1Z5MA

Crystal structure of n1-[3-[[5-bromo-2-[[3-[(1-pyrrolidinylcarbonyl)amino]phenyl]amino]-4-pyrimidinyl]amino]propyl]-2,2-dimethylpropanediamide complexed with human pdk1
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
286
structure length
275
Chain Sequence
b'PRKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEYLIFQKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTPPKLT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-phosphoinositide dependent protein kinase-1
publication title Novel small molecule inhibitors of 3-phosphoinositide-dependent kinase-1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 75
structure length 275
sequence length 286
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2005-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1z5mA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1z5mA01
3KXGA 3DPKA 4FV9A 3FI3A 1QMZA 3HMIA 5H8EA 4KBKA 4UZDA 4ZS0A 5EW9A 4C34A 3OWPA 2QVSE 3EN7A 4QT1A 3A4OX 4YSJA 2HYYA 4O22A 5L2IA 3NUAA 2Z7SA 4ASDA 5HBHA 4DEEA 1KE6A 4E73A 5A6OA 3TV7A 3TNWA 2BTRA 4BIBA 4DLJA 3A8WA 4MBIA 4BF2A 5CEOA 5HNBA 4GW8A 4DBXA 4RVTA 3IGOA 4R1VA 4RWIA 4X3JA 5EFQA 4R7HA 2ZMDA 3L8PA 4J1RA 1K9AA 2ITNA 4D5HA 4D4YA 3OWJA 4QTCA 3LFBA 4OTFA 4FV3A 1OPJA 2FGIA 5B2LA 2PZ5A 4C61A 2CNUA 3GUBA 4YZNA 3D7TA 4QMMA 3BHTA 2OK1A 1RE8A 4M13A 5GNKA 2XKDA 4GUEA 4MXZA 4X2GA 5ANIA 2ESMA 1XBAA 3VVHA 5AUTA 3ORLA 1REKA 1Y8GA 2PY3A 4YURA 1M17A 2B9HA 3WE4A 1SVHA 3BQRA 4CLIA 1X8BA 3NAXA 2WOTA 2XIRA 4OTQA 2LGCA 4F09A 4DTBA 1OKZA 4BDDA 3LQ3A 5AWMA 5HBEA 1L8TA 4MD7E 3S1HA 3PIZA 4XG9A 3ATTA 5C03A 4BI1A 2C0OA 2W1GA 3ULIA 4BCPA 4YTCA 4DTAA 5FRIA 2HCKA 1BL6A 2CMWA 2Y4IC 3K54A 3QTXA 4TWNA 4B7TA 3A2CA 