4R7IA

Crystal structure of fms kinase domain with a small molecular inhibitor, gleevec
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
302
structure length
290
Chain Sequence
TQLPYNEKWEFPRNNLQFGKTLGAGAFGKVVEATAFGLGKEDAVLKVAVKMLKSTAHADEKEALMSELKIMSHLGQHENIVNLLGACTHGGPVLVITEYCTYGDLLNFLRRKAEAMLGPSLSGRPLELRDLLHFSSQVAQGMAFLASKNCIHRDVAARNVLLTNGHVAKIGDFGLARDIMNDSNYIVKGNARLPVKWMAPESIFDSVYTVQSDVWSYGILLWEIFSLGLNPYPGILVNSKFYKLVKDGYQMAQPAFAPKNIYSIMQACWALEPTHRPTFQQITSFLQEQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords Macrophage colony-stimulating factor 1 receptor
publication title Structure-Guided Blockade of CSF1R Kinase in Tenosynovial Giant-Cell Tumor.
pubmed doi rcsb
source organism Homo sapiens
total genus 95
structure length 290
sequence length 302
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2014-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4r7iA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4r7iA01
5L2SA 5C8MA 3U8WA 5HIBA 2BIYA 4X2FA 3RM6A 4JRVA 3H0YA 2VWYA 3RK9A 3SC1A 3F2RA 5BYLA 3NYOA 5HGIA 5FM2A 4FE2A 2YCRA 3PJ3A 2A1AB 4KAOA 3G5DA 2YFXA 2ITXA 5BYZA 1G5SA 3KRRA 4IWQA 5JT2A 3ORXA 3BWJA 1WVWA 4ZEGA 5D10A 2FSTX 5L2IA 5HO6A 2BRBA 4HYIA 4AN9A 3SGCA 4QMLA 5AR4A 4B4LA 5C4KA 3LFEA 5CAQA 3M42A 3D5XA 3QZGA 5LVMA 3QTRA 3KC3A 3OCSA 4L44A 3CR0A 4ZSEA 5LVLA 4QPMA 3ZCLA 2ITZA 2B0QA 5FD2A 3JUHA 2VO7A 2W0JA 5CAVA 5CF6A 2RIOA 3P86A 4EH7A 3TUCA 4X2GA 4AF3A 2ETRA 4EUUA 3OTVA 2RSVA 2R0UA 5EYMA 4C2VA 4AE6A 5I9YA 1KE7A 2CGXA 1K3AA 3Q4CA 5J9YA 4GL9A 1JAMA 3GU4A 4BDAA 3GI3A 2AUHA 1OMWA 4EJ7A 3NEWA 3ZS5A 2W1HA 5KBRA 4X3JA 4YU2A 1JSTA 2HZNA 4EEVA 4FVPA 4IAYA 4RWIA 1GZNA 1YHVA 5E7RA 4IX6A 3ZOSA 5L6OA 2OLCA 2WOTA 4UXQA 1YHSA 5FP6A 3IK3A 3ZFMA 5IQCA 3W2RA 2UZUE 3F2AA 3V8WA 4TY1A 2VD5A 1K2PA 2XKEA 4M13A 3MVMA 5LVPA 1CKIA 5HCYA 3C4WA 1JWHA 4Y5QA 1QPDA 4OUCA 2Z2WA 3KXXA 1B38A 2WQOA 3QHWA 2ITPA 4BCHA 4E3CA 5BX0A 2R3GA 3TKUA 3GOKA 3LFNA 1H4LA 3PIZA 2J0IA 4FG7A 3AMAA 4GK3A 1Q62A 2JDTA 5HI2A 3LM0A 5CWZA 4RQKA 3A60A 4D9TA 4ZSGA 4DFXE 4AFEA 3IONA 3WIKA 4BYIA 5CX9A 1NVQA 1OBDA 4F64A 2R3KA 5L8KA 4EBVA 3KULB 4FYNA 4PL3A 3WE4A 4YURA 3FEGA 4FKRA 5E90A 5T68A 3TI1A 3DA6A 3R00A 3OEZA 2UZDA 4FIIA 3FPQA 3QQJA 2HZ0A 5DLSA 3MH1A 3VS2A 5HO7A 5LMKA 3CTQA 4YC8A 3RVGA 2Y4PA 5JK3A 3ZRKA 4BWPA 3FLQA 5KMJA 4LGHA 5EW3A 1YI4A 3ZSHA 4DH5A 3G15A 3DB6A 3OZ6A 4L42A 4E1ZA 4JLCA 4AOJA 4W4YA 3QZFA 3P78A 2Z7QA 2I0VA 5CY3A 5A4QA 2BTRA 2E2BA 4ZTHA 5J95A 5GIOE 4GCJA 4UB7A 4Z3VA 5BVNA 2PMIA 4MXAA 4QP9A 4L7SA 2WTJA 3DQWA 3VS1A 1S9JA 5CT0A 3VW6A 3DTWA 4W4VA 4C3FA 3HUCA 1UKIA 3HDNA 3D2KA 3T8OA 3R02A 4HNFA 5CYIA 4FNYA 4D9UA 3QTXA 5LCKA 5K0XA 4GYIA 5H8EA 1KE5A 2ETKA 2ZM3A 5AV3A 5AV4A 1NA7A 2XCHA 3ORNA 4WG5A 4GU9A 1ATPE 1PKGA 3EQGA 3A62A 5HBHA 3KXMA 3BEAA 4FTTA 4N4SA 4YLKA 1DAWA 3FMJA 3RNIA 2PULA 5AV0A 4H3QA 3E7OA 3I1AA 4TNDA 4QPAA 3ROYA 3K5VA 4RLKA 4RIWB 4FSTA 5HD7A 3R8VA 5KKRB 3IW6A 3VUHA 4MYGA 1HCLA 4BI1A 4MK0A 3U87A 4BCMA 2RL5A 2WEVA 4L52A 1Y8GA 4PMMA 5GJGA 5DWRA 4YZ9A 4BDFA 4GEOA 4TNBA 3C0IA 4FUXA 2QKWB 4EJNA 5I4NA 2Y4IB 5CSPA 2XJ1A 3Q5ZA 1XR1A 1W98A 4DH8A 3PXKA 1QPCA 3ALOA 3H3CA 3CPBA 2XIRA 1XH6A 1O6LA 2W05A 5CF5A 2ITVA 2OZOA 1KE6A 2YABA 4LYNA 1REJA 4D2SA 3H30A 3SDJA 2IVTA 5IQAA 3NYXA 4J71A 2UW5A 3PPZA 3QUEA 2G9XA 3MVLA 1APME 2BAJA 1IA8A 4QP6A 5EYKA 3BYMA 4BCJA 4YGAA 3FI2A 5EM5A 1P4OA 4DT9A 4GW8A 4AGDA 3EQIA 3MS9A 1OL6A 3FZPA 4E6QA 2E9OA 5HLPA 3B8RA 1GZKA 4BDHA 5FWKK 5E8YA 2W1IA 2W1CA 4BGHA 1Y6BA 1W83A 3BCEA 4ZTQA 4U5JA 5CVFA 4HW7A 4BCFA 1NT2A 3ZO3A 3TNWA 2CDZA 4AZTA 1IAJA 1XHAA 2PVHA 4LRJA 4DTAA 4HPTE 4I6FA 3IDBA 3Q6UA 4QMXA 5CI6A 1M2QA 3CLYA 5DI1A 1H25A 1Q41A 1VYWA 3QFVA 3UOLA 4Z55A 3O51A 3PSDA 2LAVA 4GVJA 2YCSA 3NZ0A 5DRBA 4U6RA 1Z9XA 3HVCA 2VX1A 5LCJA 5IF1A 4C59A 5HVJA 4R5YA 2PVJA 4F09A 2R3RA 4K0YA 3ETAA 4NUSA 4EH4A 2WQMA 5AAEA 4FKJA 3O2MA 3DK6A 2ERKA 2IVVA 4FNWA 3HUBA 4ERWA 2WMRA 1MRYA 4Q5EA 4DEAA 4I93A 4ALVA 4XH6A 5HG8A 4W8EA 5HOAA 3NIZA 5FEEA 4R78A 4OTIA 4B9DA 5C26A 1OL1A 4EUTA 2IN6A 4RC3A 4BDCA 3U6HA 2BAQA 3LW0A 4FUYA 4HYSA 4IAKA 2ERZE 4U45A 4A9UA 3NMUF 2P3GX 3E93A 2R3LA 4M14A 1H0WA 5F4NA 3NDMA 4FZ7A 4XLIA 2GQGA 4NJDA 3NUSA 3GU6A 4EWHA 3KGAA 2VZ6A 3HAMA 5FDPA 2Y0AA 3IOPA 4O6EA 3U51A 4BCNA 2GS2A 5FP5A 4DGGA 5LQFA 3QYZA 2UZBA 3QUPA 4PL4A 4Z7HA 4FKTA 2VTHA 2QOCA 2OJGA 3OW4A 3F69A 3CTJA 4QO9A 4PX6A 2CNVA 2C6DA 4MQ2A 2WXVA 4L68A 3GB2A 3EQDA 3QALE 4HCTA 4M67A 3DV3A 4ACMA 3RK5A 1P5EA 3LJ1A 4IMYA 3QRTA 3TUDA 4IBMA 2HZIA 4NT4A 2QI8A 2FVDA 3ORLA 4GG7A 4OW8A 5IA5A 4BGQA 4M12A 4DG2E 2PWLA 4M15A 5FG8A 4KA3A 5BMMA 3UZPA 3WF5A 5CXHA 2Y9QA 2BFYA 2W96B 3A4PA 4WG3A 5CU4A 2XIYA 2CJMA 4BC6A 5AUUA 2WMSA 2XYUA 4CFWA 2SRCA 2QOOA 3QQLA 5H3QA 3FQHA 4C4FA 4BCGA 4XEYA 2JAVA 2VAGA 3QCYA 1DI8A 4JXFA 5D11A 3O17A 4BYJA 3KRJA 3TACA 3V5TA 4XG3A 1U4DA 3CCNA 4FVRA 3PWYA 4QMSA 5HG5A 2E9PA 1YXXA 4RJ6A 4D2TA 1UU8A 3HRBA 4F6SA 4F70A 4QTAA 5JZNA 3R8PA 4CYIA 3V8TA 4ZJJA 4AWIA 3FXWA 4G3FA 2ZV2A 3QTQA 4KBAA 4IM2A 4YMJA 4A4XA 1WVXA 1BUHA 2QONA 4O2PA 4D4VA 2R9SA 2VRXA 4GK4A 4QP1A 4ZY5A 1UWJA 3RINA 4S33A 2XNBA 1ZZ2A 3UG1A 5ETIA 3S1HA 3EQCA 1WBSA 4HNIA 