3RWPA

Discovery of a novel, potent and selective inhibitor of 3-phosphoinositide dependent kinase (pdk1)
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
287
structure length
277
Chain Sequence
b'QPRKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEYLIFQKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTPPKLT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-phosphoinositide-dependent protein kinase 1
publication title Discovery of Novel, Potent, and Selective Inhibitors of 3-Phosphoinositide-Dependent Kinase (PDK1).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 82
structure length 277
sequence length 287
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2011-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3rwpA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3rwpA01
3DGKA 5AMNA 1OI9A 2XK8A 2WTDA 2BHEA 3KVWA 3VUDA 4DGMA 5IA4A 1DAWA 4WRSA 4FIGA 1KOBA 3ALOA 3QTXA 4Y46A 2ZAZA 4XV9A 3MA6A 4DT8A 5LVPA 4EHZA 5CSXA 3CPCA 3NR9A 3PIYA 4CNHA 4GT4A 4YNOA 5F4NA 2W5BA 3ZDIA 3NMUF 3BQRA 5EI8A 5DE2A 1Y8YA 4MF0A 5AV2A 3ORXA 1M2RA 4WHZA 5M07A 2JDVA 5CWZA 5HG8A 3RHKA 5J5TA 1XBCA 2JKKA 3OW3A 5CAVA 5IA5A 2X0GA 4BGQA 4IMYA 2R0UA 3TCPA 5I9ZA 3HECA 2ITYA 3NUYA 2GHGA 3BV2A 5KCVA 4HGTA 3UQGA 4O81A 3UG2A 2R3FA 2J0KA 3R02A 1REKA 1ZYDA 2OU7A 4ZAUA 1KV2A 4U80A 3JXWA 4IB0A 5DRBA 3BHVA 2PUPA 3FI8A 3ELJA 3F88A 3PSCA 2OJGA 2PE1A 4FSYA 2XJ1A 4JDJA 3OD6X 3R1QA 1H01A 2IVTA 3R2BA 4ITJA 4NFMA 5TKDA 4BGHA 4EYJA 3NNWA 5EQYA 1YI4A 5HORA 5AX9A 5HBEA 5HNBA 2C5XA 2XBJA 3P9JA 4KKHA 5EYDA 4DBNA 5E8WA 2VWZA 4PP9A 4FIIA 5CSVA 3RPVA 1XKKA 3TNHA 3WF6A 4BFMA 4D5KA 4EOLA 4BICA 4L68A 5FQDC 2CMWA 3UG1A 5BVNA 4HNFA 4JX7A 3R7YA 4M0ZA 4OTQA 1Q8ZA 2W4JA 2J7TA 4J53A 4PTEA 5EQEA 3DLZA 4DEDA 3B8QA 4OTRA 5A4TA 3QQHA 1URWA 3NUUA 5CSWA 5ETIA 2WTVA 3QU0A 2YM8A 2V55A 3SHEA 3ZXZA 2QU5A 4I5CA 5JH6A 1TKIA 2W17A 5E8UA 3QA0A 4QTCA 3UVQA 3ROYA 3W8QA 3D9VA 3C50A 5E8ZA 5C27A 3PPJA 3EFKA 4R1VA 4GFOA 3VO3A 3DTCA 5BMSA 4FSMA 3E93A 2XKCA 3G0EA 4DH5A 4IDTA 2IPXA 1GNGA 4CXAA 4JVGA 2BROA 1NVQA 3Q4TA 2Z2WA 1PHKA 3MYGA 4ZTNA 1F3MC 4ZTLA 4FT3A 4OTIA 4XLVA 3TACA 4BRXA 2YISA 4Z9LA 3PJ1A 2WIPA 3POOA 5CT0A 5CU6A 5FBOA 4WNPA 4BKZA 4PTCA 4FV1A 4M69B 4W4VA 3HZTA 3QUDA 4OTFA 5FBNC 5IEXA 3FZTA 4YO6A 3HX4A 3OP5A 3WZEA 4L42A 3KB7A 4U7ZA 3ZHPC 3GU7A 3QFVA 4YJSA 3HLLA 5B2LA 2YA9A 5J1VA 5IQGA 1AD5A 5FD2A 4BIDA 3VS0A 2ETKA 1XQZA 3F9NA 5A4CA 3REPA 4O7RA 1PW2A 5GJDA 4ZY6A 1KSWA 1YOLA 3IW8A 4I6QA 3WZKA 4EH4A 2X2KA 3VRZA 4G3CA 3TNWA 3HDNA 5IF1A 3LQ3A 3IS5A 2A2AA 3TV7A 2OFUA 4H3BA 2PVNA 4LUEA 5KKRC 3R73A 5CXZA 5IUIA 4CEGA 4CZTA 1G8AA 2BUJA 2WMTA 4B99A 3BHHA 5IH6A 1FQ1B 5AV3A 4KD1A 4NCTA 3G90X 4JL9A 3NYOA 3R1SA 2J2IB 5AR4A 3QYWA 3SV0A 4BCMA 2XIZA 4BBFA 4H58A 3DKCA 3DT1A 4MBIA 3S95A 5BMMA 3PVGA 4KKGA 3I0OA 3KK8A 5ETFA 4M68A 4ZEGA 4AU8A 3CIKA 3F3WA 3PYYA 4NFNA 3N9XA 3RINA 4FT0A 5I3RA 4J95A 1JPAA 3HYHA 4ZLOA 1H1PA 4WNOA 3G15A 4MH7A 2BIYA 3VS5A 1OITA 4IANA 2RKUA 4AP7A 4F7NA 3L8PA 2YWPA 4QMNA 3VS1A 5ANGA 1Y6BA 3P78A 4WSYA 2WQOA 2XYUA 4N0SA 5HEZA 3QZHA 3ZXTA 4FT7A 2VN9A 4DTKA 3EIDA 1UU7A 4I92A 4P7EA 3OCBA 4RIYA 2WNTA 5C8MA 3SRVB 1MQBA 4RLLA 3O8TA 1H08A 3DBFA 1R3CA 5AIRA 4ACHA 4XBUA 4EHEA 1YI3A 3GCSA 4GVJA 1R1WA 3QTSA 4MD7E 2OXYA 2JKOA 3SD0A 2HENA 4I4EA 3KF7A 4TNBA 4OTDA 2JD5A 2VTIA 4FC0A 4FV0A 4FSUA 4QNAA 5EDPA 4KAOA 4PMPA 3BWFA 3CGFA 2EXMA 2F2UA 4YJOA 5I9WA 3PLAE 2J6MA 4C3FA 1YOJA 4YHTA 3ZSIA 4FG8A 3OCSA 1NVRA 2GSFA 4RBLA 4D2RA 5LWMA 4V04A 2C30A 2OGVA 2RG6A 3ORNA 3QZFA 4FYNA 4K6ZA 1YQJA 2CSNA 5KZ0A 3MY0A 3IG7A 3T3UA 3UNZA 4F9CA 4C4HA 5HICA 3W16A 1V0PA 2B54A 2C6TA 4YZBA 4CFMA 4A9TA 4ZSLA 5LVNA 2VTRA 5D12A 1ZMUA 1CM8A 3Q4ZA 4LUDA 2QOHA 3ZFMA 3F2RA 1OECA 2X2MA 3AT3A 3GC0A 4IFGA 3R7IA 1IAHA 4G6NA 4FKLA 3QRJA 2PUUA 3A7IA 2C3LA 4BWXA 2QOBA 1M2PA 4C62A 4DFYA 5L2WA 3GOPA 2YDKA 2B9JA 2JITA 2F9GA 3ORPA 4K77A 4CZUA 3W33A 4BI1A 3VS3A 5KMKA 3L9MA 4UMTA 3PUPA 4PTGA 4QMYA 3VW8A 5CEIA 3FC2A 3QD2B 1WBVA 3DV3A 1J3HA 3K5UA 3MPTA 5KX8A 3LKMA 2E9VA 3ETAA 2XK3A 2X39A 3MSSA 3Q4UA 3R8MA 5J95A 5TO8A 3GFWA 3IO7A 5JEBA 2C6EA 3MS9A 2XK6A 1MP8A 2A19B 3FMNA 5CX9A 2YM4A 4ZZMA 2CN5A 4PNIA 2HZ4A 1A48A 3MVJA 4L44A 3W2RA 4CKRA 4K0YA 2R9SA 3VAPA 4D2PA 2C0OA 5HIEA 4NEUA 4Q9SA 4AQCA 4BIEA 1DM2A 3FQHA 4FKUA 3HVCA 2XZSA 3NUPA 5LVMA 4YJNA 2VTNA 3BZ3A 4JAIA 3U9CA 3COHA 2WMWA 1Z5MA 2I6LA 1HCKA 3BKBA 4GH2A 1U5QA 4JDHA 4IM3A 4AGCA 2X2LA 4KIKB 2HWPA 3E3BX 3QTWA 4ZS0A 4PY1A 4QP4A 3MVMA 4FX3A 2B7AA 3QQGA 5AJQA 3PA3A 5J8IA 3Q9ZA 5EK7A 5GJFA 2BAJA 4I5HA 4M14A 4XMOA 2DWBA 2PZIA 2YIYA 3A4PA 2VO3A 4FKSA 4C33A 2CHLA 5KE0A 2CCHA 5FEQA 2OG8A 3LM0A 2VRXA 4V0GA 4F0IA 4QMMA 2OJJA 3R00A 4OLIA 2ITWA 1XO2B 2OIBA 3R30A 3VRYA 1UU8A 3KKVA 3OOMA 3DFCB 5AM7A 5L8JA 3QTUA 5EI6A 3UNKA 5HGIA 1B39A 2BFYA 4AAAA 2PVLA 4DG3E 5I9UA 4DEBA 3TIZA 4CFNA 2Y9QA 5HI2A 4D1SA 4PDPA 5IZFA 3QX4A 4XG7A 4TWOA 5M4IA 1GY3A 3EQPA 4TY1A 4D1XA 2UVZA 1R0EA 3ENHA 5CVFA 2I7QA 1RJBA 3F2AA 4K1BA 5DT4A 5BYLA 2QR7A 5HBHA 2W05A 3QKMA 3AC2A 5DH3A 2BDFA 3ZC5A 4ZY5A 1SVEA 5LCKA 3VUGA 4UEUA 5DFPA 3R8VA 3F5GA 3ET7A 4BB4A 3QC4A 5AP6A 