 2W1GA 3NIZA 2WTKC 3HMOA 4LRMA 1J7UA 3LMGA 4ZOGA 3OZ6A 5HQ0A 3W2QA 3QHWA 3PXQA 2X9FA 5HHWA 1YXTA 2YIWA 5AJQA 3SAYA 4EZ7A 2PVJA 3I81A 4F09A 2HWPA 3TWJA 1MQBA 1SM2A 4ZJIA 1OIRA 1XBCA 4EK8A 4OBOA 2VX3A 4G3CA 2W1DA 2GQSA 3FMLA 4GJ3A 3G90X 4LMUA 4YC8A 3COMA 4IB5A 2Y9QA 4IH8A 4DT8A 4K1BA 4MBIA 1JSVA 4I5CA 1YXSA 1AQ1A 1M17A 4FMQA 4ZK5A 4KIPA 3VS2A 4V0GA 3RZFA 4IB0A 2XA4A 2PUNA 3QQKA 5JRQA 4AUAA 5M4FA 1JLUE 2Q0BA 3IW4A 3CP9A 5D7AA 1WVYA 3TUDA 4MWIA 3HAVA 4U97A 2WXVA 4OAVB 4WBBB 3HP5A 5CS6A 3EWHA 4FT7A 5CT7A 1JSUA 3DV3A 3HZTA 3UIMA 4AFEA 5I9ZA 4K8AA 2QLQA 2XNPA 4FKGA 3MA3A 5AR7A 3R7IA 4YJNA 3PSCA 4FTAA 3ZH8A 2QG5A 2JEDA 2PVRA 3QGWA 3FYJX 2OICA 4ZIMA 2ITOA 3GC7A 2RIOA 4DFZE 5BVFA 2B52A 1U46A 3IGOA 4I0SA 3V01A 4GUEA 1VEBA 1XBAA 5HCZA 3II5A 3A4PA 4FKTA 1PMNA 3ANQA 2BR1A 3KXGA 4M0ZA 3UMXA 3JVSA 3A7HA 3VC4A 4DGLC 5T68A 4W4WA 3VBWA 2PTKA 3A7FA 4WHZA 2BRGA 3Q2JA 2LGCA 2XNEA 3O23A 1R3CA 4M69B 2R9SA 5JH6A 3Q2MA 4X0MA 3RP9A 3ZC6A 5FM3A 2IWIA 3F69A 5D41A 1WVWA 4NEUA 1Q3DA 5AUXA 3R1SA 2WMRA 1XWSA 5DR6A 1GZOA 2YIRA 3Q4ZA 4KIKB 5E91A 4Y83A 3WZUA 3SG9A 1UKHA 2VTOA 5H9BA 5BQ0A 2I1MA 4U7ZA 3RK5A 3TTJA 4YHTA 2DUVA 3ZO4A 4BDEA 3COIA 4FKOA 2XZSA 2QOKA 4CLIA 4C57A 2JKKA 4O6EA 1UU7A 2W5HA 3FZRA 4PMMA 3TIYA 1M7QA 3V5LA 3TT0A 2VNWA 1B39A 3QRIA 4N0SA 3ZC5A 3I0QA 3HP2A 4U80A 2PZRA 2WGJA 3E87A 3H4JA 2XKDA 5IH5A 5J87A 4RMZA 4L52A 4X3JA 4E93A 5BVOA 5BNJA 4DC2A 4ANNA 4O0UA 5FBNC 3FSKA 2QG7A 3F2RA 5HNIX 4JRVA 3RKBA 5M4IA 5FGKA 2QODA 3DZQA 2W99B 3NUXA 4RJ7A 5KE0A 4G16A 4WUAA 2QD9A 2ITYA 5CSWA 4C36A 4AGWA 2G2HA 5EQEA 4C4GA 2NRYA 5LCJA 2P0CA 5AP2A 2HY0A 4FT5A 3CJGA 3ID6C 5JQ5A 3EQDA 3QZHA 2B0QA 1Y91A 3NWWA 3M11A 2J4ZA 5DPVA 3PVUA 3I6WA 1MRVA 4AOTA 2Z2WA 3QQUA 1XJDA 4AFJA 4EK4A 3DBFA 3Q96A 1YI4A 4ANBA 2BAQA 1NXKA 3S1HA 3A61A 3RTPA 4TYHB 2RFDA 4D9TA 3IK3A 3O7LB 4OTHA 3NNVA 3BHYA 1Q99A 2UZEA 3PVWA 3MH1A 5KZIA 2J0IA 4YLLA 4YTHA 5CEIA 2WD1A 5IA5A 3V3VA 2KTYA 2ITQA 4F1MA 1M2PA 5J79A 4ONAA 3RWQA 5M06A 4XP2A 3IS5A 3UYTA 3R9RA 4FKQA 3LIJA 2OH0E 4XCUA 1XH7A 3R7YA 2UZNA 3BYMA 3MWUA 3ETAA 3ZYAA 5EDPA 4JQ7A 5LCKA 5CLPA 2ITZA 4I23A 4IX5A 3CSVA 4OAUC 4G2FA 1QPCA 3BHHA 2VRXA 4IZAA 2XRWA 1OIQA 3QZGA 4HPTE 4GUBA 4O27B 5I5ZA 4EHZA 4BYIA 2RG6A 4O6LA 5DEYA 4FV3A 5LMBA 4O7SA 3NCZA 4UWCA 4ZSAA 4JBVA 1REJA 3Q6UA 4NWMA 1G8SA 2FH9A 2PYWA 2YA9A 3TCPA 3FY0A 1YWVA 3DOGA 5C8MA 5M55A 4GYIA 4BZNA 4HNIA 4FZ6A 4AU8A 5KMOA 4P7EA 1UVRA 4XRLA 3BU3A 4LV8A 4JNWA 1QPDA 2PZ5A 4C34A 4F1TA 5AP0A 4RA5A 4L44A 3RNYA 4I1ZA 2PUIA 5HG9A 3A8WA 3QWKA 5KHWA 3OOGA 4HW7A 4UY9A 4E4NA 4Q9ZA 3UQCA 3VUIA 3RJCA 1FGKA 2JDVA 5EKOA 2I7QA 3BCEA 3ODYX 3GCUA 4RIXA 2P33A 4JAJA 3HECA 2OSCA 4L43A 2O5KA 4PF4A 3AT2A 4ZLZA 2R7IA 4QMYA 4BICA 2UW7A 3HMNA 3R7VA 2XB7A 1NT2A 2XM9A 1O6KA 5CF4A 4DE4A 3BGQA 5HU9A 1ND4A 1L8TA 2ZV8A 3LW0A 4NJ3A 2YDKA 2W0JA 2Y4IB 5KMLA 4FZDB 5J5TA 2ACXA 3SKCA 4DH7A 5BVDA 4CT2A 3ORZA 4HNFA 4DBNA 2R3MA 3SLSA 3NPCA 2FSLX 2IZTA 1YVJA 3RM6A 4DH5A 1OL5A 3DK7A 3SGCA 5E8TA 