3TV4A 3I79A 5K5NA 4BCOA 3H10A 4BIBA 4U8ZA 4F65A 4KINA 4R3RA 4D4RA 2GHLA 4TL0A 3TNHA 5EK7A 4YBJA 3PP0A 3ORZA 4IZYA 2OXYA 4C36A 3GEQA 4M0ZA 4CV8A 3LCDA 5KMMA 3GCSA 2VWXA 3C4CA 3HMMA 3Q9XA 1LPUA 2F7ZE 3BU5A 4G17A 4G3DA 2GTNA 2ZYBA 3U4UA 5IQDA 1X8BA 3I0QA 4S31A 2XRUA 1G8SA 3UOHA 4YNEA 4FIJA 3R2BA 4HCVA 4RX7A 1FMOE 4YR8A 2IW6A 4O2ZA 4JL9A 5JGAA 4OLIA 3V5JA 4NIFA 4E20A 3DQXA 2X0GA 4RA5A 3ZYAA 3HZTA 4G1WA 4FZ6A 2Z02A 3E63A 3FMDA 4LGGA 4RFYA 2QLUA 4QYEA 3C13A 5HKMA 3COMA 4MNEB 4OR5A 3S00A 2EVAA 2OFUA 5ETFA 4PTGA 2XIZA 2WHBA 4F9CA 3MYGA 3L9PA 4YO6A 3A99A 3JR1A 2W1ZA 4YJNA 2B9IA 2W4OA 4FL1A 4FEVA 5CS6A 4X2JA 4BFMA 2CLQA 4L6QA 4XBRA 1XWSA 3PJ2A 4L01A 3OBGA 3ODYX 3NGAA 5CEOA 5J1VA 4X0MA 2GNFA 5HU9A 4JQEA 4L3JA 3ZC5A 5L4QA 3DAJA 4GT4A 5AIRA 3RK7A 4PPBA 4D2WA 2W7XA 3L9NA 4QTBA 4OAVB 2JIUA 2VO3A 2B1PA 2HELA 1Y57A 2F7EE 2W5AA 1Q3DA 4O22A 2XUUA 3EFLA 3K3JA 2W06A 3LJ0A 4O0RA 1BLXA 3HYHA 4XS2A 4JBPA 1H1PA 4D2VA 3N4UA 4YJOA 2J90A 2ZM4A 5BVFA 5AX9A 1OKZA 4ITHA 4X21A 4F0GA 3RPSA 4NL0A 3PA4A 3NPCA 4EOKA 3QA0A 1ZLTA 2CMWA 3RPRA 4ZTMA 3CSVA 3LMIA 3DNDA 4PDPA 4FMQA 3LAUA 4IVBA 4EBWA 4LUDA 3FYKX 3GCQA 4KD1A 4LRMA 3VW8A 4JIAA 3FQEA 1WFCA 3OWLA 3ZRMA 4O7RA 1YQJA 4KSQA 4F9BA 5DOSA 5CF8A 3I60A 4P7EA 1QPJA 1PY5A 3IPHA 4QP2A 4WIHA 3DKOA 2DQ7X 2XMYA 3FZOA 5IUIA 4ANLA 2ESMA 2QG5A 1YI6A 3JPVA 5IZFA 3OEFX 3ROCA 3GC9A 3ZLWA 2OJJA 2I1MA 2LGCA 1V0PA 1QPEA 4J52A 3R0TA 3LQ8A 2J6MA 3P08A 4QMMA 3QRIA 4X6RA 1ERKA 4DEIA 4QMWA 5M07A 5AP0A 4U0IA 3ZLYA 4GSBA 3S2PA 3AXWA 3LXKA 1W82A 2YIYA 5CU3A 3TNPC 4YZBA 2HIWA 3FXZA 3C5UA 4CTCA 3NUYA 1H1QA 2O8YA 3I7CA 1GIJA 2VX3A 4M84A 4NTSA 2OIQA 5AP4A 1XH8A 4E5WA 3V6SA 5CLPA 4WUNA 2FA2A 3BGPA 4MCVA 1J1CA 4XYFA 4HVHA 5E4HA 1VR2A 3FC2A 4IACA 1UNLA 2JBPA 3HP5A 4FSMA 5GIPE 2WZJA 4L53A 5E8UA 5FTGA 5HE1A 2VTJA 1BX6A 1O6YA 3EN9A 1LP4A 5EYCA 4FKOA 4FTKA 4NW6A 4XV9A 4MVFA 3OWKA 3F82A 4E6CA 4EC9A 2DUVA 3KN6A 3VWAA 1OUYA 3TZMA 3PUPA 4CFMA 3IDCA 2BDWA 4C35A 2QVSE 1XH5A 4FTOA 4I6BA 4BCQA 4C37A 1XH7A 4MBIA 3EQHA 3MIAA 5J87A 5H2UA 4ZIMA 3SXSA 5LMKC 3BU6A 1A48A 4W4WA 2J5FA 4N6ZA 3C4ZA 3FI4A 3PTGA 4FTCA 4BHZA 5EW9A 1XJDA 2BALA 4G3GA 4MHAA 4YJUA 4EHGA 4OTDA 4GT5A 2PU8A 1R78A 2B7AA 3VHKA 4BCKA 4O7ZA 1REKA 3IG7A 5TE0A 3QTSA 4F7SA 3QU0A 4UWCA 4PWNA 2C3KA 3OCGA 3HMIA 3HV5A 1OPLA 1ZRZA 3OCTA 5DPVA 3KCKA 1SMHA 4Y8DA 4U44A 2GU8A 3PJ1A 4BGGA 2XM9A 4IB3A 4RZWA 2ZMCA 2QU5A 4NKSA 4YZDA 3UTOA 3VUGA 1PKDA 4ZTSA 2GSFA 3FLSA 4XUFA 4DGMA 4H1JA 3OCBA 4CZTA 4CV9A 4FTJA 2VV9A 2QNJA 3ZSGA 3ZC6A 2PZYA 2BMCA 3QQKA 4M69A 2R3PA 2JKOA 2JLDA 3UOKA 4BBMA 2W5HA 3TDVA 5JFXA 1K9AA 3SXFA 2GNJA 4FV2A 2C1AA 4DA5A 3WZJA 3R7UA 4JDHA 2YDIA 3LFDA 4JBVA 3VJOA 5HTCA 3AG9A 4FTNA 4V05A 3H4JA 4O7LA 3DBFA 1OI9A 2HYYA 4E73A 5KKRC 3FUPA 4HGTA 3A7JA 4HZSA 5KMKA 1E1XA 1RDQE 4TYJA 2XNEA 2C6EA 3KA0A 3OOMA 1MUOA 3BYVA 4FGBA 4CFUA 4I1ZA 4YSJA 4M0YA 2Y4IC 3QCSA 3G90X 2ZDTA 5EW8A 3ZFYA 5M4FA 4FSRA 4BCIA 5D12A 2XRWA 5EKNA 3DBCA 3GOPA 3ULZA 3ATSA 3SRVA 3NAXA 3NW5A 3QQGA 4IX4A 4UEUA 3LQ3A 1DS5A 3MFTA 3I5NA 3QRJA 4JQ8A 4U43A 4CT1A 4GUBA 2UZOA 1YXSA 2G2HA 4I20A 4QMQA 5AUTA 3ATTA 2W9FB 3G33A 1H1WA 1OVEA 4BL1A 3E88A 2C6IA 5JH6A 1YW2A 3DZOA 1E9HA 4TYHA 5IEXA 5IISA 3C0HA 3K54A 4W9XA 3UIMA 2VWVA 4FR4A 3VQHA 3NCGA 3EN4A 1Q61A 4FNXA 4YTCA 3W8QA 4RLLA 5HCXA 5L2WA 4GV1A 4O81A 1V0BA 3WF6A 1GZ8A 3QL8A 4Q9ZA 3F7ZA 4UALA 3R22A 3MH2A 1J91A 2QQ7A 4ZY4A 2WMTA 3TV7A 3HNGA 4AGWA 4QP7A 3NX8A 3SA0A 5KMNA 1ZARA 5AV1A 5JRSA 2V7AA 2VTSA 3BPRA 4YNOA 1FGKA 5GZ8A 2OK1A 5HNBA 4HVGA 4I3ZA 4N57A 4CFFA 1Q8WA 4PF4A 4BB4A 3MVHA 3OC1A 1Q8TA 2QKRA 4G5PA 1W84A 4E4LA 2VWZA 4IE9A 2JDOA 2X9FA 4JG8A 4A9RA 1JSVA 2JKQA 3IW8A 4BDJA 1CKJA 2UW3A 5IDNA 4KB8A 5ANOA 2YM7A 5FTOA 4DFBA 4CNHA 4KS7A 5LMAA 4V0GB 3VUKA 3T9TA 5IQBA 4CKJA 1RJBA 3EMGA 4M66A 4DH3A 4ZTNA 1XH4A 2BIKB 1PMUA 3ZHPC 1FVVA 4O7TA 3RKBA 5B2MA 3FHIA 4Q5HA 3OOGA 4HVSA 2FYSA 5A4LA 4UY9A 4YP8A 2NRYA 3RWQA 2YJSA 3ORPA 3A7FA 4D0WA 2ITNA 1H24A 3E7VA 1YDRE 3ANQA 3CE3A 4OT6A 4DITA 4FEWA 4EORA 5IU2A 1KOAA 2YZLA 3ZDIA 3IECA 1YKRA 1ZYSA 4FA2A 2UZNA 5JQ5A 5BUIA 4ZXTA 5CEMA 1GAGA 3MH0A 2I0YA 2JIIA 3H9RA 3KMUA 4ALUA 5BUJA 4F9YA 3OFMA 5I9XA 1IRKA 3RCJA 3P9JA 3R01A 4H58A 2QOFA 4WKQA 4FSUA 4FT5A 1FINA 1XH9A 3EWHA 5JRQA 4GRBA 3PSCA 5J1WA 2C0TA 1OITA 1PXMA 2Y8OA 4XRLA 2OJ9A 5M51A 3KL8A 2XB7A 1M17A 3DBEA 2X4FA 3FZRA 4OTHA 4UYAA 4ZTRA 4IAZA 3UO5A 4TN6A 5CZHA 4IWPA 4Y72A 3D14A 1H26A 1YWNA 3MFRA 1U5RA 3CJFA 4NZWB 2GQSA 2AC5A 5TOZA 5KHXA 2X39A 4LG4A 3QX2A 3LZBA 2YLEA 3BV2A 3QRKA 2A19B 4FKGA 2BTSA 3I5ZA 4MF0A 4QTDA 4U80A 3DU8A 3SX9A 3UP7A 4AW2A 3UQCA 3QUDA 4Y83A 4EK8A 1CTPE 4FTLA 4IADA 4KIQA 4EZ7A 4EYMA 4IH8A 3QTZA 3FLWA 4C57A 1J1BA 2R3FA 3CGFA 2ZMDA 4Q9SA 4IAIA 3UE4A 2PTKA 4G3EA 3W2CA 4D5HA 4ITJA 4LOPA 4XV3A 5IH4A 2UUEA 3DB8A 3PZHA 2W17A 4WNMA 4IHPA 1H1RA 4RC2A 4G16A 4BCPA 2IVUA 1BL6A 3BQRA 4O91A 4QOXA 3ZXZA 4CCBA 4ASEA 5CAPA 4AOIA 5G1XA 1DI9A 1R3CA 2C0OA 2PVFA 3PJ8A 3V04A 2BHEA 5K4JA 2W4KA 3QD4A 5HEZA 5HLWA 2O5KA 3CJGA 3M11A 4UBAA 3V8SA 4CSVA 3GCVA 4HOKA 2IW9A 4U40A 4C33A 4FG9A 4FSQA 4IVCA 1OGUA 5KMOA 3O96A 3QA8A 3VS4A 5CSVA 2UV2A 3DFCB 3LIJA 2YEXA 1QCFA 2OF4A 4FK6A 3RJCA 3U9NA 