3ZZWA 4V0GA 1P4OA 5JGBA 4O0XA 5AM6A 1TQPA 4Q9SA 4A9RA 4CD0A 3D5WA 3TWJA 4AW0A 3C4ZA 3FJQE 3L8VA 3MFUA 4TL0A 5BVOA 4YP8A 5CAPA 3CJFA 4E7WA 4PNKA 5IA2A 3O7LD 3MA3A 3KRXA 4ITJA 4L3JA 3RKBA 3S2PA 4EJNA 4CVAA 3FQSA 5CZHA 2WQEA 2YHVA 3WE8A 4C59A 5JFWA 4MHAA 4EK5A 4NW5A 4FG9A 4BZNA 4QTEA 5L2WA 4RFYA 1RDQE 2FH9A 4EKKA 4GKIA 4C4FA 3OUNB 5CX9A 4NIFB 4ZSJA 1JKKA 4I5HA 2H96A 2I0YA 3AC1A 1OL2A 4FTJA 2IWIA 1JVPP 2GFSA 4QMXA 3G5DA 5ETIA 3W2SA 5FXQA 3I81A 3PLSA 1Y57A 2WMBA 5FG8A 5LVNA 3GBZA 3MIYA 4DINA 5F95A 2OJGA 2YN8A 3FMKA 3FXXA 3JVSA 4YGAA 2WTCA 4FNWA 3LJ1A 1OBDA 3U54A 3HKOA 5HORA 3ORTA 1H24A 5IUGA 5CU4A 1JWHA 4L67A 2HOGA 4IM0A 2OH4A 4HVDA 2UZTA 4WNKA 4DEHA 2QU5A 2HZNA 2QOBA 4QNYA 1JOWB 2VD5A 4QP1A 4BTJA 4LM5A 4H05A 3QUEA 4CT1A 4U6RA 5K4JA 2CGUA 4I0RA 2C69A 1PXPA 3ORNA 4TYJA 4DAWA 1HOWA 2J0LA 4MKCA 2WMSA 4F1MA 1Q8ZA 3ZRKA 3PXKA 3DDPA 2VAGA 3F7ZA 1B39A 4CFFA 4JG8A 3LCDA 4YJPA 1KE8A 2R9SA 1G3NA 3OWKA 2P2HA 4O6EA 1BL7A 4AW1A 2GNLA 3EQPA 3DKGA 3FLNC 4FIGA 5BVNA 1YI3A 5LCJA 2R3RA 1FVVA 2OSCA 3R01A 4RC3A 3D2IA 5AP4A 3P7AA 3CGOA 4AA4A 4ITHA 4CFMA 5DRDA 2YAAA 1KWPA 1CDKA 1R3CA 3RPSA 5HVKA 1PW2A 5T6KA 4G1WA 4BDIA 1JSUA 5IH6A 3ACKA 4GEOA 3VO3A 4ZTQA 3SAYA 1TVOA 2OXYA 5FQDC 4GG5A 2PULA 2IW9A 4G3EA 5M44A 1YHVA 4YSMA 5E1SA 4EWHA 1Y6AA 5B7VA 3GC8A 4JLCA 2ETKA 3E8DA 4IEBA 4ASEA 3PLAE 4O1OA 5AV1A 4DEIA 5AP3A 4ALVA 5T68A 2Y6OA 4RX7A 3N9XA 4D5KA 3QCQA 2VUWA 4AGUA 4ERWA 2J50A 4FTRA 4Z7GA 3PSBA 4I23A 4D1ZA 3RP9A 2W1IA 4BTKA 4D2RA 3CR0A 2BAKA 4S34A 1M2PA 4IM2A 4ZJJA 4ARKA 5JT2A 1YXUA 4IMYA 4TXCA 3PXYA 5EM6A 2DWBA 4BKJA 4C3FA 3RVGA 4QNAA 4YJSA 2DQ7X 3H9FA 2R3IA 1JKSA 2YEXA 3GQIA 1WBNA 5F9EA 4UWYA 3IW4A 5BYLA 3MVMA 4NCTA 4OTDA 3ZO1A 3QTIA 1JPAA 1V0PA 3QCYA 