4R7IA

Crystal structure of fms kinase domain with a small molecular inhibitor, gleevec
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
302
structure length
290
Chain Sequence
TQLPYNEKWEFPRNNLQFGKTLGAGAFGKVVEATAFGLGKEDAVLKVAVKMLKSTAHADEKEALMSELKIMSHLGQHENIVNLLGACTHGGPVLVITEYCTYGDLLNFLRRKAEAMLGPSLSGRPLELRDLLHFSSQVAQGMAFLASKNCIHRDVAARNVLLTNGHVAKIGDFGLARDIMNDSNYIVKGNARLPVKWMAPESIFDSVYTVQSDVWSYGILLWEIFSLGLNPYPGILVNSKFYKLVKDGYQMAQPAFAPKNIYSIMQACWALEPTHRPTFQQITSFLQEQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Macrophage colony-stimulating factor 1 receptor
publication title Structure-Guided Blockade of CSF1R Kinase in Tenosynovial Giant-Cell Tumor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 95
structure length 290
sequence length 302
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2014-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4r7iA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4r7iA01
2XM9A 3JR1A 5K5NA 2IVTA 3UIMA 1FMKA 4K77A 1P4FA 1QMZA 4BY9E 4N57A 3BHVA 5HHWA 4I6HA 4BYIA 2W5BA 4QT1A 3OFMA 4O7SA 1YOMA 4MD9E 2UZNA 3JYAA 2NRYA 3OWLA 3DAKA 2ESMA 3GB2A 4FKLA 4BCJA 5IUHA 1ZMWA 4NCTC 3D4QA 5JH6A 3QZHA 4L45A 3FHRA 3KA0A 4EC9A 4UWYA 4I6FA 4AZTA 2BAJA 3DK7A 4R77A 3DT1A 4XLVA 3WYXA 5IA5A 4FKWA 4ZTRA 3MWUA 4NSTA 4UALA 4QQ5A 3NYOA 4J8NA 3ENMA 2BROA 5CYIA 5DLSA 3G0FA 1O6YA 3QZIA 4FKVA 5AR4A 3R7UA 5BUIA 3IW6A 4EORA 3NW6A 3LM5A 4E4LA 4B4LA 1J91A 1V1KA 5BYZA 4F9CA 3V5JA 4ZMEA 3Q52A 2PVKA 2UVYA 3QFVA 4O1OA 3MY0A 4JBPA 4AQCA 5AAGA 4HYSA 4CMOA 1JSTA 5E90A 3DK3A 5CEMA 3NNXA 4RT7A 4GFMA 1Y57A 4I0RA 4XRJA 4O7VA 5DYJA 2IZTA 4D2SA 2HXLA 2X4FA 3LFEA 3RK7A 1PXKA 4AN9A 2CDZA 1OMWA 3VS0A 4MNEA 3QLFA 3H0ZA 4J71A 4KNBA 4PPAA 5IQBA 3ETAA 3EQRA 4MXAA 3FV8A 4FTAA 3PVUA 2W1CA 2UZDA 3D7TA 3DPKA 1WBNA 4S32A 3R8MA 3ZC6A 2WQMA 3C0IA 2I0HA 3PY3A 4FV7A 5IUGA 4D58A 3FQEA 4DEIA 3RNIA 2W05A 1ZYCA 4JOAA 3P08A 4G9CA 4I23A 5EM7A 5JGAA 3ULIA 4OAVB 3QQUA 2CGUA 4O7YA 1BX6A 3DZOA 5HO6A 4MBJA 4FV0A 3TM0A 3BQRA 2R3LA 2XNOA 3OEFX 3W2RA 2IG7A 2EB2A 4Z7GA 3BHTA 4BI2A 1KE7A 3TCPA 5HD4A 3CQUA 1Q3DA 3ELJA 2FH9A 2E9VA 1H01A 4RVKA 5EKOA 2A27A 2ZDTA 4IB1A 1M2RA 5GZ8A 3A4OX 5IA3A 5AV1A 2ZM3A 4FTKA 4ZLOA 3A7FA 5BYYA 4KIKA 3OWJA 1WBPA 1ZZ2A 2V7AA 5CZIA 4MWIA 4FK3A 3VUHA 1WMKA 2X6DA 2W4JA 3POZA 5CTPA 2ZOQA 2A19B 4RIXB 2X9EA 4ZIMA 4FZ7A 3PLAE 5M57A 4FL3A 5AAFA 3VS6A 2J0JA 4CQEA 2PZIA 3AXWA 5FEDA 3KY2A 3GCUA 4GFOA 2R0UA 3DGKA 3FLYA 3VJOA 2VWUA 4LQMA 4F7JA 4KKHA 5IISA 4H1MA 2HIWA 5AR5A 2OIQA 3LFFA 3FL4A 4DFNA 3KXHA 3R7EA 2WB8A 2XA4A 2VZ6A 4JXFA 5CU0A 4I0TA 4GK2A 4GS6A 4OLIA 4I93A 2XNPA 4Z7HA 5IDNA 3ORPA 4G6OA 2XK6A 5FBOA 3DQWA 4F4PA 4QMMA 2XEYA 5LMBA 2OK1A 3NWWA 4F7LA 2UVZA 4FV6A 5CXHA 4O82A 2PVNA 3W16A 4KINA 5H2UA 1HCKA 3CE3A 1WBOA 4FKGA 4YPSA 4DFUA 1JKTA 4IZAA 3A7HA 4GKHA 4HGEA 5IF1A 1WFCA 3GFWA 3HV5A 3R9HA 4EWHA 2RFDA 1W8CA 3F3VA 2G01A 2ITOA 2C30A 4DH1A 4CCUA 2DYLA 4FKIA 2OFVA 3CTHA 2C4GA 4I22A 3ZFMA 4FIEA 1KE8A 1NVRA 5CZHA 4C57A 4G9RA 4AW5A 4C61A 4F9BA 3UOJA 3ZXTA 4A4XA 4FTUA 4G2FA 3F3ZA 4I4FA 3RZBA 1I44A 2JD5A 4QMOA 5IA0A 3F69A 4BDHA 2F7EE 3PZHA 4YJTA 4F1OA 3FMMA 1G3NA 3AD4A 4FNXA 4OTIA 4KWPA 3F5XA 5LCKA 3KF4A 3UO5A 5BYLA 4D5KA 5J1WA 3LCSA 3Q4CA 5FEQA 4E7WA 1Y8GA 4I6QA 1APME 2WTKC 3TV6A 5AV2A 3DKGA 5C26A 2VX3A 3I60A 1CDKA 3RBWA 3O2MA 4XHKB 4EHGA 5ETAA 2PVYA 4ACDA 5CU4A 3RK9A 4PL5A 4GU9A 4QMYA 4FVQA 4W4YA 3KRRA 2UZEA 2YFXA 4FUXA 4YC6A 4BDJA 5KMMA 5AP4A 5EQPA 1OPKA 3H0YA 3QUDA 4TN6A 4IZ7A 2X2LA 3HRCA 3WIKA 3MA3A 3OT8A 4WRSA 5HBJA 1YQJA 1LPUA 3L9LA 3PG3A 2I1MA 4AZWA 4K6ZA 3V5TA 3NNVA 4ORKA 2HENA 3AD5A 5F94A 2BVAA 4QRCA 2OJGA 2WGJA 1U4DA 4AU8A 5CAUA 2BHEA 2DS1A 2G2FA 1LEWA 5E8ZA 4ZSJA 1A48A 2G2IA 2Y4PA 4BWKA 3DXPA 3R83A 3TNHA 3QRTA 3K2LA 3NRMA 3QA0A 4U45A 2FB8A 3P9JA 4NL0A 3UVRA 4WSYA 4F09A 3S95A 2WMUA 3TWJA 1LP4A 4G16A 4J98A 5EW3A 4O7RA 2XM8A 5CAOA 4RX7A 4FSQA 5I0BA 2UW3A 3U9NA 3R73A 3E7VA 3KK9A 1PW2A 2P3GX 3DLSA 1FGKA 3CD3A 4ZY4A 2YM6A 3FLNC 4HPTE 4ZAUA 5HE2A 2V22A 5HU9A 4BDEA 4V0GB 3KXXA 3LQ5A 4Q9SA 5KHWA 4RQKA 1UNLA 3NPCA 3QYZA 2GNLA 4DC2A 4WIHA 3SHEA 4LOOA 1E1XA 4OTWA 4LV8A 4S2ZA 4O0WA 1DM2A 4IANA 4E5WA 2VO7A 4M0YA 3SXSA 4W4VA 1XH8A 2ITZA 2RG5A 5BMMA 2UVXA 4LOQA 3BEGA 3D94A 5DFPA 1J1CA 4RJ4A 4HPUE 1OL5A 4GKIA 2OIBA 3AC3A 4QP8A 1T45A 4WOVA 1L8TA 2GS6A 4DF3A 3UOHA 3WE4A 3O17A 1IAJA 3UO6A 3PA4A 4EH4A 3Q32A 3EHAA 2O64A 4ZZMA 4CKJA 2PY3A 5DNRA 4EH3A 4F7SA 3ANQA 4FKTA 4XS2A 1Q99A 3GU7A 3MH0A 3ITZA 4O0RA 3MPMA 4C3RA 3AQVA 5I9XA 3G0EA 5LVLA 3REPA 3ZM4A 3H9OA 4PPCA 1Q97A 3BWFA 3DXNA 3Q5IA 4K33A 3QTQA 4IAKA 3ZEPA 5FXRA 4C36A 2ZB1A 1F5QA 2BRMA 5HLPA 3M1SA 4O0TA 3SV0A 2QKRA 3ZO1A 1Q3WA 2YDJA 2OJ9A 4RG0A 2UZUE 2ZMCA 4FIFA 2A1AB 3EYGA 4AA4A 3EKKA 1ZLTA 5E9EA 1YHWA 4ZJJA 3ZO3A 3BU5A 3C4ZA 4N6YA 4OW8A 4QMZA 4RX9A 4IZYA 5CVGA 4RZWA 1OKWA 5EI8A 3UNKA 1K2PA 4QMVA 4QTEA 2A4LA 3VN9A 3VUKA 3CGFA 4E20A 5J7BA 2XIKA 3K3JA 4X7QA 3UMXA 3DFCB 4OTRA 3FMHA 1O6KA 1VZOA 3AGMA 3MN3A 4Z55A 5L3AA 2VN9A 5AJQA 3OCTA 5EM6A 5FP6A 1BL6A 2R3FA 5ACBC 2OXYA 4PV0A 3VAPA 1PKDA 4LGHA 4O38A 4JG6A 1TQIA 4I5HA 2JGZA 1YWNA 2BUJA 1OKYA 3UIUA 3O8UA 4ANQA 