2OJFE 2IZUA 5M09A 2BZJA 1A06A 5B7VA 4O0YA 4IB5A 4CRLA 4ENYA 1JKTA 4ZS4A 1O9UA 3ALNA 3MWUA 3UP2A 5M4UA 4IQ6A 4O38A 3R1YA 2J0LA 3BWFA 4EH3A 3C50A 1HCKA 4JG6A 1W0XC 3PSBA 5FQDC 4BICA 1YOMA 3WZKA 4RRVA 3FYJX 5ANEA 4GKIA 3K5UA 1U5QA 2WIPA 4OT5A 1M14A 3DDPA 4WO5A 4Y73A 2XK9A 1M52A 2GNGA 2XS0A 4OTQA 3JS2A 4YJRA 2WB8A 4QD6A 1KE8A 4YJSA 4BY9E 4U97A 1OKYA 4RWKA 4TW9A 4WBBB 4Y95A 5CVGA 4FEXA 2C4GA 4JT3A 2WOUA 5CNNA 2PE2A 3E92A 4QNYA 4MX9A 3D94A 5HTBA 4FV0A 4X6QC 3VJNA 1ZOGA 4IAAA 5F20A 4P2KA 4IJ9A 5LVOA 5GINE 2V22A 4FSYA 3PIYA 4WOVA 3KY2A 5D7AA 2WAJA 2PZIA 5AUWA 2Q83A 4M7IA 2JC6A 5F1ZA 4EH6A 4ORKA 3ZEPA 1IR3A 4M8TA 4K1BA 2CKEA 2JFMA 2ITWA 3BGZA 2RKUA 1R39A 4CD0A 1GIHA 2YJRA 4DHFA 4IZ5A 3VBTA 2IG7A 1GZOA 4GUEA 2XM8A 4C4EA 4MEDA 3PFQA 4JIKA 2X81A 3VUTA 3FPMA 3AC8A 4P5QA 3TNQB 3BHYA 3HKOA 3FMKA 1H08A 4HJOA 3DLSA 2A2AA 3QZHA 3KULA 4QMUA 5EQYA 3IQ7A 3KVXA 2WU7A 3O8UA 3Q6WA 3QYWA 4RJ3A 4BTKA 3FE3A 4K8AA 4RWLA 4DEHA 4F6UA 3ACJA 3OXTA 5I9UA 3UNJA 5IEVA 3I6WA 1KSWA 5DE2A 1E1VA 4E5AX 2NO3A 2Q0NA 2J5EA 3DAKA 3OP5A 4GG5A 4ZLYA 4C4IA 5A46A 4FV9A 4ZSJA 1FOTA 4IANA 1UU3A 2BRNA 4QQJA 4AXAA 4CLJA 5IMEA 3FMNA 3U54A 4QRCA 3HLLA 3GCUA 4IB1A 4G31A 4EH2A 5K4IA 3HA6A 4B99A 3CIKA 3D2IA 3CD3A 3D0EA 3BYUA 4FNZA 5BVWA 4ANMA 1OPJA 2GS6A 2UVZA 3HA8A 2VTAA 4IZAA 5HHWA 4C38A 3AGMA 3CKXA 3TJCA 3NW7A 2WMVA 4L00A 2GHGA 3HMNA 3KXGA 2WFYA 5ANKA 2P2IA 1PRYA 2ETMA 3PXQA 3Q4UA 1FBNA 3TTIA 3G9NA 3EYHA 3P23A 3PE1A 1NW1A 5J8IA 3V6RA 2PVYA 3R8UA 3ZUUA 4ZOGA 3U55A 4L45A 4DN5A 3BE2A 4RIWA 4TXCA 1MQBA 3O7LB 2CKPA 5DEYA 4XG2A 3D4QA 3GC8A 5HCZA 4FOCA 1HOWA 5AP1A 3OT8A 5EI2A 1KV1A 3AGLA 4JS8A 4U7ZA 1YWRA 4NW5A 3GXLA 2YM5A 5HE0A 4USDA 2RFEA 4D2RA 3N4TA 3M2WA 4DFUA 5DRDA 3E3BX 1SVGA 4ASZA 3HMOA 4BDKA 3OD6X 5E8WA 4PV0A 1J7IA 4XX9A 4EC8A 1I44A 1WCCA 2WTWA 3DJ5A 4G3CA 3NIEA 2G15A 3LOKA 4WG4A 3NS9A 5CEKA 5J5TA 3RP9A 3CGOA 4XNEA 2C5YA 4I0SA 2YIQA 5EYDA 2JDVA 3GC0A 3MPTA 4YBKA 2WQNA 1URWA 2CSNA 3Q9ZA 4K9YA 4LM5A 4RVMA 3DKFA 4KIOA 4H3PA 4CVAA 3H0ZA 3VAPA 1JPAA 5AR2A 3GP0A 5A4EA 3ORTA 2PUPA 2R0IA 4C3RA 4G9RA 4W9WA 3BHVA 4USFA 3FKOA 3W33A 5AAFA 3R9HA 4PPAA 2XCKA 3NVKI 2WMWA 2C3LA 4RVLA 5AUYA 4AE9A 4Z7GA 1UVRA 4TWOA 4WNOA 2R3JA 3PXRA 4ANNA 3TKHA 3Q5IA 3Q60A 4EL9A 4ZS0A 4NSTA 2C5XA 4DGOA 3COIA 1PMEA 5HZNA 4C34A 3QTIA 3TZ9A 3DDQA 4QMOA 5CVHA 4K33A 2BZIB 2B9HA 4NFNA 4DFYA 4L46A 4S32A 2OG8A 3MPAA 3PA5A 1MRVA 4IVDA 4XLVA 1OZ1A 4RJ8A 4XV1A 4CZYB 3OHTA 4FG8A 5HVYA 3TN8A 2P0CA 3W2SA 5FUTA 2XNOA 2J9MA 2UZEA 4CTBA 2X8EA 2Y7JA 4KUJA 3ACKA 3F2NA 4QQ5A 5CNOA 4IM3A 2X6DA 5M44A 2WEIA 4PMTA 3NWWA 3R7YA 4ASXA 5CT7A 3JXWA 2QR8A 3KB7A 4GMYA 3PDTA 2QC6A 5C9CA 5EI8A 4AW1A 5AUZA 4DFNA 3ZBFA 4TT7A 4IDVA 3OY3A 3VVHA 4QP4A 2J2IB 3BHTA 3HMPA 3TV6A 5AA9A 2J7TA 1NVRA 1KV2A 3UPXA 4AG8A 4CYJA 4F63A 3EHAA 5C8NA 4PY1A 4O1PA 1OECA 5M4CA 1GY3A 2ITQA 3GUBA 4TZRA 4ZMFA 5BVKA 4E4XA 4MAOA 2JBOA 2V0DA 4DE4A 3HP2A 4FSNA 3DGKA 3VC4A 2P4IA 2X6EA 5J9ZA 2QO9A 3FI3A 4FICA 4OBQA 3ZM4A 1ZOEA 3MPMA 2GPHA 3PXFA 3R7GA 2F49A 4DYMA 3NUPA 2I0EA 2X9EA 3SLSA 4ZJVA 5IG1A 4RBLA 4WA9A 2HY81 1SVEA 2R3HA 3WYYA 3LCTA 3FMLA 3EH9A 4BVUA 1S9IA 4A9TA 3RTPA 2CNQA 2F9GA 2QOHA 4FEQA 3EIDA 5DGZA 2W4JA 4O7YA 3VRYA 1YOJA 4BDEA 2CGVA 4AP7A 3LFAA 2RFNA 4DG3E 3WE8A 4F7NA 4YTHA 4MQ1A 1BYGA 4FEUA 4EOLA 4ZK5A 4DINA 3TJDA 1LEWA 2HZ4A 4PDSA 2XF0A 4EK5A 3S0OA 3WIGA 4YC6A 2G1TA 5CALA 1WBPA 3CP9A 3FWQA 3MY5A 1PMVA 5A4CA 3N4VA 4EONA 4NEUA 1NY3A 3FJQE 4UXLA 1W7HA 5TR6A 3RI1A 2PMOX 4RIXB 3DK7A 3RPOA 4C4JA 2BRGA 5IQGA 3KN5A 4HGLA 1XBAA 4PRJA 3FLZA 4QYGA 3F5XA 3KMMA 4RIXA 4O0XA 4EKLA 4EHZA 3VS5A 1F3MC 3CEKA 2JGZA 2GFSA 2ACXA 3RM7A 2C3JA 1IEPA 3ODZX 3R04A 4MXZA 5DT4A 1EH4A 3FSFA 2WIHA 3QXOA 2Z7SA 3C51A 4CLIA 4R7HA 5CSWA 1J7LA 5T6KA 4IWOA 2V7OA 4BTJA 3WF7A 2BKKA 3PG1A 5C1QB 4BKYA 4D2PA 4F99A 4MWHA 4YJTA 2JDSA 4XP2A 1ZY5A 2F4JA 2VTOA 3W2OA 4ASDA 2CKQA 3K2LA 1PW2A 3EZVA 3OWPA 3PVGA 5CU0A 4R77A 5E1EA 4IFCA 4GYGA 4I4FA 1WBOA 1OIRA 2QHNA 3UO4A 5A54A 5EKOA 2QG7A 4QPSA 4U41A 3UIBA 2B55A 2X7OA 3QZIA 4GIHA 3A7GA 3SOCA 4RQVA 3R8LA 4NM3A 4FV8A 5D7VA 3W2PA 3AC3A 4TWNA 3R9DA 1NVSA 3ZLXA 1U59A 4F1MA 4YC3A 3R71A 5B0XA 4XJ0A 5HIEA 2OXDA 2YISA 4ZSAA 4F7JA 5BNJA 2G2IA 2W5BA 3E5AA 2OICA 4KKEA 1YI3A 5BVEA 3RHKA 5M57A 4FTRA 1XO2B 4JAIA 5IUHA 5LMBA 4IEBA 5K3YA 4RIYB 5DIAA 1DM2A 1H27A 2QOLA 2UW4A 1H01A 2A4LA 5EOBA 3F3UA 3MB7A 3RPVA 4MNEA 2BVAA 1B39A 2B9JA 3IS5A 4ZZNA 1WMKA 3EOCA 3NAYA 5ANJA 3WI6A 3ZBXA 1FMKA 4EH5A 3R28A 3VNTA 1AGWA 4DT8A 4RGJA 3RNYA 2VNYA 3NLBA 4J8NA 4X3FB 3LPBA 3IOKA 1H28A 2YCFA 3UNKA 4JDJA 1SYKA 3DT1A 4C61A 4DTKA 3KEXA 3TIYA 4UYNA 3SVVA 2PVMA 3DS6A 4X3FA 2PPQA 2VTRA 3R7EA 4ACDA 3Q32A 5E8TA 4FSWA 2V55A 2UZLA 5L6PA 4RFMA 3WYXA 2CLXA 4FKWA 4NM0A 5A6NA 3ID6C 2EB3A 3PY0A 4E6AA 3MESA 4MF1A 4ITIA 4UN0C 4CMUA 4U3YA 4DEDA 5IA0A 4LQMA 1FPUA 2XNMA 1FVTA 3ZUVA 4CT2A 1MRUA 3QX4A 4J97A 5FEDA 1PXJA 4EQUA 3FKLA 3IW4A 2H9VA 5EH0A 2XK3A 3VN9A 4ZP5A 5BVOA 3NNUA 3QD2B 5BYYA 3UODA 2A27A 4HYHA 4LMUA 4ANQA 3UIXA 1TQPA 4H39A 3LFSA 2NNWB 3LM5A 5EM7A 4V04A 5AMNA 5AV2A 1BI8A 3PRIA 3UNZA 4YLJA 2QURA 2CGUA 4RMZA 5AUVA 3RZBA 3TXOA 4H36A 1SNUA 3DBQA 4EWQA 2GS7A 1JSUA 2VTIA 3HV7A 