3EHAA 4U42A 5BUEA 4FV3A 2W5HA 4FKPA 2O64A 2YDIA 3I4BA 3VS7A 4O0UA 4P5ZA 4QPMA 5C4LA 2FSOX 3ZLYA 4EK5A 4IAIA 1STCE 1Y6AA 4R7HA 4ZLYA 3ZYAA 5GZAA 3OHTA 3PXQA 5DI1A 4QTEA 2GQRA 4O7VA 4PNKA 3A99A 4TYGA 1Q97A 4WNKA 2XKFA 1F5QA 1OIYA 2R4BA 1OGUA 3QCSA 3BBWA 4MAOA 4EQCA 4QYEA 5K9IA 3JR1A 4B4LA 4HPUE 4X6RA 3C1XA 4O21A 4QP3A 2Z60A 2X4FA 1UWJA 1T46A 3HV4A 1G3NA 4RC2A 4QMLA 3TXOA 5M09A 4FL1A 4X2JA 2QVSE 2O0UA 3MH2A 1A9UA 3NAYA 2UW6A 3COMA 4CCBA 4IX6A 4IX3A 5H9BA 3UBDA 3LW0A 3QWKA 4TPTA 5L3AA 2E2BA 3DNEA 5CTPA 5DRDA 2QG5A 1UNHA 1M2QA 3BCEA 4LRMA 3Q96A 4O6LA 3SW7A 4DFUA 4S33A 3FQEA 1FVVA 4XOZA 4E26A 1FGKA 2XRUA 1UWHA 4IADA 1OPKA 5ANEA 4AZWA 5ETCA 1YWVA 5HO8A 3V04A 5HE0A 4BCPA 2OF4A 1Q62A 3DOGA 4AA5A 3MGYA 3QCYA 3HMNA 2VGOA 1S9JA 3R9DA 3F5PA 5FP6A 1YVJA 4WSQA 4XH6A 4EH6A 2R7IA 3P5KA 3KXXA 2BRNA 3NUXA 4DEHA 3MI9A 3LCOA 5F1ZA 3TNQB 4M66A 5HX8A 4CV8A 5IQAA 5C03A 4O1PA 4U41A 1ZZLA 5EDRA 4EQMA 1LUFA 2JAMA 4Y73A 2W1GA 4FKVA 5EHYA 3IK3A 3TWJA 2I40A 1OL1A 3A62A 4AS0A 5KUPA 4H3PA 2P4IA 4TTHB 2PWLA 2ZVAA 4XOYA 3LQ5A 2XBAA 4EOPA 2F7EE 4TWPA 4NW6A 4IAZA 2VWBA 3LXNA 2RSVA 2YJRA 5J79A 3FMJA 1JSVA 4AT4A 5HG9A 3N4VA 3AC4A 4I5MA 3PE2A 1KE8A 4FTLA 4O0YA 4WG4A 1OUYA 4X2GA 3NWWA 4S34A 2UZEA 3QALE 2GNIA 2YM6A 4FTJA 4EYMA 5JFXA 5H8EA 4AZTA 3BYUA 3ZLWA 3LMHA 1OPJA 2OIQA 3R63A 4RJ8A 4BDGA 2UVYA 3QWJA 4LOOA 4IWOA 5AX3A 2ITUA 5CU3A 4YTFA 3R9OA 3RM6A 2C3KA 5AUZA 3P1AA 2WGJA 4NKSA 4QQCA 4XS2A 4B9DA 1OBDA 2BKKA 2VWUA 3QKLA 2BVAA 3PLSA 3NUNA 2DUVA 4XHKB 2B9FA 3JYAA 4RX9A 1BX6A 1VYZA 2P55A 5ETAA 3R7EA 1QPJA 2SRCA 5EYMA 3WF9A 4QPAA 1P4FA 3PPZA 2QLUA 2VWIA 3CXWA 3LVPA 3GI3A 1YWNA 4DBXA 3UP7A 5FWKK 4RA4A 2QD9A 4AE9A 1YXTA 1M52A 3CJFA 4LV5A 4R3RA 4AF3A 3NIZA 2PUNA 1KE5A 2WMXA 3COKA 4L7FA 2OSCA 3I79A 1WZYA 4U6RA 2IW6A 3PSBA 2C5OA 3M2WA 4FNWA 4G3FA 4ITIA 4OW8A 2XA4A 5M51A 3O23A 3MPAA 2ACXA 2OO8X 3BYOA 3LFBA 4HGEA 1WBOA 5AP3A 3VUHA 1GJOA 1I44A 4WNMA 4DH8A 2FH9A 4OBQA 5IH5A 3VBTA 5EG3A 4J96A 4QQTA 1SVHA 2BIKB 2QO7A 3FMMA 3HV5A 3MA3A 4ZP5A 2QR8A 3CKXA 5IG1A 4XG8A 2YABA 3PG3A 1VJYA 2XYNA 3R8LA 3DU8A 3TTIA 3C4WA 4YJTA 4ANMA 5I0BA 3MIYA 4LRJA 3D7ZA 5AUWA 2B1PA 1QL6A 2WMRA 3GENA 3ZFYA 4EK6A 4OTHA 2W1HA 5TF9A 1W0XC 1OB3A 3RTPA 2JBOA 4ZJVA 4BTKA 5DMZA 4UBAA 4FNXA 3GU6A 2VTJA 3KXZA 2CKEA 3QHRA 5BVFA 4N6YA 5AUTA 3T3VA 4I6FA 4F7JA 4GKHA 4YPDA 4HNIA 3IGGA 5K0XA 3VUTA 2RFSA 4F4PA 2XNOA 3POZA 1Y91A 4YTCA 2BMCA 1FOTA 1U5RA 3WF8A 4JQ7A 4AW1A 1DI8A 3AMAA 4N6ZA 3AT2A 4IC8A 2OKRA 1H27A 2W1ZA 4BDEA 5E8TA 3UGCA 3NAXA 3PVUA 1Q8UA 2LGCA 3R8UA 1H24A 4IACA 2JC6A 2W0JA 3DY7A 4BDFA 4F1MA 4XX9A 4OAVB 5CT7A 2OIDA 3ZS5A 5DEYA 3C5UA 3TUBA 3ORIA 2WXVA 4E5BA 4AZEA 5DHJA 4CRSA 4DAWA 4DGGA 4H36A 4PPBA 3TUDA 2PVKA 3ANQA 4GFGA 2V7OA 4MXYA 2YLFA 1ZAOA 2WOTA 1NXKA 1ZYLA 2GPHA 2XRWA 4FV2A 1ZRZA 2G15A 4Z16A 3KN5A 2ZV7A 3R7GA 2OJ9A 2XKEA 2Y8OA 5E8YA 3THBA 2YLEA 3VHEA 3F3ZA 2VWVA 2ITPA 2OXDA 2P33A 4FICA 4U5JA 3C4XA 5EKOA 1WFCA 3ZEPA 4EUTA 2WO6A 1ZWSA 3ACJA 4TYEA 2PUIA 2GNGA 3AGLA 3W2QA 3LCSA 3COIA 2WMAA 4A9SA 3HRFA 1LR4A 3RKBA 2I1MA 3P0MA 2X7FA 1OKVA 3FSFA 4C4FA 5HLNA 2X1NA 2F4JA 4CZYB 5CS6A 3Q4CA 5B2KA 4UX9A 1BL6A 4BC6A 4IZ5A 3PIXA 2B4SB 3E8NA 3R6XA 4XCUA 4ASDA 3ZBXA 3UIUA 3BGZA 3KK9A 3NVKI 4EJNA 5L6OA 2VTAA 2R2PA 2HWOA 3AMBA 3I1AA 4IBMA 2WQEA 5FM2A 4ZK5A 3R9RA 2OBJA 1X8BA 3SOCA 1BL7A 2G2IA 4O0RA 3NYVA 4I0SA 4MF1A 5IA0A 3V6RA 2YM7A 5CAQA 5EYKA 3QRIA 4U45A 1J7IA 3UZRA 4FV6A 4IM0A 4UALA 3VIDA 4F0FA 4O7TA 4BCHA 2JFLA 5EKNA 4IVCA 2OI4X 3BBTB 2IVSA 5JMSA 4CGAA 4EOKA 4CKIA 1IEPA 4EBVA 4RIWB 1UNLA 4DH1A 5CZIA 3TZMA 3FMHA 2HZIA 3LLTA 4RGJA 2X9EA 3DTWA 4CQEA 3S1HA 3BYMA 1H1SA 2OF2A 5JFWA 3EWHA 5HD7A 4U3ZA 5HKMA 4G9RA 1PXIA 5KMMA 3R71A 3B2WA 4ZMEA 4E7WA 1BLXA 5IUHA 5FTQA 4L52A 1Y8GA 4IZYA 4R7IA 2X8IA 3MDYA 2W7XA 4LFIA 2P0CA 4RX8A 5B2MA 2JIIA 1OUKA 5A9UA 3FI3A 3VC4A 3WZJA 5HVJA 3EJ1A 3EKKA 1XH6A 4KA3A 3CE3A 4PDOA 1NW1A 4LI5A 4FEUA 2PVRA 4KRDA 5JZJA 3DBQA 2QONA 1SZMA 2PHKA 4TRLA 4CTCA 2QQ7A 3E7VA 4R78A 4PP7A 1FBNA 1YW2A 5E92A 4HVDA 2QKRA 1VYWA 5E4HA 3A2CA 3TKUA 3MFRA 3QRUA 2B9IA 3SX9A 3W18A 5LVLA 4FR4A 4D55A 3P7CA 2H34A 4KBKA 4RIXA 2HAKA 4IE9A 4RIYB 4NSTA 4E4NA 2FB8A 1OL6A 2ZB1A 4RT7A 1XH8A 4BN1A 3WF7A 2EB2A 4PMSA 2EU9A 4GVAA 4L3JA 5I9VA 4YZDA 1QPEA 3FUPA 2XMYA 3ZEWA 4Q9ZA 4EK3A 4YBJA 5TT7A 4IB3A 4AOJA 4D28A 5CEOA 4CTBA 4JBVA 4XJ0A 2XEZA 2REIA 3BGQA 3P86A 3UVPA 2HK5A 2R3NA 2R3QA 4X2KA 2PE0A 4WG5A 4ZSJA 3W2PA 2OZOA 3O7LD 4JG7A 5CEPA 3ATSA 1TVOA 4L6QA 3TM0A 3BX5A 3KY2A 5DPVA 4YR8A 2YIRA 1SVGA 3RZFA 4QMWA 3HP2A 2Q0NA 5AAGA 5BYZA 3DK3A 4ACDA 2VTLA 4U43A 3NDMA 2V5QA 4Y95A 3C51A 4GYGA 1CKPA 3Q2MA 3EKNA 4XG2A 4UZHA 2HXQA 4XRLA 1SNXA 3LXLA 3LLAA 1H8FA 3ID6C 1H0WA 4OBOA 4F0GA 4PPCA 4ZSEA 5CVHA 2HOGA 4QRCA 5F95A 2C5NA 4FEVA 2ZJWA 1M14A 2PZRA 3CY2A 5CYIA 2FGIA 4C0TA 3NNVA 4F70A 3ATTA 3QGYA 5K3YA 2QU6A 4QMVA 1J7LA 2IZTA 3F7ZA 2W4KA 3TJCA 1H26A 3KCKA 2O65A 4FSWA 4YJUA 4DEEA 4EI4A 2C3IB 2VGPA 4CMTA 3RM7A 1JQHA 3PY1A 1OPLA 1OKZA 4FKQA 4FMQA 4RJ3A 2Y0AA 3ZLXA 4E5WA 4KINA 3DA6A 4BI2A 3FKNA 1ZY5A 3WE4A 3HL7A 1SNUA 3HKOA 4CMUA 4FE2A 3BU5A 5KMNA 3MESA 4FSZA 3V3VA 5AAEA 5IQEA 3CTQA 