1R39A 2YCRA 3DQWA 3VBQA 3ZO2A 4AA5A 1YOJA 4WG3A 1XH8A 2B9HA 3ZMMA 4NCTC 5DBXA 2QO7A 3FLYA 2R4BA 2E9OA 3IW7A 1E9HA 4X3FC 3RPRA 3V8WA 4FYOA 5K5XA 4FKUA 1GJOA 2CNQA 2UW3A 1XHAA 4C37A 2JBPA 2CNVA 1NVQA 3FZSA 5IA1A 3OWLA 5CI7A 5CSVA 4GYGA 3D7ZA 3TV4A 1TVOA 2W9FB 3MDYA 4G1WA 4H3BA 5AP3A 4EOQA 1VYZA 4C62A 4FV5A 2Z60A 4MBLA 5K3YA 3F7ZA 4X2GA 4BDDA 3KVWA 3G33A 1IAHA 1OUYA 4XV3A 4CG9A 2C69A 2CLXA 3VUMA 3MPAA 1YOLA 4TY1A 2YISA 2OZOA 3HMIA 4YGAA 4ACDA 3CQUA 3ZM4A 4AS0A 3FDNA 1MRUA 3NAYA 1TKIA 1QPJA 2FUMA 4EZ5A 2XEZA 3F9NA 3GC8A 3Q4TA 3ZDIA 4EYMA 5BPYA 1XO2B 2X7OA 2R3JA 2OGVA 2XKFA 3PG1A 4H39A 5B7VA 3PFQA 3F88A 3R71A 1W83A 1BUHA 3GBZA 3VJOA 5IZFA 3W2CA 3ZS5A 5LXMA 3NGAA 4YJOA 4D2TA 5CALA 3QC4A 2CKQA 3IQ7A 3UIXA 3NR9A 2QI8A 4J98A 4QMSA 5A4TA 3L9MA 4O81A 4R77A 3D0EA 3I0OA 4FOBA 3DDQA 4KABA 4IB1A 2CN8A 5EHOA 4CEGA 2HOGA 5DVRA 4Q2AA 5BVWA 3TIZA 3R01A 1JWHA 2C6OA 4B99A 4IANA 2IZUA 3A62A 3P4KA 4ANSA 4JG7A 4F08A 3FQSA 5L6OA 3DPKA 3V6RA 4IC7A 3RCJA 2H9VA 5AUYA 5A46A 3THBA 5CU2A 1Q4LA 3EQBA 4MX9A 4NM5A 2CDZA 5HE2A 2BRNA 4F9YA 1P2AA 4O1PA 5AR2A 5F4NA 5HE3A 1UKIA 2JDOA 4XEYA 4C58A 2CMWA 3CTQA 2PVYA 3CR0A 1YDRE 3CD3A 2DWBA 1JVPP 4GVJA 5HIBA 3VHKA 4ANMA 5L2IA 5HLPA 3OWKA 4O7LA 4L53A 1ZZ2A 3ZBFA 3EQRA 2X6EA 1KSWA 2C4GA 2XNMA 1CMKE 4NTTA 1UU9A 4FNZA 4C3RA 3LFNA 2J0LA 4GK2A 2AYPA 2XBJA 5FDXA 4Z3VA 4LMNA 5C8NA 5H8BA 4ANQA 1CSNA 3BE9A 4PMSA 2IG7A 1KE9A 2F7EE 2XJ1A 3OTUA 3RMFA 3RCDA 2PWLA 4EL9A 3QX4A 1ZAOA 3ORPA 4RZWA 5CU6A 4IHPA 2Y6OA 2GPHA 3FZTA 3IW6A 2JIVA 3IDPA 3C7QA 2WTDA 4DFXE 5JQ8A 1H25A 4PMTA 1WAKA 4UZHA 3R1NA 5AADA 2W1HA 4A9UA 4U6RA 1S9IA 3V6SA 4NZWB 3QA8A 5GJGA 5D9HA 3QTSA 4RFZA 3VUDA 1IASA 3SHEA 3VS1A 4A9TA 4IXPA 4I6FA 3FPMA 4FBXA 5DRDA 2Y7JA 2FSMX 3ZFYA 2PMOX 2JIUA 4QOXA 1OIUA 2PUPA 2CJMA 4YUQA 4YMJA 4FT3A 4AQCA 4F9CA 2BVAA 3QBNA 2XNGA 3S3IA 3E93A 3HAMA 4GEOA 4DG2E 2V7OA 4H1JA 3MY5A 4QMZA 2BILB 4KIQA 5HEZA 3EN9A 3JR1A 2QC6A 3CGOA 4U40A 1SNXA 3HKOA 4BIEA 2BZIB 4X21A 3R30A 3OF0A 2WB8A 3KULA 4BCPA 5AP5A 5LVNA 2HZNA 3MPMA 4LGGA 5ETAA 5CQWA 3ULZA 2IJMA 3U87A 3UO4A 5CNNA 5D10A 5L4QA 3PA5A 3HV5A 4R5SA 4YJQA 5EK7A 4CZUA 4QPAA 2R3PA 4WA9A 2W5AA 1DS5A 5AV0A 4PQNA 3VUTA 3UGCA 2WTWA 3LFBA 4KIOA 2EB3A 3F5XA 3W8QA 4B7TA 2XEYA 4CFVA 3PWDA 5FBOA 5CEQA 2J0MB 5FUTA 2EU9A 2GNIA 3BIZA 3RAIA 4E1ZA 3PXKA 5GZAA 5I9XA 3S0OA 1GAGA 2GHLA 5EQYA 5I9WA 4OTRA 2JBOA 5HCYA 2XF0A 2QOOA 2A2AA 3CIKA 4XX9A 3Q60A 3NUAA 2XK7A 2BTRA 3PRIA 5HBEA 4JBQA 4O0VA 3TM0A 3DXPA 4I5MA 3QTIA 2C6EA 3EH9A 4F7JA 4YSJA 4EH8A 5L8LA 4WG4A 3FL5A 3WIKA 1LEZA 4QQ5A 4RWLA 5DLSA 3POZA 3ZUTA 1BL6A 2A0CX 4F65A 2UZOA 3IKAA 3OXTA 3GU6A 3MS9A 3B2TA 3ZOSA 3ZFXA 4E6DA 1G8AA 2YHVA 3WZDA 4FIFA 3P5KA 1Q41A 4AG8A 3NAXA 5DGZA 4FIGA 2UZDA 2VWIA 4EHGA 5FEEA 3KQ7A 4XG3A 3ZXTA 4APPA 2QHNA 4MAOA 2B9IA 3MY0A 1UWJA 3U4UA 4D58A 3GCSA 1ZYJA 5CU4A 3OUKA 3F3WA 3Q4UA 4EH5A 4EQMA 3R21A 2XBAA 3IGGA 4EYJA 4L01A 3PWYA 5DI1A 3G15A 4QTDA 4HYIA 3EJ1A 4QP4A 4TWCA 2E2BA 4ZY5A 1LPUA 4WNPA 4NL0A 