4C59A

Structure of gak kinase in complex with nanobody (nbgak_4)
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
307
structure length
266
Chain Sequence
DFVGQTVELGELRLRVRRVLAEGGFAFVYEAQDVGSGREYALKRLLSNEEEKNRAIIQEVCFMKKLSGHPNIVQFCSAASIGKEESDTGQAEFLLLTELCKGQLVEFLKKMESRGPLSCDTVLKIFYQTCRAVQHMHRQKPPIIHRDLKVENLLLSNQGTIKLCDFGSATTISHYPDYSNFPIGEKQDIWALGCILYLLCFRQHPFEKYSIPPHDTQYTVFHSLIRAMLQVNPEERLSIAEVVHQLQEIAAARNVNPKSPITELLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Cyclin-G-associated kinase
publication title Structure of cyclin G-associated kinase (GAK) trapped in different conformations using nanobodies.
pubmed doi rcsb
source organism Homo sapiens
total genus 70
structure length 266
sequence length 307
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2013-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4c59A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4c59A01
5HE1A 4FE2A 3RINA 3KKVA 5DH3A 2V55A 4QTDA 2ZB0A 3DXPA 2HXLA 5CEIA 4ZIMA 4QYEA 4P5QA 5DEWA 4EK5A 3BHTA 4FKJA 1ZY4A 4CCBA 3ULIA 5DE2A 5IUIA 3DK7A 2IZSA 3LJ0A 5BVKA 4YTHA 3MH1A 4J99A 3HNGA 3NNXA 4I5MA 4MF1A 5FTOA 4YZBA 4JLCA 3OHTA 5DR2A 3TZMA 4BCPA 2CGVA 4CT1A 4EI4A 5L2SA 4MXAA 3SW7A 1ZOHA 4DLJA 5IMXA 3HV6A 4IH8A 4UY9A 3RALA 2XNGA 4MXOA 4TW9A 4ASEA 4FEXA 4ZK5A 4DT8A 2GS7A 4IVBA 4YJOA 5CEQA 5IQHA 3SG8A 5LVNA 4Y83A 4BGGA 1WVXA 3MVHA 5IQGA 3D15A 3TDVA 1ZMUA 4HW7A 5HEZA 5HO8A 1ZLTA 3V3VA 2WMSA 4YC6A 3OXIA 3ZLSA 5FTGA 2JIVA 3G0EA 4ZMEA 4PTEA 3ELJA 2VZ6A 4B4LA 4KKGA 2XNBA 4G17A 4F9WA 4PPBA 4QTAA 2UZVA 3EL8A 3SDJA 4U97A 1ERKA 3NW6A 3RPRA 3T3VA 3V5JA 2EXCX 2PE0A 3BWFA 5A4LA 4EONA 3QKKA 1Y6BA 3MW1A 4JL9A 4EYMA 1OIYA 3BELA 2BVAA 5TO8A 4AA4A 4F1MA 3HDMA 5T68A 4EOPA 1XKKA 4KIQA 4KWPA 4ZTQA 4NZWB 3O8PA 5EW9A 4KD1A 3F3ZA 4ZTHA 3VUDA 2OF4A 5K4JA 4IFCA 2UZNA 4KSPA 5AP3A 1F0QA 4ERKA 3KMWA 3PXYA 3E93A 1WBWA 3EMGA 3SHEA 4QQ5A 5BYLA 3KB7A 2RSVA 3W55A 2XB7A 3NYOA 4RG0A 1G8AA 3PXKA 2XUUA 3QU0A 4ZLYA 4BL1A 2C5YA 2C1BA 2ITXA 5FWKK 5K9IA 4B6LA 5EKOA 3R71A 5J7HA 4HVDA 3HAMA 4V01A 2ITWA 2O5KA 2RG5A 4HPUE 5LXMA 3JXWA 5BVDA 4NTSA 2J50A 5JQ8A 5JGDA 3L8XA 3FEGA 3RHKA 1MRYA 4HVSA 3MJ2A 2UW8A 3I81A 3HA6A 4L3JA 5M51A 5AFVA 5HCXA 4F9AA 4MBIA 3TIYA 4Y46A 3PXQA 5HE3A 3VW8A 4PDOA 4FKWA 4GG5A 2YHVA 3MTLA 4NFNA 4HVGA 4M15A 3VF8A 4D9UA 3NW5A 4C4HA 3ETAA 4BDGA 4DINA 1GIHA 2WKMA 3AT3A 5DFPA 4G31A 4RFZA 3MJ1A 3QX2A 4EH5A 3BPRA 3FKLA 2UZWE 2Y4PA 3HMNA 4XG8A 4BDEA 3G15A 3BU6A 4Y72A 2W4KA 1OIUA 4B8LA 3HP2A 3FPQA 1PYEA 4RVKA 2GU8A 4FV4A 4JR3A 4GEOA 3CGOA 3DAJA 4TRLA 4U6RA 4ERWA 4IM3A 1OECA 5CAOA 5EHYA 2XYUA 3N4VA 4FICA 4K1BA 3RAIA 3FBVA 3GENA 5I4NA 4W4VA 1FVVA 4XEYA 5IQDA 1A48A 2BALA 1H24A 3UPZA 2HK5A 4BWXA 3ORZA 4BN1A 4W8EA 1YI4A 5EQPA 2BZKB 2JD5A 2J0LA 4CGAA 5IEYA 4P2KA 4YJNA 4USFA 3NS9A 1JOWB 4BDCA 3REPA 5J87A 5E7RA 1AQ1A 3QF9A 3EN9A 2VWIA 2X9FA 3QBNA 4MNEA 5HKMA 1YWRA 4AOIA 4C3RA 4RC2A 3KCKA 3VF9A 5IUGA 4LOPA 3FI3A 3HGKA 1E1XA 3AD6A 4FZAB 3ZRKA 1SVGA 1XBAA 3U4UA 2G9XA 1OGUA 5EG3A 2OFUA 4UN0C 4BCQA 1J3HA 4QMQA 4EKKA 2OFVA 2XNMA 1M2QA 2UW0A 1H1QA 4AT4A 3LFDA 1XJDA 1UNHA 2ZDUA 5LVLA 5CZIA 3FI8A 3GU5A 3TDWA 4MNEB 1XH7A 1ZMVA 2R3IA 4RQKA 2QHMA 3U51A 5A9UA 2ITNA 3R9RA 3VO3A 3VBVA 1QL6A 2Z7SA 3EIDA 3V6SA 3TM0A 3VUKA 3MBLA 3ZLYA 3C1XA 1I44A 4QMMA 3QYWA 1H25A 4CV8A 4U40A 5JQ5A 3L9PA 5HESA 1NVRA 5F20A 1H0WA 2J4ZA 3C7QA 2G1TA 3UQFA 3T8OA 2BCJA 4YC3A 2HOGA 1J1CA 3KXHA 1UA2A 2B9HA 4P4CA 3LFCA 5E8ZA 4O96A 3MVLA 4AGUA 4I1ZA 2BZHB 3PY1A 4NJ3A 2R3QA 4D2RA 1Q4LA 3HV3A 4BTMA 2R0UA 2FSLX 3OW3A 3A4OX 1OKVA 4AA5A 5E9EA 2EUFB 3R2YA 4MNFA 1E9HA 5FUTA 3Q32A 4L00A 3IW8A 4FZDB 3QQKA 4R77A 4AN2A 4CNHA 4AX8A 1W0XC 5HOAA 1JSUA 5DT0A 5AR8A 3QLFA 5DNRA 3DZQA 1CDKA 3VRYA 4BKJA 5JMSA 5CVFA 3AC2A 3DB8A 3TI1A 4I20A 4FI1A 3KK9A 4QQCA 2R3GA 3UZPA 1RW8A 4AW1A 4Q9SA 4CQEA 4ENXA 4GKIA 5DMZA 3CTQA 4LFIA 1K2PA 4BB4A 5D7AA 2VX3A 5G6VA 5GJFA 3R0TA 3W18A 3MB6A 4DH5A 4XV9A 5IF1A 4QPSA 1KUTA 2GMXA 4ZSJA 4XG3A 1PXNA 5D9HA 3CKXA 4BDKA 1Q8ZA 4EWQA 4IANA 5EOBA 3LCDA 3F69A 4G34A 1ZYCA 3GU8A 4G6OA 4C33A 2WXVA 1TQMA 5KMKA 3DJ5A 3AT2A 4FA2A 2XZSA 2QO9A 1A9UA 4PNIA 3FMLA 1JSVA 4G9CA 2YZLA 4ACCA 2NRYA 1H27A 2VNYA 4OTPA 4R1YA 3DQWA 2OBJA 3PLSA 4QMOA 5L6OA 2OZAA 4EEVA 3LCKA 5CEOA 4FVQA 4JI9A 4XBUA 1URWA 5IKWA 2OKRA 3D83A 3QLGA 3PVUA 5H8BA 5JEBA 4QMNA 3TUCA 3MN3A 4L6QA 1NT2A 2IVSA 1OI9A 5C8KA 4PTGA 1NVQA 3E88A 3OBJA 1SZMA 4U7ZA 3LAUA 1FOTA 3SLSA 2C1AA 4I3ZA 3PVBA 2GQRA 4G3CA 4WNPA 3RZFA 5AWMA 5DIAA 3EFJA 4D4SA 3AGMA 3N9XA 3G51A 4JG7A 2C4GA 2JAMA 5AA8A 3U9CA 5AUTA 2ZVAA 2Z8CA 4M14A 4O7YA 3FQEA 5DOSA 1ZZLA 3BHYA 2J0JA 2F2CB 5KO1A 4IM0A 4QMVA 2BZJA 4WRSA 4IAZA 4BCGA 5JKGA 5AM7A 5KMLA 1M17A 3ZTXA 2O0UA 4UWBA 4C4FA 4IFGA 4D5HA 2X6EA 4TNDA 5A6OA 5HBJA 3TNWA 4H05A 3OFMA 4G1WA 2XK4A 2A19B 4FODA 4V05A 5EW8A 4TL0A 3PSBA 3A8WA 4OW8A 1CKJA 3F7ZA 4ASDA 2OJIA 3F9NA 3GCUA 3KA0A 3OT8A 4FTAA 3IK3A 4I4EA 4O1OA 5CTPA 2UV2A 5A46A 4QOXA 3EQFA 3FQSA 3OC1A 3OMVA 4U3ZA 5I9UA 4W9WA 3V51A 4HGEA 4YJPA 4EQMA 2XYNA 1UKHA 3H0ZA 3R01A 2ITTA 3LZBA 4TXCA 4J71A 3EL7A 3L9LA 3N51A 4QMZA 2G2FA 1JLUE 3V5WA 2B9JA 4A9RA 5E8TA 4HYIA 