3ORMA 2W1FA 3IGGA 4JOAA 4DBXA 4LV8A 4EK6A 4XOYA 3KXNA 4BZDA 3KK9A 2ZV7A 5AX3A 4CQGA 1AQ1A 1OL5A 3FDNA 2PVLA 3LCKA 2BRHA 3PXYA 5E8VA 4GFGA 1OIQA 3F5GA 2XEYA 4U42A 2VWUA 3V5QA 3QWKA 3I81A 5TKDA 2QOIA 2WD1A 4MKCA 5TT7A 4OAUC 3FV8A 2VGOA 4A9SA 1I09A 1W8CA 4E6DA 3IW7A 4B7TA 4F7LA 4FV6A 5C01A 4GFMA 4XG7A 3DXQA 4R1YA 2O64A 3SKCA 3V01A 4RVTA 1OL2A 3EKKA 3OXIA 4P4CA 4WSQA 4O82A 4D1SA 3BKBA 5JKGA 4QMTA 2NRUA 2XVDA 1UNHA 3P7BA 4EOIA 2FSMX 3JY0A 5D1JA 3PG3A 4N0SA 2PVNA 1M2PA 4W8DA 3SD0A 4PTCA 2VN9A 4CFXA 4WNPA 4ZY6A 5D9HA 3JVRA 5FTQA 4AGCA 4D4SA 5HE3A 1Q8UA 2AYPA 4MBLA 5AP3A 5IQEA 4JAJA 1R0EA 5CEQA 3W1FA 1Q97A 4AOTA 4AS0A 3GENA 3PRFA 3PY3A 4FT3A 5AJQA 3DOGA 3QAME 4NM5A 3OT3A 1PXNA 4CMOA 4IZ7A 3QKKA 3FLYA 5DR9A 1PXIA 5J9LA 2C30A 3FAAA 2X2KA 3F3TA 3L8SA 3HRCA 4PQNA 3ENMA 4U3ZA 5DA3A 3REPA 4EYJA 2R3OA 3DBDA 2FSOX 3QD3A 4II5A 3IO7A 3BELA 3QC9A 5A6OA 4U81A 4YJPA 5A3XA 1H8FA 3DTCA 3UBDA 1Q3WA 3L9MA 5J5SA 3F66A 2RGPA 4FBXA 4KRCA 4OTRA 5GNKA 4Z16A 3GGFA 3AT2A 3R1NA 5AM6A 5HLNA 4G5JA 4CKRA 3AT4A 3VS6A 1UA2A 2P33A 1JKSA 5CQUA 4UWYA 2PE0A 3R73A 2JFLA 5BUEA 3DJ7A 4O96A 2JDRA 3PLSA 5KUPA 3CPCA 4RWJA 4RZVA 3OG7A 2OXXA 3SW4A 2EU9A 2VX0A 4D58A 5M08A 4NTTA 4XG8A 3QF9A 4F4PA 3VBYA 1GJOA 3QXPA 4HCUA 3V5PA 3UQFA 1L3RE 3FZ1A 4DFLA 4FKIA 3LE6A 5AR7A 4FTAA 3TKIA 3W16A 3GU5A 2UW8A 4FT9A 3E3PA 4XP0A 1AD5A 5FBNC 3WZUA 3OMVA 1BKXA 4FTQA 2PZPA 4I5CA 4Y85A 4E4MA 4ERKA 4P90A 5DH3A 2GCDA 2OZAB 2QO2A 5CENA 2YN8A 5AP6A 4BKJA 2XYNA 2XZSA 3VQUA 3QD0A 2RFDA 3BZ3A 2FUMA 3BEGA 4IWDA 4RJ5A 3EFWA 5F94A 3AD5A 4UMPA 2XEZA 3G2FA 3K3IA 3WF9A 3OROA 4PP9A 5IQHA 4N6YA 1M2RA 5EDRA 4AFJA 4YTIA 3ZLSA 4JDIA 5AAGA 2B4SB 5FXQA 5E1SA 1G8AA 1Q99A 3D83A 4JJRA 3UC4A 1P2AA 2C6KA 4FKLA 5JMSA 4HVIA 3KRXA 2ZV8A 3T3VA 4EH9A 2HXQA 2QO7A 3L8PA 4RA4A 3NUAA 3ITZA 4LL5A 3MJ2A 2WTKB 4QQCA 4BKZA 3ZONA 3ORIA 4DLJA 2YM4A 2OKRA 4I24A 4YZNA 3H9OA 5M56A 3R1SA 3D5VA 4PNIA 4QTEA 2RFSA 2OJIA 2O3PA 2GNLA 4L67A 4EQMA 3AMYA 2Y6OA 4N70A 4R3PA 2WTDA 4B8MA 4WBOA 3BE9A 5AR5A 4FKPA 4FIGA 3COKA 2VGPA 5FXRA 3BU3A 3VUMA 2J0JA 1Q24A 4QNAA 3UGCA 3T9IA 4BDBA 2GNHA 4FIEA 3AC2A 5CU2A 4FVQA 3HV3A 1BMKA 3OW3A 5IQFA 5IH5A 5IA2A 5HBEA 5BPYA 2QR7A 3LCSA 2O65A 1FGIA 5A9UA 2YA9A 4CG9A 5EM8A 4NM7A 5I3OA 2VTMA 5CEIA 5IA1A 1OPKA 2W9ZB 4OTWA 2YDJA 1IG1A 4D28A 2X1NA 4KWPA 2O63A 3O8TA 4LMNA 3LKMA 4YHJA 3PYYA 4C7TA 3NSZA 5C4LA 4TTHB 3BGQA 5ETAA 3VF9A 4AT4A 3LLTA 3DCVA 4QP3A 4DCEA 1XBCA 1KE9A 2ZV9A 3QWJA 3W8LA 1OM1A 3I6UA 2VNWA 3NNXA 4O21A 3ZO2A 4DEBA 4V0GA 3E8DA 3ZTXA 1WAKA 1PXOA 2WQEA 3UVQA 2IPXA 3ZUTA 3B2TA 4GH2A 3SW7A 2X2LA 2VWIA 4F1TA 2R7BA 4NWMA 5E8SA 3IGOA 4V01A 5ANDA 4AAAA 5HBJA 4G6OA 4J7BA 4OTGA 1OKVA 2PYWA 5IQIA 2I6LA 3QGYA 1FVRA 3MB6A 2CCIA 4IJPA 4MD8E 3UVRA 4FV4A 4HZRA 2PUIA 3VF8A 2EXMA 3FZTA 2GDOA 3DK3A 3FMEA 5HNIX 2ITYA 4O6LA 3WARA 1CSNA 4OBPA 2YZAA 2FO0A 4FKQA 4JI9A 5FLFA 2VTTA 4UV0A 3LJ2A 2YWVA 3PZEA 5CAOA 3BQCA 5AP2A 2IZTA 3D15A 4I0TA 4BIDA 3AC4A 3C0GA 2XNPA 4UWBA 3RZFA 4E8AA 3O0GA 2UVXA 1U54B 4U79A 2PSQA 4GJ2A 2V5QA 4HGSA 3O23A 3HRFA 5F95A 3PLAE 2C68A 4DC2A 4S30A 4F9WA 3ZZEA 3R30A 4FODA 4R6VA 1TVOA 4GJ3A 2QLQA 4UZDA 4IDTA 1STCE 4K2RA 3THBA 3UZTA 3MIYA 4I92A 2V62A 2WTCA 3NUNA 4QT1A 3UC3A 5FXSA 1JKKA 1YXTA 3RAIA 3F3VA 3MJ1A 4QP8A 2J4ZA 3KRWA 4KNBA 5L8JA 2ZAZA 2VWWA 4F0FA 2B54A 3AC5A 3KCFA 2QD9A 1ZYCA 4BN1A 4XP3A 4I22A 2JAMA 4FI1A 3BI6A 5LWNA 1O6KA 1TQIA 2W1EA 3MGYA 4M3QA 2JKMA 4C62A 4FZAB 3VS7A 4L9IA 3DY7A 4YTFA 1PJKA 2ZJWA 3ET7A 1V0OA 4MXCA 3VBWA 3VUDA 3G51A 3SAYA 3LCOA 3MTFA 4J8MA 3O8PA 4B0GA 1NXKA 4PL5A 3RAHA 3CQEA 3Q4TA 1PXLA 2ZVAA 4KIPA 4MD7E 4G2FA 3RWPA 2UZVA 2WMUA 5HTIA 4GS6A 4O0UA 5DHJA 1PF8A 4C02A 3MFSA 1KWPA 2R3QA 2PUUA 4JQ7A 4O7NA 5FGKA 1IA9A 4ZTLA 2XK6A 4BZOA 4KKGA 2FH9A 3NNWA 3B2WA 2XK8A 3MW1A 1PXPA 1YDTE 4ANBA 3A7IA 4DAWA 4XG4A 3LXNA 4IX5A 2H8HA 4APPA 3EZRA 4HGEA 3VS0A 3LQ5A 4PDYA 3D9VA 4O7SA 2IZRA 3NYVA 5DR6A 5A4TA 3NNVA 4C8BA 2JEDA 2RG6A 4B6LA 3ZEWA 4CEGA 2YDKA 5LWMA 1OKWA 4EOOA 2X4ZA 1KUTA 2EWAA 5AA8A 3POOA 2Z8CA 4YPSA 3ZH8A 4O7VA 5FM3A 2BRMA 4L8MA 3IW5A 3R1QA 4CFNA 1YVJA 1R0PA 1ZWSA 4UMTA 5GJDA 5C03A 4EQCA 2QHMA 5ANIA 3TG1A 4A7CA 4KSPA 4YZMA 5CEPA 1M7NA 3WZEA 4CG8A 3ZO1A 1H07A 2OBJA 3FMHA 4FZFB 4A4OA 3V5LA 5E91A 4UMRA 1Z57A 4J98A 3KKVA 4LGDA 4X3FC 2YHVA 4BWXA 2B53A 4FV7A 4FL3A 4BDDA 2J0MB 3F88A 1ZXEA 2J50A 4IC7A 3E62A 4WNKA 5K5XA 4O83A 1SVHA 3EQFA 4ZMEA 2C5VA 3LXPA 2OU7A 3GU7A 4ANOA 3NR9A 4UZHA 4BTFA 4K6ZA 4RJ7A 4KKHA 4O7WA 5AM7A 2W99B 2R3NA 5CU6A 3OS3A 3QQUA 2WTIA 3A4OX 5HD4A 3A8WA 4L43A 2G01A 4XG6A 1PXKA 3W10A 4D1ZA 4HVDA 3F5PA 2BILB 3BBWA 4I5PA 1SNXA 5HO8A 4TWPA 2UW6A 1KOBA 4RX9A 4AN3A 4NYEA 4O86A 3ZM9A 4JRNA 5FRIA 2HCKA 4BRXA 2KTYA 5EQPA 2QOQA 3ZXTA 4BR3A 3EFJA 4O1OA 3FSKA 4EI4A 3C4EA 4ARKA 2GQRA 5L2QA 4BDGA 2CNUA 2GTMA 4LI5A 3GC7A 1CMKE 3QTUA 3EJ1A 3P5KA 2C1BA 3R63A 2WGJA 2CKOA 4D55A 1Q4LA 3GQIA 4JBOA 2YLFA 3COHA 4P5ZA 4I0RA 4AT3A 4BF2A 2WPAA 3UMXA 2XKCA 3KK8A 1LEZA 2XIXA 3C1XA 5LARA 3HEGA 4FV1A 3AQVA 5FDXA 2VUWA 2R4BA 1QMZA 4GU6A 4FF8A 1ZOHA 2C6LA 4ZAUA 3Q3BA 3OWJA 4EK4A 4Z9LA 4BI2A 4R7IA 1TQMA 3HGKA 3Q2JA 4M68A 4ZJIA 3LVPA 3JY9A 1ZMVA 3C7QA 3AT3A 2R2PA 1YXVA 