4HGTA 3ZSGA 1A48A 2VTLA 5EI2A 4HYUA 3DLZA 4N6YA 3RNIA 4N57A 1JKKA 3OEZA 3HV7A 5GINE 4ZSJA 4DH3A 2B1PA 4R3CA 4S34A 4D4SA 4ZXTA 4E73A 4X2KA 5DA3A 4K77A 1KV1A 5L6PA 4QQTA 4QMVA 4HVGA 2X1NA 3OEFX 3Q9ZA 1BKXA 2GQGA 4DFUA 4BF2A 4CMOA 4OBQA 1BI7A 2P4IA 2ZM4A 2Q0NA 3GOKA 2YM5A 1JKLA 2VO3A 4UALA 2JITA 3F3ZA 4FEUA 4ZMFA 4DHFA 1YHSA 4C33A 4ZZOA 3RBWA 1JPAA 3G5DA 3R2YA 4QMMA 4AWIA 3DJ5A 2OXYA 4L6QA 3VRZA 2F7XE 3MFRA 4BZOA 3CXWA 4FSQA 4FKRA 4F64A 4LUDA 2V22A 3HEGA 3D5VA 2X81A 4FIIA 4UX9A 3EL7A 5FEQA 4D2WA 2B7AA 4ZLOA 4NM0A 3MA6A 1HCKA 2QOQA 2WU7A 3FMJA 3H3CA 2WEVA 3H9OA 4EUUA 2F4JA 3CEKA 3OMVA 4FV4A 4GT4A 4Z16A 1JKTA 1M7NA 4BDFA 5IISA 3U6IA 2Y8OA 3SXRA 4ZY4A 3QWJA 1PMUA 3RPVA 4RX8A 3ANRA 3OXIA 4K2RA 3OVVA 4CTBA 3UQGA 2I0EA 3NZ0A 2VGPA 3RPSA 2QLUA 2XP2A 1O9UA 4QP7A 3UYSA 4YJTA 4KIKA 4GL9A 2E9PA 3POOA 2HENA 5HX6A 4O0SA 2VTHA 1SVHA 3PP0A 4U0IA 3TV7A 4F7NA 5IKWA 5JFSA 4YR8A 3R02A 3QQGA 3S95A 1FMOE 2R0UA 3R00A 4QMOA 4Y8DA 4AW1A 3MFSA 2PVHA 3ERKA 3C5UA 1DAYA 4GIHA 5TR6A 2OF2A 5A4CA 2XIKA 1I09A 2HAKA 1RE8A 3FMMA 4OBPA 4NSTA 1ZMVA 1BL7A 3SDJA 1PXOA 3TZ7A 1TQMA 3PDTA 4GV1A 2VGOA 4XG2A 5ACBC 5I3RA 2OWBA 4NT4A 3PXYA 4G3GA 4Y95A 2C5OA 5ANIA 2DYLA 1UA2A 2CSNA 4EOLA 2QKWB 3KMWA 2C6DA 1LP4A 2RFNA 3MVHA 5DT0A 4A4XA 3QXPA 4I5HA 4UV0A 4C35A 4DLJA 5FP5A 1ZWSA 5IQFA 3SA0A 3WE8A 3HYHA 4QT1A 1ZY5A 3PLAE 4F1OA 4IAYA 4RJ8A 3DY7A 2QHMA 4YHFA 3COKA 4HZRA 4JBOA 4QP3A 3JVRA 5F95A 4UB7A 4EBWA 5CAPA 3L9PA 3QGYA 5D1JA 2NO3A 3FKNA 1AGWA 1UWHA 2PUUA 4M14A 1QPEA 1DM2A 3KN6A 2OJFE 3UP2A 2VWUA 4AX8A 4I3ZA 4EONA 1H00A 3AOXA 4IW0A 4O0TA 4I4FA 4TYHA 3GCVA 5GNKA 1VZOA 5CI6A 5I9YA 4U81A 5IMEA 4LGHA 5J1VA 2RFEA 3PUPA 2G2FA 3TACA 5IUGA 1WBSA 3QC9A 2JC6A 4E6QA 2AUHA 4LUEA 5IF1A 4FTMA 2OG8A 2ZB1A 5FXRA 4GKHA 2X39A 5FRIA 3A7IA 3VS0A 2GMXA 3C5IA 4BY9E 2VN9A 1KE5A 3QRUA 3ZM9A 2JFMA 4XOYA 4Y5HA 2W17A 4U43A 3WZKA 4EOJA 2NP8A 5L3AA 3LFCA 3TUCA 3TN8A 3ZBXA 4TL0A 5ANJA 1YDTE 4HCUA 4WSQA 4EHEA 3AD5A 3F5PA 4GS6A 3I79A 5HICA 4EH3A 3QXOA 3FI8A 4LRKA 2QO2A 2XRUA 1P14A 1NVSA 2PY3A 3R7OA 3LZBA 4X2FA 3WE4A 3M42A 2BRHA 5D7VA 1H0VA 4MXOA 4CCBA 2C3KA 4D2RA 5CAQA 2WAJA 3DLSA 2BZJA 4QO9A 2JIIA 3KULB 4DFYA 5KKRC 3RPYA 4GFMA 1R1WA 4C3FA 3FXZA 2B53A 4K18A 5BYYA 4OTPA 3FZPA 1VJYA 2BRBA 3NUNA 3P79A 4HZSA 4IDVA 3PVBA 4GVAA 4NU1A 3D94A 4TWOA 5KZ0A 3OT8A 4L42A 3W2RA 5EYCA 3HMMA 4RJ6A 4S30A 3ZUUA 3QD2B 4XJ0A 3ULIA 4A07A 2C6LA 3DBDA 5EH0A 3TZ9A 4FTJA 1KV2A 1QCFA 3S00A 2WTIA 2CPKE 2C5VA 4ACGA 3Q9XA 4W9WA 4Y46A 5CF6A 2OZAB 3UTOA 3UIBA 1P5EA 4AN2A 4QNYA 1IR3A 2V62A 4BTMA 4DEGA 5A6OA 1WBWA 2XK6A 1H0WA 5J5SA 4YJSA 4D5KA 4YU2A 4OW8A 1OZ1A 3OCTA 3OUNB 5HLNA 3DB6A 4RA4A 1OBGA 1J7IA 3QALE 3JYAA 5BUIA 2BDJA 3R22A 3LMIA 3QLFA 4DG3E 5JFXA 5B2KA 2XK3A 1OECA 4AZFA 1XH4A 2P3GX 4JDKA 4X2NA 5DNRA 1M2RA 4U41A 5CASA 3A7GA 3UIUA 2XS0A 3C4ZA 2FO0A 1W0XC 4ZZNA 2BCJA 3ZRLA 3QTZA 2BKKA 3PE1A 3MYGA 4N70A 4EOOA 5AP4A 1H1QA 3BBWA 1ZRZA 2ITXA 2CKEA 3P78A 4QTEA 2PK9A 2EB2A 4BDIA 4U3YA 3BQCA 