4BZDA 4TL0A 3HRFA 3DKOA 3NGAA 4E6CA 4E93A 4O86A 3PY1A 4C4GA 1U54A 5M06A 2BILB 3FXZA 3BLQA 4R3CA 4LM5A 3NIZA 1AGWA 1B38A 2R3MA 1NVQA 3IOPA 2QVSE 3UIBA 4G17A 2C5OA 5JGBA 4KRCA 4DH3A 1PMVA 2Q0BA 3TKUA 3ZLSA 4YJUA 2W1EA 4JIAA 4FV3A 3TZ8A 1P4OA 4MTAA 2P55A 3FPQA 4G3GA 4BHZA 4XUFA 2BRGA 5DR2A 2C69A 4Y95A 2QOHA 2IW9A 4E6DA 4L3LA 1YI4A 4BDFA 2I7QA 3ZUTA 3MIYA 3DFAA 4FK6A 4RWLA 4XBRA 2CKOA 2WTWA 2ETMA 2E2BA 5GIPE 3CTQA 3E8EA 2RFSA 4TPTA 4U6RA 1YXTA 4DEAA 4M97A 3KL8A 5A6OA 4JDJA 3MFUA 4FGBA 2PMIA 2VUWA 3ZEWA 2PZRA 4I1ZA 3AC5A 5HEZA 2CKPA 3A62A 5AP0A 2ETRA 2YCSA 5HNIX 3KF7A 3G5DA 2JDVA 2PTKA 3EQHA 5HKMA 2WD1A 3FLWA 3KB7A 5HORA 2BAKA 2HXQA 5JRSA 4BFMA 2R3RA 2YITA 3L9PA 5HGIA 4D9TA 3RPSA 5EDPA 5IUIA 4M0ZA 4XH6A 5IA1A 4FTMA 5IDPA 2XIZA 4QYFA 3A60A 4YUQA 4FI1A 4E4MA 4FTRA 1ZOEA 5CLPA 2GNHA 3VW6A 1P14A 5FEEA 3ORTA 4AW2A 3GVUA 4BVUA 5JRQA 2RF9A 2OSCA 3OUNB 5J95A 4O84A 3S4QA 1GIHA 4L53A 4USDA 2J7TA 3IDCA 4CT2A 3FI4A 5C01A 2YISA 4EHVA 4RJ5A 3ZSGA 4DITA 1FBNA 4CTBA 3E3BX 4J7BA 3LOKA 3LJ2A 4XNEA 3V5LA 5AP2A 5AUXA 2UZVA 3V5QA 4ALVA 4EUTA 5CEOA 5DN3A 4AE9A 4ASZA 3HMPA 4O0SA 5A9UA 3F88A 3I6WA 2R5TA 4A4LA 3SXFA 4MD8E 2HOGA 4ZXTA 1KV2A 5HOAA 5BPYA 4YZMA 2W06A 3R8ZA 3PG1A 4D1ZA 4C4IA 4CFUA 4E1ZA 5TF9A 3O8TA 3RI1A 4FT9A 5I9VA 3V5WA 3PRFA 4MEDA 2I0YA 3RZFA 3OW4A 2QURA 4YTFA 3EB0A 3GCQA 3NDMA 5CEIA 3N4UA 3L8SA 4BCKA 4NFNA 4DEHA 3NUXA 5EI2A 4Q5EA 5HNBA 3EQBA 4CFWA 4AE6A 3T9IA 5FXQA 3VO3A 3R8PA 4E3CA 2ZV7A 4GIHA 3QKKA 3HMNA 4RWKA 3ORZA 3VRYA 1P2AA 4WD5A 3N4VA 3R04A 5KZIA 4NT4A 4M68A 3Q6WA 3DDPA 4U80A 4XG6A 1NY3A 4R7IA 3D7TB 5L2IA 2V55A 5CSXA 4ALWA 2O5KA 3PIZA 2R4BA 2IVVA 3EZRA 3MB7A 1B39A 2RIOA 4V05A 4DFBA 2Y6MA 4BIDA 4OBPA 1SM2A 2FO0A 4FSMA 2ZAZA 4JDKA 3CY3A 5I9ZA 5IQFA 5I3OA 4RFZA 4ZSGA 3GC8A 2NRUA 1FMOE 5HICA 4F99A 2C6MA 4FKPA 2ONLA 3ZRLA 2GHGA 3Q6UA 1Y6BA 3FWQA 1OVEA 4FSZA 5EQEA 2QG5A 2E9UA 5E92A 5D1JA 4CV8A 5IEYA 4RJ7A 3DNEA 3E8DA 4XP3A 3R01A 5EI6A 5AMNA 2OF4A 2AUHA 3U55A 4FT7A 4YURA 5HD7A 5C8MA 2QOLA 4D4YA 3CGOA 4KIKB 2GDOA 4O7ZA 3AGLA 4G6NA 4ZP5A 5HU3A 5IQDA 3FLQA 3EN4A 3HRBA 4OAUC 2CN8A 3P1AA 2YAKA 2QU6A 3OBJA 4YHJA 4JS8A 2WMWA 4FT3A 2PVMA 4U97A 1ERKA 4DE4A 2ERZE 2BZHB 3FUPA 1GAGA 3EH9A 2VWZA 4RRVA 3BRBA 4ZOGA 5GZAA 4RGJA 4C2VA 1J7IA 2QO2A 3MH1A 3UG1A 2O8YA 2XZSA 4LGDA 4YO4A 4BTKA 3PXKA 3R0TA 3UNZA 3LXNA 4CEGA 2VTOA 1U59A 1DI9A 4I0SA 2QHNA 4DFZE 4D1SA 4EKLA 3DJ7A 2QOQA 4G31A 1XH9A 2UW7A 2RGPA 2VX0A 4Y72A 2VAGA 3Q9YA 2JKMA 4V0GA 3HDMA 4FUYA 5LMKA 4D0XA 3CKXA 4P4CA 2F7ZE 5LOHA 4EOJA 1PRYA 4GCJA 4IE9A 3C5IA 1JBPE 2YIQA 4EL9A 4DH5A 4ENYA 4XX9A 1H00A 2QR7A 4GUEA 3W2PA 3F66A 4KD1A 4QTAA 3DU8A 1IASA 2B53A 2X2KA 3NW5A 5KMLA 5CF5A 2VTHA 3CCNA 4E5BA 4XG4A 3RTPA 4DG0E 5E1EA 3L9MA 4IB3A 5AUWA 4EYJA 1WBSA 2VTIA 1Y8YA 2XK3A 4UYAA 3B8QA 1PHKA 4W4WA 2RL5A 2C3JA 4L42A 5CU6A 5M4IA 5J5SA 3PFQA 1JSUA 3WZUA 4UXQA 4X6QC 3KRXA 3W2OA 1OKVA 4Y85A 3OD6X 3L8PA 1Q8TA 1UNGA 4O0XA 3EL7A 4AT4A 4CNHA 3LJ0A 3VS4A 2EB3A 5EW8A 4ITHA 5AM7A 3HUCA 3LVPA 2XRWA 4EK5A 4KB8A 5HQ0A 2ITPA 3EWHA 4O7TA 3AC8A 2PVJA 2JLDA 5IQHA 4YPDA 5IH4A 1SVEA 2FYSA 3MH3A 3F82A 4YJVA 2ONLC 4FG7A 4LMNA 5IQCA 4L3JA 5E8WA 3DJ5A 5C1QB 5HNGA 3MFRA 4BWPA 3BHUA 3LXLA 2PK9A 3KVXA 4NJ3A 3ZLYA 3ZSHA 4CFMA 1FVRA 4RIYA 4WSQA 2JAMA 2YM7A 2OZAA 3E63A 5H8EA 5DBXA 5AUUA 4KBAA 4DG2E 2Y8OA 4YJQA 3BE9A 1H1WA 2AC3A 3LAUA 4BCHA 3GU4A 3BKBA 3Q2MA 3WZJA 4F0FA 4CG9A 4N0SA 4BZNA 4F6SA 5CVHA 2YN8A 3D5XA 2C6OA 5HVKA 3ROCA 5ANOA 5CSWA 4U3ZA 4LRJA 1AQ1A 3OY3A 3BLRA 4KABA 2Q0NA 3G9LX 4ZTHA 3VHEA 2C3IB 2YIXA 4BGHA 3LIJA 4UEUA 3QD4A 4U9AA 3RWQA 3QHWA 2PUUA 5CSHA 1BYGA 4A9SA 4FKQA 1YDSE 4JL9A 3ZO2A 4FZAB 3UIXA 3EJ1A 4BCOA 4FEQA 3E64A 3OF0A 2Z7LA 4E8AA 5B0XA 5D41A 4XV9A 4LRMA 5DR9A 3SW4A 3TUDA 2XNNA 4PMPA 5T3QA 4GYIA 2PHKA 3OXZA 2WTCA 2YCFA 3A7JA 4OT6A 4DEGA 5IMXA 5LMKC 1M14A 3PVBA 4QQCA 4UZHA 3G6HA 2GTNA 3B2TA 2Y7JA 3ZXZA 3L8XA 3MJ1A 4JR3A 3CXWA 2AYPA 2CGXA 4BDGA 5BMSA 1EH4A 2BTSA 4ANBA 3LMGA 3MVMA 2PUPA 5FTOA 3F3TA 4IMYA 4O27B 1UU8A 1Q5KA 4I5MA 4ID7A 3OC1A 5FDXA 4GEOA 4Y5QA 3C9WA 2QQ7A 3QD0A 4P7EA 3FXXA 4X2KA 4DTKA 4PMTA 4ZZNA 5DH3A 5EKNA 2XBAA 3I4BA 5M51A 2VU3A 4W4XA 2OLCA 5CEPA 3PYYA 4RVMA 5TR6A 4FNYA 3SG8A 2HW6A 5BVNA 2C6LA 4EHEA 5AWMA 3JXWA 4OTHA 4WG5A 3ANRA 2IO6A 2J90A 4WBBB 4PDPA 3QTUA 1BI7A 2KULA 4YBJA 3UG2A 5KZ0A 3AT2A 3UNJA 2G15A 4FOBA 3MY1A 4AP7A 4IM2A 1ZRZA 2ZDUA 3QA8A 5TE0A 1ZY4A 3LQ8A 3BHYA 4PL3A 4A9UA 4U0IA 5GHVA 4FTLA 5IMEA 2WMAA 4UZDA 4XG3A 4CRSA 4C38A 3I6UA 3IECA 4AG8A 5FXSA 3VQUA 5HCYA 4GT5A 4XYFA 2CN5A 2BIKB 2HAKA 2XK8A 3RAIA 4EONA 3UP7A 1SYKA 4MQ1A 5CXZA 3BZ3A 2YCQA 1WVXA 2HW7A 4ANOA 4C4FA 2GQSA 3LE6A 4DYMA 3D5WA 1J7UA 3HEGA 3HMIA 3KMUA 2W17A 4MAOA 5BVKA 4ZJIA 4BC6A 4CQGA 2F9GA 3HYHA 5AV3A 2WO6A 2PPQA 5HVYA 4YNOA 1SZMA 2SRCA 3W1FA 3SOCA 5A4EA 5JN2A 2J0IA 5AM6A 1QCFA 3C7QA 4K0YA 3VBTA 3PTGA 3ZUVA 1S9JA 4ACGA 3TUCA 5I4NA 5AR8A 3TJDA 4CD0A 5J5TA 4XP0A 2EVAA 1YOJA 2O3PA 3DTCA 3GU6A 3KCFA 4RC3A 1DI8A 4AFEA 1QPEA 3CR0A 4U7ZA 3BELA 3QTZA 1U54B 3MESA 3EFLA 3RPOA 4AT5A 1OL2A 5AIRA 3CJGA 4F1TA 1OIRA 3TTIA 3P7CA 2XK4A 3QTSA 5A6NA 2R9SA 4FIGA 1MRVA 2P0CA 4BIBA 5B2LA 5FDPA 4PDYA 4AW1A 3U6IA 