1YOLA 5IUHA 3TNHA 1F5QA 3EKKA 3R30A 1OVEA 4IB3A 4AZEA 4RQVA 4RZWA 4XV3A 3QTQA 4UV0A 2DYLA 4IQ6A 3ZLXA 2PYWA 3N4TA 1NXKA 5T6KA 2VTLA 2PZPA 5CQUA 1ZXEA 3E5AA 4NM5A 2B7AA 5IQFA 5KX8A 2YM5A 1MUOA 2OIQA 4FEWA 4X3FC 4FKUA 3TWJA 3ZHPC 3ET7A 4ACGA 4J1RA 1EH4A 2IJMA 3EN7A 3F2RA 3IO7A 3KRJA 4PMTA 3DTCA 1ZARA 4HNIA 2C5XA 4IAYA 3HVCA 4LMNA 3ITZA 3ZC6A 4F70A 4C59A 3GBZA 2RL5A 2PUNA 2PULA 2WU7A 2C6DA 2O65A 4QYFA 4FKQA 4J8NA 4Q5EA 3FY0A 2XIZA 4AE9A 4K0YA 4BCMA 4F08A 3PP1A 3QZHA 4K9YA 5AP2A 4OBQA 3ZUTA 3A8XA 3CPBA 4E73A 4II5A 3AMYA 2C6OA 2C6EA 3OWPA 3ZFYA 3QGWA 1YW2A 3VBYA 5A3XA 3UZTA 4R5SA 2YM3A 3V5QA 5DI1A 4F0FA 1GNGA 2ETRA 3FLNC 4YZNA 4EOMA 5JFXA 3RJCA 3FZRA 4NM0A 2ETMA 2WTDA 4F9CA 2PHKA 5EYCA 3ZLWA 2XCKA 5FXSA 1QPEA 2VWWA 4AW5A 2I1MA 2JIIA 4E6AA 3I79A 5I5ZA 3PYYA 3O23A 1TQPA 2OGVA 3T9IA 4PF4A 4FGBA 3ZDIA 3Q6UA 4RC3A 5C03A 3A7JA 5CXZA 4KNBA 3HA8A 1AD5A 2ITQA 3HYHA 2X8DA 1H8FA 4ENYA 4F0IA 3UQCA 3NVKI 4GYIA 3NRMA 3VS3A 4H58A 5BVNA 5J8IA 1RDQE 2XCHA 4RJ6A 4YPSA 2R3FA 3DLZA 4GU6A 5DHJA 3FE3A 3ZOSA 4M68A 3TZ9A 3R7UA 3UOKA 4ANNA 1XO2B 2XNOA 3NCZA 3QGYA 5D1JA 3W8QA 2VWUA 4BDHA 3W2RA 3DJ6A 2C0OA 3BHHA 1YHWA 4EHGA 4W9XA 5FBOA 4BCJA 3DBEA 2YITA 2OK1A 3PDTA 4GFMA 4RVTA 2KTYA 3IOKA 4MCVA 4CQGA 5CLPA 5DGZA 3PVWA 4ACMA 4D4RA 2WEIA 2JFLA 2VO7A 4O1PA 3LCTA 5C01A 3K3IA 3PRFA 5KCVA 4O83A 3GFEA 1OIRA 2E9UA 3KVWA 3QRIA 3U9NA 5CZHA 2Q83A 3SGCA 3Q4ZA 4ZSGA 3S3IA 4QP9A 3O51A 4BCHA 4NTTA 4EOLA 1WBNA 4JBPA 5I9WA 2HAKA 1QCFA 2HZIA 1Q3WA 4QP4A 3ZBFA 4FOCA 3A61A 2O3PA 2HELA 2XIRA 1M7NA 4RIYA 4S31A 4A06A 5CEKA 4FKLA 2JDSA 3C4EA 2GTNA 3TV7A 3EYHA 2PVYA 4DEAA 4GRBA 3EFWA 2XP2A 4CMUA 4TY1A 3IG7A 3Q4TA 4C62A 2GHGA 2PMNX 2CPKE 5L2WA 4F99A 5HVYA 5IDNA 4E6DA 2C5VA 3DJ7A 1DM2A 2C5OA 2W9FB 2X7GA 4FYNA 4TWPA 3VAPA 2B9IA 4CKJA 1H1WA 1PMUA 3QA8A 1CMKE 2VO0A 4ZSLA 2FSOX 1OITA 4JR7A 4JXFA 5I9YA 4XG2A 2GS6A 4RIYB 3QYZA 3MS9A 1MRVA 3JVRA 3PE1A 1FVTA 3U4WA 3VBXA 4C4GA 3DBFA 4ONAA 4PMSA 3RK7A 4IVAA 2QOBA 3ZO4A 4J97A 4FKPA 5JK3A 3I0OA 2ESMA 4GU9A 4R7BA 4C7TA 2F57A 3FHIA 3IECA 1PXJA 4GUBA 3PPJA 3AC8A 2F7EE 4UYNA 4WBBB 5ANOA 1OZ1A 2CMWA 3D5VA 4AGCA 3QTXA 4X6QC 3QWKA 4DEBA 3BQCA 5IQAA 3LE6A 1BI7A 2ITPA 4TNBA 3KEXA 5ETAA 4U3YA 1LUFA 3FLZA 1PJKA 2QNJA 3U54A 4OBOA 4FL2A 4WHZA 3SD0A 3FLQA 3A62A 4BVUA 5E1EA 3LFNA 4FUXA 2BHEA 4YZCA 4DG2E 3OW4A 2P4IA 3A7IA 3LFFA 1PW2A 4IAKA 1FBNA 3BGZA 2ERZE 2UZUE 3PIYA 3G33A 4EOJA 5FDPA 5JN2A 4CFXA 1OL1A 3OWLA 4PX6A 4EYJA 3LFSA 3HV4A 4O84A 3HMMA 4BCNA 1S9JA 3LOKA 4LOOA 4LG4A 4FV9A 4XUFA 4CLJA 4CZTA 3PJCA 4TYEA 2OJJA 2W0JA 2C6MA 3R83A 4IM2A 1YDTE 2J51A 4WG3A 1H1PA 2PMLX 4F7SA 3P4KA 4BCKA 5CF5A 4JAIA 3NX8A 5GJGA 2VWVA 2WTWA 2WTVA 2YM7A 4UEUA 4EK6A 3RM6A 3V8TA 5IH4A 4QP8A 3TKIA 5KMOA 2QI8A 4OT6A 4PY1A 3FQHA 3IDCA 4M66A 3UO6A 3VIDA 5C4KA 4E4NA 4O7TA 1M7QA 4FZFB 2GTMA 5CSWA 3IONA 1OBDA 3CD3A 1FVRA 5JFWA 3GVUA 4MD7E 4YO6A 4Y5QA 3CY2A 4LGGA 2VTAA 4L44A 3PSDA 4DFXE 3NNWA 3ORMA 4WT6A 4MBLA 1E1VA 4GUEA 3TL8A 1BYGA 5M09A 4W8DA 5CSXA 1FINA 4QTEA 3OCSA 2YWPA 2HZNA 3S0OA 4M13A 5IG1A 3Q2JA 3C0GA 3LFBA 4OBPA 4FZ7A 1OPJA 5HG5A 2PVFA 5KMIA 5KKRB 3PUPA 3MFUA 4QRCA 2VWXA 4EZ3A 4YSMA 1K3AA 3M2WA 4F64A 5D12A 3HUBA 4IWOA 4QMSA 4FTMA 5K3YA 3QUDA 2VWYA 3EN5A 2CGUA 3BYSA 4RIOA 4ARKA 3HX4A 3EQPA 5L4QA 4U41A 3GC9A 3R04A 3QZFA 4TZRA 5A54A 4LGDA 2I6LA 4AUAA 3OEZA 5F9EA 3QTUA 2WQEA 3E8NA 4UZDA 4BIEA 5IU2A 5DN3A 4DGMA 2XK8A 3D0EA 4GV1A 4O82A 5EYMA 3MYGA 3DK3A 3QKMA 3OTUA 4MF0A 1LP4A 1MRUA 3I7BA 3DA6A 3L8VA 3VJOA 3FY2A 1M2RA 1WBOA 3IQ7A 5HE2A 4AAAA 2H34A 1BLXA 1GY3A 3GU6A 3LQ5A 4HNFA 4FV7A 2QOKA 3PTGA 3ACKA 3D9VA 2GHMA 3BHUA 3HRCA 4IACA 4PV0A 1ZZ2A 2PMOX 2QU5A 3BBTB 3QC9A 4YHTA 4U0IA 2REIA 4O7LA 3K2LA 5AR2A 4XV2A 3OS3A 3UO5A 2BRGA 3LCOA 3T9TA 4Q9ZA 3C5IA 1TVOA 4MVFA 4DBXA 2X39A 4ZLZA 4O2PA 5DBXA 4E1ZA 2UW9A 5J79A 3CLYA 3POOA 4H36A 2XKEA 4X3FA 4K33A 4ITIA 5AV3A 5IA5A 4ACDA 1O6YA 3O7LD 4I6QA 2WMXA 5AIRA 5AP0A 4L8MA 5HHWA 1Y6AA 2WQNA 4WD5A 5ETCA 2R64A 3SX9A 5AAGA 2BDFA 1OL6A 2DS1A 3V6RA 3BE2A 3B8RA 4YLJA 3TUBA 3FLWA 5KE0A 2W5BA 3AD5A 3COIA 3FI4A 1WVYA 2R3LA 2BKKA 2HENA 2A1AB 3M42A 1H1SA 4IJPA 4WSYA 5F4NA 5G1XA 2VTJA 5HICA 3SV0A 2BZIB 4YMJA 4TN6A 4UZHA 5A6NA 4KSQA 3BU5A 3NZ0A 5KMNA 4NT4A 3P78A 4PQNA 2Q0BA 2GCDA 1ZY5A 3F66A 3GCVA 4FV5A 2YIQA 5CX9A 5HLWA 1V0PA 2VTRA 4BTFA 3GCQA 2B4SB 3KCFA 4U79A 5ACBC 3MH2A 4YZ9A 3EQRA 3BV2A 3PWYA 2UZBA 4AG8A 3SRVA 4L68A 4D2PA 3LMHA 4F7LA 3VBWA 3DS6A 3DK6A 3NSZA 3FZSA 4S2ZA 2PVNA 3R00A 5AP6A 3RBWA 3UP7A 4NSTA 2B0QA 1FQ1B 2EXMA 3VVHA 2V22A 3OBGA 2ITVA 4M67A 3MFSA 2HYYA 4IW0A 2RFSA 3OXZA 1KWPA 3EOCA 4LQMA 2F2UA 3IS5A 4XBRA 3RPYA 4F7JA 3R22A 1WVWA 4MXCA 4W4XA 5AUXA 4O91A 2EWAA 4G2FA 3SRVB 5CAQA 4EK3A 3QA0A 3C4ZA 3P9JA 3FV8A 3RNIA 4ZZOA 4AZVA 2IZRA 2ITOA 2IVUA 2JIUA 3MV5A 4JBVA 4ZP5A 4C37A 4DG0E 3CY3A 1B38A 3R6XA 3UMXA 2WMWA 3FXXA 5IQBA 3OCBA 3QRUA 3FSKA 3ZC5A 2E9PA 2XNEA 4DG3E 2CN5A 3PFQA 3R28A 5AP4A 3BRBA 4FZ6A 2ACXA 3UOJA 2PE1A 4HOKA 4YP8A 2R3PA 5HX8A 2XJ2A 4JBQA 5FG8A 4C0TA 5M57A 3MH0A 1OL5A 4O6LA 5A4EA 3WYXA 2PVHA 3HP5A 1YI3A 3DNDA 3NUSA 4FKSA 5E8UA 4CMTA 3W2CA 5CSPA 2GNGA 4N0SA 5HCYA 3BWJA 1GZ8A 1XH9A 4C57A 