2YITA 3SG8A 2XKDA 4AN2A 3PVBA 5M06A 3VBVA 1F5QA 4TYIA 4AZWA 4DG0E 5JSMA 5EHYA 3BX5A 3ERKA 4E26A 4I5MA 3HX4A 5T3QA 1T45A 3Q9YA 1UKHA 3OF0A 2BKZA 3GQLA 1YDSE 5LOHA 3ZMMA 2Z7RA 4OBOA 1SZMA 3GBZA 5DT3A 1T46A 2F2CB 2EUFB 5HG9A 2DYLA 2QODA 4I23A 5JFSA 5AADA 4WUAA 3OUKA 5LXMA 3DJ6A 4XRJA 3TZ8A 2W1DA 2HY0A 4AA5A 4ALWA 4MNFA 5I5ZA 3P7CA 3CKWA 4YO4A 3UO6A 4H3BA 4IM0A 4AACA 1ZZLA 2UZTA 4PMPA 2HK5A 2XBJA 2HXLA 3O71A 4LUEA 5D41A 3G0FA 4FT7A 4BI0A 4DLIA 5EHOA 1YHWA 1VEBA 3HL7A 3IKAA 2E9VA 4D0XA 4R8QA 5KMLA 2VTPA 4S2ZA 5AIKA 4FKSA 2J0KA 3Q2MA 2XJ0A 5K9IA 3POZA 3CY2A 3QKMA 5FEQA 2OFVA 5M4IA 5J79A 3SOAA 1BI7A 2BCJA 2XKFA 3KF4A 4B8LA 3FI8A 2H34A 4BZNA 3LLAA 3KREA 2I7QA 3D7TB 3KXZA 3IDPA 3PY1A 3UJGA 4IX3A 4ACHA 4CZUA 4DBNA 2PZRA 4NCTA 5EG3A 2WTVA 3D7TA 4KABA 2VTQA 4NKAA 1H0VA 2BHHA 2YM8A 1WBNA 1Q8ZA 2PMNX 4D4YA 4WT6A 3EN6A 5TO8A 3FL4A 2YIXA 5HORA 4IB0A 3GFEA 4I21A 3R7IA 3TZ7A 4F0IA 5DYJA 2WELA 2IZSA 1Y91A 4AZFA 3OY1A 1H00A 3AC1A 3QBNA 3TM0A 3JYAA 3MA3A 1CDKA 1Y6AA 2FSLX 3OXZA 4TKSA 5HE2A 4DF3A 1UWHA 4WSYA 3EQBA 1BL7A 4W4XA 5DEWA 5G6VA 3FLNC 3R7VA 1H1SA 2GFCA 4IFGA 3VBQA 1Y8YA 4RC4A 5L2TA 4GIIA 3CBLA 3FY0A 4RIOA 2BR1A 5EFQA 4EZ3A 3W55A 3GT8A 1ZMUA 1UU7A 1LUFA 2ITOA 3LFFA 3MH3A 3QCXA 3Q96A 4XCUA 2ZM1A 4C0TA 4DFZE 2UW9A 3MN3A 1PHKA 3LHJA 4O27B 2EB2A 3V3VA 3LFCA 4O84A 4O0SA 1JQHA 1GNGA 3WBLA 3WOWA 5IEYA 4XG9A 4ZLOA 4EOQA 2OGVA 2HW7A 4E4NA 4AZEA 5J7HA 2C3IB 2BUJA 5HX8A 4A07A 3NVMB 2IVSA 4IXPA 1A9UA 2XJ2A 3L1SA 5CSXA 2WTKC 4K18A 3BIZA 3N51A 5HIDA 3UYTA 5IUGA 5JN2A 3BLQA 3LMHA 2C5OA 1SM2A 2XK7A 5EQEA 4MXYA 5L6WL 4L3PA 4EOMA 4I6QA 5CANA 3W32A 2CHLA 3GNIB 4FYOA 1PYEA 3R83A 5GJFA 4MXOA 4OGRA 5AEPA 4A06A 4ACCA 5ANGA 3UIUA 3Q52A 3CXWA 2ITTA 4L3LA 4X2NA 4E93A 3FKNA 4APCA 2OH4A 2XA4A 2GMXA 3C4XA 2OSCA 2WMXA 4Y46A 4DH7A 1GIIA 4PNKA 2EXEA 3AMBA 4U9AA 4F1OA 5IA3A 4KBKA 2R7IA 4AGUA 5KBQA 3VS3A 3KF7A 5E8ZA 1YRPA 1PYXA 5AP7A 4GT3A 1TKIA 3EN7A 2YACA 3A8XA 4YHTA 4JDKA 3QHRA 3RBWA 3F3WA 3PPJA 3UPZA 4C58A 4BIEA 5JFWA 3ULIA 4ONAA 3E8NA 3E8EA 2BROA 3F5UA 3QQHA 3G6GA 4AUAA 4OTFA 5DMZA 4DCAA 5FBOA 4RJ4A 3ZSIA 3F61A 3E64A 2EXCX 2WNTA 2WMBA 3G0EA 1P4FA 2X8DA 2IO6A 5HICA 4C4HA 2HWOA 3SQQA 4DGNA 4H05A 2WQBA 3CTHA 3MV5A 2REIA 4KRDA 3F7WA 4QMPA 4CMTA 3CQUA 4UMUA 5KNJA 4FKUA 4ZZOA 2UZWE 3NUUA 4C4GA 2WMQA 4J99A 4EOJA 3CC6A 2QCSA 5KZIA 4BDIA 2DS1A 4PMSA 2UW7A 3CQWA 3R7OA 5E9EA 2H96A 2F7XE 3PA3A 3FC1X 4I41A 5BMSA 4H1MA 4J53A 5CTPA 3SXRA 3C5IA 3KVWA 3BRBA 3FMMA 2PZ5A 5CASA 3HV6A 3VULA 4ZLZA 3CD8A 4FIFA 5EM6A 5H8BA 5LJJA 1YXUA 4I94A 5EDPA 3MI9A 5IH6A 4GVAA 4DTBA 3AD6A 2PVKA 4D1XA 2O0UA 5CAUA 3QTWA 4JR7A 5ACBC 5KCVA 2PY3A 4RIYA 3R8MA 3QC4A 4NIFB 1J3HA 4IVAA 1OB3A 2YM6A 4ANSA 3R9NA 5GZ9A 3DAEA 2ONLC 4AZVA 1QL6A 4O0VA 3SG9A 2WO6A 2I0HA 1UU9A 2HENA 2PE1A 2CPKE 4PP7A 4X7QA 3S95A 4K77A 3TDWA 5H8GA 3UYSA 3OBJA 4DEEA 4FTIA 4FSZA 2PHKA 4PPCA 4FK3A 4XBUA 2XH5A 4YZCA 4EZ5A 3C9WA 2ZB0A 2CCHA 4I6HA 3EYGA 1Q5KA 4QMYA 5DFPA 3MFUA 5KO1A 3TL8A 3RPYA 3DNEA 2BZKB 2H6DA 3D5WA 2R3IA 4TWCA 2BPMA 3AOXA 4YJVA 5B2LA 3FXXA 4JNWA 5HX6A 2GHMA 2NPQA 4RG0A 3FBVA 2C69A 5DR2A 3QQFA 3S4QA 2OO8X 2YAKA 4JX7A 4TPTA 3D7ZA 4UMQA 2OIBA 3TIZA 4BWKA 5IDPA 3DXNA 4PDOA 5C27A 1CKPA 4J95A 3CS9A 1IASA 2B9FA 2O2UA 3DFAA 1XKKA 3GU8A 3OTUA 4J96A 4LFIA 3S3IA 3QGWA 5AWMA 3NYNA 3W2QA 3C4FA 3VO3A 5GZAA 2JITA 5AR3A 3KU2A 2YAAA 3MSSA 3FY2A 5IA4A 4K11A 2IWIA 2ZB1A 2ZOQA 3EQRA 5J7BA 3MTLA 3BLRA 2NP8A 3MDYA 3U4WA 2BFXA 3VBXA 4E5BA 1ND4A 2WKMA 2OW3A 3PP1A 1WVYA 4JBQA 3RAKA 2HW6A 1DAYA 4QMZA 4BBEA 2HOGA 2J51A 4KBCA 3I4BA 1YOLA 4YHFA 5HESA 3ZRLA 4CCUA 3RALA 1J7UA 5BVDA 3GCPA 4KIKB 4MD9E 1L8TA 5BQ0A 3HV4A 3UZRA 4G6NA 3G6HA 4IIRA 3WILA 1WZYA 4KIKA 1XQZA 3ZU7A 4ZZMA 3QKLA 3H9FA 1RW8A 5M55A 3L8VA 3LXLA 4AX8A 1JLUE 3FHRA 2CGWA 1UV5A 1P14A 1Q8YA 5HNGA 5IKWA 3RAWA 3RHXA 5JEBA 5L3AA 4LRKA 3TEIA 3U6JA 4S34A 3P7AA 4AQCA 4R7BA 2R3MA 3DPKA 3VHEA 4A9YA 5IPJA 3UVPA 3PJCA 3B8QA 4FC0A 5CQWA 2YIRA 3BYOA 4AZSA 5HU3A 1CM8A 3LMGA 2GNIA 4A4LA 2Z60A 3I7BA 2QU6A 4AW0A 4NK9A 2ITUA 3SHEA 3SV0A 3TNIA 1UNGA 2C6TA 4TYEA 3F3ZA 2BZHB 4NH1A 4ACGA 3KXHA 4FL2A 3L9LA 3BHUA 2X7GA 3T3UA 3RGFA 3ZO4A 3OVVA 4E7WA 3QRUA 2UW0A 3DLZA 5C8KA 5KHWA 3TTJA 1Z5MA 3KFAA 1ZMWA 4GFOA 4I4EA 2YCQA 1VZOA 4IW0A 4Q2AA 1URCA 2RF9A 1JKLA 1FQ1B 3A7HA 5AUXA 5I0BA 5DT0A 2B52A 4GKHA 1JNKA 4WHZA 2VU3A 1MP8A 4EHEA 1YWVA 4AU8A 4JVGA 3A61A 4BTMA 3ENHA 3V5WA 3GFWA 5KMIA 1ZYDA 2OI4X 5HQ0A 4LOQA 4KS8A 4RVKA 5ETCA 5GHVA 3HECA 1WBVA 2IJMA 1OIYA 4RX8A 2OH0E 2PVRA 4JG7A 2VTLA 3W18A 2YM3A 5H9BA 4NJ3A 4UX9A 4WRGA 5HG7A 3RMFA 4NFMA 5I9ZA 3PXZA 5I3RA 2YERA 2P2HA 5LVNA 4QYFA 2I40A 3TT0A 4QMVA 2XNGA 2R64A 3MBLA 2OZAA 3PVUA 3R6XA 5JGDA 1RE8A 3HDMA 3E8CA 4M69B 4LV5A 2C5NA 3EN5A 5CI7A 2VO6A 4YLLA 4XMOA 3TUBA 5EDQA 4USEA 5L8LA 2WMAA 5ICPA 4FKVA 3EQPA 4ID7A 1VJYA 2CN5A 3P1AA 4HYUA 4ZSLA 3O7LD 4O0TA 2YWPA 4LOOA 3QLFA 4R1VA 4I5HA 4TYGA 5KE0A 4EOSA 1OIUA 4DH1A 2PK9A 4J1RA 4AW5A 5F9EA 4X2KA 5AR8A 4C3PA 3FQSA 4RPVA 2FGIA 4F6WA 3KRLA 3QCQA 4G6LA 1JOWB 5HVKA 4XV2A 2W1GA 4HPUE 2OIDA 3P4KA 5AP5A 3NUXA 4AA0A 4QQTA 4Y5HA 4FTMA 1M7QA 3R9OA 4FT0A 5JZJA 4MWIA 3WF8A 3SRVB 4FGRA 3KQ7A 1RQQA 3BV3A 3UQGA 