4FNXA 2WIPA 3LXPA 4RQVA 3VBWA 3S4QA 4ZIMA 4JS8A 4YNOA 3OW4A 2PU8A 1H00A 3R9DA 3GU6A 5CZIA 3FYKX 4RIWB 4RQKA 1YVJA 3G90X 4GG7A 5DBXA 1AGWA 3V5TA 3F2NA 3JVRA 3ORZA 3CGFA 1PXKA 1B6CB 4BDBA 3ANQA 3RINA 2ZB1A 5CEPA 2WU7A 4FICA 2H34A 3LLAA 4M0ZA 3VUKA 1UKIA 2FA2A 4ZJIA 5IU2A 3IW6A 3NRMA 3DU8A 4I4FA 4M67A 4YLKA 4H58A 4EHGA 3NS9A 5L2SA 3TUBA 5IQGA 3HAMA 4FT7A 5JQ8A 4C2WA 1H27A 3DJ6A 3E8CA 2BFXA 2BFYA 3OBJA 4LMUA 2PPQA 5DT4A 5HX8A 4TT7A 2CDZA 3UIMA 2W1ZA 3AGMA 4QMOA 4QTAA 3OS3A 4PX6A 3PA4A 5GJDA 2YLEA 3ZBXA 2UUEA 3W32A 3QHRA 1DI8A 1JSTA 2R3LA 1CMKE 4EYJA 4R78A 2UZWE 4FIFA 3AOXA 5H8BA 5GJFA 4FTAA 1UV5A 4D4RA 2F2UA 2Q83A 2PK9A 2E9OA 4LL0A 1YRPA 4JIAA 5EHLA 2QQ7A 1LUFA 2G01A 5LMKC 2BZHB 2VZ6A 1M52A 4DGMA 3O8TA 3CKWA 3CXWA 3G2FA 4WG3A 5BUIA 2A19B 3ENMA 1U5QA 4WNMA 4M97A 4CYIA 4IWPA 5BMSA 5IA0A 3DBQA 3LFDA 4CV8A 4KUJA 4GYGA 1E1XA 3PXRA 2ZM1A 3ZFMA 4EOPA 3DAJA 3VQHA 5DT0A 2R3PA 3VS5A 4ACMA 3W55A 4DGOA 1YOLA 2XEYA 5A4CA 1UNLA 2I0VA 4QTBA 3DXNA 4C37A 3BBWA 4RPVA 4MX9A 4OGRA 2W0JA 3V5JA 3AMAA 4IQ6A 4C4GA 4A4OA 4MXXA 4ZZOA 2X4ZA 5DPVA 3LXNA 4GUBA 3NUXA 3NR9A 1TQIA 4DFZE 1GZ8A 3LLTA 3PJ3A 2QOOA 4P5ZA 3VF9A 2PMOX 4JBVA 4EK8A 3DB6A 4FTCA 3LCKA 4ZTNA 3TKIA 3N4TA 3Q4TA 4BCFA 3EMGA 3GXLA 3IW5A 2C3KA 4MNFA 1IASA 3U87A 3BCEA 3GI3A 1UWHA 5EI6A 1SVEA 4FV1A 3EFJA 4IXPA 3DK3A 4NUSA 2WMQA 1W7HA 2B0QA 3IW8A 5IH5A 4D1SA 3G0EA 5A6NA 3NUPA 4I93A 3NW5A 4YJNA 5E92A 5FUTA 5GZ8A 4N4SA 3MV5A 4G6NA 2WTKB 4XBUA 5ETFA 3GOKA 5LVLA 5L8KA 2DYLA 2XRWA 4RC4A 4GS6A 3RK9A 2RG5A 2W06A 2OF4A 3RK7A 4YLJA 4QQ5A 2BKZA 4I3ZA 2ITUA 4LG4A 3TZ7A 3D7TB 3FHRA 4DHFA 3NNUA 2JEDA 2RSVA 2EXMA 3E93A 3O8PA 3R04A 4RIYA 1G8SA 5LVPA 2G9XA 3E62A 4HPUE 3QL8A 4AACA 2W5HA 3OVVA 3ZO2A 4X3FC 3LOKA 5I9UA 