1H08A 2W4JA 2HZ0A 4JDIA 5HTCA 4R6VA 4AOTA 3LLAA 1ZYLA 3MY1A 2WB8A 3ERKA 2ONLA 1Q8TA 3Q9XA 4FV1A 5F94A 3ZUVA 2XNNA 4D1XA 4USEA 5HCZA 4AE6A 4IAAA 4BRXA 3HRBA 3S1HA 4M97A 4K77A 3GUBA 3QL8A 2Y9QA 4WNKA 2WTKB 4X2JA 4QD6A 2ZV2A 2W1EA 3I0QA 2X2MA 4EBVA 3VS5A 5L6WL 4J96A 3FZPA 1JKTA 2PK9A 2W05A 2W1DA 5IH6A 1JVPP 3R7YA 1MP8A 3QRTA 2UVZA 2C69A 4CZUA 3K54A 1YXXA 3GFWA 4I6BA 2YAAA 2DWBA 3KRWA 5EH0A 5CAPA 2B1PA 3DU8A 5HVJA 3ORXA 4UMTA 3R9NA 3KREA 3ZU7A 1H0VA 2IZTA 2A4LA 4DF3A 2QKRA 4IJ9A 1UU3A 3Q04A 2VTPA 4I0SA 2YDJA 1OKWA 4C36A 4EH8A 1H1RA 5JSMA 2CJMA 2XKFA 2ZV7A 5I9VA 4HZSA 2JLDA 2CHLA 3JY0A 3GP0A 5BYZA 4A9YA 4O0TA 2OH0E 5DEYA 5DVRA 4CFWA 2W1GA 3F5XA 3FKNA 5FM2A 3QAME 1O9UA 3FZTA 2WHBA 5CF6A 3TUDA 2XK9A 2OZOA 1OIQA 3QUEA 3W2PA 5LVMA 4DH1A 4BIDA 2WIHA 4E26A 4OUCA 3BIZA 3DKOA 2CDZA 4TYIA 2YISA 4UXQA 3FPMA 4IE9A 5LMKA 1YKRA 3ZO3A 3Q3BA 3TNPC 3GU7A 5HD7A 2EB2A 4FTQA 4TYGA 4W4YA 4O7SA 2C3IB 4IX5A 4R8QA 3WF9A 4C34A 3WZDA 5K0KA 3TN8A 2YLFA 3HAVA 3UYSA 2NP8A 5HU9A 1CSNA 4QYYA 2W1ZA 1YQJA 3UNJA 4DEIA 5FM3A 4O38A 2XBJA 3DAKA 3OY1A 2C3KA 5ACKA 3MA3A 2PTKA 4RC4A 4F6WA 4Z7HA 3HMIA 3NIEA 3UVQA 4LRMA 4F0GA 5AA9A 2J0MB 3V04A 1G5SA 4BICA 3E7OA 4FSMA 4FBXA 2WIPA 4MKCA 4E6CA 5CU3A 4D0WA 4U45A 4HVIA 5FEQA 3TZ7A 5M08A 3TG1A 4FSNA 4F9YA 3CJFA 3OY3A 4IB0A 3EQDA 2ZAZA 3PIXA 4E6QA 3FXZA 4QMUA 3NAXA 4IX4A 5FDXA 5HE0A 3IW5A 4IC8A 3R02A 5EDRA 5M55A 5LWMA 4V0GA 2CNUA 3RTPA 1B39A 1SVEA 3ZYAA 2X8EA 1H01A 5D10A 3R8VA 3FLYA 3M1SA 1M52A 3BI6A 2CGWA 2HWOA 3FAAA 4BFMA 4AQCA 2YN8A 2HWPA 2Z02A 2XH5A 3ATTA 4FT7A 4EHEA 2PL0A 4XCUA 1KV1A 2QU6A 4IIRA 4YNEA 4D58A 3G9NA 1Q3DA 2VGPA 4ORKA 1SNXA 5CU0A 5I9ZA 3CKWA 3ZZEA 5M4IA 2XIYA 4WA9A 5BPYA 4JRNA 1CKIA 4FTLA 4V0GB 3OP5A 1PXLA 4FL3A 2HY81 4I93A 4S34A 2C3JA 4O2ZA 3ZUUA 2UW6A 4C3PA 4RX7A 4ZAUA 3QQFA 4MBJA 4TWCA 4X2KA 4ZEGA 2QURA 5CSHA 2FA2A 4IWDA 1W98A 3Q9WA 2XJ0A 5DLSA 4F65A 1WBPA 2O8YA 3R1SA 3QALE 2JDVA 4RPVA 5LVPA 5IEVA 4GH2A 5KZ0A 4DH8A 3SW4A 2J7TA 2XEYA 4I5PA 3KF7A 3SQQA 2YJSA 4EH6A 4FNYA 2CNQA 2H96A 5IA3A 2OJ9A 4HPTE 1PRYA 1IA9A 4FSYA 4YBKA 1G3NA 4I92A 1Z5MA 2X7OA 3FYKX 3QQUA 4KIKA 3R7IA 4E4MA 5H2UA 3WI6A 3R8UA 2FB8A 1RJBA 4GL9A 4FG7A 1W8CA 2WPAA 1DAYA 3R1QA 2UZEA 4FVRA 4JG8A 2Q0NA 3ODYX 4RJ8A 3KK8A 2X8IA 3EQGA 3UG1A 1YXSA 4R7IA 3GCSA 3TJCA 2X7FA 3C4FA 3Q53A 3K5VA 4ANQA 3HV5A 3LIJA 4I5CA 5D41A 3E7VA 3B2TA 4FIHA 1W84A 3Q9ZA 4TT7A 5E91A 4DTBA 3L9MA 1KOBA 3AC1A 4IZ5A 4E7WA 4QMXA 3F88A 3OZ6A 5LOHA 4DA5A 2XRUA 4UBAA 1YOMA 5TT7A 4JRVA 4KIKB 1VZOA 4D2VA 5J5TA 4FTUA 3JPVA 2A0CX 1TQIA 3VS7A 3TTJA 2UZOA 4YTCA 2XM8A 2BROA 4RWIA 4DFZE 2BHHA 2OJFE 3GEQA 1BI8A 3CE3A 3BYOA 3RMFA 1ZYJA 4BI1A 4IZAA 1GZOA 3PRIA 4ZTRA 4JQ7A 1ZRZA 4D2TA 4PL3A 3BX5A 5KMJA 5CENA 4UB7A 3UYTA 1OUKA 2XK7A 2QOIA 4NW5A 4QYHA 5CU2A 3W33A 1O6LA 5JRQA 5C27A 3KMMA 4ZSEA 3VUGA 3WBLA 4YGAA 3KXZA 4BTJA 5KKRC 1Q99A 4RVLA 1SM2A 5FRIA 3C13A 3BCEA 2GNIA 4C58A 4YURA 3D5XA 4Y73A 4JDKA 5JRSA 1P2AA 4FT3A 1Q97A 5J5SA 3BU3A 2ZMDA 3QRJA 2IW6A 3ZO1A 4CLIA 1YXUA 3ORIA 4PDYA 4EK4A 3F5UA 2Y4IB 4FNZA 5DRDA 1QPJA 1VEBA 5DA3A 3D2KA 5E90A 2PVJA 3NGAA 4NK9A 4EHZA 2JBPA 1R0PA 3I60A 3OUKA 5HG8A 5AP7A 5B0XA 4ALWA 5AUZA 2OIBA 1ZYDA 2J5EA 1A06A 3KMUA 2H8HA 3RWPA 3ENMA 3CBLA 5HNGA 4A4XA 2PPQA 3HEGA 1JBPE 1YVJA 3BKBA 2VTOA 4BDFA 4DLIA 4R78A 3WF6A 3MI9A 3QFVA 3FMMA 4WUNA 4E5AX 3DKGA 2PWLA 5C26A 3NDMA 3K5UA 4P5ZA 5EK7A 4YJTA 4GS6A 3RVGA 3E3PA 4BI0A 3NUNA 2PSQA 3TXOA 5CU6A 3FMHA 4RJ5A 3TT0A 3PZEA 4E5BA 4M12A 3BGPA 2JDOA 2IO6A 3VRZA 4XOZA 3CQEA 4D1ZA 4ZLOA 3AQVA 3Q96A 4FTKA 4EORA 4BBEA 4DFUA 2WAJA 1ZAOA 4L3PA 4S32A 2ITZA 5HZNA 3E3BX 1Y8GA 3UC3A 3GQLA 4N57A 4FTIA 4PDSA 3KRLA 4C2VA 5EYDA 4BDDA 5IA4A 3F3VA 4HYHA 4XG9A 5ANKA 2UW7A 2YM8A 1P4OA 1RE8A 2QVSE 5DPVA 5EOLA 4O0XA 2HXQA 2XS0A 4HCTA 2XK6A 3ZS5A 2X4ZA 3DAEA 4APCA 1NA7A 4M8TA 4IB1A 5GIPE 3FMKA 2RF9A 3PJ3A 4TYHA 1UVRA 3ZM9A 1SNUA 4FL1A 4O7RA 2WOUA 2R4BA 3BEGA 3BEAA 3JUHA 1OB3A 3MSSA 4FV6A 4J7BA 3THBA 4FKRA 1DI8A 3PXFA 4C8BA 3W1FA 4LGHA 4DFYA 1LEWA 2WD1A 5DR9A 3TEIA 4UMPA 4CD0A 4UYAA 3D5WA 2HZ4A 1P5EA 4QMLA 4G3EA 4ANSA 3KVXA 2P3GX 4FEQA 4EH7A 5JGBA 4TWOA 3BV3A 2PUIA 5CNNA 1UNGA 4TYHB 2QO2A 4L7SA 2QO7A 4BZNA 2BMCA 1O6KA 2RGPA 1WCCA 3LXLA 2O64A 2F9GA 2BRBA 3G5DA 2EXEA 5CU4A 4CTCA 4YO4A 1KE6A 4MQ2A 3QTIA 3GOKA 4RWKA 2EB3A 3TTIA 3ATSA 3FHRA 2I0YA 3UP2A 3F3UA 5L2QA 1JSTA 2CLQA 4CTBA 4D0XA 4N6YA 4FSZA 5CI7A 2C68A 2J5FA 1PXKA 4J98A 3G6HA 5BUIA 3PY3A 3SG9A 3TKHA 4ZOGA 3R1YA 1H00A 3LXKA 3RAHA 5IA2A 5K5XA 3ULZA 1XH5A 2HCKA 4FG8A 4CG8A 2QQ7A 4G5JA 3W2QA 4M69A 3MTFA 2YIYA 1J7LA 4WSQA 5HLPA 2X2KA 5KMMA 2XRWA 4H1JA 4ASXA 3FC1X 4D2SA 4USDA 3DLSA 4FK3A 3ZEPA 4H39A 1WBVA 4U42A 4IWPA 4AZSA 2QR7A 4B8MA 3LJ2A 1LR4A 2G2IA 1PXIA 3BE9A 3LFAA 5FLFA 1JNKA 1Q41A 2OG8A 3UC4A 5HTIA 2VTSA 3EKNA 3CPCA 2R3HA 4RA5A 5TR6A 3NVMB 5L8LA 4HVHA 4IBMA 3NYXA 4DTKA 3OCTA 3F5PA 3EH9A 3VS4A 3CD8A 4M69B 3EB0A 3F82A 5AUVA 3R1NA 4OAUC 3KY2A 3NNUA 4DAWA 1OPKA 2C0TA 2E9VA 4RWJA 3KGAA 4IX3A 3FZ1A 4TWNA 2XA4A 3NUPA 4C4IA 2EVAA 3FMNA 4ZTSA 1KOAA 1ZMWA 3S4QA 3ZSHA 1ZYSA 3FC2A 3PXZA 2PZ5A 4YNOA 4AWIA 5C8NA 4TPTA 4QYGA 3MIYA 3ACJA 1HCLA 3MPTA 2WTKC 2C47A 