2BCJA 3IOKA 2JDRA 2RG6A 2PZYA 3DTWA 3EQGA 2GU8A 4F7NA 1YRPA 4A9YA 1Q41A 3CS9A 2W1HA 4RIOA 1PYXA 3IPHA 3V8TA 1H08A 5DIAA 4NM7A 5EM5A 1OL6A 2J0KA 4OUCA 1Z9XA 2VWXA 3QQKA 4G6LA 4UYNA 1IEPA 3IDPA 4GK4A 2I40A 2IZSA 2BRBA 4QMLA 4AZFA 2GNJA 4ZLZA 5ANJA 4UV0A 5KMNA 3F6XA 5HG7A 1XBBA 2FA2A 2RFEA 3ODZX 4I4EA 5AA9A 4KAOA 4C7TA 3DZQA 3UGCA 3D7ZA 4PL4A 5HBHA 4FV1A 4JIKA 4YSMA 1XBAA 3S0OA 4FZ6A 2OJIA 3G9NA 4HYHA 3UC3A 3DBFA 4EOPA 5M4FA 4IEBA 4JQ8A 5AX9A 5AFVA 5IZFA 2WEIA 5HZNA 3D0EA 2WNTA 3VBYA 4YMJA 1PKGA 2C0OA 4J1RA 2ITXA 3C50A 5L2QA 4JLCA 3OWPA 5ANIA 2O63A 3CPBA 4L8MA 5EDQA 2R3IA 3BPRA 4N4SA 4C4EA 3WZKA 3GOPA 5CVFA 4JVGA 4A9RA 2W1DA 5CF4A 4NU1A 3PDTA 3RKBA 4CG8A 3LFCA 4PTEA 3KN6A 3V6RA 5AP1A 4IACA 2NO3A 4IAYA 1Q24A 5JFSA 1H24A 5FQDC 4BGQA 5L8LA 2PVHA 3OZ6A 3Q9WA 2IW6A 1V0PA 3WF9A 3D5UA 1Q61A 4DGGA 4F63A 3HP5A 4HVHA 3BGZA 4YJRA 4MXXA 4RX5A 5FUTA 1CKPA 3OVVA 3HNGA 4RQVA 2CCHA 5K3YA 2V5QA 3OXTA 5T68A 2J2IB 3FY2A 4EYMA 3ERKA 3I5NA 2EU9A 2RFNA 4K9YA 5L2TA 4MBIA 4FIHA 1ZOHA 3TEIA 2BKKA 3M11A 4XV1A 5EYKA 3RPVA 1H28A 4XOZA 1KOBA 4AAAA 1YHVA 2XYUA 3KFAA 5I3RA 4E4XA 3QD2B 4CV9A 3MH2A 4ERKA 2JFMA 3D2KA 1ZYDA 3NW7A 3PPKA 4LOPA 2JBOA 3BYOA 4DEBA 3GENA 4WNKA 4EHZA 3FYKX 4BKYA 5KNJA 4JX3A 4EWQA 2IWIA 3CEKA 4HCTA 4D2TA 3FZPA 4U81A 5GZ9A 2ZM4A 2PMLX 4D2PA 2WMQA 4HVGA 3ZFXA 5LJJA 4ZSAA 3E92A 2YM4A 4WKQA 4TTHB 2ETKA 4PF4A 2OBJA 5HTBA 4UN0C 2YWPA 2EWAA 4QQJA 4BCIA 2W9ZB 4U43A 4ACMA 4DT8A 3R1SA 2PL0A 5C4LA 3R7IA 2WMRA 3NUYA 4GFGA 5CY3A 4CYIA 2QLUA 4OBQA 3UPXA 5IH6A 2YZLA 4J52A 1Q62A 1ZARA 3OT3A 4O81A 4QP6A 5IQGA 4MCVA 4RA4A 3BU6A 2PMNX 1ZAOA 3EN5A 4Y8DA 2X7OA 1GY3A 4U41A 1OL1A 1YXSA 4DLIA 5HO8A 4G34A 4WNOA 5JKGA 1VYZA 4R1VA 5KE0A 3WBLA 4O22A 3PWDA 4DEEA 2R64A 3FQHA 4FZFB 1YI6A 2HZNA 1OL7A 4LV5A 4QYYA 4X2JA 1UWJA 4Z9LA 1U5QA 2XIRA 5HO7A 4DH7A 1XJDA 3ODYX 3AG9A 2BDWA 4DINA 1PXMA 4QMUA 3L1SA 2X8DA 4YHTA 4FKJA 4H3BA 3BGPA 3ZMMA 3CSVA 3CKWA 2HY0A 5HE3A 2J9MA 4QTBA 4U79A 3OP5A 4C58A 4Y73A 4ANLA 3F5UA 4IIRA 3MDYA 3SVVA 3B2WA 3TV7A 4L01A 1B6CB 5J9ZA 3CPCA 4BCFA 2W0JA 4CKIA 4JBOA 4QP7A 5JZNA 5DA3A 4ARKA 5IQIA 1PMEA 4AGWA 3IK3A 3OW3A 4LMUA 5C8NA 1CTPE 2OICA 2P33A 3P86A 4BI0A 2OZOA 1PMNA 3MTLA 1H0VA 2QD9A 3DLZA 2R0IA 1V0BA 4IX6A 5AP5A 3L9NA 3UOKA 1OPJA 4HJOA 3II5A 4D28A 4FIIA 1Q8ZA 4FTIA 1H27A 3O7LD 5LVNA 3PSCA 2V0DA 3ZTXA 3G51A 1WBTA 4YC8A 4CYJA 3OWKA 4EEVA 1KE6A 1IR3A 3R63A 4K18A 2QI8A 3IONA 4P5QA 1M2QA 4L46A 4YLLA 5EK7A 4EH2A 4C62A 3AT4A 4J8MA 3PXRA 4YNEA 2R3JA 4CVAA 5C4KA 3TV4A 3VVHA 3V5PA 2YJRA 3KGAA 1ZYLA 2JDSA 3NYNA 4L52A 5L6OA 4JX7A 3MFSA 3R8VA 3P7AA 4AW0A 2WHBA 2R3NA 4FT0A 3QRKA 5K9IA 4L44A 3R2BA 4C35A 5IA4A 4QMTA 4IB5A 3BBWA 4IVAA 3R71A 3O0GA 4QPSA 4A07A 3TTJA 1JKLA 3PE1A 3H9FA 5FRIA 4USFA 3TXOA 3ZRMA 3QUEA 2X1NA 3QKLA 4QP3A 4RC2A 1XR1A 1ATPE 2BKZA 2Q83A 2BDFA 3OOMA 3F9NA 3RM6A 2YA9A 3ZBFA 2XB7A 4ZZOA 4BTFA 3R9DA 4BDBA 4H36A 1J3HA 2VTJA 3OTUA 3RINA 5L6WL 2QOOA 1A9UA 4YO6A 2OO8X 3BV3A 1Q8WA 2WOTA 3OG7A 4B9DA 3H4JA 5DI1A 1ZXEA 4RIYB 5ACKA 3U51A 2OZAB 3FMJA 3LFDA 4FEVA 3MIAA 1PMUA 2VWWA 4N6ZA 4J96A 5BQ0A 3BYUA 1UKIA 2UW5A 4XRLA 4UMPA 1OITA 3EOCA 4FKOA 5KUPA 2G2HA 3NYVA 2YDIA 4FTTA 1KUTA 4FG8A 2PE1A 4HZRA 2F2UA 3MJ2A 3PP0A 2HZIA 4WBOA 3TG1A 4DG3E 1BMKA 3HV6A 1U5RA 1GZKA 3CY2A 3FZOA 3N9XA 3BIZA 3O8PA 2C0TA 3Q4TA 4HCVA 3RHKA 4OBOA 4DTAA 4JR7A 3W8LA 4AGUA 5CF8A 3G6GA 4WO5A 3DA6A 2H34A 5JGDA 1UU9A 4TY1A 3GT8A 4NEUA 3I5ZA 5LWNA 4BDDA 2B1PA 4EZ7A 5A46A 4RVLA 3DK6A 3DBEA 4U42A 4PNIA 1OKZA 4FVPA 3EN7A 3OHTA 1H1RA 1ZWSA 2YM3A 5L6PA 3Q4UA 4GVAA 4IAAA 1NT2A 2XCHA 3HV3A 3LCTA 3UTOA 2VD5A 3UZRA 2DWBA 4MD7E 1M17A 4ZSEA 3VBQA 2YWVA 2HYYA 3E62A 3Q5ZA 3A7GA 4ZY6A 3WOWA 4IAZA 4APCA 5IU2A 4CLIA 1UKHA 5LVPA 3R00A 4JAIA 3WF6A 4NWMA 1DAWA 1H0WA 5L8JA 1PXLA 5GIOE 3P79A 3PE2A 5JQ5A 3VS2A 3UODA 2Y6OA 2XJ0A 4N70A 3ZDIA 3PXQA 3SKCA 3U9CA 1FVVA 1MQ4A 3BBTB 5CEQA 3HA8A 3TI1A 4X2GA 4S31A 4M15A 1XH4A 2RKUA 3MA6A 5IQEA 4AZSA 4CLJA 2W4OA 4IM0A 4EOOA 3ZOSA 3ZRKA 4FVRA 5DEYA 5I9UA 4AOJA 4YSJA 4JT3A 2E9PA 4PMMA 4RWIA 3ZYAA 2PE2A 3ORMA 4H3QA 2PVRA 4AGCA 3FKLA 4PDOA 4B8MA 5FTQA 3UQCA 2JITA 2QC6A 3JUHA 5EHYA 3WF5A 4QTDA 5DE2A 2WMVA 4CCBA 3K5UA 3TNWA 4EBVA 4M14A 5CX9A 4RLLA 5HI2A 2XYNA 1A06A 4X3JA 4PTGA 1UU7A 5EOLA 1XH7A 2UUEA 1PXIA 4OTFA 4RJ6A 4ASXA 4E26A 3A8WA 4YBKA 4FL1A 3ZO4A 4DA5A 4AOIA 4GJ2A 3KRJA 5CAVA 2XIYA 5B2KA 3TZ7A 1TKIA 2X0GA 1K9AA 3KXMA 3Q60A 4YTIA 3P0MA 4I41A 3PSDA 4M67A 3ZUUA 3NMUF 3NAYA 5I9YA 4MHAA 2YDKA 4A4OA 4ZMFA 3QYWA 3KXGA 3F5GA 4TNBA 2OIDA 5FG8A 5TOZA 4BN1A 3U6JA 2ITNA 2PZ5A 4E73A 2OWBA 4EH7A 2CNQA 2W1GA 4D2VA 2EXCX 2CSNA 2VRXA 2Z2WA 3FI8A 1CSNA 4R3RA 4TZRA 2CNUA 2Z02A 1XBCA 3MYGA 4NIFA 5IH5A 3DKCA 3I1AA 4TYGA 3GBZA 3GU8A 5J8IA 3WZEA 4PY1A 1M2PA 4KUJA 5CNOA 2XS0A 4A9TA 2QKWB 2JIUA 1Q8YA 3Q3BA 5EYDA 3C51A 2X7GA 4KIOA 3S1HA 1MRYA 4RFYA 4C59A 1J1BA 4GT4A 3FQSA 1VR2A 3VQHA 2JEDA 3NNWA 3QTIA 2GNIA 2OFUA 3E7OA 4KBKA 4Y46A 4O2PA 4R5SA 4TXCA 4IWPA 3R8LA 2YIWA 5D11A 1XKKA 2LAVA 5BVFA 3HV4A 2GS7A 4AA0A 2PVLA 2QONA 5F20A 2B9JA 1CM8A 2OKRA 3VHKA 3DKFA 3A2CA 4MQ2A 5CAPA 1ZYSA 4MBLA 4ANMA 2FGIA 5E8YA 3ORIA 4PP7A 3I7CA 4RIWA 5ETCA 5G1XA 5AUZA 5A4LA 3KU2A 