4FSNA 3EOCA 4MVFA 3WZDA 1P14A 4GK4A 5I9XA 3DTWA 3PIXA 2W4JA 5M06A 4AF3A 2Y4PA 4HNIA 3CPCA 4EH3A 3CY3A 2QU6A 3BHUA 4AOJA 3ORKA 4EH8A 4G3FA 3DCVA 4BCGA 4U97A 5C8NA 4M0YA 1MRYA 4AN2A 3UOHA 5AX3A 5E8YA 1UVRA 4DFXE 4L44A 4L68A 4OAUC 2F2CB 3PXFA 1Z5MA 2PUNA 3V04A 2CPKE 2CNVA 5E4HA 3EFKA 4XYFA 3SX9A 4BZDA 4M69B 4YTHA 4EBWA 3R71A 2VX1A 2GNHA 4U7ZA 2EB2A 3FUPA 3F5PA 3QZFA 3WF8A 3MDYA 3PWDA 3P23A 5EI2A 3R7GA 4LOOA 5E8VA 3A4PA 2BDJA 2BHEA 1VR2A 1WCCA 3ZDUA 3QD2B 4BKYA 3Q4CA 4QYYA 3NUUA 3Q9YA 4YJOA 2ZV2A 3SDJA 3ETAA 4GYIA 4ANLA 5EM7A 2JIVA 2UW6A 4X6RA 4YPDA 3MA6A 5HU9A 5J1VA 4ORKA 1Z9XA 2UVYA 4G3CA 4QMUA 3UVRA 4DGGA 5EYMA 3QQLA 5M55A 4IB0A 3EN4A 4IVBA 2ZJWA 2PMIA 3QAME 2UVZA 2Q0BA 3IK3A 3FYJX 1NT2A 2YERA 3UP2A 3G15A 4KIPA 2YDIA 1BKXA 3PVWA 3QTSA 3FKOA 4JDJA 3FMNA 3QCSA 4AX8A 1R39A 4QMTA 4J95A 1LP4A 3HMOA 3KL8A 4JR3A 4BGHA 3PY3A 3DJ7A 5IQDA 5EHYA 3PIYA 3UVPA 5HTCA 4PL5A 2VTRA 4I94A 4P4CA 1GIHA 2X2MA 4FKJA 4QOXA 3PA5A 4RT7A 4YJVA 3VS2A 4HVSA 2CNQA 5E90A 4CQGA 4H3QA 3AG9A 3OTVA 4CQEA 3GCPA 3RI1A 3PY1A 3Q5ZA 3HA8A 4CSVA 5CU6A 2OZOA 3QRKA 4Z3VA 4XG7A 1OL1A 5CF4A 1YDTE 4A9TA 5ANKA 3KRJA 5L6PA 3UJGA 4KIQA 3I7CA 5KMMA 2PVLA 5D7AA 3BE9A 3D83A 4YJQA 4C4JA 5KMKA 5K5NA 2BRNA 4CTCA 2JDVA 5I5ZA 1BX6A 3T3VA 3IPHA 3PVUA 5T3QA 2QG5A 3TDVA 3CY2A 4IAZA 4RSSA 3ZLWA 4D28A 4JQ7A 3AD4A 2WMXA 4RLLA 5H3QA 4LQMA 2NRUA 1UU3A 4ANQA 4BCQA 2X81A 2OI4X 5DEYA 4L43A 4CKJA 3FMHA 1XH4A 4HYSA 2HZ0A 4G34A 1DAYA 2R5TA 4NIFA 5IUIA 5EOLA 1AQ1A 3ZM4A 2XCHA 2PUUA 3LFCA 2VWZA 1H1RA 4G5PA 4EK6A 4WNOA 3PPKA 3AGLA 3QWJA 4UMTA 4A9YA 4NM3A 4AGDA 4XX9A 4Y46A 4BKZA 4N6YA 1JAMA 2XIZA 2H6DA 4PTGA 5HG7A 3UPXA 1DS5A 3GU5A 4EOSA 2ITZA 5DLSA 4UN0C 3E63A 1Y6BA 1GZOA 3NNWA 2WQBA 2CLXA 2ITWA 