4RQVA 3LXPA 4G17A 4ZTSA 5AR5A 3R9HA 4DG2E 1Q5KA 4XBRA 4B0GA 4D1ZA 2RFDA 2RIOA 3O71A 4QTAA 4BIBA 4G1WA 4B7TA 3C4FA 3BIZA 3BV3A 3D5VA 5K5XA 4D4SA 3RI1A 3FZPA 3EQFA 4UMUA 4E73A 2YIQA 4U40A 5H8GA 2P2HA 2R3RA 3FLYA 3K3JA 3QA8A 2OW3A 4JXFA 4D58A 3A60A 4NJDA 2ZM1A 4K2RA 3FC1X 5KBQA 3BU3A 5FUTA 4IIRA 3Q60A 3V5QA 4M8TA 3BEAA 5J9YA 2PVMA 3OUKA 4J8NA 4DG0E 4OTGA 3R1NA 2PVHA 5FXSA 5AR8A 5EYCA 5D10A 3HDMA 4AXAA 4BTFA 5IKWA 2PMLX 3RK9A 3UQCA 4O6EA 5H2UA 5HCZA 2QO2A 4MVFA 3W55A 4M3QA 4J99A 3D14A 4FUXA 2X9FA 4MQ1A 2J0JA 4QYHA 4V0GB 5BUJA 2R5TA 3EYHA 4QMQA 5G6VA 2HCKA 2HW6A 2ERZE 5A4EA 4W8EA 5IQHA 5CI7A 3DS6A 1Q61A 2CLQA 3GGFA 4AG8A 2C5YA 2B53A 1GZOA 3PTGA 4O91A 4EOSA 5HE2A 4HW7A 3I6UA 2F2CB 2FSLX 3FQSA 2RL5A 3W2CA 4FZ7A 5A6OA 4KNBA 3OOGA 5FTGA 2BFXA 2OZAB 4RZVA 4QYGA 4YO4A 3F3TA 3P79A 5CF4A 5M44A 3HMOA 3KFAA 2WOUA 3QX2A 4QMSA 4M13A 3ZO2A 3L9PA 4BWPA 1VR2A 4DN5A 2P3GX 4CLIA 4XNEA 3ZRKA 2QOLA 4F9BA 4O7LA 3ZSGA 3AD6A 4RIWA 5A3XA 3UMXA 4ZMFA 1FMOE 2HW7A 4ENXA 3QQJA 4BVUA 4LRKA 4Y83A 3T9IA 4C37A 4JNWA 3UIMA 4IX4A 5BPYA 5HD4A 5LMBA 4EJ7A 1YI6A 2JAVA 3DJ7A 5LQFA 1FVRA 4DE4A 5EW3A 2J50A 4NCTC 2QURA 2EWAA 4NYEA 1GAGA 3C5IA 3CR0A 4HYIA 5IMXA 4HYSA 2C6IA 2YIWA 4N70A 4RVLA 4G3DA 3U6IA 3U6JA 3MVLA 4A9RA 5HESA 3QCQA 4DHFA 4ZJIA 4R77A 5T68A 4G3GA 4RJ4A 4TL0A 4MHAA 5T3QA 3HA6A 2OK1A 4RWJA 3D0EA 4DC2A 3L9NA 4I94A 5ANDA 1Y57A 2ETRA 5HLPA 1JBPE 4IAFA 3D5XA 4C38A 4F64A 4W4YA 2WMVA 4NKAA 5I9XA 3ZZEA 2WTKC 4LGGA 5D9HA 4MWIA 2R3MA 3BI6A 5E9EA 4YZMA 4I1ZA 2VTPA 5IDPA 4FVRA 4S31A 3DAJA 3LJ1A 3UC4A 2ZOQA 5FEEA 4QP9A 3SAYA 4EH7A 4ZY4A 5FXRA 4P90A 5HE3A 2WTWA 3GC7A 1MRVA 4FIFA 4O1OA 1IA9A 3QLFA 4LYNA 4WA9A 4F65A 2JDTA 2GU8A 4NTTA 2JKQA 3CD3A 4JRNA 2QOFA 3ZONA 2CGUA 3UZPA 4E1ZA 5BNJA 3DLSA 4O0WA 4L9IA 4XV1A 4DTAA 1BKXA 3ZRLA 4BCKA 2BKZA 2G9XA 4RX5A 5AR7A 3PY0A 3DZQA 4HOKA 3WYYA 3HEGA 4FKTA 5HTBA 2PMNX 1O6YA 3DKFA 4E4MA 1PMNA 4Q2AA 1W82A 2PULA 3MH3A 5IISA 4EHGA 3MV5A 4BYIA 4W4WA 2YZLA 2PL0A 3MW1A 4ZSGA 2ETMA 3Q9YA 4PMMA 3MTFA 4LQMA 1PJKA 4S2ZA 1ZYCA 1PKDA 2Z8CA 2PY3A 4ZOGA 3KRLA 3QUPA 4ZJJA 3D2KA 2BAKA 2O2UA 4HVIA 4DFZE 3SA0A 2R3IA 5EM7A 3RAWA 4CFUA 4CCUA 1YXUA 2BZKB 2FO0A 2WMUA 3NPCA 2G2FA 1H1QA 3O51A 3PWYA 2QNJA 4KWPA 4TYHB 4CRLA 3K3IA 5CANA 2WMQA 2BCJA 4FKWA 4TWCA 4MK0A 4YHJA 4G6OA 5J1WA 1ZOGA 3W2SA 4V05A 2BILB 4O86A 2ITQA 3RZBA 2BAQA 4QYYA 5HU9A 4FTQA 3H9RA 1Q99A 3LM5A 3FKLA 1P5EA 4NIFA 2VNWA 4JDKA 4L00A 1L8TA 3PE1A 4U79A 3DZOA 5J87A 3VF9A 4A7CA 3I0QA 4G5JA 4X21A 3L9LA 4CFFA 2PPQA 3CY3A 2F57A 2WQBA 5EW9A 3GC8A 3R7OA 2WU6A 1ATPE 4F7LA 2C0TA 4TXCA 4I5PA 3KCFA 1OIQA 3KF4A 3BRBA 2GFCA 4HGLA 4JS8A 3DDPA 4M12A 4YTHA 3ZO4A 4ASXA 4BDCA 4X7QA 5HU3A 5EW8A 1CKJA 1HOWA 1YRPA 3H10A 5LCJA 1S9IA 3BGPA 3Q5IA 2J5EA 4OUCA 4JR3A 3RWQA 2JIUA 5I4NA 4ANLA 3UODA 2CN8A 2UVXA 4MXZA 1PXMA 4PUZA 4EL9A 5AV4A 3OCTA 1IAJA 3N51A 4MBJA 3QZGA 5M55A 4ANSA 3RVGA 3E3PA 4IHPA 3ZSHA 3U6HA 2KTYA 3ODYX 1XH5A 2Z7RA 4PDSA 3U87A 3LXKA 4ORKA 2I0YA 2ZM4A 2PVFA 4JBOA 2ZB0A 4UXLA 3P4KA 1PXNA 4OBPA 3AC3A 4CG9A 2XF0A 1OL7A 4O0XA 2OICA 2GHMA 2XNBA 3RPOA 1IG1A 4LV8A 1UNGA 4YHFA 3ULZA 2OLCA 3QBNA 2RFEA 3RALA 2W9FB 4AA0A 3PJCA 3RBWA 5A4LA 3QTQA 1GZ8A 3HV6A 4WUAA 3SXFA 2UZDA 4F99A 3Q5ZA 2NNWB 4I93A 4YC3A 1P14A 4FKJA 2QO9A 4AZFA 2OZAA 3GCVA 4NM5A 3BLHA 3UOJA 4FTUA 3ZZWA 3AGMA 5DNRA 1NA7A 5CASA 4FZFB 3D5UA 5A4QA 3HMPA 3BWJA 2WTJA 1DS5A 4NUSA 5HO7A 2R0IA 3AD4A 4GK4A 4KIOA 3I81A 3FLZA 4XLIA 4YNEA 3K2LA 4OTPA 3E8CA 4UZDA 4DFNA 2VTQA 5IDNA 4EC8A 2YCSA 1NT2A 5DWRA 4FKRA 4AE6A 3DJ6A 5BVEA 3QKKA 4IX5A 3RPRA 5JFVA 1XBAA 2FSMX 4GFMA 5AIKA 3S00A 4EZ5A 5CF5A 1ERKA 5E8SA 3F82A 3V8SA 2I0VA 2R3GA 3R22A 4EOJA 3NEWA 3IOKA 3PXYA 4P2KA 3LQ8A 4QQJA 4O2ZA 4M0YA 4CMOA 2H8HA 4BDJA 4IVAA 2C6LA 3QUEA 2V62A 1OL2A 4W9XA 4HVSA 2B9HA 3KRWA 3TI1A 4BHNA 2VX1A 2HXLA 3ORKA 5DT3A 1PF8A 3C4EA 3MTLA 3FAAA 2BRBA 1OIUA 2XJ0A 4BDKA 5JSMA 2BDJA 4OT6A 2QOQA 4PL3A 4O22A 3L8SA 2YFXA 5D41A 5A46A 1PMEA 4EH9A 4UMPA 5KMOA 4IAAA 1FVTA 2WU7A 5LARA 4AFJA 4C58A 1APME 4FNZA 4RWLA 3OXZA 5DR6A 4HZSA 1R78A 4XEYA 4XRJA 5HHWA 2GQSA 3FJQE 3EFJA 3NYXA 4WIHA 1Z9XA 3LJ2A 5GZ8A 5L2IA 4FK6A 4BDBA 3FZ1A 1PYXA 4YLKA 2CGXA 2PVJA 3D4QA 4G9CA 5JFSA 3KULA 3O2MA 2VUWA 5CF6A 2E9UA 5HBJA 1B6CB 5CALA 2V0DA 1M7QA 3QD0A 4I6BA 5CENA 4GCJA 1LP4A 3V5JA 3OTVA 4G6LA 5FGKA 4TNDA 4AGWA 4C02A 3RHXA 3ZH8A 2VX3A 2FSTX 3IW5A 3E87A 2UZOA 4BZOA 1OL5A 3PA4A 4MWHA 1JVPP 2O63A 3QQFA 4R5YA 1XH7A 2ZYBA 3KXNA 4FV5A 4YZCA 4K8AA 2RF9A 2C1AA 4FZDB 3MY1A 3BHUA 3KXMA 3P7BA 4K18A 4WG3A 3V01A 5CU0A 3BELA 3B2TA 3F61A 4NH1A 3Q52A 3WI6A 3NLBA 4KABA 2PZPA 3FI4A 3R83A 1G8SA 5E8VA 5F20A 3UOHA 3V5WA 2C69A 2WMBA 2Z7LA 5AP2A 3PSDA 3RWPA 1WVXA 3VNTA 5J7HA 1PMUA 4X3FB 4XP3A 5HIDA 1WBPA 3L1SA 3FMLA 3TDWA 3F6XA 4PF4A 2J0MB 3I60A 4J7BA 3UVRA 4DINA 2VAGA 3M1SA 4YJPA 2CKPA 4KSPA 5C26A 4BDIA 4YJVA 3QF9A 4C59A 5L2SA 3C4CA 4O2PA 1UU9A 3LCDA 1OVEA 2RG5A 4JI9A 2HIWA 4TYHA 4DFBA 4LMUA 2XS0A 3E7OA 1R39A 3CKWA 5TR6A 3FXZA 4QP1A 4KUJA 4RVMA 4FIHA 3LMGA 3OTUA 2HYYA 3EQBA 1YHVA 4J97A 1UKIA 3ZFXA 5EM8A 2YM3A 3ULIA 3IONA 2A4LA 5E1EA 5B0XA 3U51A 1PY5A 2UW4A 2YDJA 3FHIA 1HCLA 2G2HA 2ONLA 