4MF1A 1F3MC 2V62A 3K54A 3DOGA 1R1WA 3QKMA 4BB4A 4L7FA 2B9IA 3DAJA 3IW8A 3WF7A 2WQNA 3Q04A 2C3LA 2HWPA 4FTNA 4R8QA 5DOSA 2XEZA 3EFJA 3KCKA 3QZGA 1O6LA 2A2AA 2J4ZA 3GXLA 3G2FA 2VTTA 4QP2A 4DFLA 2YLEA 4XG2A 1RW8A 3EZVA 4F65A 3D2IA 4YR8A 1I09A 3LQ3A 3NYXA 3V01A 4UBAA 4DBXA 4R7HA 4D9UA 1PXPA 3AMYA 4FSTA 2R7IA 3AMAA 4OTQA 4AZEA 3ULZA 4X3FB 5ETIA 4J95A 4ALUA 4UB7A 4BWXA 3DV3A 2XH5A 3DBQA 2OJJA 4C4HA 2X2MA 4EOLA 3KVWA 3RAWA 3R2YA 4XCUA 2XK7A 2ITWA 4D55A 5FM3A 3C4XA 3KK8A 4QPAA 3UDBA 2UW6A 2W96B 5ANDA 4DGOA 4IW0A 5BUEA 5EFQA 2CGWA 4FNZA 4U44A 3PJ1A 3PIXA 4ZEGA 3SX9A 2VWYA 5IA2A 4NTTA 5E8VA 5E8XA 4EH9A 2WIHA 5M4UA 3NNUA 3R30A 2WEVA 4BCMA 2XF0A 2YACA 1FGIA 4YGAA 4ENXA 3DJ6A 3TNQB 4LG4A 4F0GA 3MI9A 1W82A 2QO9A 3FZ1A 5M55A 2GS2A 3PXYA 3FLSA 4ZS0A 3LM0A 4TRLA 2C6IA 3FZRA 3FEGA 2WU7A 5ANKA 1E1VA 5HIBA 4KKGA 3WYYA 4ANNA 4R78A 2CGVA 3QC4A 1PXOA 1PF8A 4CMUA 4YC3A 1MRUA 2XNGA 2X7FA 2UV2A 3V8WA 3QD3A 5AUTA 5JSMA 3VUDA 2WQBA 1ZMVA 3UVPA 3DXQA 2W1FA 4O0UA 4PMSA 3H10A 2BZKB 1FPUA 4BDIA 4F08A 4C4JA 3HVCA 4TKSA 2JFLA 5CNNA 4M3QA 2G1TA 5AV0A 3PVWA 5HCXA 3PLSA 1H26A 4FICA 3T8OA 4EKKA 3BEAA 3U4WA 5JEBA 2QNJA 2WOUA 3POOA 4Q5HA 2YABA 3RMFA 3TKHA 1H1PA 3SA0A 3W18A 1DS5A 4X21A 5CSVA 3QRIA 4KRDA 3MVLA 1R3CA 4WG3A 1JAMA 4IB0A 2PZPA 4H05A 2PE0A 2XKFA 4YHFA 2QODA 3DNDA 3U8WA 5B2MA 4QNYA 3EN6A 3QGYA 1FVTA 4IM3A 4QOXA 1WVWA 2WQOA 2VX1A 3IW7A 2R7BA 3DB6A 3HMOA 5D9HA 4MWHA 3IQ7A 4OTDA 3R8UA 1M52A 2VO6A 3TN8A 3ROYA 3NUPA 2VO0A 4BL1A 4EK8A 2O65A 4RLKA 3VNTA 5HLWA 1BLXA 4EOKA 5TO8A 4WUNA 3Q96A 4V04A 3VUGA 3ZZWA 4AGDA 5L8KA 3LMHA 3OROA 4UWCA 2W4KA 5FTGA 3ORKA 4IH8A 4DCEA 4J97A 4JNWA 3U4UA 2PULA 3R1NA 2YEXA 3E8CA 1OIQA 2R2PA 5M08A 3R1QA 2J50A 2C1BA 2CLXA 2QO7A 3MB6A 3PA3A 3TIYA 2OXXA 3CQEA 4GRBA 1YWRA 4CTCA 1OBGA 3VIDA 3F2RA 4QP4A 4KIQA 3LFAA 1GZOA 3DQXA 2BFYA 4FV4A 4GV1A 4I21A 5B7VA 1UWHA 2YAAA 3CTJA 4RJ8A 4ZTQA 3NEWA 3OCBA 4HCUA 1CMKE 3FBVA 3NUNA 3UBDA 5LQFA 4EK6A 3RCJA 2B9FA 1IA8A 3GFEA 5C27A 5AAEA 4JBVA 2YLFA 5C9CA 5J9YA 4L9IA 5KCVA 2FSTX 1AD5A 3FZTA 3IW4A 4H39A 3A8XA 2JC6A 3ORLA 4TWOA 3AT3A 3FI2A 3A7IA 2JDOA 4L43A 4FSYA 4X0MA 5I5ZA 2I0EA 1WVYA 2QOBA 1NXKA 5IPJA 2UW0A 4NYEA 2VTPA 2BRNA 2GNFA 5M09A 2KTYA 2ZVAA 2QG7A 3G15A 1T46A 4GW8A 1H8FA 5DWRA 4FEWA 4AUAA 4EOIA 3QC9A 4AACA 4TYJA 4AA5A 2C5YA 2YERA 5BVEA 1RQQA 1W7HA 4MK0A 4O83A 1L3RE 3QXPA 2XNBA 4IAIA 4AT3A 4O0VA 3UP2A 3RGFA 2PSQA 4UWBA 3CLYA 2R3GA 1W0XC 5D7VA 4NZWB 2XRUA 3D83A 3R7VA 5HIEA 5FBNC 1XHAA 3R7GA 4FTJA 3LHJA 3MSSA 4G3DA 2VTLA 4Q2AA 3PXFA 4TWCA 3HGKA 2ITVA 2HK5A 4W9XA 4CFXA 4CMTA 5LVOA 4ITJA 3RM7A 5LXMA 4O7LA 2BAQA 5HE0A 4QMQA 4JQ7A 3NUUA 3MGYA 1R39A 4KIPA 4BRXA 4EOSA 2WQEA 4J53A 5KMIA 4HGSA 4MH7A 5DVRA 3RP9A 4XJ0A 3VS3A 3W33A 5GJDA 3F2AA 2VNWA 4JRVA 3R7OA 3OOGA 4CGAA 2F4JA 4IDVA 4TYIA 5KMKA 3FJQE 4NJDA 5FGKA 4YLKA 4C37A 4M12A 4YTHA 4HW7A 2EXMA 3LFNA 4XG9A 4QQTA 3BHHA 2HZ4A 3PP1A 3A99A 4R1YA 3CP9A 2UW4A 3QBNA 1IAHA 4E6QA 3RVGA 5IKWA 3R28A 4F9YA 3A4PA 1CKJA 4QYEA 4PTCA 3EQCA 5HG5A 4XEYA 1TVOA 4EOQA 2PUIA 3VBWA 2WMTA 4M7IA 1WBWA 1RDQE 4BI1A 1JKSA 4HGTA 1IRKA 2BPMA 2BMCA 4IWQA 4GU6A 2B7AA 3QUPA 2QCSA 3PJ2A 3ZH8A 4DEDA 3R9RA 2FVDA 5CU3A 5A3XA 2PMOX 2WU6A 3CD8A 3UE4A 2FUMA 2I0VA 4C34A 1XH5A 4JRNA 4ACHA 4DGLC 4FKSA 3GQIA 3NX8A 4W8EA 4FF8A 1Y91A 5KKRB 3QZFA 2R3KA 3COHA 3PSBA 4MXCA 3VF8A 2BDJA 1OUKA 3Q2JA 2UW9A 3COKA 4NH1A 5A4CA 4IX5A 2BIYA 3O51A 4WRGA 2GPHA 4I5CA 3OS3A 3BYSA 4QPMA 3W10A 3OCGA 4D2RA 3NZ0A 3KULB 4QYHA 2W5AA 4FIJA 4RJ3A 2J0MB 4TWPA 4EH5A 3W55A 2VTAA 2H96A 3MVJA 4IBMA 1P5EA 1FOTA 3O96A 3PY0A 4B99A 2VO3A 4HGLA 5LMAA 3W2SA 2VWVA 5E8TA 4FZDB 3EIDA 5LWMA 3LKMA 2W5HA 2REIA 4K8AA 5LCJA 3KMWA 2P4IA 5EQYA 2JIIA 4CXAA 2ZMDA 2X39A 4F9WA 4K1BA 3FMEA 2W9FB 4BR3A 3QAME 4O91A 2WTJA 2XK9A 2E9OA 3FSFA 2B52A 3FSKA 3JVRA 5C8KA 4O96A 4HYUA 5FLFA 3OUKA 4II5A 3QRJA 4X3FA 2C5XA 2FSMX 2VTQA 3HA6A 3VUTA 2VNYA 4RBLA 3H9RA 2VTSA 3RNYA 3ZHPC 4AF3A 3UZPA 3GQLA 1SNUA 3FKOA 1UA2A 5KHXA 2C0IA 5EHLA 3HAVA 3C5UA 1KV1A 2WFYA 2BR1A 2ZM1A 4IHPA 5AEPA 3WE8A 4PRJA 3CIKA 4AS0A 2V7OA 1IG1A 2XIXA 2FSOX 2IJMA 3HLLA 3QWJA 3NUAA 3MW1A 2WKMA 5E4HA 4FOCA 2XP2A 3MY5A 4QD6A 4ASDA 4D4VA 3BX5A 2EXEA 1IA9A 4IC7A 3WZDA 4IX3A 3O50A 3QTXA 4BKZA 1YI3A 1Q4LA 3NAXA 4IAFA 2JKOA 4YZNA 3CBLA 3IW5A 3UQFA 1H07A 3QCSA 2X8IA 1LEZA 5J7HA 1PJKA 1YHSA 4ANSA 3FPMA 4RFMA 3PVGA 1VYWA 2VTRA 1X8BA 2CJMA 2DUVA 5HCZA 3ZCLA 3NCGA 3HP2A 4JDHA 3GC9A 4O0YA 5F4NA 5ITAA 3E5AA 3R9OA 3VW8A 2BHHA 2XJ1A 3F61A 4HYIA 2O2UA 2R3PA 4QNAA 5AUVA 5TT7A 3JS2A 4LFIA 4ZS4A 5HX8A 4ZTSA 2H6DA 5E7RA 3VBVA 5EYCA 2J5FA 3P23A 2QLQA 4AFJA 4AWIA 3PUPA 1SMHA 4MKCA 4NIFB 4ZJVA 5CAQA 3RPRA 5ICPA 4FYOA 4KS7A 3RHXA 3A61A 2J51A 2J0LA 2H8HA 2JBPA 2VTNA 5A14A 3ALOA 4BCQA 3ZM9A 2PVFA 3LLAA 3I0QA 2ZB0A 5JT2A 4LL5A 4LL0A 5BVDA 1WAKA 4XLIA 2OG8A 1G8SA 3MPTA 2H9VA 3FMLA 2C68A 4O7NA 4C02A 5M4CA 1GZNA 3QCQA 4KKEA 5JQ8A 3TACA 2PYWA 3HV7A 4CZTA 1S9IA 1YW2A 4RIWB 3W2QA 3LMIA 4FYNA 2ZV2A 3T3UA 2NNWB 5JMSA 4IADA 5AR7A 3SXRA 3ORXA 2OH4A 3R7YA 4OR5A 4DN5A 5J79A 2FSLX 4LRKA 4RSSA 3IKAA 4U5JA 3DB8A 5KMJA 2BRHA 2X81A 2GTMA 1BKXA 4FA2A 4KS8A 3HAMA 3HECA 4V01A 4XP2A 3PWYA 2C5NA 3ACKA 