1ZAOA 3II5A 3TCPA 3CY3A 3P79A 4RX5A 4CGAA 3GVUA 4FOBA 4XOZA 1OUKA 2E9UA 4FV3A 5I9VA 5CXZA 2C6MA 4BBFA 3Q04A 5EHLA 3M1SA 1ZY4A 1JBPE 2Y6MA 4FTUA 4FZDB 3BHHA 3MVJA 5DG5A 5E92A 4RSSA 5EOLA 1WBTA 3R8ZA 4QYHA 2VO0A 1PMNA 4DGLC 5JFVA 4TYHB 5AFVA 3ZDUA 2G2FA 2HAKA 4MBJA 4CKIA 3QLGA 4FV5A 4O0WA 4JX3A 3PVWA 3AD4A 4NCTC 4DEGA 4EK3A 3PPKA 5DN3A 2UVYA 4MTAA 3NRMA 3DKGA 2RG5A 3ZFXA 3KMWA 1V1KA 3JVSA 3PE2A 1GOLA 2A0CX 2Q0BA 3UOJA 2WU6A 1XBBA 4RT7A 4FX3A 5DNRA 3RCDA 4GK2A 5CZIA 4EH8A 5M53A 3EKNA 5CF4A 3R2YA 4F9AA 3D5UA 1IAHA 5KZ0A 4R3CA 3V51A 4D5KA 2F2UA 3DKCA 2X2MA 3A2CA 3EFKA 3MA6A 4JR3A 3WZDA 1JVPP 3LFQA 2XNNA 5K0KA 3VUIA 4G9CA 2CN8A 2XK4A 3BBTB 1G3NA 2HWPA 4QMNA 2PUNA 2XP2A 2VTNA 1ZYLA 3L8XA 5JQ8A 5ACKA 1OBGA 4CRSA 2JIVA 3PIXA 5EI6A 3R9RA 3FZSA 5KX8A 3F9NA 3UDBA 2Z7LA 2OWBA 3VRZA 3N9XA 3ELJA 5B2KA 2R5TA 2XIKA 5E8XA 1OL7A 3O50A 3Q4ZA 4AA4A 2BDJA 2X8IA 2E9NA 3DZQA 3G9LX 3NCZA 4QTCA 3P0MA 4NU1A 4YPDA 5DVRA 4M97A 3MY1A 4WRSA 3I0OA 2QOKA 3U6IA 3HAVA 1ZYJA 2C0IA 3UG2A 3BYSA 4BHNA 4CQEA 4YJQA 4CXAA 2YIWA 2F57A 2ZDUA 3ANRA 3BLHA 4IAFA 4QYYA 3TWJA 2AC3A 2PL0A 1B6CB 2DWBA 5CSHA 3OUNB 4YUQA 4R5SA 3UMWA 4TRLA 1U54A 1U46A 3VIDA 4PUZA 1WBWA 3EL7A 4LL0A 2KULA 3Q53A 4EOPA 2C6OA 4FIHA 4RFZA 3DXPA 2ONLA 5DBXA 3F6XA 2XBAA 3E87A 2BDFA 3U9CA 4XHKB 2FB8A 4YSMA 2BAKA 2QOBA 3ORKA 2VWBA 4G34A 4L7FA 3Q9WA 5I9WA 4MH7A 3LFBA 4MXXA 1LR4A 4C2WA 4CFVA 5ITAA 4IC8A 2JD5A 3ZZWA 4ENXA 5JGBA 3EB0A 4PTEA 5IMXA 2OF2A 2JKKA 4OTPA 1VYZA 3MY0A 4EHVA 3EL8A 5A14A 3PWDA 2IW8A 3NW6A 2C47A 1F0QA 1R1WA 4F08A 4AT5A 2X7FA 3R21A 1MQ4A 4WD5A 2P55A 2PMLX 5TF9A 3FL5A 4EKKA
chains in the Genus database with same CATH superfamily
5L2SA 5C8MA 3U8WA 5HIBA 3KIOC 2BIYA 4X2FA 3RM6A 4JRVA 3H0YA 2VWYA 3RK9A 3SC1A 3F2RA 5BYLA 3NYOA 5HGIA 5FM2A 4FE2A 2YCRA 3PJ3A 2A1AB 4KAOA 3G5DA 2YFXA 2ITXA 5BYZA 1G5SA 3KRRA 4IWQA 5JT2A 3ORXA 3BWJA 1WVWA 4ZEGA 5D10A 2FSTX 5L2IA 5HO6A 2BRBA 4HYIA 4AN9A 3SGCA 4QMLA 5AR4A 4B4LA 5C4KA 3LFEA 5CAQA 3M42A 3D5XA 3QZGA 5LVMA 3QTRA 3KC3A 3OCSA 4L44A 3CR0A 4ZSEA 5LVLA 4QPMA 3ZCLA 2ITZA 2B0QA 5FD2A 3JUHA 2VO7A 2W0JA 5CAVA 5CF6A 2RIOA 3P86A 4EH7A 3TUCA 4X2GA 4AF3A 2ETRA 4EUUA 3OTVA 2RSVA 2R0UA 5EYMA 4C2VA 4AE6A 5I9YA 1KE7A 2CGXA 1K3AA 3Q4CA 5J9YA 4GL9A 1JAMA 3GU4A 4BDAA 3GI3A 2AUHA 1OMWA 4EJ7A 3NEWA 3ZS5A 2W1HA 5KBRA 4X3JA 4YU2A 1JSTA 2HZNA 4EEVA 4FVPA 4IAYA 4RWIA 1GZNA 1YHVA 5E7RA 4IX6A 3ZOSA 5L6OA 2OLCA 2WOTA 4UXQA 1YHSA 5FP6A 3IK3A 3ZFMA 5IQCA 3W2RA 2UZUE 3F2AA 3V8WA 4TY1A 2VD5A 1K2PA 2XKEA 4M13A 3MVMA 5LVPA 1CKIA 5HCYA 3C4WA 1JWHA 4Y5QA 1QPDA 4OUCA 2XAOA 2Z2WA 3KXXA 1B38A 2WQOA 3QHWA 2ITPA 4BCHA 4E3CA 5BX0A 2R3GA 3TKUA 3GOKA 3LFNA 1H4LA 3PIZA 2J0IA 4FG7A 3AMAA 4GK3A 1Q62A 2JDTA 5HI2A 3LM0A 5CWZA 4RQKA 3A60A 4D9TA 4ZSGA 4DFXE 4AFEA 3IONA 3WIKA 4BYIA 5CX9A 1NVQA 1OBDA 4F64A 2R3KA 5L8KA 4EBVA 3KULB 4FYNA 4PL3A 3WE4A 4YURA 3FEGA 4FKRA 5E90A 5T68A 3TI1A 3DA6A 3R00A 3OEZA 2UZDA 4FIIA 3FPQA 3QQJA 2HZ0A 5DLSA 3MH1A 3VS2A 5HO7A 5LMKA 3CTQA 4YC8A 3RVGA 2Y4PA 5JK3A 3ZRKA 4BWPA 3FLQA 5KMJA 4LGHA 5EW3A 1YI4A 3ZSHA 4DH5A 3G15A 3DB6A 3OZ6A 4L42A 4E1ZA 4JLCA 4AOJA 4W4YA 3QZFA 3P78A 2Z7QA 2I0VA 5CY3A 5A4QA 2BTRA 2E2BA 4ZTHA 5J95A 5GIOE 4GCJA 4UB7A 4Z3VA 5BVNA 2PMIA 4MXAA 4QP9A 4L7SA 2WTJA 3DQWA 3VS1A 1S9JA 5CT0A 3VW6A 3DTWA 4W4VA 4C3FA 3HUCA 1UKIA 3HDNA 3D2KA 3T8OA 3R02A 4HNFA 5CYIA 4FNYA 4D9UA 3QTXA 5LCKA 5K0XA 4GYIA 5H8EA 1KE5A 2ETKA 2ZM3A 5AV3A 5AV4A 1NA7A 2XCHA 3ORNA 4WG5A 4GU9A 1ATPE 1PKGA 3EQGA 3A62A 5HBHA 3KXMA 3BEAA 4FTTA 4N4SA 4YLKA 1DAWA 3FMJA 3RNIA 2PULA 5AV0A 4H3QA 3E7OA 3I1AA 4TNDA 4QPAA 3ROYA 3K5VA 4RLKA 4RIWB 4FSTA 5HD7A 3R8VA 5KKRB 3IW6A 3VUHA 4MYGA 1HCLA 4BI1A 4MK0A 3U87A 4BCMA 2RL5A 2WEVA 4L52A 1Y8GA 4PMMA 5GJGA 5DWRA 4YZ9A 4BDFA 4GEOA 4TNBA 3C0IA 4FUXA 2QKWB 4EJNA 5I4NA 2Y4IB 5CSPA 2XJ1A 3Q5ZA 1XR1A 1W98A 4DH8A 3PXKA 1QPCA 3ALOA 3H3CA 3CPBA 2XIRA 1XH6A 1O6LA 2W05A 5CF5A 2ITVA 2OZOA 1KE6A 2YABA 4LYNA 1REJA 4D2SA 3H30A 3SDJA 2IVTA 5IQAA 3NYXA 4J71A 2UW5A 3PPZA 3QUEA 2G9XA 3MVLA 1APME 2BAJA 1IA8A 4QP6A 5EYKA 3BYMA 4BCJA 4YGAA 3FI2A 5EM5A 1P4OA 4DT9A 4GW8A 4AGDA 3EQIA 3MS9A 1OL6A 3FZPA 4E6QA 2E9OA 5HLPA 3B8RA 1GZKA 4BDHA 5FWKK 5E8YA 2W1IA 2W1CA 4BGHA 1Y6BA 1W83A 3BCEA 4ZTQA 4U5JA 5CVFA 4HW7A 3PUFC 4BCFA 1NT2A 3ZO3A 3TNWA 2CDZA 4AZTA 1IAJA 1XHAA 2PVHA 4LRJA 4DTAA 4HPTE 4I6FA 3IDBA 3Q6UA 4QMXA 5CI6A 1M2QA 3CLYA 5DI1A 1H25A 1Q41A 1VYWA 3QFVA 3UOLA 4Z55A 3O51A 3PSDA 2LAVA 4GVJA 2YCSA 3NZ0A 5DRBA 4U6RA 1Z9XA 3HVCA 2VX1A 5LCJA 5IF1A 4C59A 5HVJA 4R5YA 2PVJA 4F09A 2R3RA 4K0YA 3ETAA 4NUSA 4EH4A 2WQMA 5AAEA 4FKJA 3O2MA 3W0MA 3DK6A 2ERKA 2IVVA 4FNWA 3HUBA 4ERWA 2WMRA 1MRYA 4Q5EA 4DEAA 4I93A 4ALVA 4XH6A 5HG8A 4W8EA 5HOAA 3NIZA 5FEEA 4R78A 4OTIA 4B9DA 5C26A 1OL1A 4EUTA 2IN6A 4RC3A 4BDCA 3U6HA 2BAQA 3LW0A 4FUYA 4HYSA 4IAKA 2ERZE 4U45A 4A9UA 3NMUF 2P3GX 3E93A 2R3LA 4M14A 1H0WA 5F4NA 3NDMA 4FZ7A 4XLIA 2GQGA 4NJDA 3NUSA 3GU6A 4EWHA 3KGAA 2VZ6A 3HAMA 5FDPA 2Y0AA 3IOPA 4O6EA 3U51A 4BCNA 3UDTA 2GS2A 5FP5A 4DGGA 5LQFA 3QYZA 2UZBA 3QUPA 4PL4A 4Z7HA 4FKTA 2VTHA 2QOCA 2OJGA 3OW4A 3F69A 3CTJA 4QO9A 4PX6A 2CNVA 2C6DA 4MQ2A 2WXVA 4L68A 3GB2A 3EQDA 3QALE 4HCTA 