2F7ZE 2P2IA 3KRXA 3FMEA 4RIXB 4RZWA 1WBWA 4ALWA 2OJFE 2ZDUA 4APPA 3RAKA 4DF3A 4HZRA 4CQGA 4O38A 3BLRA 1J1CA 3CD8A 2WQMA 3H30A 5EH0A 4RMZA 4E4LA 3TEIA 4MX9A 4U9AA 1AQ1A 4W8DA 4E8AA 2VO6A 1YDTE 3RK5A 3JS2A 4NZWB 4MNEA 4HCUA 4RWIA 2ONLC 3LCKA 3VF8A 4AN2A 4FTOA 5EOBA 1PMVA 3FV8A 5FXQA 4D4VA 5CI6A 5BYYA 5CXHA 1ND4A 2WAJA 2IVUA 1W83A 3BYSA 4NTSA 4DT9A 4ZXTA 3VUKA 4MXCA 3G0FA 3QTIA 4TWNA 3BQCA 3RPSA 2YM5A 5A54A 4C7TA 1PRYA 4BYJA 2Y6MA 1A06A 1I09A 3I6WA 4IVBA 4JJRA 3TTJA 4CFXA 5AADA 4I3ZA 2VNYA 4D5HA 3QL8A 4ANQA 1U59A 3KMUA 3GT8A 4O7SA 3AXWA 4MTAA 4IC7A 3TDVA 2IO6A 4Q5HA 3C4ZA 5KHWA 3VUIA 4F7SA 5IQBA 3B8RA 1ZMWA 3QAME 4ACCA 3PG1A 2QOIA 4YLLA 4FV7A 3TV4A 5LWNA 1YWRA 2CCIA 4WD5A 4IH8A 2ITOA 4KS7A 3SOAA 3UOKA 2YCFA 2VWYA 4AFEA 3LZBA 3U8WA 3SG9A 5CNNA 3PRIA 3FHRA 3L8XA 1H28A 2UW5A 4FBXA 2BTRA 3V51A 4O7YA 4CT2A 4DLJA 2GNFA 3GP0A 1OIRA 3I7BA 4OR5A 3OBJA 3PXZA 4XV2A 2W1CA 3GNIB 2WEVA 3NS9A 1U54A 3QYZA 5DIAA 3VS4A 3Q2JA 3CJGA 4PRJA 5EFQA 4DGNA 3UYTA 5FM3A 4XG9A 4ACGA 2H6DA 2X81A 4A06A 1YXXA 4XP0A 5GIOE 2BZHB 3F3UA 3ZO1A 4BKYA 1J91A 2B0QA 1H0VA 2VTSA 4ERWA 3FWQA 3ZMMA 3HA8A 3GCQA 2ITXA 3FMKA 4L3LA 5EHOA 3FKOA 3RCDA 3ZU7A 4DLIA 3CQUA 3QZIA 5CY3A 4QMPA 2R64A 3KXHA 2EXCX 3G9NA 5DGZA 4ZTRA 3S3IA 4PX6A 4FTAA 2YERA 4CFVA 4F1TA 1UV5A 3ZRMA 2VWWA 2WHBA 4QOXA 4EH3A 3GUBA 1TQMA 1VZOA 5C9CA 3R8PA 3UMWA 4A4XA 3QTZA 2AC3A 4O7NA 4JBPA 5DR2A 3KU2A 4UB7A 3VQUA 4O7ZA 4IB1A 5ITAA 1JNKA 1TQIA 1JAMA 4GG5A 2XEYA 3QHWA 4RJ6A 2PVYA 3Q9WA 4DEGA 2YWVA 1H07A 2BDWA 4GV1A 4FG9A 4JBQA 1BMKA 2BALA 3WILA 4FTIA 2A27A 4F09A 2OJIA 4J71A 4GEOA 3DFAA 4DYMA 4FIJA 3R21A 5JQ5A 5CZHA 3WOWA 4DH7A 2GNJA 3EZVA 3HUCA 4PWNA 4R3PA 2ZV8A 3GVUA 3KC3A 1ZMVA 1FGIA 4NJ3A 4WRGA 5AUXA 3QGWA 4BY9E 3GQLA 5D1JA 3HUBA 1V1KA 3R1YA 5M08A 1MRUA 3C0GA 4Z7HA 2VTOA 4F9YA 2IZUA 4NU1A 2CNUA 3VBWA 4EWHA 1YHSA 3EOCA 3PRFA 4BCFA 1V0BA 1R0PA 1G5SA 4D2WA 1JOWB 4ITHA 1RE8A 1ZYSA 4YGAA 2VTMA 4OT5A 3OUNB 3EN6A 3HMMA 4DGOA 4C4JA 2XK9A 4N57A 3BE2A 4FODA 3CTHA 1XHAA 2UZUE 4JLCA 4ALUA 3HMIA 5DN3A 4I24A 4QO9A 2H96A 4B8LA 4FT9A 3WF5A 2ERKA 4CSVA 4J52A 5IPJA 3RNIA 3WZDA 2NPQA 4NM3A 3KRRA 1LEZA 1F0QA 2PYWA 3EN4A 2FYSA 1Q41A 4YC8A 1Q24A 1J1BA 4GIIA 4DCEA 3OMVA 4QNYA 4YZ9A 1E1XA 3EFWA 1M17A 2WEIA 3PXRA 4X3FA 1WBNA 4L8MA 2UZTA 4PQNA 2XJ2A 2BZJA 3TZ7A 4EK4A 4F6SA 3SXSA 1AGWA 3LHJA 4FSTA 4UV0A 4XUFA 2XCKA 4M84A 3GCUA 2J9MA 3E92A 4FV9A 1ZARA 3D5WA 3T9TA 4EORA 5JGDA 4ACMA 2J5FA 2V7AA 4FGBA 3R7UA 4CLJA 4FYOA 1PXLA 4FL3A 5FP5A 4X3FC 4EZ3A 1PKGA 3AMYA 3OWLA 2UW8A 2Z7QA 3EQRA 2VWXA 2WTKB 3H0YA 3EMGA 3NW7A 3VULA 4FT5A 2HY0A 5AV0A 2GMXA 4BWKA 5AUYA 2IN6A 2Z7SA 1JKLA 3DDQA 3FI2A 4FG7A 4H1MA 4GG7A 4XV3A 3SG8A 4FI1A 4LG4A 4O82A 3Q6UA 1JLUE 3F2NA 3DXPA 5JGAA 5IU2A 2O5KA 1FPUA 5HVKA 4HPTE 2NRUA 2OXXA 1RDQE 4HGSA 4ZSAA 3HRCA 3RMFA 3LFDA 4HVHA 1IA8A 3W8LA 3NW5A 3SVVA 5JQ8A 5JT2A 4ONAA 2R3PA 4E20A 3EN7A 4NWMA 4QMXA 1OBGA 2CNQA 3F7WA 3ODZX 1YDRE 5L6PA 5GINE 2W4OA 3OBGA 4MCVA 4RVTA 5KHXA 3KREA 1YHWA 3AD5A 3D7TB 4XG4A 1ZLTA 4EBWA 4GUBA 3DCVA 5T6KA 4D9UA 1K9AA 4EWQA 2YZAA 2QKWB 4L3PA 4EUUA 3PJ3A 2X7GA 4BGGA 5IA2A 3VJOA 4QP8A 2UZLA 4XP2A 4A4OA 5DOSA 3DKGA 5AP4A 4Z3VA 3VHKA 3CPBA 4GUEA 4GJ2A 3DBCA 4D2VA 1UU3A 4BCOA 2QOKA 1XH4A 3A7FA 3ZOSA 5AFVA 4WOVA 4XYFA 4H1JA 5JK3A 5BUIA 3G6HA 4OGRA 1KWPA 1QCFA 3II5A 5EM5A 3TNIA 4Y5HA 4YJQA 5HQ0A 4KIQA 5L6WL 4FOCA 4LOPA 5J7BA 1P2AA 4IAKA 4QTDA 3H0ZA 3CEKA 2C1BA 5BVWA 3FDNA 4GT5A 3BU6A 4J98A 2JKMA 4O0TA 4W9WA 5C01A 5IUGA 4D0XA 4BTMA 3QTRA 1H25A 4NW5A 3RCJA 1URCA 4KKEA 2NRYA 4FEQA 2VV9A 3Q53A 5DG5A 2CPKE 3TZ9A 3AC1A 3M42A 2CKQA 4CD0A 3KMWA 5CEKA 3ROCA 3LFAA 2WTCA 3OT3A 4H3QA 5ANIA 2G1TA 5GIPE 1SYKA 3QQUA 2XKDA 3GQIA 1TQPA 4ZIMA 4NIFB 5TOZA 4UYNA 4FEXA 4RG0A 1IASA 4HYUA 4YURA 2ITNA 5C1QB 2W96B 2DYLA 5J5SA 1H00A 4O0SA 4JIKA 5AV1A 5CAUA 3WBLA 4IZAA 4OTWA 4C4EA 3A7GA 2Y4IB 2C4GA 4BCGA 3U4UA 5HG7A 3GC9A 3GU8A 4KS8A 5AR3A 4I0RA 4C2WA 3FY2A 4ALVA 4FTKA 4UN0C 2BPMA 3UQFA 1WCCA 4J1RA 1E1VA 2X6EA 1JSTA 2XIKA 4G31A 4ZTQA 4GSBA 3A8XA 3UNJA 3FYKX 3ORTA 2XK4A 4RVKA 3DQXA 3V5TA 4ASEA 1Q3WA 4RC3A 3WIKA 5L2TA 3UO4A 5KNJA 1KOAA 3UPXA 3OXTA 3VN9A 3G9LX 5HZNA 2UUEA 3D94A 1SMHA 4F9AA 4Z55A 1O6KA 2VU3A 1W7HA 3JVSA 5HLWA 4AZSA 4UY9A 2ESMA 5GHVA 3GB2A 4O83A 2CLXA 3PZEA 2DS1A 5B7VA 1OKYA 3VW6A 4AW0A 3NUAA 1O6LA 3PVWA 3JY0A 3TKIA 2XNPA 3RAIA 3V5LA 3FXWA 1BYGA 3DXNA 2Q0BA 2JIVA 4IVDA 4I41A 4CV9A 5FRIA 4XG6A 2XUUA 4B6LA 5CNOA 1CMKE 2R7BA 5DT0A 4NL0A 4FTRA 4A9YA 4HCVA 2WFYA 4O96A 3IDBA 3EQCA 4EOQA 3TN8A 3VS6A 1UKHA 4LGDA 1ZOHA 3FEGA 1BI8A 2IVVA 5BX0A 4DITA 5HNIX 4RJ5A 3DPKA 5GJGA 4E3CA 2ITVA 3QD4A 3G6GA 4BZDA 3O8UA 5HTIA 3RP9A 4F1OA 3AQVA 5EM6A 4ZZOA 2A1AB 4FTTA 4I20A 3QQLA 5CEQA 4KSQA 2WIHA 4X2FA 4X6QC 5CSPA 1RW8A 4UWYA 2J0LA 3KRJA 3KQ7A 4AN9A 1K2PA 1WBSA 2GS7A 2PTKA 2XB7A 4FV4A 3IW4A 4RPVA 3AC5A 4S30A 1KE7A 4WBOA 4RFMA 2HZ0A 2GNHA 3HGKA 3BE9A 4MXOA 5DVRA 4ARKA 4BDAA 4C8BA 1Z57A 4Z7GA 5CVGA 4HYHA 4MEDA 5IMEA 3NCGA 3VWAA 5F94A 2UZBA 3P08A 3MH1A 2GTNA 4EKKA 4II5A 4BI0A 4QMOA 3Q6WA 1E9HA 2O3PA 2IZRA 1W8CA 4I21A 2VD5A 2Y4PA 1BUHA 3F66A 3CGOA 4WBBB 5I3OA 2XNEA 4DEAA 3FYJX 4EK8A 