3M42A 1UV5A 3MS9A 4FMQA 3EQFA 4TYHB 4LYNA 3NLBA 3DBDA 3VS5A 3OBGA 3FHIA 1PXJA 4X6RA 3KEXA 3QCYA 4YJSA 4X3FC 1H4LA 1OECA 2XCKA 4MXYA 2BALA 4TW9A 2R3QA 2Y4IB 1JQHA 3R6XA 3CC6A 2QOCA 5DT0A 4ZTLA 1GNGA 3LLTA 4XMOA 3ZS5A 4BDCA 5KX8A 3FL5A 4M8TA 4L6QA 3ZDUA 5H9BA 2GHMA 2B55A 5GJGA 3LCDA 3C4FA 4YTCA 4I3ZA 2C5VA 4EQUA 3EQDA 4WUAA 4KSQA 4Z3VA 5L2WA 4MNFA 3MV5A 2WELA 3R21A 4R3PA 3RJCA 2Z7QA 3C4CA 3PXZA 4G5JA 3W32A 3GC0A 3OEZA 4F1MA 3EMGA 3R1YA 2WTVA 3DY7A 2WPAA 3V04A 3TNIA 4BF2A 4QP9A 3SW7A 3TUBA 3FAAA 5A4QA 3U87A 3TDWA 3GGFA 2UZOA 4FEUA 1FINA 4M13A 2JIVA 3TZMA 2OF2A 1GIIA 3HDNA 4YJOA 5K4JA 3ZC5A 5AX3A 4QMSA 2Z7RA 5KBRA 2GFSA 4NW6A 3LXKA 4EQMA 4QO9A 3NVKI 2C6TA 2WTDA 4WHZA 4GYGA 3IGGA 3RK5A 4R5YA 5F95A 4GH2A 5M53A 4U8ZA 1Z57A 5JFWA 4MXOA 3EN9A 4S30A 5K4IA 3IO7A 4G3EA 4FEXA 2BFXA 3ATTA 3FKNA 4BICA 3FYJX 5KMOA 2WIPA 3PJ8A 1G5SA 4XOYA 3VRZA 4O1PA 3QQGA 4EH6A 3GCVA 3N4TA 1JWHA 3UC4A 3GEQA 5CQUA 3CQWA 4CZYB 2UZWE 3K5VA 3MFTA 3KMMA 4H58A 5EG3A 2CMWA 2X9FA 4TNDA 5CEKA 2W99B 3NCZA 1YVJA 2XBJA 3FLZA 3MPAA 4GVJA 4GK3A 1OIUA 3F5PA 4QMWA 4YZCA 1PY5A 2C6EA 2CCIA 3NR9A 3QWKA 1ZMUA 3L8VA 4G3CA 2I6LA 4JG8A 2OU7A 5HESA 4MXZA 2ERKA 1BUHA 3TJCA 3RWPA 1GZ8A 2CLQA 4B7TA 3S2PA 2PUNA 3UYSA 1JOWB 3BI6A 4CSVA 1QPCA 5AA8A 2R3HA 4B6LA 3C1XA 4NM3A 2XNEA 4QMXA 5CS6A 1ZOGA 5DG5A 4KSPA 1ZYJA 2JKKA 2GFCA 5FD2A 2YHVA 2CPKE 3JY9A 2CKEA 5CI7A 5JZJA 3R22A 4QMNA 3SLSA 3TZ9A 1V0OA 3M2WA 5K0KA 3DS6A 4P2KA 4M69A 4IJ9A 3TNPC 4EI4A 3EFKA 4YLJA 3IG7A 3NS9A 4HNIA 5AIKA 3BCEA 4BCGA 3KC3A 4E5AX 2BTRA 5EW9A 5E8UA 4FODA 3ZBXA 3AC4A 3SD0A 5E1SA 3P4KA 5G6VA 4I5PA 3FMDA 5DR6A 5HE1A 4AXAA 5GNKA 5CQWA 5DHJA 1OPLA 4C3FA 3ET7A 1KOAA 2XKDA 5D12A 3WIGA 1LR4A 4AN3A 2C1AA 2ZV9A 4I20A 4IVCA 4ONAA 3Q53A 4X2FA 3ORNA 4FTCA 4PX6A 5AR3A 2JKQA 4FL2A 3ZSIA 2YCRA 3HL7A 4I92A 4G3FA 1STCE 4EQCA 3COMA 2VGOA 2WMSA 2Y0AA 4R6VA 3ZONA 4YJPA 1GOLA 4LUEA 2P2IA 4R7BA 3HX4A 2XKEA 3KXNA 5CASA 1U46A 1KE9A 1BL7A 5DGZA 3ID6C 1NW1A 5EH0A 3KULA 4FGRA 5DRBA 4C33A 5HTCA 5HX6A 2WMXA 1J7LA 3VBXA 5L4QA 3ZFYA 1TQPA 4JDIA 3G33A 4W8DA 3E8NA 3LCOA 1OGUA 2P2HA 3W8QA 2IVUA 1TQMA 1LUFA 4RPVA 2IPXA 4NKAA 2X8EA 4EBWA 3H3CA 2F57A 3R02A 4YJNA 4BBFA 3AOXA 3GUBA 3TKIA 4B0GA 2ZJWA 3P5KA 4NM0A 4XG8A 4Q9ZA 4DBNA 1JKKA 2OH0E 3F7WA 1JLUE 3EQPA 4DFYA 4EJNA 4GMYA 4BZOA 4UMRA 1JNKA 2IZRA 4FKUA 4NUSA 2XJ2A 3AMBA 4QYGA 3DCVA 3MTFA 3LPBA 4IJPA 4OTPA 4APPA 3KRWA 5HTIA 5CSPA 3ZU7A 2NPQA 4IZ5A 2CHLA 2G9XA 3ENHA 5H8GA 1OI9A 2OI4X 5DT3A 4G5PA 4D2WA 4YU2A 5HLNA 3RCDA 4QTCA 2YJSA 3FI3A 4D0WA 3EKNA 1HOWA 5CWZA 2XNMA 4FNWA 4BCNA 3FMNA 4F9AA 5LVMA 4IWDA 5IG1A 4NFMA 3GC7A 3SOAA 5I9WA 3QLGA 3SRVB 4EJ7A 1Y6AA 2Z60A 3F3UA 4H1JA 3RPYA 5EM8A 4HNFA 4UMQA 5HG9A 2OGVA 4C0TA 3FE3A 4HVDA 3S00A 4GSBA 1RE8A 4ERWA 4M66A 2CKQA 2WTIA 2PWLA 5M56A 4FV5A 4NKSA 2AC5A 4JI9A 4C2WA 5JFVA 4ACCA 2YM5A 2QOIA 4KBCA 4L7SA 4C3PA 1UVRA 1XH6A 1QPJA 3K3IA 3FC1X 4PP9A 5FP5A 2ZV8A 2RSVA 5EDRA 2O0UA 1SNXA 4FG9A 4FV8A 5F1ZA 5C03A 1R78A 1YWVA 5D7AA 1K3AA 2B0QA 4RIXA 4EOMA 4EZ5A 5EOBA 3SC1A 1YOLA 1YDTE 1URCA 3C0GA 4XV3A 3VUIA 3OCSA 5ANEA 3F7ZA 2C6KA 3QF9A 2JDTA 3KXZA 3SG9A 5AADA 2IN6A 4O7WA 1M7QA 3QCXA 3QQHA 4CKRA 4GUBA 2HELA 3FXWA 4I94A 4F64A 2B9HA 4CZUA 1H1QA 1W98A 2C6DA 3E88A 3T3VA 4BIEA 4BYJA 3UYTA 2J6MA 3Q9XA 4WNMA 4LUDA 5IQAA 3EFWA 4TT7A 4P90A 4O21A 5H8BA 1KE5A 4F6UA 5IEXA 5KKRC 3D5VA 4CFVA 2ITUA 4DGMA 4XV2A 3AC1A 3P78A 4AX8A 3PJ3A 1HCLA 3RAHA 4BDKA 4W9WA 4U3YA 3DBCA 3O71A 4WA9A 4BGGA 4ZTMA 4FSWA 3VF9A 2ITYA 5HG8A 4K2RA 4FV2A 4HVSA 4UX9A 3UMWA 2HY81 3I79A 4ZSLA 5AV4A 4CT1A 3ALNA 2VWBA 4L68A 1JPAA 5CANA 1WCCA 4FSRA 3C0HA 3V51A 5AP3A 5CF6A 2YM8A 3THBA 4H3PA 1JVPP 2XVDA 4JBQA 4JG7A 4PNKA 2XKCA 5HVJA 5LARA 4GG7A 1XO2B 3EL8A 4UMUA 5M44A 4BDAA 4GIIA 4IVDA 3HKOA 4MNEB 3QALE 4IVBA 4O6EA 4A7CA 3NVMB 3FC2A 3Q9ZA 1E9HA 1KWPA 4X2NA 5CT7A 2UW8A 4EK4A 3LXPA 3LFSA 4TYHA 3OY1A 4GJ3A 2J5EA 3W2CA 1OUYA 1REJA 1PXNA 1YKRA 1XWSA 4JJRA 3V8SA 3HMMA 3GNIB 1XQZA 4RMZA 2WTKB 3F2NA 4FSNA 4ZK5A 2JAVA 4IWOA 3D15A 3GOKA 2IVSA 2Z8CA 4L00A 1VJYA 3I0OA 3QRUA 1OIYA 3U54A 5HIDA 1ND4A 4RWJA 3WF8A 3UO4A 2VTMA 3GU5A 3NSZA 4NW5A 1MP8A 4QMPA 4L67A 4S34A 3QU0A 4CFNA 2CNVA 5GJFA 3E3PA 4JAJA 5IEVA 4XBUA 4OT5A 1OBDA 3PPJA 4D4RA 4FTOA 5AUYA 2YIYA 4D5HA 5DT4A 3GCPA 2W1ZA 3VJNA 4EZ3A 5BX0A 1M7NA 4USEA 1Z5MA 3PJCA 3DAEA 4HOKA 4IQ6A 4DCAA 3COIA 1YXUA 4K11A 5DEWA 4ZY5A 3AC2A 1OZ1A 4GL9A 3UJGA 3ZZEA 3VS1A 4CFFA 4E4NA 4HZSA 4L3PA 1WZYA 1VEBA 4O6LA 2VWIA 4WNPA 3FZSA 3BWJA 2ZYBA 2PU8A 3S3IA 3JPVA 4YP8A 3IDBA 3TT0A 4I6BA 5K5XA 5L2SA 2NP8A 3HZTA 3VS7A 1W84A 4HVIA 3CJFA 4YZBA 4O2ZA 3V6SA 3D9VA 3R9NA 4I24A 3WILA 3UPZA 2QR8A 3QQFA 4OTGA 4C8BA 5KBQA 3H30A 1SVGA 2UZBA 5CU2A 1CKIA 1MUOA 2WXVA 3QXOA 2EUFB 2GSFA 4EUUA 4OGRA 2GQGA 2OJFE 4DHFA 2GNGA 3LFQA 3QL8A 3SDJA 4UY9A 4QP1A 4D1XA 5BNJA 2QOKA 3MVHA 1FQ1B 3VC4A 1URWA 1YDRE 5JFXA 3SAYA 4LGGA 2WMBA 4GG5A 2DQ7X 4BBMA 1O9UA 1R0PA 1F0QA 4FX3A 3TDVA 3FDNA 4JQEA 3AD6A 3N51A 5D10A 4RA5A 4IXPA 2WAJA 3BGQA 4FV9A 4BKJA 4IFGA 3E93A 4MF0A 2HWOA 2B54A 3DDQA 4UMTA 3FY0A 1ZY5A 3UQGA 1ZZLA 3GP0A 4MVFA 1H1SA 3LJ1A 4EH8A 2OXDA 3KN5A 4RZVA 4TWNA 4Y5HA 3NIEA 4MX9A 3RAKA 1NVSA 3C13A 