5AM7A 4QQCA 5DH3A 4AZTA 4GFOA 4LYNA 3OCGA 4OTIA 3EQFA 5AA8A 1SMHA 5IEXA 3REPA 4DEEA 3SX9A 4GKIA 2ZAZA 2J2IB 5J8IA 3ZO3A 3U6JA 3NW6A 5DMZA 1OITA 2PL0A 3S4QA 3E7OA 5HVYA 4AGCA 5JN2A 2PVFA 3LCDA 3QTUA 4JJRA 4AZEA 4PMPA 3W33A 3BE2A 5EDRA 2R3QA 2WQMA 2G9XA 4QRCA 5AUTA 2B9FA 4DG0E 3W32A 2G1TA 3H0YA 2X8EA 3L8VA 4MHAA 2FYSA 3H0ZA 4D9UA 3LFQA 3HLLA 3FPQA 4I6QA 2C1AA 4F0IA 3P7AA 4EORA 4WOVA 2YAAA 4BDHA 4EHVA 4Q9SA 5J9ZA 1Q8TA 2SRCA 4HOKA 3DGKA 3FQEA 4OTDA 3BV3A 4C3PA 4C4EA 2VTTA 3DXNA 4MQ2A 1V0OA 4UXQA 3KL8A 4YPDA 4BBMA 3NW5A 5DR9A 5HGIA 4NYEA 2ONLC 3BGPA 4FKIA 1JKSA 3NW7A 4GH2A 4JQEA 4Y73A 2FSTX 2GNGA 1U5QA 2HW6A 3CS9A 3E8EA 4FT0A 4RIYB 3UNJA 4IAIA 2IW6A 4XH6A 3DNEA 5JT2A 3QF9A 3U6HA 3L8XA 4A9YA 5HG5A 4FKSA 1PYXA 4RX5A 3EQCA 1OPJA 3VW6A 3FMNA 3C4CA 4GG5A 4LG4A 3OP5A 4Y85A 4G5PA 3N9XA 4XV2A 5K4IA 1E1XA 4F4PA 5EQPA 5LVMA 4O86A 2O0UA 2V55A 3S2PA 4HCVA 3I1AA 4WNKA 5AV3A 3ZU7A 3E62A 4QMLA 4MXAA 4FTNA 1BI8A 1PXIA 3H9FA 3R8UA 2DQ7X 3KXHA 2VTAA 2GFCA 2GFSA 3SW4A 4WRSA 3FEGA 3BRBA 2H8HA 1GZ8A 4X7QA 2C5NA 4TYJA 3VUKA 2OI4X 1JOWB 3EKNA 5JFVA 4C4IA 4EQCA 4I4EA 2O3PA 2QOLA 4CLJA 4DFBA 2R3IA 5DT3A 2UZVA 5AIRA 5AX9A 4AN3A 4DLIA 2WIPA 3QZIA
chains in the Genus database with same CATH superfamily
5EM5A 3D4QA 1OL2A 3V5JA 3HRBA 2E9NA 4RC3A 2C6TA 5TF9A 5AR3A 3C0GA 4ALUA 4BFMA 5M44A 4L9IA 1WBPA 2CGVA 3WBLA 4E6CA 2F2CB 4I0RA 4BDJA 3UOHA 4IVAA 3OBJA 2Y6MA 3TI1A 3P86A 2JDRA 2XKCA 1PKDA 4E20A 2ZV7A 3UDZA 3WF6A 1Q5KA 4JG6A 4HVDA 5EYKA 4O0XA 4U3ZA 3TYKA 2GTNA 3AMYA 4CGAA 5KCVA 3DAKA 2YWVA 4UMTA 3SXSA 4II5A 2V7AA 4BI1A 3KRJA 4BDGA 4YTFA 1LUFA 4J96A 5CTPA 4XRJA 3N4VA 3GQIA 3EFWA 1H1PA 3D7TA 3KXNA 3MIYA 4LOOA 5E8ZA 1OL6A 1WZYA 4AW2A 2X8IA 3VJNA 4YURA 5ETFA 4CYIA 4G6OA 3WF8A 3QTXA 4QQJA 2PVMA 2WU6A 2O65A 3Q5IA 4AN9A 5BVEA 1JQHA 4J52A 4MD8E 4KINA 4JI9A 2E9UA 4AACA 3KK8A 4JMQA 2OK1A 5CAVA 4W4VA 5G1XA 3L9LA 4E6AA 2PZYA 3CKWA 3TG1A 4YO4A 3EQPA 4NIFA 1YXUA 3EFLA 3FXWA 1ST4A 3ZRMA 4AW0A 3FV8A 3HA8A 4HCTA 4U8ZA 3QD4A 4W4XA 2WTCA 3BLRA 4CNHA 4EH9A 5C4KA 4EUTA 2UVZA 3FHRA 3ZLXA 1J1BA 4BRXA 4M97A 4DT9A 2CCIA 5GIPE 4M8TA 5JFWA 5EYDA 3F5GA 3OBGA 3GFWA 5J1WA 3IW5A 3E5AA 4O0YA 4E26A 3HA6A 1U54A 4A4LA 4EOKA 5FTQA 5AV1A 2C3JA 5FDPA 2XJ0A 4K6ZA 4UBAA 2HZIA 3NFGB 3AC8A 4LOQA 4BKZA 3K2LA 5DIAA 1Q24A 4XUFA 4YLKA 1P4OA 2UUEA 2O63A 5DT4A 1DAWA 3LMHA 3HNGA 1W7HA 5HLWA 3T3VA 1OL7A 2YZLA 2C0OA 3G0EA 3UOKA 2YCFA 4H3QA 2OIBA 4IC8A 3R7EA 2JGZA 3CCNA 3R9DA 3C0IA 1Q8UA 3GQLA 3SVVA 2BZKB 3R8ZA 2WOTA 1P4FA 3FMDA 3HRCA 3GXLA 3CY3A 1ATPE 4TYIA 4FVRA 3WF5A 4F6WA 4QMUA 3W0SA 5M4UA 1BX6A 2YDJA 5FTGA 5T6KA 1PXPA 3AXWA 3FBVA 4AT3A 4C2WA 2WMAA 4D4YA 2WMQA 4V04A 4CFWA 4PTGA 3TTIA 1HCLA 3B8QA 3E3BX 4DTKA 5A4LA 4RIWB 5EFQA 3F3TA 3VF8A 4O38A 4IAZA 3AT3A 2AC3A 3ACKA 4CT1A 3EN6A 5ANEA 2PU8A 2WMVA 2BKZA 3GEQA 4K9YA 4AZWA 5LOHA 3O17A 4MNFA 1H1RA 1Y6BA 4RX7A 1ZMWA 5AAGA 4RJ5A 4EOSA 4PNIA 3TXOA 3QQHA 3KCKA 1T45A 1R0EA 2IZRA 3K3IA 4UYNA 4IB3A 2QKRA 5CU3A 5DWRA 4CFFA 