4F9WA 4IWQA 4P4CA 3HV7A 3SLSA 5KMJA 2W1DA 2Q83A 3PIZA 2UW0A 5L4QA 2C6KA 5DR9A 4GKIA 1U4DA 1Q8TA 4UXQA 5HNGA 3WYXA 5FG8A 4UWCA 3R28A 5DBXA 2XIRA 3HRBA 3N4UA 5C4KA 3KULB 4F63A 2WMSA 3KA0A 5FEDA 4Y8DA 4BKJA 5CU4A 5LMKA 3ZBFA 2UV2A 4FV8A 3NNUA 3D7TA 3V8TA 5ACBC 5AUUA 2Z02A 3UTOA 2FVDA 3ZC6A 4R6VA 4PDYA 2C0IA 4C61A 4CYJA 3SGCA 4FGRA 3NCZA 3K5VA 4IEBA 4L46A 4Q5EA 4I23A 2W9ZB 3PJ8A 5C8KA 3R0TA 5K4JA 3CS9A 3CCNA 3A61A 4E4XA 5LMKC 1PYEA 2CGWA 3R2YA 2I0EA 3EZRA 5D11A 3WIGA 4FZAB 1ZY4A 2CJMA 3MVHA 3OWKA 3PWDA 2V22A 4L7SA 3TV6A 4AUAA 4BF2A 3AT4A 4IM2A 4D9TA 4C36A 4G16A 2IJMA 5EI2A 3TT0A 4ANBA 1PXKA 1UVRA 3U54A 1OZ1A 2JDRA 3TL8A 3MIAA 2PZYA 2J4ZA 2X7OA 4TYJA 3LFEA 1H1RA 3GBZA 4GL9A 1GIHA 4R5SA 4AA4A 3RGFA 3NSZA 3NW6A 5DA3A 4QMUA 5M4UA 3EQGA 3OFMA 2ZDTA 2QC6A 2GS2A 2Y6OA 3O8PA 2AC5A 4R8QA 4C4GA 3KVXA 3RK7A 5EDQA 4GK3A 5CU2A 3ALNA 3FY0A 5AWMA 4A07A 1KE9A 3Q9XA 4FTMA 5L2QA 3H9FA 2X8EA 4GS6A 5HCYA 2FA2A 2J90A 2G01A 5AAFA 2BTSA 3FXXA 1JKSA 5JGBA 2BZIB 4E93A 2XNGA 3O0GA 2QI8A 2YITA 3A7JA 3R01A 3FL4A 1LEWA 4U0IA 2HZNA 3ORMA 4GIHA 3ZUVA 4DFLA 4ZS4A 3FZRA 3MH0A 3MWUA 3NVMB 1RQQA 3U9NA 2UZWE 2OWBA 3E5AA 3DXQA 3U55A 4IZ7A 4FA2A 4HJOA 4RFYA 3SW4A 3ZLSA 3UPZA 4BR3A 3PVBA 4YJRA 2CDZA 3EYGA 4IDVA 4AN3A 5IEVA 5JRSA 2C6DA 3F5UA 4K9YA 3KN6A 5E7RA 5AP5A 4L43A 3A7HA 3DB8A 3F3VA 2F7XE 3FL5A 4CFWA 5KMIA 3OWJA 4EEVA 5TE0A 4O7WA 4EH8A 2WPAA 3BHYA 3MJ2A 4MNEB 3G2FA 2Y4IC 5BVOA 3OF0A 5LJJA 3L8VA 4WT6A 3RNYA 3LJ0A 3NYNA 3TIYA 4D2TA 4QT1A 1Q4LA 3VBQA 1WVYA 4LOQA 3BYVA 3HAMA 1UA2A 4QPSA 4NK9A 2NO3A 3IW7A 3ZM9A 4DTBA 2X8DA 5E91A 4YC6A 2BRGA 2WTIA 4GU9A 4M7IA 3VQHA 3EB0A 3H9OA 2XP2A 3IPHA 4CKJA 4AWIA 3ZUUA 4AGUA 2AUHA 2GDOA 2W1EA 1QPCA 2EXEA 2R3LA 2IZSA 1JKKA 3C0HA 3PZHA 4FTCA 4GYIA 3O17A 3OCGA 4M69A 4APCA 4YPSA 4E6DA 3BHTA 5ACKA 2ZM3A 2JBPA 2UW7A 5I9YA 4YSJA 1CKIA 4FSRA 5IA3A 3UP2A 5D7VA 2GS6A 3M11A 3W32A 4AT3A 2E9NA 3LIJA 4QD6A 3JVRA 3HV3A 3LFNA 5FTOA 4YMJA 5C8NA 4X3JA 3ZO3A 3PDTA 3FZOA 2CGVA 4I0TA 4YBKA 3LAUA 2IW9A 3SQQA 4BBEA 4CYIA 4MKCA 2W5AA 3W1FA 1IRKA 1U54B 1JSUA 4G3EA 4N4SA 1DI9A 4FEWA 1PXPA 3C0IA 3D15A 3ORLA 3IECA 1GZNA 4KIPA 5I5ZA 2WQNA 1FMKA 3FPQA 1NY3A 4MD9E 2XCHA 5AP7A 3VUMA 5H3QA 4AOTA 4IJPA 3R9NA 5M57A 2C5VA 4EH5A 5DEWA 3KEXA 2JEDA 4JT3A 3EFLA 4FKGA 3S4QA 5AA8A 3TNPC 3OC1A 2R3OA 2XVDA 2W1FA 2JFMA 4FKIA 3I5ZA 3HNGA 4WUNA 3DAEA 2LAVA 3N4TA 3EQDA 1PXJA 2PK9A 3FZSA 3FLWA 2I0HA 4O27B 4HCTA 4M67A 4TZRA 3BLQA 3ACKA 3EN9A 4BZNA 3V5PA 4BCQA 1CTPE 5CAOA 4KBAA 3IGOA 2GQGA 2PMIA 2B55A 3V6SA 2QODA 3CLYA 3E62A 4USFA 4D2SA 3S0OA 4MXXA 4BDHA 4RIOA 4DH3A 2VO7A 5KMLA 1OM1A 3RAHA 2EUFB 4RX7A 4EKLA 2XH5A 5HO6A 4H05A 5AP0A 4GK2A 2UZVA 2WB8A 5FDXA 4JDIA 4LMNA 1QPDA 4IJ9A 5BQ0A 1YOMA 4CG8A 2C47A 4FOBA 2ZV9A 4FTNA 4LL5A 2WELA 3LOKA 3NUSA 4G5PA 1W98A 3CC6A 3GOKA 4CVAA 3GFEA 3OS3A 3P7AA 4EQUA 3QRKA 3G51A 3FLNC 4KRCA 2WKMA 1EH4A 1XH9A 3VJNA 4PL4A 4QP2A 3ORZA 4JG6A 4BL1A 1J7UA 3E8DA 3SDJA 2E9PA 2VX0A 4PMTA 1YXSA 2GTMA 4AW5A 5EOLA 5H8BA 4ZZNA 1MUOA 2VZ6A 2GNLA 3NZ0A 3SRVA 3ZCLA 3DK7A 4MBLA 5M4FA 1XBBA 3GU5A 3LCTA 2QLQA 1O9UA 4IFCA 5JKGA 4FVPA 3KGAA 3TUCA 3OY1A 3HAVA 3MBLA 4E6QA 3DB6A 4DEIA 1QMZA 5IH4A 4BHZA 4Y85A 4AOIA 2BRMA 3CQWA 2QOCA 1Q8WA 2PSQA 3QRTA 4FUYA 3PY3A 2IG7A 4QMZA 4L01A 3LFQA 1GIIA 3I5NA 3O50A 4GMYA 3E64A 2JDOA 4V01A 1ZOEA 3DAKA 5F9EA 3SKCA 3FMDA 4MYGA 3RJCA 3OVVA 5E8XA 3UYSA 4FNYA 4PL5A 3MB6A 3EL8A 4EZ7A 5KO1A 1L3RE 1IR3A 5CF8A 4C4IA 3KL8A 4RLKA 3GU4A 4TN6A 5HCXA 3W2OA 4JOAA 3DJ5A 4IXPA 4E6AA 4RRVA 5L8LA 1H4LA 1SM2A 2XK7A 2YIXA 1WAKA 4U81A 2GHLA 2QOOA 5IQCA 1OMWA 4JQ8A 1DAYA 4C57A 4K11A 4FK3A 3A8WA 2YACA 2PE2A 4YZNA 3GXLA 3ANRA 4NM7A 5JN2A 4G2FA 4JAJA 3TG1A 3E88A 4RWKA 3PXKA 4ANOA 1ZXEA 2W1IA 3CTJA 3OZ6A 3H3CA 4FL2A 5LOHA 2UW3A 3OROA 3ZUTA 4FZ6A 5KBRA 2JGZA 5J9LA 5L8KA 3OXIA 5CQUA 3ERKA 3PJ2A 3CP9A 4P5QA 4L53A 1XWSA 2YCRA 5A6NA 3AC8A 3OEFX 4DFXE 3QD3A 3JY9A 2ZV2A 3K54A 5HIBA 4JIAA 4FIEA 4R1YA 4FVQA 4EONA 3QLGA 3OY3A 4F6WA 4MQ2A 4IQ6A 4RSSA 3OWPA 4ZLZA 4UWBA 3MPMA 4LGHA 3R04A 2QHNA 5EHLA 2R3HA 1WBTA 4RJ7A 5K0KA 2GCDA 5AA9A 5FDPA 5HTCA 4L67A 5CEMA 4ID7A 5E1SA 2YHVA 3AOXA 3Q32A 2Y7JA 5ANJA 2XM9A 2X6DA 4G34A 2YN8A 1Q3DA 4U44A 4BDDA 2RGPA 1P4OA 2QHMA 3RPYA 5D7AA 4KIKA 2R3KA 1U46A 4U97A 5AM6A 4DGLC 2XIXA 2WZJA 4EOOA 3WE8A 4DCAA 2ZMCA 3Q3BA 3LE6A 3VBVA 5FLFA 5M53A 2YAKA 2CKOA 1CSNA 3NX8A 3EQIA 3ZM4A 3ZTXA 4BBMA 1JKTA 2YJSA 4GT3A 2C68A 3FBVA 3CBLA 4C3PA 4AX8A 3PXFA 1REJA 3UIBA 5CAPA 3FE3A 1CDKA 4D4RA 2IWIA 3MY5A 5M4CA 2XNMA 4JR7A 4R3CA 3H4JA 3F5XA 5AR2A 2XNNA 3BPRA 3R8ZA 3UC3A 2EVAA 2PU8A 5DYJA 3UZTA 3TZ8A 3OEZA 3V8WA 5AP1A 4BTJA 5EQPA 1V0OA 2H9VA 4YUQA 4KB8A 3QXOA 3IQ7A 4AT5A 4FSNA 5HG5A 4ERKA 1H1WA 4UYAA 3E8EA 3O7LB 3AG9A 4YTIA 3EH9A 4C35A 4HVGA 1K3AA 4C34A 2R3JA 3ITZA 3PPKA 1B38A 1MRYA 2BR1A 5ICPA 2C6OA 1XJDA 3U4WA 2J51A 4JQEA 1XR1A 3UDBA 3LFFA 4AGDA 5ANKA 4UMQA 3C9WA 4C3RA 4CT1A 4E6CA 5AEPA 5GZ9A 3NNXA 3VS2A 3CQEA 3MFUA 2BHHA 4EOIA 5M06A 3LFSA 2C3JA 2QCSA 2BRHA 4EOMA 1GOLA 3SC1A 5LMAA 4ZTMA 4X0MA 4TYIA 3UO5A 4U8ZA 3KXGA 1KE6A 5IQFA 4QP7A 2O8YA 4JX3A 4U3YA 5J9ZA 3C7QA 1T45A 5A14A 2B52A 3LPBA 3ENMA 5K5NA 