2WZJA 4PWNA 2W1IA 2IW8A 3T9TA 3O7LB 3C4EA 2BZJA 4J99A 5DRDA 2GQRA 3QQJA 1OM1A 3QHRA 2R3OA 5DPVA 3VULA 5A4TA 4UXLA 3UZTA 1SVHA 4GT3A 5BUJA 1UNHA 3BV2A 3FMKA 4IDTA 2ITTA 4BCPA 3RALA 2F2CB 3D14A 5CT0A 4DGNA 2LGCA 4YZ9A 2A0CX 5AR2A 5AP6A 4MYGA 3EYHA 2VGPA 3QGWA 4WG4A 2C47A 3QX4A 3UVQA 4LI5A 4FSUA 1R0EA 2UZTA 3F3WA 3KKVA 4PUZA 2Y4IC 4NCTA 4DTBA 2QU5A 5CI6A 4FT5A 4YZDA 3WI6A 2QHMA 2VV9A 3GI3A 3QTWA 4EK3A 4FTQA 4NK9A 3ACJA 1Q8UA 3KQ7A 3EQIA 5FWKK 4DAWA 4BTMA 4IC8A 4G1WA 5EYMA 5DMZA 4B8LA 4AN2A 2Z7SA 1H25A 3V3VA 3LW0A 3PA5A 3KREA 4IX4A 1UU3A 4F70A 2ITQA 5KO1A 2F49A 4RX8A 1BI8A 3QX2A 4AOTA 3QTRA 4AZVA 2HCKA 5ETFA 4ASEA 1RJBA 3HUBA 3KRLA 5CENA 5EHOA 1QPDA 2C3KA 4FBXA 4NM5A 4M84A 4FC0A 3IS5A 2GMXA 2XUUA 4P5ZA 5CALA 4XG7A 4BHNA 3Q4ZA 2HZ0A 2OW3A 5AP7A 3ZLWA 3P7BA 3SQQA 3BYMA 2F7XE 5J9LA 2E9NA 3LFBA 4WT6A 3NUSA 4D4SA 3PIYA 2X6EA 4FKRA 4EC8A 4S33A 3BLHA 5FM2A 5JK3A 4NTSA 4Z16A 3JY0A 5TKDA 2ACXA 3PZEA 3MBLA 3BU3A 1KSWA 2YZAA 3PPZA 4TYEA 4BTJA 2QOFA 1YXXA 5J87A 2UZLA 2W7XA 3G90X 4E6AA 4RVTA 1GIJA 3TIZA 5BVOA 3BE2A 3OMVA 3TL8A 1W83A 3QQLA 4F6WA 4ZTNA 4U40A 2YIRA 2XMYA 3BQCA 1QL6A 1MQBA 3ATSA 5E91A 5HBEA 2GCDA 1G8AA 3SGCA 4PPBA 2X4ZA 1GJOA 2GHLA 3JVSA 5H3QA 4ITIA 3IGOA 4CRLA 4ZLYA 1NA7A 1PYEA 3VWAA 4FR4A 3E87A 3OTVA 3VUMA 3SRVA 3U6HA 4KA3A 4DT9A 2B4SB 4PDSA 3OXIA 5A54A 3C4WA 5K0XA 3I81A 2Y9QA 4PQNA 5M07A 3ZLXA 5BVWA 4IFCA 3B8RA 4A06A 4DH8A 1WBVA 3LZBA 3PRIA 3GCSA 4RC4A 5F9EA 5E8SA 4DLJA 2IZUA 1YXVA 1OB3A 3UOLA 3BYVA 5T6KA 3WARA 1JSVA 3LCKA 4Y83A 5J1VA 4FE2A 4F0IA 5GINE 3I7BA 1REKA 5ANGA 2BZIB 1DAYA 4DFXE 4M69B 4BBEA 3O23A
chains in the Genus database with same CATH superfamily
2XM9A 3JR1A 5K5NA 2IVTA 3UIMA 1FMKA 4K77A 1P4FA 1QMZA 4BY9E 4N57A 3BHVA 5HHWA 4I6HA 4BYIA 2W5BA 4QT1A 3OFMA 4O7SA 1YOMA 4MD9E 2UZNA 3JYAA 2NRYA 3OWLA 3DAKA 2ESMA 3GB2A 4FKLA 4BCJA 5IUHA 1ZMWA 4NCTC 3D4QA 5JH6A 3QZHA 4L45A 3FHRA 3KA0A 4EC9A 4UWYA 4I6FA 4AZTA 2BAJA 3DK7A 4R77A 3DT1A 4XLVA 3WYXA 5IA5A 4FKWA 4ZTRA 3MWUA 4NSTA 4UALA 4QQ5A 3NYOA 4J8NA 3ENMA 2BROA 5CYIA 5DLSA 3G0FA 1O6YA 3QZIA 4FKVA 5AR4A 3R7UA 5BUIA 3IW6A 4EORA 3NW6A 3LM5A 4E4LA 4B4LA 1J91A 1V1KA 5BYZA 4F9CA 3V5JA 4ZMEA 3Q52A 2PVKA 2UVYA 3QFVA 4O1OA 3MY0A 4JBPA 4AQCA 5AAGA 4HYSA 4CMOA 1JSTA 5E90A 3DK3A 5CEMA 3NNXA 4RT7A 4GFMA 1Y57A 4I0RA 4XRJA 4O7VA 5DYJA 2IZTA 4D2SA 2HXLA 2X4FA 3LFEA 3RK7A 1PXKA 4AN9A 2CDZA 1OMWA 3VS0A 4MNEA 3QLFA 3H0ZA 4J71A 4KNBA 4PPAA 5IQBA 3ETAA 3EQRA 4MXAA 3FV8A 2XALA 4FTAA 3PVUA 3ML1A 2W1CA 2UZDA 3D7TA 3DPKA 1WBNA 4S32A 3R8MA 3ZC6A 2WQMA 3C0IA 2I0HA 3PY3A 4FV7A 5IUGA 4D58A 3FQEA 4DEIA 3RNIA 2W05A 1ZYCA 4JOAA 3P08A 4G9CA 4I23A 5EM7A 5JGAA 3ULIA 4OAVB 3QQUA 2CGUA 4O7YA 1BX6A 3DZOA 5HO6A 4MBJA 4FV0A 3TM0A 3BQRA 2R3LA 2XNOA 3OEFX 4QDEA 3W2RA 2IG7A 2EB2A 4Z7GA 3BHTA 4BI2A 1KE7A 3TCPA 5HD4A 3CQUA 1Q3DA 3ELJA 2FH9A 2E9VA 1H01A 4RVKA 5EKOA 2A27A 2ZDTA 4IB1A 1M2RA 5GZ8A 3A4OX 5IA3A 5AV1A 2ZM3A 4FTKA 4ZLOA 3A7FA 5BYYA 4KIKA 3OWJA 1WBPA 1ZZ2A 2V7AA 5CZIA 4MWIA 4FK3A 3VUHA 1WMKA 2X6DA 4FRFA 2W4JA 3POZA 5CTPA 2ZOQA 2A19B 4RIXB 2X9EA 4ZIMA 4FZ7A 3PLAE 5M57A 4FL3A 5AAFA 3VS6A 2J0JA 4CQEA 2PZIA 3AXWA 5FEDA 3KY2A 3GCUA 4GFOA 2R0UA 3DGKA 3FLYA 3KIOC 3VJOA 2VWUA 4LQMA 4F7JA 4KKHA 5IISA 4H1MA 2HIWA 5AR5A 2OIQA 3LFFA 3FL4A 4O4EA 4DFNA 3KXHA 3R7EA 2WB8A 2XA4A 2VZ6A 4JXFA 5CU0A 4I0TA 4GK2A 4GS6A 4O4DA 4I93A 2XNPA 4OLIA 4Z7HA 5IDNA 3ORPA 4G6OA 2XK6A 5FBOA 3DQWA 4F4PA 4QMMA 2XEYA 5LMBA 2OK1A 3NWWA 4F7LA 2UVZA 4FV6A 5CXHA 4O82A 2PVNA 3W16A 4KINA 5H2UA 1HCKA 3CE3A 1WBOA 4FKGA 4YPSA 4DFUA 1JKTA 4IZAA 3A7HA 4GKHA 4HGEA 5IF1A 1WFCA 3GFWA 3HV5A 3R9HA 4EWHA 2RFDA 1W8CA 3F3VA 2G01A 2ITOA 2C30A 4DH1A 4CCUA 2DYLA 4FKIA 2OFVA 3CTHA 2C4GA 4I22A 3ZFMA 4FIEA 1KE8A 1NVRA 5CZHA 4C57A 4G9RA 4AW5A 4C61A 4F9BA 3UOJA 3ZXTA 4A4XA 4FTUA 4G2FA 3F3ZA 4I4FA 3RZBA 1I44A 2JD5A 4QMOA 5IA0A 3F69A 4BDHA 2F7EE 3PZHA 4YJTA 4F1OA 3FMMA 1G3NA 3AD4A 4FNXA 4OTIA 4KWPA 3F5XA 5LCKA 3KF4A 3UO5A 5BYLA 4D5KA 5J1WA 3LCSA 3Q4CA 5FEQA 4E7WA 1Y8GA 4O4BB 4I6QA 1APME 2WTKC 3TV6A 5AV2A 3DKGA 5C26A 2VX3A 3I60A 1CDKA 3RBWA 3O2MA 4XHKB 4EHGA 5ETAA 2PVYA 1XMMA 4ACDA 5CU4A 3RK9A 4PL5A 4GU9A 4QMYA 4FVQA 4W4YA 3KRRA 2UZEA 2YFXA 4FUXA 4YC6A 4BDJA 5KMMA 5AP4A 5EQPA 1OPKA 3H0YA 3QUDA 4TN6A 4IZ7A 2X2LA 3HRCA 3WIKA 3MA3A 3OT8A 4WRSA 5HBJA 1YQJA 2NYAA 1LPUA 3L9LA 3PG3A 2I1MA 4AZWA 4K6ZA 3V5TA 3NNVA 4ORKA 2HENA 3AD5A 5F94A 2BVAA 4QRCA 2OJGA 2WGJA 1U4DA 4AU8A 5CAUA 2BHEA 2DS1A 2G2FA 1LEWA 5E8ZA 4ZSJA 1A48A 2G2IA 2Y4PA 4BWKA 3DXPA 3R83A 3TNHA 3QRTA 3K2LA 3NRMA 3QA0A 4U45A 3TMOA 2FB8A 3P9JA 4NL0A 3UVRA 4WSYA 4F09A 3S95A 2WMUA 3TWJA 1LP4A 4G16A 4J98A 5EW3A 4O7RA 2XM8A 5CAOA 4RX7A 4FSQA 5I0BA 2UW3A 3U9NA 3R73A 3E7VA 3KK9A 1PW2A 2P3GX 3DLSA 1FGKA 3CD3A 4ZY4A 2YM6A 3FLNC 4HPTE 4ZAUA 5HE2A 2V22A 5HU9A 4BDEA 4V0GB 3KXXA 3LQ5A 4Q9SA 5KHWA 4RQKA 1UNLA 3NPCA 3QYZA 2GNLA 4DC2A 4WIHA 3SHEA 4LOOA 1E1XA 4OTWA 4LV8A 4S2ZA 4O0WA 1DM2A 4IANA 4E5WA 2VO7A 4M0YA 3SXSA 4W4VA 1XH8A 2ITZA 2RG5A 5BMMA 2UVXA 4LOQA 3BEGA 3D94A 5DFPA 1J1CA 4RJ4A 4HPUE 1OL5A 4GKIA 2OIBA 3AC3A 4QP8A 1T45A 4WOVA 1L8TA 3P5JC 2GS6A 4DF3A 3UOHA 3WE4A 3O17A 1IAJA 3UO6A 3PA4A 4EH4A 