3OD6X 5AAEA 1KE9A 5BUEA 1KSWA 2X4FA 2CKPA 3C4XA 2ITYA 3CR0A 5TF9A 4A4OA 3H9FA 4IB5A 4OTFA 4QMPA 1PY5A 4LV5A 3I6UA 4O22A 5ANDA 1GIJA 3UVPA 4GYGA 2ONLC 4TYJA 4H3PA 5CSVA 3ZCLA 4MWHA 5HNIX 3ORKA 2PUUA 2I40A 4GT5A 2OICA 1ND4A 5IISA 4ITHA 2OI4X 3ALOA 2B9FA 2JKQA 3O17A 5GINE 3PG3A 1H26A 4CFVA 4GVJA 3F3WA 5EFQA 2WO6A 3FSFA 4IWQA 4O0SA 5ANJA 4A4LA 5LJJA 4RWLA 3A7HA 2ZM1A 4YJQA 2QOQA 3Q2MA 2C6LA 5J9YA 4KIOA 3E62A 4MWIA 4N4SA 4OTRA 2UW5A 3F5GA 3I6WA 4O0RA 5AP5A 3OEFX 4GCJA 2F4JA 3ZSGA 4CMOA 3PA4A 4FR4A 2Y7JA 3VUMA 5CF8A 4NJDA 4RZVA 3WE8A 3LM0A 2E2BA 1NY3A 3QQHA 4O0UA 2VO6A 1YI6A 3WF8A 4NH1A 5A4TA 4HYSA 3IPHA 4KA3A 4X7QA 4AA0A 4E4XA 4UXLA 3ZM4A 2E9OA 2XJ1A 3PA5A 3FJQE 4PP7A 5GJDA 3ZRLA 2BAKA 3QHWA 3TZ8A 5LWNA 4NCTA 3A4PA 3FL5A 2C3LA 3MIAA 4TKSA 4FSWA 4BC6A 4Z3VA 4L46A 1FMKA 3VBQA 3C0HA 3R8PA 3BYUA 3L1SA 5E1SA 1VYZA 3ANQA 4IXPA 4EOQA 4RRVA 4QP6A 2BRMA 2BIYA 2RG6A 4XG4A 3IKAA 2JDTA 1IASA 3KF4A 3FWQA 5LMKC 4X3JA 5H8EA 5LMBA 5LQFA 4G16A 4C35A 3D4QA 4DGGA 1PMNA 4A7CA 4AW2A 4ZS0A 3OVVA 3VUHA 4F1OA 2V7OA 4QQJA 1V1KA 5EI6A 5FP5A 5KZIA 5JFSA 5GIOE 4NYEA 4U8ZA 3DXQA 4L9IA 4JNWA 5CXHA 4FV0A 4JVGA 5IEXA 3D2IA 4BCOA 5AM6A 4GK3A 3PPZA 1R0EA 3AXWA 1UU9A 3OOGA 4GIIA 4PP9A 4OAVB 4OTGA 3V5LA 5HLNA 3UQGA 1YWNA 3HKOA 1UU8A 4ZJVA 3QTRA 2H6DA 2V5QA 2ZB1A 4JQ8A 3KN5A 4NM7A 3IDBA 3KFAA 4Q5HA 5F95A 4FEVA 4CG9A 4IEBA 3ODZX 3NYVA 1YWVA 4FOBA 3O7LB 3LFQA 4U43A 4NEUA 4DE4A 4R3RA 1V0OA 2NO3A 1H28A 1PKDA 2H9VA 4MTAA 2Z7LA 3RWQA 4DEDA 5L8KA 4O7WA 4KUJA 1IA8A 2AUHA 5FBNC 2BFXA 4EWHA 5IA0A 3WZUA 1R3CA 3V01A 3UVRA 3VS2A 4MEDA 5L6PA 4ZS4A 2BAQA 4AZWA 3T3UA 5CI6A 5M44A 3PA3A 5AR4A 4U81A 3JS2A 5CS6A 2OXXA 2OO8X 5FXQA 5CANA 1LPUA 3Q5ZA 4FNXA 1PMEA 4H1MA 4M0YA 3R9OA 1OKZA 1STCE 3ZXTA 2J0KA 5HIEA 4I22A 3CIKA 4CYJA 2YM6A 3EWHA 3QZIA 4KS8A 4XRJA 4O86A 3NEWA 4RX5A 4L42A 4MD9E 2YACA 4OTHA 3TCPA 4JOAA 5EDPA 4EQCA 5LARA 3NLBA 1UU7A 1UWJA 3F2AA 3EQBA 5AUWA 3AC5A 2P33A 1PXPA 3B8QA 4OTQA 5I0BA 1Y91A 5H8GA 2J90A 3HMOA 3QD4A 5ITAA 2CN8A 2W7XA 3AMAA 3CEKA 1U59A 5M07A 2VTNA 4AZTA 2IVTA 2JITA 4GK4A 4XLVA 2R2PA 5HG7A 3Q4UA 4E5WA 4A07A 4D4YA 2UUEA 3MVJA 4K6ZA 3TNQB 3B2WA 2GPHA 1XH6A 4IMYA 2UZTA 1UKIA 4O0VA 5AAFA 4J8MA 4LUDA 2ZM4A 4E3CA 4LRJA 4O6EA 3R9DA 5FXRA 1LEZA 5AV4A 4G3DA 3JYAA 5IH5A 3CJGA 4K11A 3I4BA 1OL2A 3DT1A 4WG4A 4FG9A 3Q9YA 1XBCA 2LGCA 2FH9A 4XNEA 4FNWA 3O71A 4P7EA 3VS6A 5M4UA 3S00A 4IAIA 4MAOA 4Z9LA 3NUAA 3MGYA 3QQLA 2C0IA 4ZJIA 4D9TA 3UGCA 3OXTA 3CGFA 3EQHA 4EOKA 1URCA 2GQGA 4DEHA 4BDJA 4C02A 2JEDA 3COHA 4KB8A 5KHWA 5E92A 3DCVA 1B6CB 4ZTLA 4M0ZA 5B2KA 3MY0A 4EBWA 2HY0A 4GK2A 4F1TA 4AW0A 4FTTA 3JY9A 5AUYA 3O8TA 4OR5A 5AIKA 2FUMA 4KS7A 3G6GA 3PP0A 4Q2AA 3ROCA 2YM4A 1OUYA 3P79A 3RK5A 1Q8UA 3VHKA 5DG5A 3V5PA 4EK8A 2YIRA 1AGWA 2Y4IC 5L8JA 3TKUA 4QNAA 4ZXTA 4EOSA 5L2IA 5M53A 3NPCA 4M3QA 4Z7GA 4PUZA 3FZOA 2IPXA 3ALNA 2W5AA 4FTJA 2Y6OA 3E8EA 3F7WA 5E8VA 4FVPA 3ANRA 3QHRA 3UG2A 2WQMA 3OROA 4JS8A 2OXDA 1U4DA 3FMEA 5AR7A 4XHKB 4R5YA 3O50A 4FTCA 3OWJA 1J7IA 4OTWA 2VRXA 4YPDA 4YUQA 1Q8YA 1BMKA 3WZKA 3ZO2A 3ZXZA 4CFNA 3SC1A 3UJGA 2WMQA 1JKKA 2BDJA 3QKLA 3Q4CA 4RIWA 3VJNA 2QKWB 3WARA 3KXNA 4YJRA 2YJRA 4HJOA 4KINA 4BTKA 2JBOA 4GT4A 3GNIB 3EN6A 3RNYA 3SA0A 2I0VA 5AX3A 1WBSA 3GC7A 3QQJA 4XMOA 2OXYA 3EJ1A 3RKBA 4CVAA 5CNOA 4CYIA 3C51A 3VWAA 4KRDA 3F3TA 4APPA 1GZNA 4NKAA 2XVDA 4LL0A 2QOOA 4RIWB 4XG7A 3UNKA 3FL4A 4L01A 1PMVA 4N70A 4JJRA 4H3BA 1MQBA 4BWPA 1GIIA 1JWHA 5TE0A 4C2WA 4DTAA 1WFCA 3U8WA 3P0MA 4AS0A 4XH6A 2FO0A 1X8BA 4D1SA 3RAWA 4I6HA 4BHNA 3CQUA 3HECA 2YAKA 3P08A 3R2BA 4D4VA 3FMJA 4FIFA 4O7NA 3GU4A 4DGLC 4Y8DA 2CNVA 3H9RA 1BX6A 1RQQA 2F49A 5IPJA 4X21A 4BBFA 3FI2A 5GZAA 2JKKA 4HGTA 4JIAA 4U80A 5CEMA 3NR9A 3ZEWA 3RM7A 5EW3A 4KRCA 4AXAA 2OLCA 4JX7A 5CALA 3K3JA 2WMTA 3A7FA 4IADA 3DKCA 5CEPA 2BUJA 2WTCA 3EHAA 5IQIA 1Q61A 4YC8A 2X81A 4FYOA 5T3QA 3SXRA 5AP1A 3IGGA 5C8MA 4ZY5A 2PE2A 4QMTA 3AG9A 3CTHA 3DQXA 3O96A 4BZDA 2C30A 1PXOA 2OSCA 3KL8A 3C9WA 4UWYA 2FGIA 4TTHB 3OUNB 3W8LA 1JAMA 1M14A 2B55A 3D7ZA 3Q6WA 1UWHA 4EH4A 3R7VA 1UV5A 4ANBA 4GMYA 2IN6A 1H4LA 3LCSA 3C4CA 1YDRE 4C3FA 5HX6A 3P7BA 3ID6C 3DBCA 1OL7A 1FMOE 2R3KA 2BFYA 2I0EA 2FSMX 3HLLA 3RAKA 3V5TA 3RHXA 3VUIA 4CZYB 3GC8A 4RGJA 3MPAA 3LHJA 3GI3A 3U6IA 1DAWA 2Z7QA 5J1WA 1SMHA 1CKPA 3H30A 1PHKA 3GB2A 4XRLA 3RGFA 4AFEA 4CFUA 3MESA 3SOAA 3LMIA 1OMWA 2QG5A 2QLUA 3DV3A 3DPKA 1V0BA 2E9NA 3KRRA 2YCRA 3ZDUA 4DEEA 3P23A 3QXOA 4G6NA 4KAOA 4PDPA 5F1ZA 2YZAA 4MXXA 3LXPA 4IDTA 2UW3A 1U46A 5LMAA 2IG7A 4LOQA 2XKCA 2CKOA 1CTPE 5JH6A 3GXLA 2CKQA 2GNJA 3BBWA 4F9BA 2R0IA 5FEDA 5L3AA 4AT3A 1U5RA 4DGOA 3P7AA 3L9NA 5HQ0A 2BKZA 3R63A 4WRGA 4UMRA 2GNLA 1IRKA 3IW4A 3M11A 3LMGA 2PZYA 2CKEA 3VC4A 5IQEA 4CRSA 4B7TA 1QMZA 4RJ7A 5AR5A 3PXRA 2WMVA 3LVPA 4C38A 2G2HA 4E8AA 4IX6A 1J7UA 4N6ZA 3UDBA 5EDQA 1P14A 3BLHA 3EN4A 5BQ0A 2HW7A 2OWBA 3MDYA 3RPSA 3P5KA 4JIKA 4LUEA 3FKOA 3LQ8A 4LL5A 2VX1A 2RIOA 4GW8A 4YJVA 4NM3A 4NIFA 2YCSA 1VYWA 3QTSA 1WBTA 2X1NA 3W2OA 3VQHA 2QLQA 3WF5A 2VWBA 3GCPA 4GFGA 3QCYA 3KN6A 5AJQA 4RVMA 2W17A 3A2CA 2VNWA 4DEGA 4C4EA 4QO9A 3P1AA 3DFCB 5CVHA 5AX9A 3ROYA 4E20A 3P7CA 5BVOA 4FIJA 3CXWA 3LXNA 2C5NA 