4DA5A 4IWPA 4RA5A 3F69A 3DBEA 4S32A 4F08A 4EC9A 3LFCA 2YCQA 3S2PA 3UO6A 4OAUC 1WMKA 2FUMA 3DNDA 4LL0A 5K4IA 2C6MA 4L45A 3UOLA 2OH0E 3D83A 1KUTA 5LXMA 3MFSA 4XG3A 4WO5A 1M7NA 4I22A 4MXAA 4ENYA 4NM0A 2EB3A 2JDSA 4O0VA 4RFZA 4YU2A 3FSKA 3G33A 2W99B 3IDPA 4TKSA 5IA1A 2KULA 3T8OA 3OG7A 1ZZ2A 3UIXA 4C2VA 3NIEA 1NVSA 4QP6A 3WZUA 2W06A 3HP5A 5JZNA 1FINA 2HY81 3DKOA 2OFVA 3GCPA 4BCIA 2JLDA 3TJDA 3EN5A 4GRBA 4J8MA 3SXRA 3BEGA 4F6UA 2F49A 5HVYA 3QC9A 4D0WA 2AYPA 3Q04A 4FSQA 3E63A 2OH4A 5E90A 3QCXA 4K33A 4KBCA 5HX6A 3VBXA 3LMIA 4Y72A 3A4OX 4O84A 4R7BA 4BCNA 1KV1A 1LPUA 4Y5QA 3O96A 5LVOA 3PP0A 4ASZA 5KKRB 4WKQA 4EH2A 4GU6A 4M97A 4IWDA 5AUVA 2XIYA 5G1XA 3CSVA 2HELA 1PXOA 1ZYJA 2UW9A 3QQKA 4GJ3A 3C13A 3FLQA 5CQWA 2UZNA 2ITTA 1YKRA 4FF8A 5DLSA 2A0CX 3EQHA 3MJ1A 4NT4A 5BVDA 3TKHA 4EHVA 2DQ7X 2ITZA 2VTHA 5CSHA 1VEBA 4JG8A 2VO0A 1WVWA 4AW2A 3PA5A 4M15A 5HOAA 4IW0A 3VBYA 1W84A 3EL7A 1MQ4A 5M56A 4LM5A 4I6HA 5KZIA 3W10A 5CLPA 4A9UA 4D4YA 4ANNA 3MB7A 4ZTHA 2RFNA 3IW6A 4GW8A 4PV0A 3DK6A 5IQDA 3OT8A 4PPAA 4TT7A 2YAAA 1YXVA 3IOPA 2WD1A 4E5AX 3MFTA 4QTBA 3NGAA 2VTTA 3QXPA 4A4LA 4AACA 2X4ZA 2GFSA 5ANOA 4QMTA 3DBDA 5BVKA 2XM8A 1GZKA 5IEYA 3JUHA 3VVHA 3UJGA 1Q8YA 3MN3A 4QQ5A 4UMRA 4RC4A 4USDA 3FLSA 3KMMA 1JWHA 4YSMA 3G5DA 4TW9A 3R7VA 1YDSE 3JPVA 3OW4A 4FKOA 2QG7A 2PZ5A 2CNVA 3ZDUA 3NRMA 2IW8A 4BCJA 3FPMA 2PMOX 3DQWA 4USEA 4I4FA 5IQIA 2YEXA 1BI7A 3D2IA 3P23A 3IKAA 4MD8E 4RQKA 5JRQA 3I7CA 3PFQA 3IDCA 4IB5A 4AZVA 4H39A 4YP8A 4B8MA 4YLJA 2E9OA 4X2NA 3UE4A 1OKWA 2NP8A 4QYFA 2ZMDA 4MNFA 2J0IA 3GEQA 3PP1A 4IAYA 1GIJA 5GNKA 5HE1A 3WARA 4W4XA 4JRVA
chains in the Genus database with same CATH superfamily
3DGKA 5AMNA 1OI9A 2XK8A 2WTDA 2BHEA 3KVWA 3VUDA 4DGMA 5IA4A 1DAWA 4WRSA 4FIGA 1KOBA 3ALOA 3QTXA 4Y46A 2ZAZA 4XV9A 3MA6A 4DT8A 5LVPA 4EHZA 5CSXA 3CPCA 3NR9A 3PIYA 4CNHA 4GT4A 4YNOA 5F4NA 2W5BA 3ZDIA 3NMUF 3BQRA 5EI8A 5DE2A 1Y8YA 4MF0A 5AV2A 3ORXA 1M2RA 4WHZA 5M07A 2JDVA 5CWZA 5HG8A 3RHKA 5J5TA 4FJVA 1XBCA 2JKKA 3OW3A 5CAVA 5IA5A 2X0GA 4BGQA 4IMYA 2R0UA 3TCPA 5I9ZA 3HECA 2ITYA 3NUYA 2GHGA 3BV2A 5KCVA 4HGTA 3UQGA 4O81A 3UG2A 2R3FA 2J0KA 3R02A 1REKA 1ZYDA 2OU7A 4ZAUA 1KV2A 4U80A 3JXWA 4IB0A 5DRBA 3BHVA 2PUPA 3FI8A 3ELJA 3F88A 3PSCA 2OJGA 2PE1A 4FSYA 2XJ1A 4JDJA 3OD6X 3R1QA 1H01A 2IVTA 4DDIA 3R2BA 4ITJA 4NFMA 5TKDA 4BGHA 4EYJA 3NNWA 5EQYA 1YI4A 5HORA 5AX9A 5HBEA 5HNBA 2C5XA 2XBJA 3P9JA 4KKHA 5EYDA 4DBNA 5E8WA 2VWZA 4PP9A 4FIIA 5CSVA 3RPVA 1XKKA 3TNHA 3WF6A 4BFMA 4D5KA 4EOLA 4BICA 4L68A 5FQDC 2CMWA 3UG1A 5BVNA 4HNFA 4JX7A 3R7YA 4M0ZA 4OTQA 1Q8ZA 2W4JA 2J7TA 4J53A 4PTEA 5EQEA 3DLZA 4DEDA 3B8QA 4OTRA 5A4TA 3QQHA 1URWA 3NUUA 5CSWA 5ETIA 2WTVA 3QU0A 2YM8A 2V55A 3SHEA 3ZXZA 2QU5A 4I5CA 5JH6A 1TKIA 2W17A 5E8UA 3QA0A 4QTCA 3UVQA 3ROYA 3W8QA 3D9VA 3C50A 5E8ZA 5C27A 3PPJA 3EFKA 4R1VA 3W0RA 4GFOA 3VO3A 3DTCA 5BMSA 4FSMA 1G8JA 3E93A 2XKCA 3G0EA 4DH5A 4IDTA 2IPXA 1GNGA 4CXAA 2XAOA 4JVGA 2BROA 1NVQA 3Q4TA 2Z2WA 1PHKA 3MYGA 4ZTNA 1F3MC 4ZTLA 4FT3A 4OTIA 4XLVA 3TACA 4BRXA 2YISA 4Z9LA 3PJ1A 2WIPA 3POOA 5CT0A 5CU6A 5FBOA 4WNPA 4BKZA 4PTCA 4QDVA 4FV1A 4M69B 4W4VA 3HZTA 3QUDA 4OTFA 5FBNC 5IEXA 3FZTA 4YO6A 3HX4A 3OP5A 3WZEA 4L42A 3KB7A 4U7ZA 3ZHPC 3GU7A 3QFVA 4YJSA 3HLLA 5B2LA 2YA9A 5J1VA 5IQGA 1AD5A 5FD2A 4BIDA 3VS0A 2ETKA 1XQZA 3F9NA 5A4CA 3REPA 4O7RA 1PW2A 5GJDA 4ZY6A 1KSWA 1YOLA 3IW8A 4I6QA 3WZKA 4EH4A 2X2KA 3VRZA 4G3CA 2XAMA 3TNWA 3AKKA 3HDNA 5IF1A 3LQ3A 3IS5A 2A2AA 3TV7A 4LDTA 2OFUA 4H3BA 2PVNA 4LUEA 5KKRC 3R73A 5CXZA 5IUIA 4CEGA 4CZTA 1G8AA 2BUJA 2WMTA 4B99A 3BHHA 5IH6A 1FQ1B 5AV3A 4KD1A 4NCTA 3G90X 4JL9A 3NYOA 3R1SA 2J2IB 5AR4A 3QYWA 3SV0A 4BCMA 2XIZA 4BBFA 4H58A 3DKCA 3DT1A 4DHJA 4MBIA 3S95A 5BMMA 3PVGA 4KKGA 3I0OA 3KK8A 5ETFA 4M68A 4ZEGA 4AU8A 3CIKA 3F3WA 3PYYA 4NFNA 3N9XA 3RINA 4FT0A 5I3RA 4J95A 1JPAA 3HYHA 4ZLOA 1H1PA 4WNOA 3G15A 4MH7A 2BIYA 3VS5A 1OITA 4IANA 2RKUA 4AP7A 4F7NA 3L8PA 2YWPA 4QMNA 3VS1A 5ANGA 1Y6BA 3P78A 4WSYA 2WQOA 2XYUA 4N0SA 5HEZA 3QZHA 4FRFA 3ZXTA 4FT7A 2VN9A 4DTKA 3EIDA 1UU7A 4I92A 2IF8A 4P7EA 3OCBA 4RIYA 2WNTA 5C8MA 3SRVB 1MQBA 4RLLA 3O8TA 1H08A 3DBFA 1R3CA 5AIRA 4ACHA 4XBUA 4EHEA 1YI3A 3GCSA 4GVJA 1R1WA 3QTSA 4MD7E 2OXYA 1ST0A 2JKOA 3SD0A 4AAYA 2HENA 4I4EA 3KF7A 4TNBA 4OTDA 2JD5A 2VTIA 4FC0A 4FV0A 4FSUA 4QNAA 5EDPA 4KAOA 4PMPA 3BWFA 3CGFA 2EXMA 2F2UA 4YJOA 5I9WA 3PLAE 2J6MA 4C3FA 1YOJA 4YHTA 3ZSIA 4FG8A 3OCSA 1NVRA 2GSFA 4RBLA 4D2RA 5LWMA 4V04A 2C30A 2OGVA 2RG6A 3ORNA 3QZFA 4FYNA 4K6ZA 1YQJA 2CSNA 5KZ0A 3MY0A 3IG7A 3T3UA 3UNZA 4F9CA 4C4HA 5HICA 3W16A 1V0PA 2B54A 2C6TA 4YZBA 4CFMA 4A9TA 4ZSLA 5LVNA 2VTRA 5D12A 1ZMUA 1CM8A 3Q4ZA 4LUDA 2QOHA 3ZFMA 3F2RA 1OECA 2X2MA 3AT3A 3GC0A 4IFGA 3R7IA 1IAHA 4G6NA 4FKLA 3QRJA 2PUUA 3A7IA 2C3LA 4BWXA 2QOBA 1M2PA 4C62A 4DFYA 5L2WA 3GOPA 2YDKA 2B9JA 2JITA 2F9GA 3ORPA 4K77A 4CZUA 3W33A 4BI1A 3VS3A 5KMKA 3L9MA 4UMTA 3PUPA 4PTGA 4QMYA 3VW8A 5CEIA 3FC2A 3QD2B 1WBVA 3DV3A 1J3HA 3K5UA 3MPTA 5KX8A 3LKMA 2E9VA 3ETAA 2XK3A 2X39A 3MSSA 3Q4UA 3R8MA 5J95A 5TO8A 3GFWA 3IO7A 5JEBA 1W2FA 2C6EA 2XK6A 3MS9A 1MP8A 2A19B 3FMNA 5CX9A 2YM4A 4ZZMA 2CN5A 4PNIA 2HZ4A 1A48A 3MVJA 4L44A 