3Q32A 3EHAA 2O64A 4ZZMA 4CKJA 2PY3A 5DNRA 4EH3A 4F7SA 3ANQA 4FKTA 4XS2A 1Q99A 3GU7A 3MH0A 3ITZA 4O0RA 3MPMA 4C3RA 3AQVA 5I9XA 3G0EA 5LVLA 3REPA 3ZM4A 3H9OA 4PPCA 1Q97A 3BWFA 3DXNA 3Q5IA 4K33A 2XANA 3QTQA 4IAKA 3ZEPA 5FXRA 4C36A 2ZB1A 1F5QA 2BRMA 5HLPA 3M1SA 4O0TA 3SV0A 2QKRA 3ZO1A 1Q3WA 2YDJA 2OJ9A 4RG0A 2UZUE 2ZMCA 4FIFA 3W0QA 2A1AB 3EYGA 4AA4A 3EKKA 1ZLTA 5E9EA 1YHWA 4ZJJA 3ZO3A 3BU5A 3C4ZA 4N6YA 4OW8A 4QMZA 4RX9A 4IZYA 5CVGA 4RZWA 1OKWA 5EI8A 3UNKA 4AXCA 1K2PA 4QMVA 4QTEA 2A4LA 3VN9A 3VUKA 3CGFA 4E20A 5J7BA 2XIKA 3K3JA 4X7QA 3UMXA 3DFCB 4OTRA 3FMHA 1O6KA 1VZOA 3AGMA 3MN3A 4Z55A 5L3AA 1ST4A 1TFFA 2VN9A 5AJQA 5BV3A 3OCTA 5EM6A 5FP6A 1BL6A 2R3FA 5ACBC 2OXYA 4PV0A 3VAPA 1PKDA 4LGHA 4O38A 4JG6A 1TQIA 4I5HA 2JGZA 1YWNA 2BUJA 1OKYA 3UIUA 3O8UA 4ANQA 4BZDA 4TL0A 3HRFA 3DKOA 3NGAA 4E6CA 4E93A 4O86A 3PY1A 4C4GA 1U54A 5M06A 2BILB 3FXZA 3BLQA 4R3CA 4LM5A 3NIZA 1AGWA 4O4CA 1B38A 2R3MA 1NVQA 3IOPA 2QVSE 3UIBA 4G17A 2C5OA 5JGBA 4KRCA 4DH3A 1PMVA 2Q0BA 3TKUA 3ZLSA 4YJUA 2W1EA 4JIAA 4FV3A 3TZ8A 1P4OA 4MTAA 2P55A 3FPQA 4G3GA 4BHZA 4XUFA 2BRGA 3VONA 5DR2A 2C69A 4Y95A 2QOHA 2IW9A 4E6DA 4L3LA 1YI4A 4BDFA 2I7QA 3ZUTA 3MIYA 3DFAA 4FK6A 4RWLA 4XBRA 2CKOA 2WTWA 2ETMA 2E2BA 5GIPE 3CTQA 3E8EA 2RFSA 4TPTA 4U6RA 1YXTA 4DEAA 4M97A 3KL8A 5A6OA 4JDJA 3MFUA 4FGBA 2PMIA 2VUWA 3ZEWA 2XARA 2PZRA 4I1ZA 3AC5A 5HEZA 2CKPA 3A62A 5AP0A 2ETRA 2YCSA 5HNIX 3KF7A 3G5DA 2JDVA 2PTKA 3EQHA 5HKMA 2WD1A 3FLWA 3KB7A 5HORA 2BAKA 2HXQA 5JRSA 4BFMA 2R3RA 2YITA 3L9PA 5HGIA 4D9TA 3RPSA 5EDPA 5IUIA 4M0ZA 3W0RA 4XH6A 5IA1A 4FTMA 5IDPA 2XIZA 4QYFA 3A60A 4YUQA 4FI1A 4E4MA 4FTRA 1ZOEA 5CLPA 2GNHA 3VW6A 1P14A 5FEEA 3ORTA 4AW2A 3GVUA 4BVUA 5JRQA 2RF9A 2OSCA 3OUNB 5J95A 4O84A 3S4QA 1GIHA 4L53A 4USDA 2J7TA 3IDCA 4CT2A 3FI4A 5C01A 2YISA 4EHVA 4RJ5A 3ZSGA 4DITA 1FBNA 4CTBA 1G8KA 3E3BX 4J7BA 3LOKA 3LJ2A 4XNEA 3V5LA 5AP2A 5AUXA 2UZVA 3V5QA 4ALVA 4EUTA 5CEOA 5DN3A 4AE9A 4ASZA 3HMPA 4O0SA 5A9UA 3F88A 3I6WA 2R5TA 4A4LA 3SXFA 4MD8E 2HOGA 4ZXTA 1KV2A 5HOAA 5BPYA 4YZMA 2W06A 3R8ZA 3PG1A 4D1ZA 4C4IA 4CFUA 4E1ZA 5TF9A 3O8TA 3RI1A 4FT9A 5I9VA 3V5WA 3PRFA 4MEDA 2I0YA 3RZFA 3OW4A 2QURA 4YTFA 3EB0A 3GCQA 3NDMA 5CEIA 3N4UA 3TYKA 3L8SA 4DHIB 4BCKA 4NFNA 4DEHA 3NUXA 5EI2A 4Q5EA 5HNBA 3EQBA 4CFWA 4AE6A 3T9IA 5FXQA 3VO3A 3R8PA 4E3CA 2ZV7A 4GIHA 3QKKA 3HMNA 4RWKA 3ORZA 3VRYA 1P2AA 4WD5A 3N4VA 3R04A 5KZIA 4FJVA 4NT4A 4M68A 3Q6WA 3DDPA 4U80A 4XG6A 1NY3A 4R7IA 3D7TB 5L2IA 2V55A 5CSXA 4ALWA 2O5KA 3PIZA 2R4BA 2IVVA 3EZRA 3MB7A 1B39A 2RIOA 4V05A 4AAYA 4DFBA 2Y6MA 4BIDA 4OBPA 1SM2A 2FO0A 4FSMA 2ZAZA 4JDKA 3CY3A 5I9ZA 5IQFA 5I3OA 4RFZA 4ZSGA 3GC8A 2NRUA 1FMOE 4BJJB 5HICA 4F99A 2C6MA 4FKPA 2ONLA 3ZRLA 2GHGA 3Q6UA 1Y6BA 3FWQA 1OVEA 4FSZA 5EQEA 2QG5A 2E9UA 5E92A 5D1JA 4CV8A 5IEYA 4RJ7A 3DNEA 3E8DA 4XP3A 3R01A 5EI6A 5AMNA 2OF4A 2AUHA 3U55A 4FT7A 4YURA 5HD7A 5C8MA 2QOLA 4D4YA 3CGOA 4KIKB 2GDOA 4O7ZA 3AGLA 4G6NA 4ZP5A 5HU3A 5IQDA 3FLQA 3EN4A 3HRBA 4OAUC 2CN8A 3P1AA 2YAKA 2QU6A 3OBJA 4YHJA 4JS8A 2WMWA 4FT3A 2PVMA 4U97A 4DDIA 1ERKA 4DE4A 2ERZE 2BZHB 3FUPA 1GAGA 3EH9A 2VWZA 4RRVA 3BRBA 4ZOGA 5GZAA 4RGJA 4C2VA 1J7IA 2QO2A 3MH1A 3UG1A 2O8YA 2XZSA 4LGDA 4YO4A 4BTKA 3PXKA 3R0TA 3UNZA 3LXNA 4CEGA 2VTOA 1U59A 1DI9A 4I0SA 2QHNA 4DFZE 4D1SA 4EKLA 3DJ7A 2QOQA 4G31A 1XH9A 2UW7A 2RGPA 2VX0A 4Y72A 2VAGA 3Q9YA 2JKMA 4V0GA 3HDMA 4FUYA 5LMKA 4D0XA 3CKXA 4P4CA 2F7ZE 5LOHA 4EOJA 1PRYA 4GCJA 4IE9A 3C5IA 1JBPE 2YIQA 4EL9A 4DH5A 4ENYA 4XX9A 1H00A 2QR7A 4GUEA 3W2PA 3F66A 4KD1A 4QTAA 3DU8A 1IASA 2B53A 2X2KA 3NW5A 5KMLA 5CF5A 2VTHA 3CCNA 4E5BA 4XG4A 3RTPA 4DG0E 4QDVA 5E1EA 3L9MA 4IB3A 5AUWA 4EYJA 1WBSA 2VTIA 1Y8YA 2XK3A 4UYAA 1TZDA 3B8QA 1PHKA 4W4WA 2RL5A 2C3JA 4L42A 5CU6A 5M4IA 5J5SA 3PFQA 1JSUA 3WZUA 4UXQA 4X6QC 3KRXA 3W2OA 1OKVA 4Y85A 3OD6X 3L8PA 1Q8TA 4AXFA 1UNGA 4O0XA 3EL7A 4AT4A 4CNHA 3LJ0A 3VS4A 2EB3A 5EW8A 4ITHA 5AM7A 3HUCA 1G8JA 3LVPA 2XRWA 4EK5A 4KB8A 5HQ0A 2ITPA 3EWHA 4O7TA 3AC8A 2PVJA 2JLDA 5IQHA 4YPDA 5IH4A 1SVEA 2FYSA 3MH3A 3F82A 4YJVA 2ONLC 4FG7A 4LMNA 5IQCA 4L3JA 5E8WA 3DJ5A 5C1QB 5HNGA 3MFRA 4BWPA 3BHUA 3LXLA 2PK9A 3KVXA 4NJ3A 3ZLYA 3ZSHA 4CFMA 1FVRA 4RIYA 4WSQA 2JAMA 2YM7A 2OZAA 3E63A 5H8EA 5DBXA 5AUUA 4KBAA 4DG2E 2Y8OA 4YJQA 3BE9A 1H1WA 2AC3A 3LAUA 4BCHA 3GU4A 3BKBA 3Q2MA 3WZJA 4F0FA 4CG9A 4N0SA 4BZNA 4F6SA 5CVHA 2YN8A 3D5XA 2C6OA 5HVKA 3ROCA 5ANOA 5CSWA 4U3ZA 4LRJA 1AQ1A 3OY3A 3BLRA 4KABA 2Q0NA 3G9LX 4ZTHA 3VHEA 2C3IB 2YIXA 4BGHA 3LIJA 4UEUA 3QD4A 4U9AA 3RWQA 3QHWA 2PUUA 5CSHA 1BYGA 4A9SA 4FKQA 1YDSE 4JL9A 3ZO2A 4FZAB 3UIXA 3EJ1A 4BCOA 4FEQA 3E64A 3OF0A 2Z7LA 4E8AA 5B0XA 5D41A 4XV9A 4LRMA 5DR9A 3SW4A 3TUDA 2XNNA 4PMPA 5T3QA 4GYIA 2PHKA 3OXZA 2WTCA 2YCFA 3A7JA 4OT6A 4DEGA 5IMXA 5LMKC 1M14A 3PVBA 4QQCA 4UZHA 3G6HA 2GTNA 3B2TA 2Y7JA 3ZXZA 3L8XA 3MJ1A 4JR3A 3CXWA 2AYPA 2CGXA 4BDGA 5BMSA 1EH4A 2BTSA 4ANBA 3LMGA 3MVMA 2PUPA 5FTOA 3F3TA 4IMYA 4O27B 1UU8A 1Q5KA 4I5MA 4ID7A 3OC1A 5FDXA 4GEOA 4Y5QA 3C9WA 2QQ7A 3QD0A 4P7EA 3FXXA 4X2KA 4DTKA 4PMTA 4ZZNA 5DH3A 5EKNA 2XBAA 3I4BA 5M51A 2VU3A 4W4XA 2OLCA 5CEPA 3PYYA 4RVMA 5TR6A 4FNYA 3SG8A 2HW6A 5BVNA 2C6LA 4EHEA 5AWMA 3JXWA 4OTHA 4WG5A 3ANRA 2IO6A 