3UOJA 2A4LA 3HV4A 3ZUVA 3WYYA 4FEXA 3PIYA 4RRVA 4TW9A 5CVGA 1MRYA 5H3QA 3VS5A 4BCJA 2C47A 2C3LA 4PWNA 2X8DA 4RWIA 5B2LA 1ZXEA 4L67A 2IVSA 2BFXA 5FD2A 4P5ZA 3EN7A 1OVEA 4IFCA 5CQUA 3VWAA 4W8DA 3TZ8A 2W4OA 4ITJA 3D15A 4ZTNA 5AUZA 3DU8A 1WCCA 3R04A 5KMIA 4IE9A 3VUGA 1ZOEA 3R1YA 4ORKA 3U9NA 3PA3A 1V0BA 1SZMA 1UV5A 2UW8A 4M68A 2GHMA 5CXZA 5AUUA 2JD5A 3R8PA 4C2VA 4ZTLA 4FSNA 1CKPA 5HBJA 3KIOC 4DEBA 3LFAA 4NK9A 1ZZLA 2FVDA 3KU2A 5GHVA 4HYSA 5GZ8A 5KNJA 3EN5A 2EXEA 2GU8A 3AC1A 2OU7A 2AQXA 3IO7A 5C9CA 5BVNA 5HIEA 4RG0A 4KBCA 4EOPA 2ETMA 2FA2A 3FY2A 5B2MA 2X9EA 3O5AA 3QHRA 5K0KA 4XHKB 4A7CA 3KK9A 4AOJA 3PPKA 4HVHA 2HXLA 3MH2A 3UVRA 4C0TA 4PPBA 5LMAA 4H3PA 4BB4A 2J51A 3I7CA 3CQEA 1NA7A 5E1EA 2CGXA 4ZS4A 4BDAA 3QLGA 4H36A 3FSFA 3CTJA 3ORMA 1STCE 5L2WA 4BCMA 2R3RA 3C51A 4FTOA 1NVRA 3VW8A 2IVVA 4DGNA 3NRMA 4IWQA 3D9VA 1YDSE 3BKBA 2WNTA 5CEPA 4QTBA 2HZ0A 5ICPA 5A6NA 2QU6A 5AV2A 4Y5QA 2FB8A 3QTRA 1SNUA 3RHXA 3LLTA 3KXMA 4ZJJA 5H8GA 5EW9A 1M14A 1PXKA 4I0TA 3KA0A 4QYGA 2HW7A 3F66A 2XK4A 4XBUA 4EOIA 2HYYA 5LQFA 3GT8A 5IU2A 4I6LA 3TL8A 1GIJA 2C5YA 1T46A 4LFIA 4NH1A 3GC9A 4O2PA 3VVHA 2PE0A 5IUIA 2I6LA 2QQ7A 3UP7A 4ENYA 3SRVA 4IDTA 3PSBA 3Q3BA 4C02A 2C6KA 3MVLA 4HPUE 4OUCA 2PZIA 2WTJA 3FC2A 3ORKA 4ZSGA 3R9HA 4O1OA 5M53A 4ID7A 5BYLA 3MV5A 2EXCX 3KN5A 4GSBA 5ANKA 2XCHA 3UODA 3BL9A 3O7LD 5CU0A 3TJCA 4MUQA 4D4VA 1YW2A 3Q9WA 1Z57A 3PZEA 3LFFA 4XP3A 2JKQA 4JX7A 4RLLA 2OF4A 4DEIA 4F7SA 4G6NA 4IZYA 4ZZMA 3MI9A 5KBQA 5IQHA 3UMWA 4O7TA 3E64A 3JY0A 3W0QA 4JT3A 3MBLA 2Z7LA 5ITAA 3D7TB 4QMWA 5CNOA 2FSOX 4LGDA 5E92A 5HO6A 2HY81 4D1ZA 2XIXA 3IONA 3RI1A 4MYGA 1JAMA 2BIYA 2YN8A 4HGSA 2C0IA 4IACA 3ALNA 4I6BA 1CKIA 3SOCA 2ITWA 5JRSA 4D1XA 4C7TA 1Y57A 4QYHA 1PXLA 4G5JA 5E4HA 4FZ7A 2VWXA 2BHEA 1U4DA 1RQQA 2BAJA 4NIFB 4M84A 4I5PA 4EBVA 3V04A 1IA9A 4QMXA 3T3UA 4S33A 2F9GA 3A7JA 1OI9A 3HL7A 3O8TA 4I92A 4RQVA 5FEDA 5HO8A 3TKHA 4EOMA 3GGFA 5C8KA 1F3MC 4G17A 3VF9A 4EKLA 4D55A 1A9UA 2QOCA 3EYHA 2IVUA 5HX8A 3ORTA 1U54B 3PLSA 2OZAA 2ZDUA 3WILA 1TFFA 3UO6A 5F9EA 3FLSA 5HG8A 2QR7A 1IG1A 2UV2A 5JGDA 4FYNA 1S9JA 4NFMA 4FICA 4PY1A 5LMKA 2PHKA 1GNGA 2VTSA 2GQRA 4KBAA 4DEAA 2VTNA 4G31A 4TNDA 3BV2A 4YZNA 3D5XA 3AG9A 3CLYA 3SXFA 4U45A 1Q8YA 2VTIA 1GZNA 3RALA 2ETRA 2VU3A 3BBTB 1BLXA 4AW5A 5GZ9A 4BIDA 2JLDA 3G6HA 3Q32A 5EDQA 5AFVA 5E8SA 4F7LA 5IUHA 1WVXA 4YP8A 1ZOGA 3EL8A 3PJ1A 4LRJA 3W2PA 2ZYBA 1ZY4A 4QYFA 4YZMA 4G9RA 3KRWA 2OFUA 4IAKA 3A99A 2BAKA 4DDIA 5IH6A 4DEDA 1CTPE 1FVRA 4GU9A 4R8QA 4BWPA 3GP0A 4I21A 4DYMA 3MN3A 2WMXA 3HX4A 4A4OA 2C30A 4DH1A 4C4HA 3W16A 5FXSA 4D5HA 2QCSA 5BYZA 3R63A 3BHTA 2YAKA 3DK6A 2PVLA 5TOZA 5AAEA 3LE6A 3WZJA 3MFUA 3ZEPA 4BTJA 5AR8A 4F70A 3MTFA 4UXLA 4PPCA 4XG8A 4PP9A 4MXYA 4O7NA 3A4OX 3ENHA 4LM5A 2VO0A 4NJDA 2XUUA 1UU3A 3LCTA 4TYGA 5AP1A 5BUJA 4FSMA 5M56A 2Y4IC 1WMKA 2X6DA 3U55A 4YNEA 2X7FA 4YJPA 4B0GA 3NYXA 4KWPA 4CSVA 5EKNA 3QD3A 3R1QA 4AXAA 5HVJA 4CRLA 4FV7A 4O4FA 3FJQE 4GJ2A 2V0DA 3WYXA 4NCTA 2HCKA 5LWNA 2QOHA 