3W2RA 4CKRA 4K0YA 2R9SA 3VAPA 4D2PA 2C0OA 5HIEA 4NEUA 4Q9SA 4AQCA 4BIEA 1DM2A 3FQHA 4FKUA 3HVCA 2XZSA 3NUPA 5LVMA 4YJNA 2VTNA 3BZ3A 4JAIA 3U9CA 3COHA 2WMWA 1Z5MA 2I6LA 1HCKA 3BKBA 4GH2A 1U5QA 4JDHA 4IM3A 4AGCA 2X2LA 4KIKB 2HWPA 3E3BX 3QTWA 4ZS0A 4PY1A 4QP4A 4LV7A 3MVMA 4FX3A 2B7AA 3QQGA 5AJQA 3PA3A 5J8IA 3Q9ZA 5EK7A 5GJFA 2BAJA 4I5HA 4M14A 4XMOA 2DWBA 2PZIA 2YIYA 3A4PA 2VO3A 4FKSA 4C33A 2CHLA 5KE0A 2CCHA 5FEQA 2OG8A 3LM0A 2VRXA 4V0GA 4F0IA 4QMMA 2OJJA 3R00A 4OLIA 2ITWA 1XO2B 2OIBA 3R30A 3VRYA 1UU8A 3KKVA 3OOMA 3DFCB 5AM7A 5L8JA 3QTUA 5EI6A 3UNKA 5HGIA 1B39A 2BFYA 4BJJB 4AAAA 2PVLA 4O4FA 4DG3E 5I9UA 4DEBA 3TIZA 4CFNA 2Y9QA 5HI2A 4D1SA 4PDPA 5IZFA 3QX4A 4XG7A 4TWOA 5M4IA 1GY3A 4AXFA 3EQPA 4TY1A 4D1XA 2UVZA 1R0EA 3ENHA 5CVFA 2I7QA 1RJBA 3F2AA 4K1BA 5DT4A 5BYLA 2QR7A 5HBHA 2W05A 3QKMA 3AC2A 5DH3A 2BDFA 3ZC5A 4ZY5A 1SVEA 5LCKA 3VUGA 4UEUA 5DFPA 3R8VA 3F5GA 3ET7A 2XANA 4BB4A 3QC4A 5AP6A 3EHAA 4U42A 5BUEA 4FV3A 2W5HA 4FKPA 2O64A 2YDIA 3I4BA 3VS7A 4O0UA 4P5ZA 4QPMA 5C4LA 2FSOX 3ZLYA 4EK5A 4IAIA 1STCE 1Y6AA 4R7HA 4ZLYA 3ZYAA 5GZAA 3OHTA 3PXQA 5DI1A 4QTEA 2GQRA 4O7VA 4PNKA 3A99A 4TYGA 1Q97A 4WNKA 2XKFA 1F5QA 1OIYA 2R4BA 1OGUA 3QCSA 3BBWA 4MAOA 4EQCA 4QYEA 5K9IA 3W0NA 3JR1A 4B4LA 4HPUE 4X6RA 3C1XA 4O21A 4QP3A 2Z60A 2X4FA 1UWJA 1T46A 3HV4A 1G3NA 4RC2A 4QMLA 3TXOA 5M09A 4FL1A 4X2JA 2QVSE 2O0UA 3MH2A 1A9UA 3NAYA 2UW6A 3COMA 4CCBA 4IX6A 4IX3A 5H9BA 3UBDA 3LW0A 3QWKA 4TPTA 5L3AA 2E2BA 3DNEA 5CTPA 5DRDA 2QG5A 1UNHA 1M2QA 3BCEA 4LRMA 3Q96A 4O6LA 3SW7A 4DFUA 4S33A 3FQEA 1FVVA 4XOZA 4E26A 1FGKA 2AQXA 2XRUA 1UWHA 4IADA 3BL9A 1OPKA 5ANEA 4AZWA 5ETCA 1YWVA 5HO8A 3V04A 5HE0A 4BCPA 2OF4A 1Q62A 3DOGA 4AA5A 3MGYA 3QCYA 3HMNA 2VGOA 5BV3A 1S9JA 3R9DA 3F5PA 5FP6A 1YVJA 4WSQA 4XH6A 4EH6A 2R7IA 3P5KA 3KXXA 2BRNA 3NUXA 4DEHA 3MI9A 3LCOA 5F1ZA 3TNQB 4M66A 3PFYA 5HX8A 4CV8A 5IQAA 5C03A 4O1PA 4U41A 1ZZLA 5EDRA 4EQMA 1LUFA 2JAMA 4Y73A 2W1GA 4FKVA 5EHYA 3IK3A 3TWJA 2I40A 3BLAA 1OL1A 3A62A 4AS0A 5KUPA 4H3PA 2IEWA 2P4IA 4TTHB 4DDGA 2PWLA 2ZVAA 4XOYA 3LQ5A 2XBAA 4EOPA 2F7EE 4TWPA 3UDSA 4NW6A 4IAZA 2VWBA 3LXNA 2RSVA 4AXDA 2YJRA 5J79A 3FMJA 1JSVA 4AT4A 5HG9A 3N4VA 3AC4A 4I5MA 3PE2A 1KE8A 4FTLA 4O0YA 4WG4A 1OUYA 4X2GA 3NWWA 4S34A 2UZEA 3QALE 2GNIA 2YM6A 4FTJA 4EYMA 5JFXA 5H8EA 4AZTA 3BYUA 3ZLWA 3LMHA 1OPJA 2OIQA 3R63A 4RJ8A 4BDGA 2UVYA 3QWJA 4LOOA 4IWOA 5AX3A 2ITUA 5CU3A 4YTFA 3R9OA 3RM6A 2C3KA 5AUZA 3P1AA 2WGJA 4NKSA 4QQCA 4XS2A 4B9DA 1OBDA 2BKKA 2VWUA 3QKLA 2BVAA 3PLSA 3NUNA 2DUVA 4XHKB 2B9FA 3JYAA 4RX9A 1BX6A 1VYZA 2P55A 5ETAA 3R7EA 1QPJA 2SRCA 5EYMA 3WF9A 4QPAA 1P4FA 3PPZA 2QLUA 2VWIA 3CXWA 3LVPA 3GI3A 1YWNA 4DBXA 3UP7A 5FWKK 4RA4A 2QD9A 4AE9A 1YXTA 1M52A 3CJFA 4LV5A 4R3RA 4AF3A 3NIZA 2PUNA 1KE5A 2WMXA 3COKA 4L7FA 2OSCA 3I79A 1WZYA 4U6RA 2IW6A 3PSBA 2C5OA 3M2WA 4FNWA 4G3FA 4ITIA 4OW8A 2XA4A 5M51A 3O23A 3MPAA 2ACXA 2OO8X 2NYAA 3BYOA 3LFBA 4HGEA 1WBOA 5AP3A 3VUHA 1GJOA 1I44A 4WNMA 4DH8A 2FH9A 4OBQA 5IH5A 3VBTA 5EG3A 4J96A 4QQTA 1SVHA 2BIKB 2QO7A 3FMMA 3HV5A 3MA3A 4ZP5A 2QR8A 3CKXA 5IG1A 4XG8A 2YABA 3PG3A 1VJYA 2XYNA 3R8LA 3DU8A 3TTIA 3C4WA 4YJTA 4ANMA 4O4DA 5I0BA 3MIYA 4LRJA 3D7ZA 5AUWA 2B1PA 1QL6A 2WMRA 3PUFC 3GENA 3ZFYA 4EK6A 4OTHA 2W1HA 5TF9A 1W0XC 1OB3A 3RTPA 2JBOA 4ZJVA 4BTKA 5DMZA 4UBAA 4FNXA 3GU6A 2VTJA 3KXZA 2CKEA 3QHRA 5BVFA 4N6YA 5AUTA 3T3VA 4I6FA 4F7JA 4GKHA 4YPDA 4HNIA 3IGGA 5K0XA 3VUTA 2RFSA 4F4PA 2XNOA 3POZA 1Y91A 4YTCA 2BMCA 1FOTA 1U5RA 3WF8A 4JQ7A 4AW1A 1DI8A 3AMAA 4N6ZA 3AT2A 4IC8A 2OKRA 1H27A 2W1ZA 4BDEA 5E8TA 3UGCA 3NAXA 3PVUA 1Q8UA 2LGCA 3R8UA 1H24A 4IACA 2JC6A 2W0JA 3DY7A 4BDFA 4F1MA 4XX9A 4OAVB 5CT7A 4AXEA 2OIDA 3ZS5A 5DEYA 3C5UA 3TUBA 3ORIA 2WXVA 4E5BA 4AZEA 5DHJA 4CRSA 4DAWA 4DGGA 4H36A 4PPBA 3TUDA 2PVKA 3ANQA 4GFGA 2V7OA 4MXYA 2YLFA 1ZAOA 2WOTA 1NXKA 1ZYLA 2GPHA 2XRWA 4FV2A 1ZRZA 2G15A 4Z16A 3KN5A 2ZV7A 3R7GA 2OJ9A 2XKEA 2Y8OA 5E8YA 3THBA 2YLEA 3VHEA 3F3ZA 2VWVA 2ITPA 2OXDA 2P33A 4FICA 4U5JA 3C4XA 5EKOA 1WFCA 3ZEPA 4EUTA 2WO6A 1ZWSA 3ACJA 4TYEA 2PUIA 2GNGA 3AGLA 3W2QA 3LCSA 3COIA 2WMAA 4A9SA 3HRFA 1LR4A 3RKBA 2I1MA 3P0MA 2X7FA 1OKVA 3FSFA 4C4FA 5HLNA 2X1NA 2F4JA 4CZYB 5CS6A 3Q4CA 5B2KA 4UX9A 1BL6A 4BC6A 4IZ5A 3PIXA 2B4SB 3E8NA 3R6XA 4XCUA 4ASDA 3ZBXA 3UIUA 3BGZA 3KK9A 3NVKI 4EJNA 5L6OA 2VTAA 2R2PA 2HWOA 3AMBA 3I1AA 4IBMA 2WQEA 5FM2A 2X0PA 4ZK5A 2OBJA 3R9RA 1X8BA 3SOCA 1BL7A 2G2IA 4O0RA 3NYVA 4I0SA 4MF1A 5IA0A 3V6RA 2YM7A 5CAQA 5EYKA 3QRIA 4F78A 4U45A 1J7IA 3UZRA 4FV6A 4IM0A 4UALA 3VIDA 4F0FA 4O7TA 4BCHA 2JFLA 5EKNA 4IVCA 2OI4X 3BBTB 2IVSA 5JMSA 4CGAA 4EOKA 4CKIA 1IEPA 4EBVA 4RIWB 1UNLA 4DH1A 5CZIA 3TZMA 3FMHA 2HZIA 3LLTA 4RGJA 2X9EA 3DTWA 4CQEA 3S1HA 3BYMA 1H1SA 2OF2A 5JFWA 3EWHA 5HD7A 4U3ZA 5HKMA 4G9RA 1PXIA 5KMMA 3R71A 3B2WA 4ZMEA 4E7WA 1BLXA 5IUHA 5FTQA 4L52A 1Y8GA 4IZYA 4R7IA 2X8IA 3MDYA 2W7XA 4LFIA 2P0CA 4RX8A 5B2MA 2JIIA 1OUKA 5A9UA 3FI3A 3VC4A 3WZJA 5HVJA 3EJ1A 3EKKA 1XH6A 4KA3A 3CE3A 4PDOA 1NW1A 4LI5A 4FEUA 2PVRA 4KRDA 5JZJA 3DBQA 2QONA 1SZMA 2PHKA 4TRLA 4AXCA 4CTCA 2QQ7A 3E7VA 4R78A 4PP7A 1FBNA 1YW2A 5E92A 4HVDA 2QKRA 1VYWA 5E4HA 3A2CA 3TKUA 3MFRA 3QRUA 2B9IA 3SX9A 