2J90A 4WBBB 4PDPA 3QTUA 1BI7A 2KULA 4YBJA 3UG2A 5KZ0A 3AT2A 3UNJA 2G15A 4FOBA 3MY1A 4AP7A 4IM2A 1ZRZA 2ZDUA 3QA8A 5TE0A 1ZY4A 3LQ8A 3BHYA 4PL3A 4A9UA 4U0IA 5GHVA 4FTLA 5IMEA 2WMAA 4UZDA 4XG3A 4CRSA 4C38A 3I6UA 3IECA 4AG8A 5FXSA 3VQUA 5HCYA 4GT5A 4XYFA 2CN5A 2BIKB 2HAKA 2XK8A 3RAIA 4EONA 3UP7A 1SYKA 4MQ1A 5CXZA 3BZ3A 2YCQA 1WVXA 2HW7A 4ANOA 4C4FA 2GQSA 3LE6A 4DYMA 3D5WA 1J7UA 3HEGA 3HMIA 3KMUA 2W17A 4MAOA 5BVKA 4ZJIA 4BC6A 4CQGA 2F9GA 3HYHA 5AV3A 2WO6A 2PPQA 5HVYA 4YNOA 1SZMA 2SRCA 3W1FA 3SOCA 5A4EA 5JN2A 2J0IA 5AM6A 1QCFA 2A98A 3C7QA 4K0YA 3PTGA 3VBTA 1S9JA 3ZUVA 4ACGA 3TUCA 5I4NA 5AR8A 3TJDA 4CD0A 5J5TA 4XP0A 2EVAA 1YOJA 2O3PA 3DTCA 3GU6A 3KCFA 4RC3A 1DI8A 4AFEA 1QPEA 3CR0A 4U7ZA 3BELA 3QTZA 1U54B 3MESA 3EFLA 3RPOA 4AT5A 1OL2A 5AIRA 3CJGA 4F1TA 1OIRA 3TTIA 3P7CA 2XK4A 3QTSA 5A6NA 2R9SA 4FIGA 1MRVA 2P0CA 4BIBA 5B2LA 5FDPA 4PDYA 4AW1A 3U6IA 2BCJA 3IOKA 2JDRA 2RG6A 2PZYA 3DTWA 3EQGA 2GU8A 4F7NA 1YRPA 4A9YA 1Q41A 3CS9A 2W1HA 4RIOA 1PYXA 3IPHA 3V8TA 4BJJA 1H08A 5DIAA 4NM7A 5EM5A 1OL6A 2J0KA 4OUCA 1Z9XA 2VWXA 3QQKA 4G6LA 4UYNA 1IEPA 3IDPA 4GK4A 2I40A 2IZSA 2BRBA 4QMLA 4AZFA 2GNJA 4ZLZA 5ANJA 4UV0A 5KMNA 3F6XA 5HG7A 1XBBA 2FA2A 2RFEA 3ODZX 4I4EA 5AA9A 4KAOA 4C7TA 3DZQA 3UGCA 3D7ZA 4PL4A 5HBHA 4FV1A 4JIKA 4YSMA 1XBAA 3S0OA 4FZ6A 2OJIA 3G9NA 4HYHA 3UC3A 3DBFA 4EOPA 5M4FA 4IEBA 4JQ8A 5AX9A 5AFVA 5IZFA 2WEIA 5HZNA 3D0EA 2WNTA 3VBYA 4YMJA 1PKGA 2C0OA 4J1RA 2ITXA 3C50A 5L2QA 4JLCA 3OWPA 5ANIA 2O63A 3CPBA 4L8MA 5EDQA 2R3IA 3BPRA 4N4SA 4C4EA 3WZKA 3GOPA 5CVFA 4JVGA 4A9RA 2W1DA 5CF4A 4NU1A 3PDTA 3RKBA 4CG8A 3LFCA 4PTEA 3KN6A 3V6RA 5AP1A 4IACA 2NO3A 4IAYA 1Q24A 5JFSA 1H24A 5FQDC 4BGQA 5L8LA 2PVHA 3OZ6A 3Q9WA 2IW6A 1V0PA 3WF9A 3D5UA 1Q61A 4DGGA 4F63A 3HP5A 4HVHA 3BGZA 4YJRA 4MXXA 4RX5A 5FUTA 1CKPA 3OVVA 4AQKA 3HNGA 4RQVA 2CCHA 5K3YA 2V5QA 3OXTA 5T68A 2J2IB 3FY2A 4EYMA 3ERKA 3I5NA 2EU9A 2RFNA 4K9YA 5L2TA 4MBIA 4FIHA 1ZOHA 3TEIA 2BKKA 3BLAA 3M11A 4XV1A 5EYKA 3RPVA 1H28A 4XOZA 1KOBA 4AAAA 1YHVA 2XYUA 3KFAA 1VLRA 5I3RA 4E4XA 3QD2B 4CV9A 3MH2A 4ERKA 2JFMA 3D2KA 1ZYDA 3NW7A 3PPKA 4LOPA 2JBOA 3BYOA 4DHJA 4DEBA 3GENA 4WNKA 4EHZA 3FYKX 4BKYA 5KNJA 4JX3A 4EWQA 2IWIA 3CEKA 4HCTA 4D2TA 3FZPA 4U81A 5GZ9A 2ZM4A 2PMLX 4D2PA 2WMQA 4HVGA 3ZFXA 5LJJA 4ZSAA 3E92A 2YM4A 4WKQA 4TTHB 2ETKA 4PF4A 2OBJA 5HTBA 4UN0C 2YWPA 2EWAA 4QQJA 4BCIA 2W9ZB 4U43A 4ACMA 4DT8A 3R1SA 2PL0A 5C4LA 3R7IA 2WMRA 3NUYA 4GFGA 5CY3A 4CYIA 2QLUA 4OBQA 4F78A 3UPXA 5IH6A 2YZLA 4J52A 1Q62A 1ZARA 3OT3A 4O81A 4QP6A 5IQGA 4MCVA 4RA4A 3BU6A 2PMNX 1ZAOA 3EN5A 4Y8DA 2X7OA 1GY3A 4U41A 1OL1A 1YXSA 4DLIA 5HO8A 4G34A 4WNOA 5JKGA 1VYZA 4R1VA 5KE0A 3WBLA 4O22A 3PWDA 4DEEA 2R64A 3FQHA 4FZFB 1YI6A 2HZNA 1OL7A 4LV5A 4QYYA 4X2JA 1UWJA 4Z9LA 1U5QA 2XIRA 5HO7A 4DH7A 1XJDA 3ODYX 3AG9A 2BDWA 4DINA 1PXMA 4QMUA 3L1SA 2X8DA 4YHTA 4FKJA 4H3BA 3BGPA 3ZMMA 3CSVA 3CKWA 2HY0A 5HE3A 2X0OA 2J9MA 4QTBA 4U79A 3OP5A 4C58A 3UDTA 4Y73A 4ANLA 3F5UA 4IIRA 3MDYA 3SVVA 3B2WA 3TV7A 4L01A 1B6CB 5J9ZA 3CPCA 4BCFA 2W0JA 4CKIA 2XAOA 2IF8A 4JBOA 4QP7A 5DA3A 5JZNA 4ARKA 5IQIA 1PMEA 4AGWA 3IK3A 3OW3A 4LMUA 5C8NA 1CTPE 2OICA 2P33A 3P86A 4BI0A 2OZOA 1PMNA 3MTLA 1H0VA 2QD9A 3DLZA 2R0IA 1V0BA 4IX6A 5AP5A 3L9NA 3UOKA 1OPJA 4HJOA 3II5A 4D28A 4FIIA 1Q8ZA 4FTIA 1H27A 3O7LD 5LVNA 3PSCA 2V0DA 3ZTXA 3G51A 1WBTA 4YC8A 4CYJA 3OWKA 4EEVA 1KE6A 1IR3A 3R63A 4K18A 2QI8A 3IONA 4P5QA 1M2QA 4L46A 4YLLA 5EK7A 4EH2A 4C62A 3AT4A 4J8MA 3PXRA 4YNEA 2R3JA 4CVAA 5C4KA 3TV4A 3VVHA 3V5PA 2YJRA 3KGAA 1ZYLA 2JDSA 3NYNA 4L52A 5L6OA 4JX7A 3MFSA 3R8VA 3P7AA 4AW0A 2WHBA 2R3NA 4FT0A 3QRKA 5K9IA 4L44A 3R2BA 4C35A 5IA4A 4QMTA 4IB5A 3BBWA 4IVAA 3R71A 3O0GA 4QPSA 4A07A 3TTJA 1JKLA 3PE1A 3H9FA 5FRIA 4USFA 3TXOA 3ZRMA 3QUEA 2X1NA 3QKLA 4QP3A 4RC2A 1XR1A 1ATPE 2BKZA 2Q83A 2BDFA 3OOMA 3F9NA 3RM6A 2YA9A 3ZBFA 2XB7A 4ZZOA 4BTFA 3R9DA 4BDBA 4H36A 1J3HA 2VTJA 3OTUA 3RINA 5L6WL 2QOOA 1A9UA 4YO6A 2OO8X 3BV3A 1W2CA 1Q8WA 2WOTA 3OG7A 4B9DA 3H4JA 5DI1A 1ZXEA 4RIYB 5ACKA 3U51A 2OZAB 3FMJA 3LFDA 4FEVA 3MIAA 1PMUA 2VWWA 4N6ZA 4J96A 5BQ0A 3BYUA 1UKIA 2UW5A 4XRLA 4UMPA 1OITA 3EOCA 4FKOA 5KUPA 2G2HA 3NYVA 2YDIA 4FTTA 1KUTA 4FG8A 2PE1A 4HZRA 2F2UA 3MJ2A 3PP0A 2HZIA 4WBOA 3TG1A 4DG3E 1BMKA 3HV6A 1U5RA 1GZKA 3CY2A 3FZOA 3N9XA 3BIZA 3O8PA 2C0TA 3Q4TA 4HCVA 3RHKA 4OBOA 4DTAA 4JR7A 3W8LA 4AGUA 5CF8A 3G6GA 4WO5A 3DA6A 2H34A 5JGDA 1UU9A 4TY1A 3GT8A 4NEUA 3I5ZA 5LWNA 4BDDA 2B1PA 4EZ7A 5A46A 4RVLA 3DK6A 3DBEA 4U42A 4PNIA 1OKZA 4FVPA 3EN7A 3OHTA 1H1RA 1ZWSA 2YM3A 5L6PA 3Q4UA 4GVAA 4IAAA 1NT2A 2XCHA 3HV3A 3LCTA 3UTOA 2VD5A 3UZRA 2DWBA 4MD7E 1M17A 4ZSEA 3VBQA 2YWVA 2HYYA 3E62A 3Q5ZA 3A7GA 4ZY6A 3WOWA 4IAZA 4APCA 5IU2A 4CLIA 1UKHA 5LVPA 3R00A 2AQXA 4JAIA 3WF6A 4NWMA 1DAWA 1H0WA 5L8JA 1PXLA 5GIOE 3P79A 3PE2A 5JQ5A 3VS2A 3UODA 2Y6OA 2XJ0A 4N70A 3ZDIA 3PXQA 3SKCA 3U9CA 1FVVA 1MQ4A 3BBTB 5CEQA 3HA8A 3TI1A 4X2GA 4S31A 4M15A 1XH4A 2RKUA 3W0PA 3MA6A 5IQEA 4AZSA 4CLJA 2W4OA 4IM0A 4EOOA 3ZOSA 3ZRKA 4FVRA 5DEYA 5I9UA 4AOJA 4YSJA 4JT3A 2E9PA 4PMMA 4RWIA 3ZYAA 2PE2A 3ORMA 4H3QA 2PVRA 4AGCA 3FKLA 4PDOA 4B8MA 5FTQA 3UQCA 2JITA 2QC6A 3JUHA 5EHYA 3WF5A 4QTDA 5DE2A 2WMVA 4CCBA 3K5UA 3TNWA