1Q5KA 2C6TA 3QZGA 3BLQA 2PZRA 2UVXA 2B53A 2X0GA 4I0TA 4NIFB 3UOLA 3V8WA 4UWCA 4A9UA 3LKMA 5M56A 2VX0A 5BUJA 2O2UA 4PL5A 4MQ1A 4XJ0A 1PF8A 4NKSA 4O27B 3TV4A 4YBJA 2FSTX 2RFDA 4IVDA 5EYKA 4RSSA 3RP9A 3NUXA 1OKYA 4EKLA 5KBRA 2WQBA 3AOXA 4YHFA 2ZYBA 3KQ7A 4X2FA 3EQIA 2GHLA 1GOLA 2UW4A 1I09A 5EHOA 3RCDA 4BCFA 4F6UA 2PU8A 5K5NA 3GT8A 1R1WA 2UZDA 4FKOA 4H3QA 4PNKA 2BPMA 4FKVA 1W7HA 1QPDA 3COMA 4PPCA 3U55A 3EYGA 3MVMA 4CT2A 1W83A 3IGOA 3KU2A 1YHVA 5BYYA 4FSRA 3CQWA 4EUUA 3MY5A 2IZUA 5LCKA 5K0XA 3PSCA 3NMUF 4JBOA 2VTTA 2ZM3A 1NW1A 5EM6A 5A4QA 4HGSA 5J95A 3QTZA 1XH4A 3CCNA 4HYUA 4NCTC 4CKRA 3BYVA 3NWWA 5AR3A 4RT7A 2B52A 5GHVA 3ZBXA 4BWKA 2QONA 2GQSA 4C61A 4FKIA 4XP3A 3AC4A 3ORTA 1HOWA 4BI2A 2RFEA 4IAFA 4UALA 2BRNA 4Y95A 5BVFA 3W10A 1XBBA 2ZDTA 4CSVA 2G01A 5K4IA 2I0HA 5ETIA 3G0FA 5BVEA 1H07A 3VUTA 2X9EA 2PVRA 4AFJA 3QCXA 4FKTA 4K8AA 3AC3A 3DNEA 4GT3A 2BTRA 4O0YA 5HBEA 4EHVA 3RPOA 5J7BA 2PVKA 4X0MA 4BF2A 4YJSA 3RI1A 3O2MA 4YLKA 3QD3A 5I3RA 2GFSA 5DYJA 4FSQA 3UODA 1FGKA 3R8ZA 4AT5A 4C4JA 3R73A 3TJDA 3RK9A 5CWZA 3SOCA 2J9MA 4LV8A 4IVCA 4I21A 1REKA 3LPBA 4AGDA 2R7IA 4CRLA 3AGLA 3IOPA 4JG6A 3WOWA 4V04A 5EQEA 2YCFA 3FYJX 1K9AA 3KRXA 5DWRA 2OU7A 4MXYA 2W4OA 4FF8A 2A2AA 5ANIA 4ZY6A 4AGWA 4AZFA 3VW6A 3UIMA 3KXMA 3PJ2A 5HBHA 4YTIA 2W1CA 2VTQA 5CYIA 2YIWA 2CCIA 2WMRA 2YERA 3DZOA 3IW6A 2ZV8A 3QCQA 4LI5A 5LVOA 1J91A 5BNJA 5IZFA 4QP7A 4R3PA 1Q8WA 4RJ3A 2GDOA 5B2LA 4GKHA 2PVLA 2VU3A 2QG7A 3PY0A 3DDQA 3ORLA 5C9CA 1GJOA 3VULA 4XP2A 5DT4A 1BL7A 4WIHA 3H9OA 3F2NA 1F3MC 4BIBA 3PJ1A 2JKMA 5LCJA 5BVWA 4ANMA 4CCUA 3A7GA 3FMDA 5CT0A 2BAJA 1T46A 1Y8YA 3COKA 3I7CA 4KBAA 4MK0A 4P90A 5DRBA 3TV6A 5EI2A 4FKGA 3MWUA 4Y85A 3D14A 5FTQA 1U54A 2YWVA 1J1BA 4KBKA 3DGKA 4QMYA 2BDWA 3Q60A 3G9LX 4X6RA 4M84A 3IW7A 4YZMA 1Z9XA 3U6JA 1U5QA 4RX9A 3H0YA 1DI9A 2P2HA 3UO4A 4MYGA 3U87A 2OZAB 3BLRA 3RZBA 2OJGA 3NUUA 4DCAA 3D5UA 4IC7A 3POZA 2DQ7X 4RMZA 4QQTA 5JZNA 5EM7A 3W32A 1U54B 1DS5A 2XBAA 4EQUA 2SRCA 2VUWA 2VTMA 3O8UA 3ORNA 4MH7A 4EOOA 2CGXA 4DC2A 3HL7A 4L45A 1JPAA 4L7FA 1R78A 5IMEA 4IHPA 4FTOA 4PTCA 4EUTA 5EQYA 3DXNA 4B0GA 5DR6A 2ZJWA 3PWDA 3O0GA 3UMWA 2HIWA 3G2FA 5CQWA 2WNTA 4FC0A 2QHNA 2Z2WA 3C50A 5B2MA 2XIKA 2WEVA 3QQGA 4DHFA 2J6MA 2LAVA 3ZFXA 3E63A 5HD4A 3IDPA 3S2PA 4HCVA 2HW6A 2KULA 4DFBA 2IW9A 1XQZA 4YR8A 2QOLA 5ICPA 3F6XA 2WTIA 4I4FA 3UIXA 4AN9A 1KE5A 3KXXA 1YXTA 3JVSA 2PMIA 4M7IA 1L8TA 4ANOA 4MHAA 2FVDA 2IWIA 2YABA 3R7GA 1TKIA 4ITJA 3VNTA 3FUPA 4S30A 1QPCA 1VR2A 1W82A 4ACHA 4EH9A 4E93A 3H10A 2ERKA 2P55A 2R3NA 2V7AA 3L8SA 4I0RA 1R39A 5DT3A 1WMKA 2BR1A 5I9XA 4FV3A 4B9DA 1GAGA 3VQUA 5IA1A 4OLIA 2BIKB 2RFNA 3RCJA 3MA6A 5E8WA 4O7ZA 4WG5A 1PXMA 1L3RE 3DB6A 5HO7A 5HTBA 4PWNA 3OF0A 3ZONA 1VJYA 2XK3A 4BR3A 4QPMA 4CXAA 4YU2A 3SAYA 2GS2A 3GGFA 3E8CA 5L2TA 4FIGA 4OTDA 3WIGA 5KBQA 5IDPA 4BCIA 3PE2A 4XOYA 1P4FA 3QWJA 1SVHA 4JQEA 2XMYA 2WZJA 4L67A 5E8XA 3UBDA 3AMBA 2R7BA 4XLIA 4EC9A 4F7NA 4F4PA 1OM1A 4JDHA 3E8DA 4RFYA 3R8MA 4G9RA 4FT0A 2OIDA 3EFLA 4HZRA 4PL4A 2GNHA 4FV8A 2XKDA 4KKEA 5C1QB 3ZFMA 5E4HA 4CFMA 2YEXA 3WIKA 3BGQA 1Y57A 5BMSA 3ZRMA 4XV1A 4RIXA 1YHSA 3ZZWA 5AMNA 5GZ8A 3MB7A 4EJ7A 2PY3A 4UX9A 2AC3A 2VWZA 4QP3A 4R7HA 4F63A 4MX9A 5J1VA 4DFNA 4DCEA 4MXZA 3PPKA 5CF4A 4WOVA 4NU1A 2X6DA 4CV9A 2Z7RA 4ZTNA 5EM5A 4X2GA 4EL9A 3P86A 3WILA 3DFAA 1ATPE 2GNFA 4FSUA 4OTIA 1FPUA 1MQ4A 2W5HA 3TNIA 5EM8A 4QTBA 3MFRA 5ANEA 4ZJJA 5JFVA 5A4CA 2WMUA 2QOHA 3C5UA 4RIXB 2PUPA 3JR1A 3BHVA 1XWSA 2W1FA 4NUSA 3WYYA 3GQIA 4U44A 1YDSE 2XM9A 5H3QA 2WOTA 4K2RA 3R8LA 4BGHA 2QOCA 4I41A 4FEUA 3R21A 1S9IA 3W16A 3LFEA 3DDPA 4IDVA 3MH3A 4FX3A 3MFTA 1T45A 4RBLA 5AUUA 3LLTA 1KE8A 4NW6A 2BRHA 3ZSIA 2VO3A 4RLLA 2JFMA 3UOHA 4W4WA 3UZRA 3LM5A 4AU8A 4PPAA 4AN3A 3D7TA 3W2SA 5CAUA 4BDBA 5CY3A 3NUYA 5AV1A 5HIBA 4ANLA 2OH4A 2W06A 2QR8A 3F61A 2YIXA 3DBQA 4FUYA 4U9AA 1XHAA 3DY7A 3VS1A 4F09A 4D5KA 5KUPA 2AYPA 5C4LA 2F7XE 4D55A 4OT5A 2VGOA 5M06A 2X2LA 3UE4A 5FEEA 3DTWA 4EOIA 3FXWA 4FT9A 3NW7A 4YJUA 4DH3A 2NPQA 3QD2B 2JC6A 5GZ9A 4Z16A 3D7TB 4GVAA 4QMWA 3WE4A 4GFOA 4JX3A 3DOGA 3WF7A 4AOJA 2F7ZE 4R3CA 1PYXA 4DN5A 5AADA 2GFCA 4NFMA 3E64A 3OT3A 5J9LA 5I3OA 4EC8A 5IQCA 1IAHA 4XG6A 2I7QA 2B54A 2O63A 4PMMA 5ANGA 3UNZA 1Q24A 3Q52A 2XNPA 3A99A 5TOZA 2VD5A 3GOPA 2QD9A 3NIZA 3CSVA 4I94A 5A14A 4EZ7A 2XEZA 4BZOA 4YLLA 2P2IA 4RLKA 5EHLA 4GIHA 4ZTMA 4UMQA 2NNWB 3NCGA 4YTFA 5HGIA 3EFKA 4JT3A 2WU6A 3DKFA 4I23A 4QP1A 2VTIA 3L8PA 3HV7A 4J52A 3CP9A 5EKNA 1ZOEA 5AV0A 4NWMA 4FTNA 2PVMA 4L43A 5HG9A 3VBTA 5BX0A 3I1AA 3QC4A 3TACA 2WQOA 2PZIA 3UTOA 4EH3A 4EH2A 4FSTA 4GSBA 3BZ3A 3WZJA 4L53A 1SYKA 1YXVA 4LRKA 3KXGA 3OCGA 4XX9A 2C6KA 2JAVA 1ZOGA 2QODA 3ORPA 5E8SA 4BY9E 1GZKA 4DT9A 1ZWSA 3PZHA 3MPMA 3HUCA 4O7VA 4WO5A 5HVKA 3QX4A 4I6FA 4QT1A 2A27A 5EI8A 3OWKA 2V0DA 3RPVA 2GSFA 3CC6A 4DGNA 3UIUA 4GJ3A 4A9TA 4ZMFA 2VTHA 2Y6MA 3HZTA 2UZLA 3HRFA 3II5A 1JQHA 2WELA 1BUHA 1CM8A 4KBCA 4I24A 4WNOA 5B7VA 1XR1A 2QOFA 3AD4A 1IR3A 4RA4A 3BYMA 2WMBA 4G3FA 2DUVA 4S33A 3SXSA 1IG1A 3G90X 1HCKA 4BKZA 4DFLA 2R3OA 4BHZA 5KHXA 4PRJA 2W1IA 2IW8A 4HGLA 4JAJA 2CCHA 5HIDA 4ZZNA 4R1VA 4BYJA 3EQCA 4BDIA 5FGKA 5CAVA 2W1HA 2P0CA 2OW3A 