3FMLA 3FLYA 4O0VA 2XNNA 1XH7A 2HWOA 4J53A 1H28A 4QPAA 4GSBA 2H9VA 4L42A 2YLFA 5J8IA 3ZTXA 3Q60A 2XS0A 3RBWA 1JKTA 3SXSA 5IISA 2C30A 2BDFA 4FMQA 4F65A 3BYOA 5J9YA 1M14A 2UW8A 4ENXA 3MVHA 4DT8A 4FSQA 4YHFA 1FPUA 4FKVA 4OTRA 3P86A 2JIUA 3L8XA 4IVAA 4PPBA 4BDFA 4PY1A 5HO6A 2VTIA 4I21A 4S31A 3SRVB 2PSQA 4ZTMA 3OCBA 2GHGA 2FSLX 3TT0A 5CNOA 4IWQA 4Q9ZA 3QUDA 5AUVA 3F3UA 4FTTA 5CEMA 1OITA 4RJ5A 4K11A 4FSMA 3FSKA 4HZRA 3C51A 4F1OA 3M1SA 4BN1A 4JNWA 5AUUA 3PA3A 2I40A 4NJ3A 2G15A 3TJCA 3TZMA 3KEXA 1U4DA 1EH4A 5CY3A 4DH3A 2JKOA 4QMWA 5KE0A 5AV2A 4EZ7A 4FE2A 2J5FA 5AAFA 3UNZA 4CKIA 3EYGA 3HEGA 4XG3A 3DT1A 2RG6A 2AC3A 3D4QA 4BCIA 2V5QA 3V6SA 5HBJA 3HMNA 3KULB 2JDTA 4YU2A 1JQHA 4UV0A 2ITYA 4EUTA 3SV0A 4EEVA 4I6QA 2RGPA 5DT3A 5AR5A 4FA2A 2GCDA 1SZMA 2VTOA 1GZNA 4FKWA 1G8AA 3PY0A 3F5GA 3GVUA 4ZXTA 2OO8X 4E4NA 2V62A 3GCQA 5DWRA 2WXVA 5A54A 1CKPA 5HD4A 2PYWA 3OTUA 3H0ZA 2PTKA 1CKIA 4E26A 2IG7A 3TIZA 1JSVA 3VBVA 4IAFA 5DR9A 3QQFA 4FKPA 1XR1A 4C4EA 5GHVA 4YC3A 5BNJA 3WIKA 3HX4A 5JSMA 4M3QA 3NYVA 4XJ0A 3UO4A 4BCJA 3NYXA 2GPHA 4FTMA 2ZDUA 3R22A 1ZOGA 3VJOA 5AR8A 5AR7A 3MB6A 4C36A 2BKKA 3UQCA 4V04A 3KC3A 3F7WA 1REJA 2YITA 4GH2A 5L8JA 4I92A 3I0QA 3U4UA 3UIXA 5CU3A 5AA9A 5M57A 4XG8A 5C9CA 4BYIA 2J0MB 5BUEA 4LV8A 5GZAA 3ALNA 2CKQA 1URWA 5A9UA 2YM5A 4GU6A 4JG6A 3ALOA 2X6EA 4RIWA 4YO6A 2GU8A 4DEAA 2P3GX 2WTIA 3ERKA 5AUYA 5I3RA 5BVDA 4PTCA 5IKWA 3GFWA 2YJSA 4X21A 3HRFA 5AV3A 2XKCA 1J3HA 2WMAA 3FDNA 4GMYA 4MD9E 4AT5A 2C6IA 4QP6A 1S9IA 1J7IA 4O7YA 2R3JA 2RFSA 2XNGA 1V0BA 3FLZA 1AD5A 3IG7A 3Q9ZA 2YDKA 4YHJA 4M12A 1IEPA 4F0GA 4EH2A 4IANA 5JRSA 3HRCA 2UZUE 2W1HA 2W7XA 4MXCA 3OOGA 5KUPA 1P4FA 1WBWA 3IDPA 2PE2A 4C02A 1A48A 4FSYA 4TTHB 5HHWA 5HD7A 3C9WA 2W5AA 