4M67A 3DV3A 4DHJA 4ACMA 3PFYA 3RK5A 1P5EA 1W2DA 3LJ1A 4IMYA 3QRTA 3TUDA 4IBMA 2HZIA 4NT4A 2QI8A 2FVDA 3ORLA 4GG7A 4OW8A 5IA5A 4BGQA 4M12A 4DG2E 4AXDA 2PWLA 4M15A 5FG8A 4KA3A 5BMMA 3UZPA 3WF5A 5CXHA 2Y9QA 2BFYA 2W96B 3A4PA 4WG3A 5CU4A 2XIYA 2CJMA 4BC6A 5AUUA 2WMSA 2XYUA 4CFWA 2SRCA 2QOOA 3QQLA 5H3QA 3FQHA 4C4FA 4BCGA 4XEYA 2JAVA 2VAGA 3QCYA 1DI8A 4JXFA 5D11A 3O17A 4BYJA 3KRJA 3TACA 3V5TA 4XG3A 1U4DA 3CCNA 4FVRA 3PWYA 4QMSA 5HG5A 2E9PA 1YXXA 4RJ6A 4D2TA 1UU8A 3HRBA 4F6SA 4F70A 4QTAA 5JZNA 3R8PA 4CYIA 3V8TA 4ZJJA 4AWIA 3FXWA 4G3FA 2ZV2A 4DDIA 3QTQA 4KBAA 3UDSA 4IM2A 4YMJA 4A4XA 1WVXA 1BUHA 2QONA 4O2PA 4D4VA 2R9SA 2VRXA 4GK4A 4QP1A 4ZY5A 1UWJA 4O4FA 4S33A 3RINA 2XNBA 1ZZ2A 3UG1A 5ETIA 3S1HA 3EQCA 1WBSA 4HNIA 3TV4A 3I79A 5K5NA 4BCOA 3H10A 4BIBA 4U8ZA 4F65A 4KINA 4R3RA 4D4RA 2GHLA 4TL0A 3TNHA 5EK7A 4YBJA 3PP0A 3ORZA 4IZYA 2OXYA 4C36A 3GEQA 4M0ZA 4CV8A 3LCDA 5KMMA 3GCSA 2VWXA 3C4CA 3HMMA 3Q9XA 1LPUA 2F7ZE 3BU5A 4G17A 4G3DA 2GTNA 2ZYBA 3U4UA 5IQDA 1X8BA 3I0QA 4S31A 2XRUA 1G8SA 3UOHA 4YNEA 4FIJA 3R2BA 4HCVA 4RX7A 1FMOE 4YR8A 2IW6A 4LV7A 4O2ZA 4JL9A 5JGAA 4OLIA 3V5JA 4NIFA 4E20A 3DQXA 2X0GA 4RA5A 3ZYAA 3HZTA 4G1WA 4FZ6A 2Z02A 3E63A 3FMDA 4LGGA 4RFYA 2QLUA 4QYEA 3C13A 5HKMA 3COMA 4MNEB 4OR5A 3S00A 2EVAA 2OFUA 5ETFA 4PTGA 2XIZA 2WHBA 4F9CA 3MYGA 3L9PA 4YO6A 3A99A 3JR1A 2W1ZA 4YJNA 2B9IA 2W4OA 4FL1A 4FEVA 5CS6A 4X2JA 4BFMA 2CLQA 4L6QA 4XBRA 1XWSA 3PJ2A 4L01A 3OBGA 3ODYX 3NGAA 5CEOA 5J1VA 4X0MA 2GNFA 5HU9A 4JQEA 4L3JA 3ZC5A 5L4QA 3DAJA 2X0QA 4GT4A 5AIRA 3RK7A 3AKKA 4PPBA 4D2WA 2W7XA 3L9NA 4QTBA 4OAVB 2JIUA 2VO3A 2B1PA 2HELA 1Y57A 2F7EE 2W5AA 1Q3DA 4O22A 2XUUA 3EFLA 3K3JA 2W06A 3LJ0A 4O0RA 1BLXA 3HYHA 4XS2A 4JBPA 1H1PA 4D2VA 3N4UA 4YJOA 2J90A 2ZM4A 5BVFA 5AX9A 1OKZA 4ITHA 4X21A 4F0GA 3RPSA 3UDZA 4NL0A 3PA4A 3NPCA 4EOKA 3QA0A 1ZLTA 2CMWA 3RPRA 4ZTMA 3CSVA 3LMIA 3DNDA 4PDPA 4FMQA 3LAUA 4IVBA 4EBWA 4LUDA 3FYKX 3GCQA 4KD1A 4LRMA 3VW8A 4JIAA 3FQEA 1WFCA 3OWLA 3ZRMA 4O7RA 1YQJA 4KSQA 4F9BA 5DOSA 5CF8A 3I60A 4P7EA 1QPJA 1PY5A 3IPHA 4QP2A 4WIHA 3DKOA 2DQ7X 2XMYA 3FZOA 5IUIA 4ANLA 2ESMA 1TFFA 2QG5A 1YI6A 3JPVA 5IZFA 3OEFX 3ROCA 3GC9A 3ZLWA 2OJJA 2I1MA 2LGCA 1V0PA 1QPEA 4J52A 3R0TA 3LQ8A 2J6MA 3P08A 4QMMA 3QRIA 4X6RA 1ERKA 4DEIA 4QMWA 5M07A 5AP0A 4U0IA 3ZLYA 4GSBA 3S2PA 3AXWA 3LXKA 1W82A 2YIYA 5CU3A 3TNPC 4YZBA 2HIWA 3FXZA 3C5UA 4CTCA 3NUYA 1H1QA 2O8YA 3I7CA 1GIJA 2VX3A 4M84A 4NTSA 2OIQA 5AP4A 1XH8A 4E5WA 3V6SA 5CLPA 4WUNA 2FA2A 3BGPA 4MCVA 1J1CA 4XYFA 4HVHA 5E4HA 1VR2A 3FC2A 4IACA 1UNLA 2JBPA 3HP5A 4FSMA 5GIPE 2WZJA 4L53A 5E8UA 5FTGA 5HE1A 2VTJA 1BX6A 1O6YA 3EN9A 1LP4A 5EYCA 4FKOA 4FTKA 4NW6A 4XV9A 4MVFA 3OWKA 3F82A 4E6CA 4EC9A 2DUVA 3KN6A 3VWAA 1OUYA 3TZMA 3PUPA 4CFMA 3IDCA 2BDWA 4C35A 2QVSE 1XH5A 4FTOA 4I6BA 4BCQA 4C37A 1XH7A 4MBIA 3EQHA 3MIAA 5J87A 5H2UA 4ZIMA 3SXSA 5LMKC 3BU6A 1A48A 4W4WA 2J5FA 4N6ZA 3C4ZA 3FI4A 3PTGA 4FTCA 4BHZA 5EW9A 1XJDA 2BALA 4G3GA 4MHAA 4YJUA 4EHGA 4OTDA 4GT5A 2PU8A 1R78A 2B7AA 3VHKA 4BCKA 4O7ZA 1REKA 3IG7A 5TE0A 3QTSA 4F7SA 3QU0A 4UWCA 4PWNA 2C3KA 3OCGA 3HMIA 3HV5A 1OPLA 1ZRZA 3OCTA 5DPVA 3KCKA 1SMHA 4Y8DA 4U44A 2GU8A 3PJ1A 4BGGA 2XM9A 4IB3A 4RZWA 2ZMCA 2QU5A 4NKSA 4YZDA 3UTOA 3VUGA 1PKDA 4ZTSA 1G8JA 2GSFA 3FLSA 4XUFA 4DGMA 4H1JA 3OCBA 4CZTA 4CV9A 4FTJA 2VV9A 2QNJA 3ZSGA 3ZC6A 2PZYA 2BMCA 3QQKA 4M69A 2R3PA 2JKOA 2JLDA 4QEBA 3UOKA 4BBMA 2W5HA 3TDVA 5JFXA 1K9AA 3SXFA 2GNJA 4FV2A 2C1AA 4DA5A 3WZJA 3R7UA 4JDHA 2YDIA 3LFDA 4JBVA 4O4EA 3VJOA 5HTCA 3AG9A 4FTNA 4V05A 3H4JA 4O7LA 3DBFA 1OI9A 2HYYA 4E73A 5KKRC 3FUPA 4HGTA 3A7JA 4HZSA 5KMKA 1E1XA 1RDQE 4TYJA 2XNEA 2C6EA 3KA0A 3OOMA 1MUOA 3BYVA 4FGBA 4CFUA 4I1ZA 4YSJA 4M0YA 2Y4IC 3QCSA 3G90X 2ZDTA 5EW8A 3ZFYA 5M4FA 4FSRA 4BCIA 5D12A 2XRWA 5EKNA 3DBCA 3GOPA 3ULZA 3ATSA 3SRVA 3NAXA 3NW5A 3QQGA 4IX4A 4UEUA 3LQ3A 1DS5A 3MFTA 3I5NA 3QRJA 4JQ8A 4U43A 4CT1A 4GUBA 2UZOA 1YXSA 2G2HA 4I20A 4QMQA 5AUTA 3ATTA 2W9FB 3G33A 1H1WA 1OVEA 4BL1A 3E88A 2C6IA 5JH6A 1YW2A 3DZOA 1E9HA 4TYHA 5IEXA 5IISA 3C0HA 3K54A 4W9XA 3UIMA 2VWVA 4FR4A 3VQHA 3NCGA 3EN4A 1Q61A 4FNXA 4YTCA 3W8QA 4RLLA 5HCXA 5L2WA 4GV1A 4O81A 1V0BA 3WF6A 1GZ8A 3QL8A 4Q9ZA 3F7ZA 4UALA 3R22A 3MH2A 1J91A 2QQ7A 4ZY4A 2WMTA 3TV7A 3HNGA 4AGWA 4QP7A 3NX8A 3SA0A 5KMNA 1ZARA 5AV1A 5JRSA 2V7AA 2VTSA 3BPRA 4YNOA 1FGKA 5GZ8A 2OK1A 5HNBA 4HVGA 4I3ZA 4N57A 4CFFA 1Q8WA 4PF4A 4BB4A 3MVHA 3OC1A 1Q8TA 2QKRA 4G5PA 1W84A 4E4LA 2VWZA 4IE9A 2JDOA 2X9FA 4JG8A 4A9RA 1JSVA 2JKQA 3IW8A 4BDJA 1CKJA 2UW3A 5IDNA 4KB8A 5ANOA 2YM7A 5FTOA 4DFBA 4CNHA 4KS7A 5LMAA 4V0GB 3VUKA 3T9TA 5IQBA 4CKJA 1RJBA 3EMGA 4M66A 4DH3A 4ZTNA 1XH4A 2BIKB 1PMUA 4LDTA 3ZHPC 1FVVA 4O7TA 3RKBA 5B2MA 3FHIA 4Q5HA 3OOGA 4HVSA 2FYSA 5A4LA 4UY9A 4YP8A 2NRYA 3RWQA 2YJSA 3ORPA 3A7FA 4D0WA 2ITNA 1H24A 3E7VA 1YDRE 3ANQA 3CE3A 4OT6A 4DITA 4FEWA 4EORA 5IU2A 1KOAA 2YZLA 3ZDIA 3IECA 1YKRA 1ZYSA 4FA2A 2UZNA 5JQ5A 5BUIA 4ZXTA 5CEMA 1GAGA 3MH0A 2I0YA 2JIIA 3H9RA 3KMUA 4ALUA 5BUJA 4F9YA 3OFMA 5I9XA 1IRKA 3RCJA 3P9JA 3R01A 4H58A 2QOFA 4WKQA 4FSUA 4FT5A 1FINA 1XH9A 3EWHA 5JRQA 3VONA 4GRBA 3PSCA 5J1WA 2C0TA 1OITA 1PXMA 2Y8OA 4XRLA 2OJ9A 5M51A 3KL8A 2XB7A 1M17A 3DBEA 2X4FA 3FZRA 