3W18A 5LVLA 4FR4A 4D55A 3P7CA 2H34A 4KBKA 4RIXA 2HAKA 4IE9A 4RIYB 4NSTA 4E4NA 2FB8A 1OL6A 2ZB1A 4RT7A 1XH8A 4BN1A 3WF7A 2EB2A 4PMSA 1W2CA 2EU9A 4GVAA 4L3JA 5I9VA 4YZDA 1QPEA 3FUPA 2XMYA 3ZEWA 4Q9ZA 4EK3A 4YBJA 5TT7A 4IB3A 4AOJA 4D28A 5CEOA 4CTBA 4JBVA 4XJ0A 2XEZA 2REIA 3BGQA 3P86A 3UVPA 2HK5A 2R3NA 2R3QA 4X2KA 2PE0A 4WG5A 4ZSJA 3W2PA 2OZOA 3O7LD 4JG7A 5CEPA 3ATSA 1TVOA 4L6QA 3TM0A 3BX5A 3KY2A 5DPVA 4YR8A 2YIRA 1SVGA 3RZFA 4QMWA 3HP2A 2Q0NA 5AAGA 5BYZA 3DK3A 4ACDA 3O5AA 2VTLA 4U43A 3NDMA 2V5QA 4Y95A 3C51A 4GYGA 1CKPA 3Q2MA 3EKNA 4XG2A 4UZHA 2HXQA 4XRLA 1SNXA 3LXLA 3LLAA 1H8FA 3ID6C 1H0WA 4OBOA 4F0GA 4PPCA 4ZSEA 5CVHA 2HOGA 4QRCA 5F95A 2C5NA 4FEVA 2ZJWA 1M14A 2PZRA 3CY2A 5CYIA 2FGIA 4C0TA 3NNVA 4F70A 3ATTA 3QGYA 5K3YA 2QU6A 4QMVA 1J7LA 2IZTA 3F7ZA 2W4KA 3TJCA 1H26A 3KCKA 2O65A 4FSWA 4YJUA 4DEEA 4EI4A 2C3IB 2VGPA 4CMTA 3RM7A 1JQHA 3PY1A 1OPLA 1OKZA 4FKQA 4FMQA 4RJ3A 2Y0AA 3ZLXA 4E5WA 4KINA 3DA6A 4BI2A 3FKNA 1ZY5A 3WE4A 3HL7A 1SNUA 3HKOA 4CMUA 4FE2A 3BU5A 5KMNA 3MESA 4FSZA 3V3VA 5AAEA 5IQEA 3CTQA 4RQVA 3LXPA 4G17A 4ZTSA 5AR5A 3R9HA 4DG2E 1W2DA 1Q5KA 4XBRA 4B0GA 4D1ZA 2RFDA 2RIOA 3O71A 4QTAA 4BIBA 4G1WA 4B7TA 3C4FA 3BIZA 3BV3A 3D5VA 5K5XA 4D4SA 3RI1A 3FZPA 3EQFA 4UMUA 4E73A 2YIQA 4U40A 5H8GA 2P2HA 2R3RA 3FLYA 3K3JA 3QA8A 2OW3A 4JXFA 4D58A 3A60A 4NJDA 2ZM1A 4K2RA 3FC1X 5KBQA 3BU3A 5FUTA 4IIRA 3Q60A 3V5QA 4M8TA 3BEAA 5J9YA 2PVMA 3OUKA 4J8NA 4DG0E 4OTGA 3R1NA 2PVHA 5FXSA 5AR8A 5EYCA 5D10A 3HDMA 4AXAA 4BTFA 5IKWA 2PMLX 3RK9A 3UQCA 4O6EA 5H2UA 5HCZA 2QO2A 4MVFA 3W55A 4M3QA 4J99A 3D14A 4FUXA 2X9FA 4MQ1A 2J0JA 4QYHA 4V0GB 5BUJA 2R5TA 3EYHA 4QMQA 5G6VA 2HCKA 2HW6A 2ERZE 5A4EA 4W8EA 5IQHA 5CI7A 3DS6A 1Q61A 2CLQA 3GGFA 4AG8A 2C5YA 2B53A 1GZOA 3PTGA 4O91A 4EOSA 5HE2A 4HW7A 3I6UA 2F2CB 2FSLX 3FQSA 2RL5A 3W2CA 4FZ7A 5A6OA 4KNBA 3OOGA 1ST4A 2BFXA 5FTGA 2OZAB 4RZVA 4QYGA 4YO4A 3F3TA 3P79A 5CF4A 5M44A 3HMOA 3KFAA 2WOUA 3QX2A 4QMSA 4M13A 3ZO2A 3L9PA 4BWPA 3P5JC 1VR2A 4DN5A 2P3GX 4CLIA 4XNEA 3ZRKA 2QOLA 4F9BA 4O7LA 3ZSGA 3AD6A 4RIWA 5A3XA 3UMXA 4ZMFA 1FMOE 2HW7A 2AEGA 4ENXA 3QQJA 4BVUA 4LRKA 4Y83A 3T9IA 4C37A 4JNWA 3UIMA 4IX4A 5BPYA 5HD4A 5LMBA 4EJ7A 1YI6A 2JAVA 3DJ7A 5LQFA 1FVRA 4DE4A 5EW3A 2J50A 4NCTC 2QURA 2EWAA 4NYEA 1GAGA 3C5IA 3CR0A 4HYIA 2X0QA 5IMXA 4HYSA 2C6IA 2YIWA 4N70A 4RVLA 4G3DA 3U6IA 3U6JA 3MVLA 4A9RA 5HESA 3QCQA 4DHFA 4ZJIA 4R77A 5T68A 4G3GA 4RJ4A 4TL0A 4MHAA 5T3QA 3HA6A 2OK1A 4RWJA 3D0EA 1XMLA 4DC2A 3L9NA 4I94A 5ANDA 1Y57A 2ETRA 5HLPA 1JBPE 4IAFA 3D5XA 4C38A 4F64A 4W4YA 2WMVA 4NKAA 5I9XA 3ZZEA 2WTKC 4LGGA 5D9HA 4MWIA 2R3MA 3BI6A 5E9EA 4YZMA 4I1ZA 2VTPA 5IDPA 4FVRA 4S31A 3DAJA 3LJ1A 3UC4A 2ZOQA 5FEEA 4QP9A 3SAYA 4EH7A 4ZY4A 5FXRA 4P90A 5HE3A 2WTWA 3GC7A 1MRVA 4FIFA 4O1OA 1IA9A 3QLFA 4LYNA 4WA9A 4F65A 2JDTA 2GU8A 4NTTA 2JKQA 3CD3A 4JRNA 2QOFA 3ZONA 2CGUA 3UZPA 4E1ZA 5BNJA 3DLSA 4O0WA 4L9IA 4XV1A 4DTAA 1BKXA 3ZRLA 4BCKA 2BKZA 2G9XA 4RX5A 5AR7A 3PY0A 3DZQA 4HOKA 3WYYA 3HEGA 4FKTA 5HTBA 2PMNX 1O6YA 3DKFA 4E4MA 1PMNA 4Q2AA 1W82A 2PULA 2XARA 3MH3A 5IISA 4EHGA 3MV5A 4BYIA 4W4WA 2YZLA 2PL0A 3MW1A 4ZSGA 2ETMA 3Q9YA 4PMMA 3MTFA 4LQMA 1PJKA 4S2ZA 1ZYCA 1PKDA 2Z8CA 2PY3A 4ZOGA 3KRLA 3QUPA 4DHZA 4ZJJA 3D2KA 2BAKA 2O2UA 2XALA 4HVIA 4DFZE 3SA0A 2R3IA 5EM7A 3RAWA 4CFUA 4CCUA 1YXUA 2BZKB 2FO0A 2WMUA 3NPCA 2G2FA 1H1QA 3O51A 3PWYA 2QNJA 4KWPA 4TYHB 4CRLA 3K3IA 5CANA 2WMQA 2BCJA 4FKWA 4TWCA 4MK0A 4YHJA 4G6OA 5J1WA 1ZOGA 3W2SA 4V05A 2BILB 4O86A 2ITQA 3RZBA 2BAQA 4QYYA 5HU9A 4FTQA 3H9RA 1Q99A 3LM5A 3FKLA 1P5EA 4NIFA 2VNWA 4JDKA 4L00A 1L8TA 3PE1A 4U79A 3DZOA 5J87A 3VF9A 4A7CA 3I0QA 4G5JA 4X21A 3L9LA 4CFFA 2PPQA 3CY3A 2F57A 2WQBA 5EW9A 3GC8A 3R7OA 2WU6A 1ATPE 4F7LA 2C0TA 4TXCA 4I5PA 3KCFA 1OIQA 4MUQA 3KF4A 3BRBA 2GFCA 4HGLA 4JS8A 3DDPA 4M12A 4YTHA 3ZO4A 4ASXA 4BDCA 4X7QA 5HU3A 5EW8A 1CKJA 1HOWA 1YRPA 3H10A 5LCJA 1S9IA 3BGPA 3Q5IA 2J5EA 4OUCA 4JR3A 3RWQA 2JIUA 5I4NA 4ANLA 3UODA 2CN8A 2UVXA 4MXZA 1PXMA 4PUZA 4EL9A 5AV4A 3OCTA 1IAJA 3N51A 4MBJA 3QZGA 5M55A 4ANSA 3RVGA 3E3PA 4IHPA 3ZSHA 3U6HA 2KTYA 3ODYX 1XH5A 2Z7RA 4PDSA 3U87A 3LXKA 4ORKA 2I0YA 2ZM4A 2PVFA 4JBOA 2ZB0A 4UXLA 3P4KA 1PXNA 4OBPA 3AC3A 4CG9A 2A98A 2XF0A 1OL7A 4O0XA 2OICA 2GHMA 2XNBA 3RPOA 1IG1A 4LV8A 1UNGA 4YHFA 3ULZA 2OLCA 3QBNA 2RFEA 3RALA 1VLRA 2W9FB 4AA0A 3PJCA 3RBWA 5A4LA 3QTQA 1GZ8A 3HV6A 4WUAA 3SXFA 2UZDA 4F99A 3Q5ZA 2NNWB 4I93A 4YC3A 1P14A 4FKJA 2QO9A 4AZFA 2OZAA 3GCVA 4NM5A 3BLHA 3UOJA 3KIOC 4FTUA 3ZZWA 3AGMA 5DNRA 1NA7A 5CASA 4FZFB 3D5UA 5A4QA 3HMPA 3BWJA 2WTJA 1DS5A 4NUSA 5HO7A 2R0IA 3AD4A 4GK4A 4KIOA 3I81A 3FLZA 4XLIA 4YNEA 3K2LA 4OTPA 3E8CA 4UZDA 4DFNA 2VTQA 5IDNA 4EC8A 2YCSA 1NT2A 5DWRA 2ZFYA 4FKRA 4AE6A 3DJ6A 5BVEA 3QKKA 4IX5A 3RPRA 5JFVA 1XBAA 2FSMX 4GFMA 5AIKA 3S00A 4EZ5A 5CF5A 1ERKA 5E8SA 3F82A 3V8SA 2I0VA 2R3GA 3R22A 4EOJA 3NEWA 3IOKA 3PXYA 4P2KA 3LQ8A 4QQJA 4O2ZA 4M0YA 4CMOA 2H8HA 4BDJA 4IVAA 2C6LA 3QUEA 2V62A 1OL2A 4W9XA 4HVSA 2B9HA 3KRWA 3TI1A 4BHNA 2VX1A 2HXLA 3ORKA 5DT3A 1PF8A 3C4EA 3MTLA 3FAAA 2BRBA 1OIUA 2XJ0A 4BDKA 5JSMA 2BDJA 4OT6A 2QOQA 4PL3A 4O22A 3L8SA 2YFXA 5D41A 5A46A 1PMEA 4EH9A 4UMPA 5KMOA 4IAAA