4CFFA 4AP7A 4ZY4A 1PKGA 4YHJA 5HNBA 2FYSA 4G6LA 1JKLA 2WFYA 3FLSA 2WGJA 4RFMA 5TKDA 4QTCA 4EJNA 4Y5HA 3S95A 4FIEA 4IZYA 5J9ZA 2C6IA 3FDNA 1Q62A 2Z60A 4J53A 3R9HA 3PIZA 4G3GA 4ALVA 4X2NA 4F6SA 2VAGA 2IVVA 3ENHA 4LMUA 1WAKA 2R5TA 3GC0A 2ZV9A 3QD0A 3H4JA 2YFXA 3OG7A 4FV2A 4NL0A 2ITUA 2W99B 5H9BA 4U5JA 1NVSA 3LQ3A 2R3JA 4BKYA 4DYMA 5FQDC 3WZEA 3BQRA 3EZVA 4XYFA 1FGIA 1IAJA 5JT2A 3KULA 2NRUA 4FIIA 2BILB 2UVYA 3V8SA 3I5ZA 3QXPA 4IZ7A 3ZMMA 3LW0A 3UIBA 5KNJA 2Y8OA 4K18A 4I5HA 2RKUA 2VN9A 3OTVA 3VHEA 4OGRA 4FT5A 4BGQA 4CEGA 2JGZA 3C0IA 3A60A 3EZRA 4G5PA 5CVGA 4BYIA 2CLXA 2J0IA 1YRPA 2YCQA 3NNVA 4XS2A 1OBGA 3SVVA 3TIZA 4L3LA 4FGRA 1Z57A 1JKSA 2Y0AA 3QUPA 4E4LA 5AV2A 3NAYA 3KULB 4WNMA 4GG7A 4KKHA 4ASZA 5HU3A 2WTJA 2R9SA 4DH7A 1YOJA 4EZ5A 2W96B 5ETFA 3VS0A 1WZYA 4LM5A 4YSJA 2CSNA 3VN9A 4KABA 4HCUA 3R7EA 1G8SA 2OF2A 4ZZMA 3QCSA 4DBNA 2V62A 3I5NA 4J95A 4D2WA 3QTWA 3E92A 4QPAA 4WUAA 2J2IB 3PVGA 3U6HA 3SKCA 2ZOQA 3PJ8A 5GNKA 4FK6A 5BMMA 4WKQA 3H3CA 2ETKA 2R3RA 4LYNA 2YDIA 1BKXA 5AEPA 5D11A 2WMAA 5JGAA 3C4WA 2AC5A 2XF0A 2VV9A 3D94A 4L52A 4Z55A 5FD2A 4XP0A 3CTJA 4ID7A 5HO6A 4O21A 4CKIA 5JZJA 2G15A 1BL6A 5HORA 3PG1A 1UNLA 3CS9A 2YDKA 2JKOA 2JDRA 1APME 3NYNA 4JDJA 4O0WA 2YLEA 4ALUA 3ZH8A 4DITA 3QRKA 2QCSA 2XIXA 4RJ4A 4B99A 1KE7A 4PMPA 5CT7A 5M4FA 3OOMA 1XH8A 5CASA 3E87A 3DBDA 4WBOA 5HI2A 5M4CA 4MD8E 2R3MA 4A9SA 1REJA 4QP2A 4AF3A 4BBMA 3HMPA 3SXFA 2W9ZB 4KIPA 3KC3A 4FMQA 4ZSAA 2YA9A 4D28A 2ZMCA 4UMUA 4O81A 5FP6A 3Q5IA 4YZDA 3PLAE 2BTSA 1KV2A 4FTRA 4QNYA 4X3FB 5E8YA 1M2PA 2QC6A 4RX8A 3UPXA 4AACA 1OPLA 3AT4A 4BDAA 2EU9A 1IEPA 5D7VA 4GJ2A 3HDNA 3R7OA 3N4UA 3LJ1A
chains in the Genus database with same CATH superfamily
5HE1A 4FE2A 3RINA 3KKVA 5DH3A 3UDTA 3VONA 2V55A 4QTDA 2ZB0A 3DXPA 2HXLA 5CEIA 4ZIMA 4QYEA 4P5QA 5DEWA 4EK5A 3BHTA 4FKJA 1ZY4A 4CCBA 3ULIA 5DE2A 5IUIA 3DK7A 2IZSA 3LJ0A 5BVKA 4YTHA 3MH1A 4J99A 3HNGA 3NNXA 4I5MA 4MF1A 5FTOA 4YZBA 4JLCA 3OHTA 5DR2A 3TZMA 4BCPA 2CGVA 4CT1A 4EI4A 5L2SA 4MXAA 3SW7A 1ZOHA 4DLJA 5IMXA 3HV6A 4IH8A 4UY9A 3RALA 2XNGA 4MXOA 4TW9A 4ASEA 4FEXA 4ZK5A 4DT8A 2GS7A 4IVBA 4YJOA 5CEQA 5IQHA 3SG8A 5LVNA 4Y83A 4BGGA 1WVXA 3MVHA 5IQGA 3D15A 3TDVA 1ZMUA 4HW7A 5HEZA 5HO8A 1ZLTA 3UDSA 3V3VA 2WMSA 4YC6A 3OXIA 3ZLSA 5FTGA 2JIVA 3G0EA 4ZMEA 4PTEA 3ELJA 2VZ6A 4B4LA 4KKGA 2XNBA 4G17A 4F9WA 4PPBA 4QTAA 2UZVA 3EL8A 3SDJA 4U97A 1ERKA 3NW6A 3RPRA 3T3VA 3V5JA 2EXCX 2PE0A 3BWFA 5A4LA 4EONA 3QKKA 1Y6BA 3MW1A 4JL9A 4EYMA 1OIYA 3BELA 2BVAA 5TO8A 4AA4A 4F1MA 3HDMA 5T68A 4EOPA 1XKKA 4KIQA 4KWPA 4ZTQA 4NZWB 3O8PA 5EW9A 4KD1A 3F3ZA 4ZTHA 3VUDA 2OF4A 5K4JA 4IFCA 2UZNA 4KSPA 5AP3A 1F0QA 4ERKA 3KMWA 3PXYA 3E93A 1WBWA 3EMGA 3SHEA 4QQ5A 5BYLA 3KB7A 2RSVA 3W55A 2XB7A 3NYOA 4RG0A 1G8AA 3PXKA 2XUUA 3QU0A 4ZLYA 4DDGA 4BL1A 2C5YA 2C1BA 2ITXA 5FWKK 4O4EA 5K9IA 4B6LA 5EKOA 3R71A 5J7HA 4HVDA 3HAMA 4V01A 2ITWA 2O5KA 2RG5A 4HPUE 5LXMA 3JXWA 5BVDA 4NTSA 2J50A 5JQ8A 3BLAA 5JGDA 3L8XA 3FEGA 3RHKA 1MRYA 4HVSA 3MJ2A 2UW8A 3I81A 3HA6A 4L3JA 5M51A 5AFVA 5HCXA 4F9AA 4MBIA 3TIYA 4Y46A 3PXQA 5HE3A 3VW8A 4PDOA 4FKWA 4GG5A 2YHVA 1TFFA 3MTLA 4NFNA 4HVGA 4M15A 3VF8A 4D9UA 3NW5A 4C4HA 3ETAA 4BDGA 4DINA 1GIHA 2WKMA 3AT3A 5DFPA 4G31A 4RFZA 3MJ1A 3QX2A 4EH5A 3BPRA 3FKLA 2UZWE 2Y4PA 3HMNA 4XG8A 4BDEA 3G15A 3BU6A 4Y72A 2W4KA 1OIUA 4B8LA 3HP2A 3FPQA 1PYEA 4RVKA 2GU8A 4FV4A 4JR3A 4GEOA 3CGOA 3DAJA 4TRLA 4U6RA 4ERWA 4IM3A 1OECA 2XARA 5CAOA 3NFFB 5EHYA 2XYUA 3N4VA 4FICA 4K1BA 3RAIA 3FBVA 3GENA 5I4NA 4W4VA 1FVVA 4XEYA 5IQDA 1A48A 4O4CA 2BALA 1H24A 3UPZA 2HK5A 4BWXA 3ORZA 4BN1A 4W8EA 2NYAA 1YI4A 5EQPA 2BZKB 2JD5A 2J0LA 4CGAA 5IEYA 4P2KA 4YJNA 4USFA 3NS9A 1JOWB 4BDCA 3REPA 5J87A 5E7RA 1AQ1A 3QF9A 3EN9A 2VWIA 2X9FA 3QBNA 4MNEA 5HKMA 1YWRA 4AOIA 4C3RA 4RC2A 3KCKA 3VF9A 5IUGA 4LOPA 3FI3A 3HGKA 1E1XA 3AD6A 4FZAB 3ZRKA 1SVGA 1XBAA 3U4UA 2G9XA 1OGUA 5EG3A 2OFUA 4UN0C 4BCQA 3O5AA 1J3HA 4QMQA 4EKKA 2OFVA 2XNMA 1M2QA 2UW0A 1H1QA 4AT4A 3LFDA 1XJDA 1UNHA 2ZDUA 5LVLA 5CZIA 3FI8A 3GU5A 3TDWA 4MNEB 1XH7A 1ZMVA 2R3IA 4RQKA 4DHIB 2QHMA 3U51A 5A9UA 2ITNA 3R9RA 3VO3A 3VBVA 1QL6A 2Z7SA 3EIDA 3V6SA 3TM0A 3VUKA 3MBLA 3ZLYA 3C1XA 1I44A 4QMMA 3QYWA 1H25A 4CV8A 4U40A 5JQ5A 3L9PA 5HESA 1NVRA 5F20A 1H0WA 2J4ZA 3C7QA 2G1TA 3UQFA 3T8OA 2BCJA 4YC3A 2HOGA 1J1CA 3KXHA 1UA2A 2X0QA 2B9HA 4P4CA 3LFCA 5E8ZA 4O96A 3MVLA 4AGUA 4I1ZA 2BZHB 3PY1A 4NJ3A 2R3QA 4D2RA 1Q4LA 3HV3A 4BTMA 2R0UA 2FSLX 3OW3A 3A4OX 1OKVA 4AA5A 5E9EA 2EUFB 3R2YA 4MNFA 1E9HA 5FUTA 3Q32A 4L00A 3IW8A 4FZDB 3QQKA 4R77A 4AN2A 4CNHA 4AX8A 1W0XC 5HOAA 1JSUA 5DT0A 5AR8A 3QLFA 5DNRA 3DZQA 1CDKA 3VRYA 4BKJA 5JMSA 5CVFA 3AC2A 3DB8A 3TI1A 4I20A 4FI1A 3KK9A 4QQCA 2R3GA 3UZPA 1RW8A 4AW1A 4Q9SA 4CQEA 4ENXA 4GKIA 5DMZA 3CTQA 4LFIA 1K2PA 1VLRA 4BB4A 5D7AA 2VX3A 5G6VA 5GJFA 2XALA 3R0TA 3W18A 3MB6A 4DH5A 4XV9A 2IEWA 5IF1A 4QPSA 1KUTA 2GMXA 4ZSJA 4XG3A 1PXNA 5D9HA 3CKXA 4BDKA 4QDEA 1Q8ZA 4EWQA 4IANA 5EOBA 3LCDA 3F69A 4G34A 1ZYCA 3GU8A 4G6OA 4C33A 2WXVA 1TQMA 5KMKA 3DJ5A 3AT2A 4FA2A 2XZSA 2QO9A 1A9UA 4PNIA 3FMLA 1JSVA 4G9CA 2YZLA 4ACCA 2NRYA 1H27A 2VNYA 4OTPA 4R1YA 3DQWA 2OBJA 3PLSA 4QMOA 5L6OA 2OZAA 4EEVA 3LCKA 5CEOA 