3LVPA 3RGFA 3V8SA 2QURA 1SVEA 2HELA 2PMNX 3DBQA 2YERA 3G6GA 3MH0A 3CD8A 3MFTA 1ZLTA 3NS9A 3QCQA 4X3FA 1MUOA 3GB2A 3VBYA 4QPMA 1O6YA 3GNIB 3QU0A 5J9LA 4EK6A 3DCVA 2ERZE 4PDSA 5CSXA 5CANA 3AKKA 3KMUA 1KE8A 4H05A 3F3VA 3BWJA 4Z55A 4Q5HA 5LJJA 1G8JA 1FVVA 3TNPC 3UPXA 3LFDA 4FK3A 4ERWA 3FC1X 4F6UA 2CHLA 3BELA 4QP9A 3KF4A 1A06A 4YZDA 4RIYA 3V5QA 4FSRA 1H01A 3JPVA 4NKSA 1M52A 5E8WA 2GNJA 1PXJA 4UMRA 4AQKA 1Z5MA 1KUTA 4IMYA 4WG5A 4XG9A 4CG8A 1GIHA 2W1FA 3NX8A 4FSYA 3HRFA 4UMPA 3PPZA 3RAHA 3LKMA 3FZOA 3IOKA 3TKIA 3NNWA 4EWQA 4LV5A 3VS3A 3LHJA 4FTLA 2QOFA 2Y4PA 5DR2A 5BX0A 4FIHA 3MJ1A 4QP2A 4BTFA 4FNWA 4YBJA 4ACHA 2I0VA 4ASEA 4PUZA 4Z7HA 3UG1A 2W7XA 4MNEB 4BDKA 4F0FA 4DDGA 2VNYA 4JBPA 5IPJA 4FC0A 4D28A 3ZHPC 1OPKA 4IAFA 2CNUA 3PYYA 2R3NA 1ZMUA 4JDIA 4U79A 3G51A 4USFA 3EIDA 2C68A 1CDKA 3NVMB 2WQOA 2GNHA 3WF7A 3KFAA 4RIOA 3PTGA 2OJ9A 5AP6A 4R1YA 2W96B 1TQIA 2R3LA 2ZM3A 3I6UA 3GU4A 3RWPA 4FUXA 3NSZA 2NNWB 5C26A 1KOBA 2GHGA 3O50A 3TNIA 2QOBA 2OIDA 2R64A 5HTIA 4MWHA 3DDPA 3D2KA 4I93A 3PPJA 4IAAA 4YJRA 2X2MA 5HESA 4AZVA 4ZLYA 4QP8A 2X2LA 3ZEWA 3FI2A 1GY3A 5HIDA 4FGRA 2G01A 4E5AX 4PV0A 4USDA 4GRBA 4O7VA 5HKMA 3GENA 3KREA 1IEPA 4KBKA 1H24A 4O84A 4FV1A 2PVKA 5JKGA 2YM6A 4A9SA 1H8FA 4JIAA 3GCPA 2IZSA 4EH4A 4AXEA 4S2ZA 4GFGA 3SRVB 2XJ2A 4WBOA 3FLNC 4FKVA 4C4JA 4R7IA 4FK6A 3Q6WA 4PDPA 3ACJA 4BKYA 1YKRA 3WOWA 3VUHA 3QQFA 4EWHA 4FZFB 4IEBA 3N4TA 5J7BA 3GUBA 5HG7A 1R0PA 2GCDA 1I44A 1H1WA 4BWKA 2PSQA 3OT3A 4WUNA 4BJJB 5AAFA 3UNKA 1TQPA 2ERKA 2W1IA 4XYFA 4ZP5A 3B2WA 5EHLA 4CKIA 3GOPA 4BC6A 3R0TA 3EQIA 2VWBA 2C3IB 3R9NA 1VLRA 5HU3A 3PZHA 1B38A 4E4MA 2XMYA 5CAOA 4D4RA 3C13A 1WBTA 4QP1A 4JS8A 1YWNA 1XQZA 4UEUA 1Q8ZA 5H8EA 5E90A 5FG8A 4AZSA 4D2VA 5IQGA 4FVQA 3VBXA 3PSDA 3PY1A 4C61A 4MF0A 2OIQA 3O8UA 3ZLYA 5ANOA 3W0NA 2HK5A 2VTRA 3QRTA 2YM8A 2ZV9A 1PYEA 4CMTA 4WRGA 3ZLSA 4RZVA 3QUPA 5TKDA 3BPRA 4FGBA 4GW8A 4I22A 5HO7A 3P23A 3LAUA 2C1BA 4YNOA 4G34A 4G3EA 3UE4A 2CLQA 4AGUA 4BCOA 5J7HA 4FTIA 3F2NA 3EKKA 5C01A 4NM3A 1H08A 5F94A 2WZJA 4IADA 4AXDA 2V5QA 1H28A 3R7UA 2DS1A 3V5PA 3F2AA 1XKKA 4PRJA 3O96A 4IQ6A 4I24A 5M57A 2ITPA 5K4JA 3DFAA 3E8NA 3Q52A 3IDCA 3BX5A 3QAME 5CZIA 3NYVA 5LWMA 2GSFA 3BZ3A 3DA6A 4NM7A 3MVMA 2W1ZA 4DEHA 2R0IA 2VV9A 4RIWA 4L45A 5HI2A 4CV9A 4B6LA 5H2UA 4AAAA 4UZDA 2WMUA 3JXWA 3IOPA 2BROA 5CF8A 2BFYA 2J7TA 5I4NA 5HOAA 3VHEA 5EOBA 5HTCA 2XNOA 4NKAA 3ZRKA 2GNLA 4BWXA 4R7HA 4I20A 3NLBA 1G3NA 3F82A 4PL4A 3RAWA 5ETCA 4FIJA 4K33A 2QR8A 4XV9A 4Z9LA 3RAKA 3PXFA 1REKA 3HUCA 4ZTSA 5GJDA 1YRPA 1PXMA 1KOAA 3MB6A 5A9UA 4KRCA 2I0YA 4KRDA 4O83A 5KUPA 2IO6A 4K0YA 4DHIB 3BEGA 2Z02A 4GMYA 4ANLA 4XNEA 4E3CA 2GS6A 3C50A 4MH7A 4BCQA 3DNDA 4DHZA 4RWKA 4RGJA 3UOLA 2YCSA 3PIZA 3EQHA 3FI3A 4WNMA 3A60A 4F0GA 2OJJA 3UZTA 3AC4A 1HOWA 4BZDA 4FKPA 1H27A 3QTWA 4XG6A 2JKOA 3E7VA 3T9TA 3RHKA 5IMXA 4FNXA 4FL2A 4PL3A 3NUUA 4R1VA 5JZNA 3DK3A 3LCOA 2PULA 4FODA 4O4BB 3EN4A 3KXZA 4ZAUA 5KMMA 4YC3A 4DN5A 3D83A 4CTCA 5CYIA 2UVXA 4FV6A 