4OTHA 4UYAA 4ZTRA 4IAZA 3UO5A 4TN6A 5CZHA 4IWPA 4Y72A 3D14A 1H26A 1YWNA 3MFRA 1U5RA 3CJFA 4NZWB 2GQSA 2AC5A 5TOZA 5KHXA 2X39A 4LG4A 3QX2A 3LZBA 2YLEA 3BV2A 3QRKA 2A19B 4FKGA 2BTSA 3I5ZA 4MF0A 4QTDA 4U80A 3DU8A 3SX9A 3UP7A 4AW2A 3UQCA 3QUDA 4Y83A 4EK8A 1CTPE 4FTLA 4IADA 4KIQA 4EZ7A 4EYMA 4IH8A 3QTZA 3FLWA 4C57A 1J1BA 2R3FA 3CGFA 2ZMDA 4Q9SA 4IAIA 3UE4A 2PTKA 4G3EA 3W2CA 4D5HA 4ITJA 4LOPA 4XV3A 5IH4A 2UUEA 3DB8A 3PZHA 2W17A 4WNMA 4IHPA 1H1RA 4RC2A 4G16A 4BCPA 2IVUA 1BL6A 3BQRA 4O91A 4QOXA 3ZXZA 4CCBA 4ASEA 5CAPA 4AOIA 5G1XA 1DI9A 1R3CA 2C0OA 2PVFA 3PJ8A 3V04A 2BHEA 5K4JA 2W4KA 3QD4A 5HEZA 5HLWA 2O5KA 3CJGA 3M11A 4UBAA 3V8SA 4CSVA 3GCVA 4HOKA 2IW9A 4U40A 4C33A 4FG9A 4FSQA 4IVCA 1OGUA 5KMOA 3O96A 3QA8A 3VS4A 5CSVA 2UV2A 3DFCB 3LIJA 2YEXA 1QCFA 2OF4A 4FK6A 3RJCA 3U9NA 2OJFE 2IZUA 5M09A 2BZJA 1A06A 5B7VA 4O0YA 4IB5A 4CRLA 4ENYA 1JKTA 4FJVA 4ZS4A 1O9UA 3ALNA 3MWUA 3UP2A 5M4UA 4IQ6A 4O38A 3R1YA 2J0LA 3BWFA 4EH3A 3C50A 1HCKA 4JG6A 1W0XC 3PSBA 5FQDC 4BICA 1YOMA 3WZKA 4RRVA 3FYJX 5ANEA 4GKIA 3K5UA 1U5QA 2WIPA 4OT5A 1M14A 3DDPA 4WO5A 4Y73A 3W0QA 2XK9A 1M52A 2GNGA 2XS0A 4OTQA 3JS2A 4YJRA 2WB8A 4QD6A 1KE8A 4YJSA 4BY9E 4U97A 1OKYA 4RWKA 4TW9A 4WBBB 4Y95A 5CVGA 4FEXA 2C4GA 4JT3A 2WOUA 5CNNA 2PE2A 3E92A 4QNYA 4MX9A 3D94A 5HTBA 4FV0A 4X6QC 3VJNA 1ZOGA 4IAAA 5F20A 4P2KA 4IJ9A 5LVOA 5GINE 2V22A 4FSYA 3PIYA 4WOVA 3KY2A 5D7AA 2WAJA 2PZIA 5AUWA 2Q83A 4DDGA 4M7IA 2JC6A 5F1ZA 4EH6A 4ORKA 3ZEPA 1IR3A 4M8TA 4K1BA 2CKEA 2JFMA 2ITWA 3BGZA 2RKUA 1R39A 4CD0A 1GIHA 2YJRA 4DHFA 4IZ5A 3VBTA 2IG7A 1GZOA 4GUEA 2XM8A 4C4EA 4MEDA 3PFQA 4JIKA 2X81A 3VUTA 3FPMA 3AC8A 4P5QA 3TNQB 3BHYA 3HKOA 3FMKA 1H08A 4HJOA 3DLSA 2A2AA 3QZHA 3KULA 4QMUA 5EQYA 3IQ7A 3KVXA 2WU7A 3O8UA 3Q6WA 3QYWA 4RJ3A 4BTKA 3FE3A 4K8AA 4RWLA 4DEHA 4F6UA 3ACJA 3OXTA 5I9UA 3UNJA 5IEVA 3I6WA 4MUQA 1KSWA 5DE2A 1E1VA 4E5AX 2NO3A 2Q0NA 2J5EA 3DAKA 3OP5A 3BL9A 4GG5A 4ZLYA 4C4IA 5A46A 4FV9A 4ZSJA 3W0RA 1FOTA 4IANA 1UU3A 2BRNA 4QQJA 4AXAA 4CLJA 5IMEA 3FMNA 3U54A 4QRCA 3HLLA 3GCUA 4IB1A 4G31A 4EH2A 5K4IA 3HA6A 3NFFB 4B99A 3CIKA 3D2IA 3CD3A 3D0EA 3BYUA 4FNZA 5BVWA 4ANMA 1OPJA 2GS6A 2UVZA 3HA8A 2VTAA 4IZAA 5HHWA 4C38A 3AGMA 3CKXA 3TJCA 3NW7A 2WMVA 4L00A 2GHGA 3HMNA 3KXGA 2WFYA 5ANKA 2P2IA 4FRFA 1PRYA 2ETMA 3PXQA 3Q4UA 1FBNA 3TTIA 3G9NA 3EYHA 3P23A 3PE1A 1NW1A 5J8IA 3V6RA 2PVYA 3R8UA 3ZUUA 4ZOGA 3U55A 4L45A 4DN5A 3BE2A 4RIWA 4TXCA 1MQBA 3O7LB 2CKPA 5DEYA 4XG2A 3D4QA 3GC8A 5HCZA 4FOCA 1HOWA 5AP1A 3OT8A 5EI2A 1KV1A 3AGLA 4JS8A 4U7ZA 1YWRA 4NW5A 3GXLA 2YM5A 5HE0A 4USDA 2RFEA 4D2RA 3N4TA 3M2WA 4QDEA 5DRDA 3E3BX 1SVGA 4ASZA 3HMOA 4BDKA 4DFUA 3OD6X 5E8WA 4PV0A 1J7IA 4XX9A 3BL7A 4EC8A 1I44A 1WCCA 2WTWA 3DJ5A 4G3CA 3NIEA 2G15A 3LOKA 4WG4A 3NS9A 5CEKA 5J5TA 3RP9A 3CGOA 4XNEA 2C5YA 4I0SA 2YIQA 5EYDA 2JDVA 3GC0A 3MPTA 4YBKA 2WQNA 1URWA 2CSNA 3Q9ZA 4K9YA 4LM5A 4RVMA 3DKFA 4KIOA 4H3PA 4CVAA 3H0ZA 3VAPA 1JPAA 5AR2A 3GP0A 5A4EA 3ORTA 2PUPA 4BJJB 2R0IA 4C3RA 4G9RA 4W9WA 3BHVA 4USFA 3FKOA 3W33A 5AAFA 3R9HA 4PPAA 2XCKA 3NVKI 2WMWA 2C3LA 4RVLA 5AUYA 4AE9A 4Z7GA 1UVRA 4TWOA 4WNOA 2R3JA 3PXRA 4ANNA 3TKHA 3Q5IA 3Q60A 4EL9A 4ZS0A 4NSTA 2C5XA 4DGOA 3COIA 1PMEA 5HZNA 4C34A 3QTIA 3TZ9A 3DDQA 4QMOA 5CVHA 4K33A 2BZIB 2B9HA 4NFNA 4DFYA 4L46A 4S32A 2OG8A 3MPAA 3PA5A 1MRVA 4IVDA 4XLVA 1OZ1A 4RJ8A 4XV1A 4CZYB 3OHTA 4FG8A 5HVYA 3TN8A 2P0CA 3W2SA 5FUTA 2XNOA 2J9MA 2UZEA 4CTBA 2X8EA 2Y7JA 4KUJA 3ACKA 3F2NA 4QQ5A 5CNOA 4IM3A 2X6DA 5M44A 2WEIA 4PMTA 3NWWA 3R7YA 4ASXA 5CT7A 3JXWA 2QR8A 3KB7A 4GMYA 3PDTA 2QC6A 5C9CA 5EI8A 4AW1A 5AUZA 4DFNA 3ZBFA 4TT7A 2ZFYA 4IDVA 3OY3A 3VVHA 4QP4A 2J2IB 3BHTA 3HMPA 3TV6A 5AA9A 3P5JC 2J7TA 1NVRA 1KV2A 3UPXA 4AG8A 4CYJA 4F63A 3EHAA 5C8NA 4PY1A 4O1PA 1OECA 5M4CA 1GY3A 2ITQA 3GUBA 4TZRA 4ZMFA 5BVKA 4E4XA 4MAOA 2JBOA 2V0DA 4DE4A 3HP2A 4FSNA 3DGKA 3VC4A 2P4IA 2X6EA 5J9ZA 2QO9A 3FI3A 4FICA 4OBQA 3ZM4A 1ZOEA 3MPMA 4JMQA 4QDVA 2GPHA 3PXFA 3R7GA 2F49A 4DYMA 3NUPA 2I0EA 2X9EA 4F78A 3SLSA 4ZJVA 5IG1A 4RBLA 4WA9A 2HY81 1SVEA 2R3HA 3WYYA 3LCTA 3FMLA 1TZDA 3EH9A 4BVUA 1S9IA 4A9TA 3RTPA 2CNQA 2F9GA 2QOHA 4FEQA 3EIDA 5DGZA 2W4JA 4O7YA 3VRYA 1YOJA 4BDEA 1XMMA 2CGVA 4AP7A 3LFAA 2RFNA 4DG3E 3WE8A 4F7NA 4YTHA 4MQ1A 1BYGA 4FEUA 4EOLA 4ZK5A 4DINA 3TJDA 1LEWA 2HZ4A 4PDSA 2XF0A 4EK5A 3S0OA 3WIGA 4YC6A 2G1TA 5CALA 1WBPA 3CP9A 3FWQA 3MY5A 1PMVA 5A4CA 3N4VA 4EONA 4NEUA 1NY3A 3FJQE 4UXLA 1W7HA 5TR6A 3RI1A 2PMOX 4RIXB 3DK7A 3RPOA 4C4JA 2BRGA 5IQGA 3KN5A 4HGLA 1XBAA 4PRJA 3FLZA 4QYGA 3F5XA 3KMMA 4RIXA 4O0XA 4EKLA 4EHZA 3VS5A 1F3MC 3CEKA 2JGZA 2GFSA 2ACXA 3RM7A 2C3JA 1IEPA 3ODZX 3R04A 4MXZA 5DT4A 1EH4A 3FSFA 2WIHA 3QXOA 2Z7SA 3C51A 4CLIA 4R7HA 5CSWA 1J7LA 5T6KA 4IWOA 2V7OA 4BTJA 3WF7A 2BKKA 3PG1A 2X0OA 5C1QB 4BKYA 4D2PA 4F99A 4MWHA 4YJTA 2JDSA 4XP2A 1ZY5A 2F4JA 2VTOA 3W2OA 4ASDA 2CKQA 3K2LA 1PW2A 3EZVA 3OWPA 3PVGA 5CU0A 4R77A 5E1EA 4IFCA 4GYGA 4I4FA 1WBOA 1OIRA 2QHNA 3UO4A 5A54A 5EKOA 2QG7A 4QPSA 4U41A 3UIBA 2B55A 2X7OA 3QZIA 4GIHA 3A7GA 3SOCA 4RQVA 3R8LA 4NM3A 4FV8A 5D7VA 3W2PA 3AC3A 4TWNA 3R9DA 1NVSA 3ZLXA 1U59A 4F1MA 4YC3A 3R71A 5B0XA 4XJ0A 5HIEA 2OXDA 2YISA 4ZSAA 4F7JA 5BNJA 2G2IA 2W5BA 3E5AA 2OICA 4KKEA