4FVQA 4JI9A 4XBUA 1URWA 5IKWA 2OKRA 3D83A 3QLGA 3PVUA 5H8BA 5JEBA 4QMNA 3TUCA 3MN3A 4L6QA 1NT2A 2IVSA 1OI9A 5C8KA 4PTGA 1NVQA 3E88A 3OBJA 1SZMA 4U7ZA 3LAUA 1FOTA 3SLSA 2C1AA 4I3ZA 3PVBA 2GQRA 4G3CA 4WNPA 3RZFA 5AWMA 5DIAA 3EFJA 4D4SA 3AGMA 3N9XA 3G51A 4JG7A 2C4GA 2JAMA 5AA8A 3U9CA 5AUTA 2ZVAA 2Z8CA 4M14A 4O7YA 3FQEA 5DOSA 1ZZLA 3BHYA 2J0JA 2F2CB 5KO1A 4IM0A 4QMVA 2BZJA 4WRSA 4IAZA 4BCGA 5JKGA 5AM7A 5KMLA 1M17A 3ZTXA 2O0UA 4UWBA 4C4FA 4IFGA 4D5HA 2X6EA 4TNDA 5A6OA 5HBJA 3TNWA 4H05A 3OFMA 4G1WA 2XK4A 2A19B 4FODA 4V05A 5EW8A 4TL0A 3PSBA 3A8WA 4OW8A 1CKJA 3F7ZA 4ASDA 2OJIA 3F9NA 3GCUA 3KA0A 3OT8A 4FTAA 3IK3A 4I4EA 4O1OA 5CTPA 2UV2A 5A46A 4QOXA 3EQFA 3FQSA 3OC1A 3OMVA 4U3ZA 5I9UA 4W9WA 3V51A 4HGEA 4YJPA 4EQMA 2XYNA 1UKHA 3H0ZA 3R01A 2ITTA 3LZBA 4TXCA 4J71A 3EL7A 3L9LA 3N51A 4QMZA 2G2FA 1JLUE 3V5WA 2B9JA 4A9RA 5E8TA 4HYIA 1YOLA 5IUHA 3TNHA 1F5QA 3EKKA 3R30A 1OVEA 4IB3A 4AZEA 4RQVA 4RZWA 4XV3A 3QTQA 4UV0A 2DYLA 4IQ6A 3ZLXA 2PYWA 3N4TA 1NXKA 5T6KA 2VTLA 2PZPA 5CQUA 1ZXEA 3E5AA 4NM5A 2B7AA 5IQFA 5KX8A 2YM5A 1MUOA 2OIQA 4FEWA 4X3FC 4FKUA 3TWJA 3ZHPC 3ET7A 4ACGA 4J1RA 1EH4A 2IJMA 3EN7A 3F2RA 3IO7A 3KRJA 4PMTA 3DTCA 1ZARA 4HNIA 2C5XA 4IAYA 3HVCA 4LMNA 3ITZA 3ZC6A 4F70A 4C59A 3GBZA 2RL5A 2PUNA 2PULA 2WU7A 2C6DA 2O65A 4QYFA 4FKQA 4J8NA 4Q5EA 3FY0A 2XIZA 4AE9A 4K0YA 4BCMA 4F08A 3PP1A 3QZHA 4K9YA 5AP2A 4OBQA 3ZUTA 3A8XA 3CPBA 4E73A 4II5A 3AMYA 2C6OA 2C6EA 3OWPA 3ZFYA 3QGWA 1YW2A 3VBYA 5A3XA 3UZTA 4R5SA 2YM3A 3V5QA 5DI1A 4F0FA 1GNGA 2ETRA 3FLNC 4YZNA 4EOMA 5JFXA 3RJCA 3FZRA 4NM0A 2ETMA 2WTDA 4F9CA 2PHKA 5EYCA 3ZLWA 2XCKA 5FXSA 1QPEA 2VWWA 4QDVA 4AW5A 2I1MA 2JIIA 4E6AA 3I79A 5I5ZA 3PYYA 3O23A 1TQPA 2OGVA 3T9IA 4PF4A 4FGBA 3ZDIA 3Q6UA 4RC3A 5C03A 3A7JA 5CXZA 4KNBA 3HA8A 1AD5A 2ITQA 3HYHA 2X8DA 1H8FA 4ENYA 4F0IA 3UQCA 3NVKI 4GYIA 3NRMA 4F78A 3VS3A 4H58A 5BVNA 5J8IA 1RDQE 2XCHA 4RJ6A 4YPSA 2R3FA 3DLZA 4GU6A 5DHJA 3FE3A 3ZOSA 4M68A 3TZ9A 3R7UA 3UOKA 4ANNA 1XO2B 2XNOA 3NCZA 3QGYA 5D1JA 3W8QA 2VWUA 4BDHA 3W2RA 3DJ6A 2C0OA 3BHHA 1W2FA 1YHWA 4EHGA 4W9XA 5FBOA 4BCJA 3DBEA 2YITA 2OK1A 3PDTA 4GFMA 4RVTA 2KTYA 3IOKA 4MCVA 4CQGA 5CLPA 5DGZA 3PVWA 4ACMA 4D4RA 2WEIA 2JFLA 2VO7A 4O1PA 3LCTA 5C01A 3K3IA 3PRFA 5KCVA 4O83A 3GFEA 1OIRA 2E9UA 3KVWA 3QRIA 3U9NA 5CZHA 2Q83A 3SGCA 3Q4ZA 4ZSGA 3S3IA 4QP9A 3O51A 4BCHA 4NTTA 4EOLA 1WBNA 4JBPA 5I9WA 2HAKA 1QCFA 2HZIA 1Q3WA 4QP4A 3ZBFA 4FOCA 3A61A 2O3PA 2HELA 2XIRA 1M7NA 4RIYA 4S31A 4A06A 5CEKA 4FKLA 2JDSA 3C4EA 2GTNA 3TV7A 3EYHA 2PVYA 4DEAA 4GRBA 3EFWA 2XP2A 4CMUA 4TY1A 3IG7A 3Q4TA 4C62A 2GHGA 2PMNX 2CPKE 5L2WA 4F99A 5HVYA 5IDNA 4E6DA 2C5VA 3DJ7A 1DM2A 2C5OA 2W9FB 2X7GA 4FYNA 4TWPA 3VAPA 2B9IA 4CKJA 1H1WA 1PMUA 3QA8A 1CMKE 2VO0A 4ZSLA 2FSOX 1OITA 4JR7A 4JXFA 5I9YA 4XG2A 2GS6A 4RIYB 3QYZA 3MS9A 1MRVA 3JVRA 3PE1A 1FVTA 3U4WA 3VBXA 4C4GA 3DBFA 4ONAA 4PMSA 3RK7A 4IVAA 2QOBA 3ZO4A 4J97A 4FKPA 5JK3A 3I0OA 2ESMA 4GU9A 4R7BA 4C7TA 2F57A 3FHIA 3IECA 1PXJA 4GUBA 3PPJA 3AC8A 2F7EE 4UYNA 4WBBB 5ANOA 1OZ1A 1ST4A 3W0SA 2CMWA 3D5VA 4AGCA 3QTXA 4X6QC 3QWKA 4DEBA 3BQCA 5IQAA 3LE6A 1BI7A 2ITPA 4TNBA 3KEXA 5ETAA 4U3YA 1LUFA 3FLZA 1PJKA 2QNJA 3U54A 4OBOA 4FL2A 4WHZA 3SD0A 3FLQA 3A62A 4BVUA 5E1EA 3LFNA 4FUXA 2BHEA 4YZCA 4DG2E 3OW4A 2P4IA 3A7IA 3LFFA 1PW2A 1W2DA 4IAKA 1FBNA 3BGZA 2ERZE 2UZUE 3PIYA 3G33A 4EOJA 5FDPA 5JN2A 4AXEA 4CFXA 1OL1A 3OWLA 4PX6A 4EYJA 3LFSA 3HV4A 4O84A 3HMMA 4BCNA 1S9JA 3LOKA 4LOOA 4LG4A 4FV9A 4XUFA 4CLJA 4CZTA 3PJCA 4TYEA 2OJJA 2W0JA 2C6MA 3R83A 4IM2A 1YDTE 2J51A 4WG3A 1H1PA 2PMLX 4F7SA 3P4KA 4BCKA 5CF5A 4JAIA 3NX8A 5GJGA 2VWVA 2WTWA 2WTVA 2YM7A 4UEUA 4EK6A 3RM6A 3V8TA 5IH4A 4QP8A 3TKIA 5KMOA 2QI8A 4OT6A 4PY1A 3FQHA 3IDCA 4M66A 3UO6A 3VIDA 3AKLA 5C4KA 4E4NA 4O7TA 1M7QA 4FZFB 2GTMA 5CSWA 3IONA 1OBDA 3CD3A 1FVRA 5JFWA 3GVUA 4MD7E 4YO6A 4Y5QA 3CY2A 4LGGA 2VTAA 4L44A 3PSDA 4DFXE 3NNWA 3ORMA 4WT6A 4MBLA 1E1VA 4GUEA 3TL8A 1BYGA 5M09A 4W8DA 5CSXA 1FINA 4QTEA 3OCSA 2YWPA 2HZNA 3S0OA 1XMMA 4M13A 5IG1A 3Q2JA 3C0GA 3LFBA 4OBPA 4FZ7A 1OPJA 5HG5A 2PVFA 5KMIA 5KKRB 3PUPA 3MFUA 4QRCA 2VWXA 4EZ3A 4YSMA 1K3AA 3M2WA 4F64A 5D12A 3HUBA 4IWOA 4QMSA 4FTMA 5K3YA 3QUDA 2VWYA 3EN5A 2CGUA 3BYSA 4RIOA 4ARKA 3HX4A 3EQPA 5L4QA 4U41A 3GC9A 3R04A 3QZFA 4O4FA 4TZRA 5A54A 4LGDA 2I6LA 4AUAA 3OEZA 5F9EA 3QTUA 2WQEA 3E8NA 4UZDA 4BIEA 5IU2A 5DN3A 4DGMA 2XK8A 3D0EA 4GV1A 4O82A 5EYMA 3MYGA 3DK3A 3QKMA 3OTUA 4MF0A 1LP4A 1MRUA 3I7BA 3DA6A 3L8VA 3VJOA 3FY2A 1M2RA 1WBOA 3IQ7A 5HE2A 4AAAA 2H34A 1BLXA 1GY3A 3GU6A 3LQ5A 4HNFA 4FV7A 2QOKA 3PTGA 3ACKA 3D9VA 2GHMA 3BHUA 3HRCA 4IACA 4PV0A 1ZZ2A 2PMOX 2QU5A 3BBTB 3QC9A 4YHTA 4U0IA 2REIA 4O7LA 4AXFA 3K2LA 5AR2A 4XV2A 3OS3A 3UO5A 2BRGA 3LCOA 3T9TA 3W0NA 4Q9ZA 3C5IA 1TVOA 4MVFA 4DBXA 2X39A 4ZLZA 4O2PA 5DBXA 4E1ZA 2UW9A 5J79A 3CLYA 3POOA 4H36A 2XKEA 4X3FA 4K33A 4ITIA 5AV3A 5IA5A 4ACDA 1O6YA 3O7LD 4I6QA 2WMXA 5AIRA 5AP0A 4L8MA 5HHWA 1Y6AA 2WQNA 4WD5A 5ETCA 2R64A 3SX9A 5AAGA 2BDFA 1OL6A 2DS1A 3V6RA 3BE2A 3B8RA 4YLJA 3TUBA 3FLWA 5KE0A 2W5BA 3AD5A 3COIA 3FI4A 1WVYA 2R3LA 2BKKA 2HENA 2A1AB 3M42A 1H1SA 4IJPA 4WSYA 5F4NA 5G1XA 2VTJA 5HICA 3SV0A 2BZIB 4YMJA 4TN6A 4UZHA 5A6NA 