4X3FB 4KSPA 1V1KA 3TZMA 1FPUA 4HVSA 4AAYA 3CY2A 3PXZA 3IW8A 3AC3A 5EOLA 5EI6A 3ORNA 2B54A 4FSWA 4PDOA 4GT5A 2OKRA 3DS6A 2A1AB 4TPTA 4C38A 5J9YA 4X6RA 4Y72A 4U42A 5M4CA 4CFNA 2IF8A 1QMZA 1B6CB 3NUYA 3OROA 5EG3A 1M2QA 5LVLA 4ASDA 2IPXA 4IVCA 5CX9A 5JMSA 5ETIA 4OT5A 3E88A 3VS6A 4MXZA 5D11A 4F9BA 3M2WA 3LXNA 1YXVA 3HMPA 4L3JA 3R73A 5FWKK 2BDWA 2ETKA 2E9VA 2HXQA 4IWOA 5A4QA 1GIIA 3UDBA 3N4UA 5IQCA 5F1ZA 4BI0A 4QMNA 2R2PA 3UC3A 3LCKA 4ZJVA 2ZB0A 4WD5A 4JDJA 5BVKA 1ZOHA 4JX3A 2UVYA 2PE1A 3QKLA 2CKPA 3OCSA 1H4LA 2A27A 2C6MA 4TN6A 4IZ5A 3UG2A 4KS7A 4V05A 3TV6A 4GIIA 3BHUA 5BUEA 4G3DA 3KEXA 3NEWA 1F5QA 3TNQB 4DTBA 4KAOA 4RC4A 2UZLA 4JDHA 1Y6AA 5DHJA 2RKUA 5I9VA 3BYUA 5EI8A 4PDYA 2C6IA 2UW9A 4FSZA 2XK9A 3AD4A 1W2CA 2X4FA 5L6WL 3RZBA 3DKFA 2WIHA 2J5EA 3DJ7A 4MEDA 4TT7A 4KNBA 2J6MA 3ET7A 4ACCA 4TYEA 5E8VA 4ZS0A 3DJ6A 1W98A 2VX1A 5CVFA 5IQDA 2R3KA 3ENMA 3KXXA 3TJDA 4KKEA 5TE0A 3DTWA 2YWPA 4PP7A 3DKOA 2HWOA 1Q97A 2VD5A 3Q4CA 5E8UA 4XBRA 4RC2A 3T9IA 3BEAA 4FVPA 2YLFA 5KMJA 4FR4A 4HGLA 4DCAA 2UZWE 4IM2A 3K3JA 4J95A 2J9MA 4EC9A 3W0PA 4BHNA 1Y8GA 4G9CA 2GDOA 4XS2A 4J8MA 4YTIA 5HVKA 3HDNA 4O22A 2BZHB 3BYOA 4DGMA 2BHHA 2YITA 3E8CA 3GC0A 5F20A 3ODZX 4G3FA 3FKOA 2O8YA 4B8MA 4IX6A 3RK7A 3PJCA 2Q83A 4R7BA 4BCGA 3EOCA 4CCUA 3L8SA 5FLFA 5A14A 4PNKA 3AC5A 3E8DA 4FL1A 4BHZA 2WO6A 4N4SA 4L3PA 2XKEA 3BWFA 1RDQE 2F2UA 4CRSA 4ENXA 2AC5A 3H10A 4NUSA 3QTQA 2ZM1A 5AP7A 4ZTRA 2UZBA 3ZLWA 3EYGA 3LOKA 3C4EA 5KMKA 3GI3A 3MH3A 5CZHA 3AD6A 3DAEA 5EYMA 5CEOA 1YXXA 4P4CA 3FMKA 5HBHA 3PA4A 2CKOA 4JQ8A 4P2KA 4ACMA 2W1CA 4EEVA 3ATSA 4MK0A 3EHAA 5JZJA 5EM6A 4A06A 3MESA 3CC6A 4ZTHA 1R78A 2WMTA 3EMGA 2GTMA 3BLHA 4IWPA 2NYAA 1PMEA 3C9WA 3GVUA 2WELA 1UU8A 4BN1A 4O7RA 4E4XA 4NW5A 2YZAA 4QTCA 3D5UA 4B8LA 3BYSA 3KRXA 4O0WA 3T8OA 4JOAA 2WQBA 2YACA 1K9AA 4R6VA 4FG7A 2RL5A 3LJ2A 5CSHA 2QNJA 3L1SA 4FE2A 4MCVA 5HORA 3DFCB 3TUBA 1QL6A 3ATTA 2YIYA 3LJ0A 3NMUF 1W2DA 3ORXA 3LJ1A 5HE0A 4F9AA 5KMNA 2ZDTA 4J97A 3MB7A 2R7BA 1FMKA 3PVGA 3VULA 3WARA 5DE2A 3LM5A 5EW3A 2JDTA 1F0QA 2YM7A 5M51A 5KX8A 4L3LA 4QTAA 3R28A 4L7FA 1ZYLA 4APCA 1GOLA 4QYEA 5FXQA 5IQEA 4N6ZA 4R3RA 5AV4A 4QEBA 1FGIA 1J3HA 2VTMA 3LQ3A 4L68A 4C59A 4OTWA 5HNGA 4EZ3A 3BLAA 3HDMA 1WBNA 2J0JA 3LFSA 4FOCA 4TWPA 4BYJA 4R5YA 5LMKC 1FVTA 1OB3A 3JY9A 3SV0A 1OPLA 2JFLA 4GT3A 4E8AA 3HV3A 4FG9A 3QCXA 4GCJA 3ZO1A 4KA3A 2KULA 4G6LA 4S32A 4O4EA 1XBBA 1L3RE 3OG7A 2BPMA 4J71A 1CKJA 2W1EA 2BDFA 5EM7A 2RGPA 4OT6A 4RQKA 3W10A 2WKMA 5KO1A 4LV7A 4YZBA 1J91A 3C1XA 3PJ8A 3AMBA 4E7WA 5DN3A 1Z9XA 2B4SB 2EXMA 4GK3A 4MVFA 5DEWA 3ROYA 3CJFA 1Q3WA 1JBPE 1NY3A 3C4WA 4JLCA 5CAUA 3DT1A 3V5TA 1UNHA 2F57A 2VZ6A 3KVXA 3P08A 4MTAA 1OL1A 2BMCA 2G15A 4TRLA 2QU5A 3F3UA 4YO6A 1ZYCA 4O96A 1TZDA 4FUYA 4D2PA 4DA5A 3LQ8A 4TWNA 3C4XA 3EQGA 4FX3A 4L7SA 4M7IA 4RLKA 4X6QC 2VO7A 2Z7SA 5ANGA 3OWPA 3BYVA 2J50A 4M12A 2X2KA 5C03A 3R8VA 3U4WA 3IDBA 2Z8CA 3NYOA 4AA0A 4CMUA 3LCSA 2O64A 3I60A 3JUHA 4KSQA 3L9NA 3NNXA 4BCKA 3G9LX 4FEVA 2C5XA 3PG3A 3VN9A 4EJ7A 3CGFA 4CFMA 1H07A 4S31A 4YZ9A 3VBVA 1FBNA 2VWYA 3R6XA 3NYNA 3SOAA 3TEIA 3TDWA 3LXPA 4O2ZA 4DAWA 5HTBA 2UZUE 2CGWA 1PF8A 3MJ2A 5E1SA 3V8TA 3FMEA 4V0GB 2G2IA 2W9ZB 5AUVA 3W18A 1FQ1B 2ONLA 4YSMA 2CCHA 2P55A 5TO8A 3L8PA 3U8WA 2J0KA 3R7GA 3OY1A 4MNEA 1FINA 4IFGA 5IEVA 2PVNA 3Q04A 4JVGA 5A3XA 4O91A 4KS8A 3NUSA 3MTLA 4EK5A 2H6DA 2ITVA 3AKLA 4AT5A 1JSTA 2UW5A 3VBTA 3VQUA 3CPCA 4RJ4A 2ITNA 3FXXA 3O0GA 4FG8A 4XG4A 4DGOA 2YABA 5FM2A 4F6SA 3CE3A 2OFVA 4YPSA 3DTCA 3OD6X 1YQJA 3OW4A 3ZTXA 2A19B 3F61A 5CENA 1OGUA 3C4FA 4D1SA 4NFNA 5EHYA 4FA2A 3E92A 2J90A 3O51A 5AIKA 4AOIA 3BGZA 2Z7QA 4EI4A 2W5BA 2WQNA 2XK8A 4XOZA 3EZRA 4JR7A 5BMSA 3BQRA 2RSVA 4RX9A 5CWZA 4O82A 3FWQA 3KGAA 4LOPA 2R3FA 3VIDA 3UBDA 1URCA 1UNLA 4RVTA 2GS7A 1W84A 3FKLA 1AD5A 1ZARA 3DBCA 5JGAA 4U44A 1GZKA 5IQBA 4EH2A 3OHTA 1OKZA 3I5ZA 1YOMA 4I6HA 4CXAA 4QMQA 4ALVA 2GNFA 3ORLA 4ITHA 3QRJA 3PJ3A 1K2PA 1OKYA 2ZOQA 4FZAB 5AR4A 4D0XA 4E5BA 5HCXA 2H96A 3FQHA 4H58A 2LAVA 4EH7A 3U9CA 5TT7A 5BV3A 4GU6A 4RJ3A 2WQEA 4IJ9A 3VO3A 2ZVAA 3SD0A 2OXXA 1XH5A 3LQ5A 4OTFA 5DG5A 1IA8A 4J53A 2UW0A 4I41A 4TZRA 3ZSHA 1OIYA 2RFSA 4CKJA 3IPHA 4FF8A 4BJJA 5CF5A 3FMHA 4EQUA 3UO5A 2ITTA 5CY3A 5G6VA 3HUBA 4BTKA 2OO8X 4BBEA 3PP1A 3ALOA 4MD7E 3QKKA 3QKMA 4IBMA 4XMOA 3DXQA 5E7RA 3U54A 3OOMA 1V0PA 3PE2A 4Q5EA 3ZONA 4K11A 4HYHA 5C27A 5LVOA 2YIQA 3FL4A 3LXLA 3H9RA 3W2SA 4AP7A 5A54A 4AE9A 5KHXA 1J7LA 5C4LA 2PMLX 2YJRA 5IQAA 4UYAA 3MY1A 2IEWA 1Q62A 4LL0A 4UWYA 5DYJA 4M67A 5DRBA 3VQHA 4FSUA 2GS2A 3R8LA 3LLAA 4WIHA 3VS7A 4RWJA 1SVGA 4YZCA 5DFPA 3ITZA 3P9JA 4FEQA 1PJKA 3EFJA 2IVTA 3KB7A 2VWWA 4FSTA 1J1CA 2UZTA 3FLZA 3HGKA 5E8XA 4UN0C 5CSPA 3D5WA 3DQXA 4Z7GA 3VAPA 3R83A 1PRYA 4O21A 4E5WA 3NNUA 3NCGA 3W8LA 2VUWA 5AWMA 1CM8A 2R5TA 2EVAA 2VTQA 3MW1A 4QP6A 5AX3A 1URWA 2RG5A 3KCFA 1MP8A 1WBOA 4BKJA 3ZZWA 5IDPA 2REIA 1OKWA 3P7CA 1JNKA 4IM3A 3U51A 4OTQA 3QQLA 2IN6A 3QD0A 4FT9A 2XIZA 3P0MA 4JXFA 2ZFYA 5HD4A 4ASZA 2OH4A 5EW8A 4DF3A 4ZMEA 3LXKA 2I40A 3TNHA 4AA4A 3C0HA 3MVJA 4IX3A 4OR5A 5KKRB 4D2SA 1H1SA 3DKGA 4P5QA 4OTGA 3FI4A 4MF1A 5EM8A 2PE2A 4FTCA 5M09A 4CYJA 3I7BA 4HVIA 3N51A 4HJOA 1XH6A 5IQIA 1OMWA 3CPBA 1W82A 4YJVA 4FTKA 2BRMA 4UMQA 5IA2A 1K3AA 3WZEA 3NDMA 4W4YA 2QONA 4MXXA 5HNBA 3WIGA 5J95A 2XYUA 4QMPA 5BMMA 3BU6A 1UNGA 3G9NA 4BCHA 5L2SA 1VR2A 2EUFB 4RVKA 3GFEA 3D2IA 4I94A 2JDSA 5K9IA 4RFYA 4ZEGA 3VNTA 4ANOA 5FTOA 3COHA 3ZCLA 1PXNA 4M0YA 3RPOA 3UZRA 2XVDA 3DZOA 2H34A 3QX2A 4ITIA 3A2CA 5B0XA 1DI9A 3FE3A 2YFXA 3BI6A 3PY0A 4FTUA 2PZPA 4L46A 4ZSEA 3QRKA 4CFXA 2UW6A 3UQFA 2WTKB 4M3QA 2WMWA 3IG7A 3NIEA 3EZVA 2OLCA 5IA0A 5JK3A 5CXHA 4AGDA 4JAIA 2VO6A 2F7ZE 4M13A 2IW9A 4JRNA 5E9EA 2JKMA 4QMTA 4O7WA 3W55A 1WBVA 4FKJA 4FTRA 3RM7A 2WPAA 2WMBA 4RIXB 3KC3A 5L8JA 3ZXZA 1BYGA 1RJBA 3AC2A 5I9UA 4A9RA 4JR3A 4MXCA 1DI8A 3W2OA 1PY5A 3NUPA 5AA9A 5GIOE 2JAMA 2R3GA 2QOIA 4RPVA 2B9JA 4IWDA 1YHWA 3QYZA 2BIKB 4XP0A 5M07A 1PMVA 2C0TA 3OY3A 2Y0AA 3EFKA 3VS4A 1YI3A 4EK3A 4ZTQA 1XR1A