4KSQA 3BU5A 3NZ0A 5KMNA 4NT4A 3P78A 4PQNA 2Q0BA 2GCDA 1ZY5A 3F66A 3GCVA 4FV5A 1XMLA 2YIQA 5CX9A 5HLWA 1V0PA 2VTRA 4BTFA 3GCQA 2B4SB 3KCFA 4U79A 5ACBC 3MH2A 4YZ9A 3EQRA 3BV2A 3PWYA 2UZBA 4AG8A 3SRVA 4L68A 4D2PA 3LMHA 4F7LA 3VBWA 3DS6A 3DK6A 3NSZA 3FZSA 4FRFA 4S2ZA 2PVNA 3R00A 5AP6A 3RBWA 3UP7A 4NSTA 2B0QA 1FQ1B 2EXMA 3VVHA 2V22A 3OBGA 2ITVA 4M67A 3MFSA 2HYYA 4IW0A 2RFSA 3OXZA 1KWPA 3EOCA 4LQMA 2F2UA 3IS5A 4XBRA 3RPYA 4F7JA 3R22A 1WVWA 4MXCA 4W4XA 5AUXA 4O91A 2EWAA 4G2FA 3SRVB 5CAQA 4EK3A 3QA0A 3C4ZA 3P9JA 3FV8A 3RNIA 4ZZOA 4AZVA 2IZRA 2ITOA 2IVUA 2JIUA 3MV5A 4JBVA 4ZP5A 4C37A 4DG0E 3CY3A 1B38A 3R6XA 3UMXA 2WMWA 3FXXA 5IQBA 3OCBA 3W0OA 3QRUA 3FSKA 3ZC5A 2E9PA 2XNEA 4DG3E 2CN5A 3PFQA 3R28A 5AP4A 3BRBA 4FZ6A 2ACXA 3UOJA 2PE1A 4HOKA 4YP8A 2R3PA 5HX8A 2XJ2A 4JBQA 5FG8A 4I6LA 4C0TA 5M57A 3MH0A 1OL5A 4O6LA 5A4EA 3WYXA 2PVHA 3HP5A 1YI3A 3DNDA 3NUSA 4FKSA 5E8UA 4CMTA 3W2CA 5CSPA 2GNGA 4N0SA 5HCYA 3BWJA 1GZ8A 1XH9A 4C57A 1H08A 2W4JA 2HZ0A 4JDIA 5HTCA 4R6VA 4AOTA 3LLAA 1ZYLA 3MY1A 2WB8A 3ERKA 2ONLA 1Q8TA 3Q9XA 4FV1A 5F94A 3ZUVA 2XNNA 4D1XA 4USEA 5HCZA 4AE6A 4IAAA 4BRXA 3HRBA 3S1HA 4M97A 4K77A 3GUBA 3QL8A 2Y9QA 4WNKA 2WTKB 4X2JA 4QD6A 2ZV2A 2XAMA 2W1EA 3I0QA 2X2MA 4EBVA 4AQKA 3VS5A 5L6WL 4J96A 3FZPA 1JKTA 2PK9A 2W05A 2W1DA 5IH6A 1JVPP 3R7YA 1MP8A 3QRTA 2UVZA 2C69A 4CZUA 3K54A 1YXXA 3GFWA 4I6BA 2YAAA 2DWBA 3KRWA 5EH0A 5CAPA 2B1PA 3DU8A 5HVJA 3ORXA 4UMTA 3R9NA 3KREA 3ZU7A 1H0VA 2IZTA 2A4LA 4DF3A 2QKRA 4IJ9A 1UU3A 3Q04A 2VTPA 4I0SA 2YDJA 1OKWA 4C36A 4EH8A 1H1RA 5JSMA 2CJMA 2XKFA 2ZV7A 5I9VA 4HZSA 2JLDA 2CHLA 3JY0A 3GP0A 5BYZA 4A9YA 4O0TA 2OH0E 5DEYA 5DVRA 4CFWA 2W1GA 3F5XA 3FKNA 5FM2A 3QAME 1O9UA 3FZTA 2WHBA 5CF6A 3TUDA 2XK9A 2OZOA 1OIQA 3QUEA 3W2PA 5LVMA 4DH1A 4BIDA 2WIHA 4E26A 4OUCA 3BIZA 3DKOA 2CDZA 4TYIA 2YISA 4UXQA 3FPMA 4IE9A 5LMKA 1YKRA 3ZO3A 3Q3BA 3TNPC 3GU7A 5HD7A 2EB2A 4FTQA 4TYGA 4W4YA 4O7SA 2C3IB 4IX5A 4R8QA 3WF9A 4C34A 3WZDA 5K0KA 3TN8A 2YLFA 3HAVA 3UYSA 2NP8A 5HU9A 1CSNA 4QYYA 2W1ZA 1YQJA 3UNJA 4DEIA 5FM3A 4O38A 2XBJA 3DAKA 3OY1A 2C3KA 5ACKA 3MA3A 2PTKA 4RC4A 4F6WA 4Z7HA 3HMIA 3NIEA 3UVQA 4LRMA 4F0GA 5AA9A 2J0MB 3V04A 1G5SA 4BICA 3E7OA 4FSMA 4FBXA 2WIPA 4MKCA 4E6CA 5CU3A 4D0WA 4U45A 4HVIA 5FEQA 3TZ7A 5M08A 3TG1A 4FSNA 4F9YA 3CJFA 3OY3A 4IB0A 3EQDA 2ZAZA 3PIXA 4E6QA 3FXZA 4QMUA 3NAXA 4IX4A 5FDXA 5HE0A 3IW5A 4IC8A 3R02A 5EDRA 5M55A 5LWMA 4V0GA 2CNUA 3RTPA 1B39A 1SVEA 3ZYAA 2X8EA 1H01A 5D10A 3R8VA 3FLYA 3M1SA 1M52A 3BI6A 2CGWA 2HWOA 3FAAA 4BFMA 4AQCA 2YN8A 2HWPA 2Z02A 2XH5A 3ATTA 4FT7A 4EHEA 2PL0A 4XCUA 1KV1A 2QU6A 4IIRA 4YNEA 4D58A 3G9NA 1Q3DA 2VGPA 4ORKA 1SNXA 5CU0A 5I9ZA 3CKWA 3ZZEA 5M4IA 2XIYA 4WA9A 5BPYA 5BV3A 4JRNA 1CKIA 4FTLA 4V0GB 3OP5A 1PXLA 4FL3A 2HY81 4I93A 4S34A 2C3JA 4O2ZA 3ZUUA 2UW6A 4C3PA 4RX7A 4ZAUA 3QQFA 4MBJA 4TWCA 4X2KA 4ZEGA 2QURA 5CSHA 2FA2A 4IWDA 1W98A 3Q9WA 2XJ0A 5DLSA 4F65A 1WBPA 2O8YA 3R1SA 3QALE 2JDVA 4RPVA 5LVPA 5IEVA 4GH2A 5KZ0A 4DH8A 3SW4A 2J7TA 2XEYA 4I5PA 3KF7A 3SQQA 2YJSA 4EH6A 4FNYA 2CNQA 2H96A 5IA3A 2OJ9A 4HPTE 1PRYA 1IA9A 4FSYA 4YBKA 1G3NA 4I92A 1Z5MA 2X7OA 3FYKX 3QQUA 4KIKA 3R7IA 4E4MA 5H2UA 3WI6A 3R8UA 2FB8A 1RJBA 2X0PA 4FG7A 4GL9A 1W8CA 2WPAA 1DAYA 3R1QA 2UZEA 4FVRA 4JG8A 2Q0NA 3ODYX 4RJ8A 3KK8A 2X8IA 3EQGA 3UG1A 1YXSA 4R7IA 3GCSA 3TJCA 2X7FA 3C4FA 3Q53A 3K5VA 4ANQA 3HV5A 3LIJA 4I5CA 5D41A 3E7VA 3B2TA 4FIHA 1W84A 3Q9ZA 4TT7A 5E91A 4DTBA 3L9MA 1KOBA 3AC1A 4IZ5A 4E7WA 4QMXA 3F88A 3OZ6A 5LOHA 4DA5A 2XRUA 4UBAA 1YOMA 5TT7A 4JRVA 4KIKB 1VZOA 4D2VA 5J5TA 4FTUA 3JPVA 2A0CX 1TQIA 3VS7A 3TTJA 2UZOA 4YTCA 2XM8A 2BROA 4RWIA 4DFZE 2BHHA 2OJFE 3GEQA 1BI8A 3CE3A 3BYOA 3RMFA 1ZYJA 4BI1A 4IZAA 1GZOA 3PRIA 4ZTRA 4JQ7A 1ZRZA 4D2TA 4PL3A 3BX5A 5KMJA 5CENA 4UB7A 3UYTA 1OUKA 2XK7A 2QOIA 4NW5A 4QYHA 5CU2A 3W33A 1O6LA 5JRQA 5C27A 3KMMA 4ZSEA 3VUGA 3WBLA 4YGAA 3KXZA 4BTJA 5KKRC 1Q99A 4RVLA 1SM2A 5FRIA 3C13A 3BCEA 2GNIA 4C58A 4YURA 3D5XA 4Y73A 4JDKA 5JRSA 1P2AA 4FT3A 1Q97A 5J5SA 3BU3A 2ZMDA 3QRJA 2IW6A 3ZO1A 4CLIA 1YXUA 3ORIA 4PDYA 4EK4A 3F5UA 2Y4IB 4FNZA 5DRDA 1QPJA 1VEBA 5DA3A 3D2KA 5E90A 2PVJA 3NGAA 4NK9A 4EHZA 2JBPA 1R0PA 3I60A 3OUKA 5HG8A 5AP7A 5B0XA 4ALWA 5AUZA 2OIBA 1ZYDA 2J5EA 1A06A 3KMUA 2H8HA 3RWPA 3ENMA 3CBLA 5HNGA 4A4XA 2PPQA 3HEGA 1JBPE 1YVJA 3BKBA 2VTOA 4BDFA 4DLIA 4R78A 3WF6A 3MI9A 3QFVA 3FMMA 4WUNA 4E5AX 3DKGA 2PWLA 5C26A 3NDMA 3K5UA 4P5ZA 5EK7A 4YJTA 4GS6A 3RVGA 3E3PA 4BI0A 3NUNA 2PSQA 3TXOA 5CU6A 3FMHA 4RJ5A 3TT0A 3PZEA 4E5BA 4M12A 3BGPA 2JDOA 2IO6A 3VRZA 4XOZA 3CQEA 4D1ZA 4ZLOA 3AQVA 3Q96A 4FTKA 4EORA 3PFYA 4BBEA 4DFUA 2WAJA 1ZAOA 4L3PA 4S32A 2ITZA 5HZNA 3E3BX 1Y8GA 3UC3A 3GQLA 4N57A 4FTIA 4PDSA 3KRLA 4C2VA 5EYDA 4BDDA 5IA4A 3F3VA 4HYHA 4XG9A 5ANKA 2UW7A 2YM8A 1P4OA 1RE8A 2QVSE 5DPVA 5EOLA 4O0XA 2HXQA 2XS0A 4HCTA 2XK6A 3ZS5A 2X4ZA 3DAEA 4APCA 1NA7A 4M8TA 4IB1A 5GIPE 3FMKA 2RF9A 3PJ3A 4TYHA 1UVRA 3W0MA 1SNUA 3ZM9A 4FL1A 4O7RA 3NFGB 2WOUA 2R4BA 3BEGA 3BEAA 3JUHA 1OB3A 3MSSA 4FV6A 4J7BA 3THBA 4FKRA 1DI8A 3PXFA 4C8BA 3W1FA 4LGHA 4DFYA 1LEWA 2WD1A 5DR9A 3TEIA 4UMPA 1OGYA 4CD0A 4UYAA 3D5WA 2HZ4A 1P5EA 4QMLA 4G3EA 4ANSA 3KVXA 2P3GX 4FEQA 4EH7A 5JGBA