4BCMA 5IA1A 2NRYA 3MVJA 5J87A 2VTMA 2OICA 4W4WA 4LGDA 3FE3A 5L4QA 1OKWA 3RMFA 2E9UA 2W9FB 2YM7A 3W33A 3WZUA 5E8WA 1GY3A 2QR8A 2ZYBA 4FV5A 3NVKI 3RZFA 3Q53A 5DRBA 2PZYA 3U51A 2IW8A 3C4EA 5KMIA 3BV2A 1UA2A 4DBNA 1KE9A 4FV8A 5EYKA 2VTAA 3W2OA 3PP1A 3RCJA 3LFQA 5AADA 3CCNA 4IZAA 2QOKA 4OW8A 3A7FA 2O5KA 3RZBA 5DYJA 3O50A 1Q97A 3BU6A 5HG5A 4FEUA 4EL9A 2C6EA 4IB5A 2P0CA 1UU9A 2WZJA 2XJ0A 3WBLA 2HW7A 4CV9A 5JRQA 4K9YA 4U3YA 3VWAA 3ZCLA 2HXQA 4RVMA 3PZEA 2C5NA 5I3OA 4EQCA 5HLNA 4IAIA 4L01A 1WVYA 1R78A 3SKCA 1PHKA 2IZSA 4UZHA 1FGIA 1E9HA 2WFYA 4FIIA 2OU7A 3HUBA 4IHPA 2VX3A 4E5WA 5AV4A 4E4XA 5AMNA 3FL5A 3LMGA 3LCTA 3CTQA 2VWUA 4G3GA 4KB8A 4XLIA 3S00A 4L45A 1SVGA 2WPAA 1H01A 2B54A 4Z16A 2V7OA 3TKHA 5BVFA 5L3AA 4IAYA 1G5SA 1UNGA 2W05A 2UZBA 5AAGA 4BIDA 1XQZA 4LRMA 1H4LA 5JFXA 3WOWA 3QD4A 3OEZA 5DR2A 3HZTA 3C0GA 1Q5KA 5CSVA 5ACKA 4AWIA 3W10A 3BGPA 2GTMA 3QA8A 3MJ2A 3ZZEA 1A06A 2R3HA 3RK5A 4RIOA 3Q3BA 3QQUA 1I09A 4EH9A 5K0KA 1SNUA 1TQMA 4U8ZA 3BBTB 4FEQA 3VIDA 1YWNA 3KVXA 4EHEA 2O2UA 3ZS5A 1ATPE 2XBJA 3ZM9A 3TJDA 4DF3A 5J9LA 4B4LA 3O51A 5DVRA 2JFLA 5K3YA 3R8UA 2HZ4A 4O7LA 2AYPA 4WA9A 5J5TA 2QOFA 2X6DA 1YOMA 1YXSA 3C0HA 4O81A 2HELA 3LAUA 2YAKA 4FKRA 3NIZA 3QXOA 3IECA 3L8SA 4E6DA 3MTFA 1IR3A 4OBPA 3DK7A 2PL0A 3OXTA 3QKLA 3VQUA 3BLRA 3R2YA 4EZ3A 3CJGA 5KBQA 2F7XE 3QD3A 4JT3A 4FR4A 3ZHPC 3QYZA 4AGWA 1WBTA 4CFXA 5IQIA 2REIA 1QPDA 4X2FA 5CVHA 5CI6A 4BTMA 5A14A 2X8DA 3BV3A 2HIWA 4USFA 2C3JA 3HV3A 2WKMA 3BYSA 3DLZA 5KMOA 4NFNA 2VN9A 3K5VA 4AE9A 2C6DA 5I9VA 3TNIA 1WBVA 3R1YA 4P7EA 4W4XA 2VWWA 2QURA 1O6YA 4NTTA 2P4IA 3FPMA 2JC6A 5HI2A 4D58A 3AXWA 2QONA 3WZEA 4M69A 3V8SA 3IS5A 3UMXA 2ETMA 2C6TA 3Q6UA 3MGYA 4FK3A 1OL7A 3ZXTA 3RJCA 4Z7HA 2EXEA 3D14A 4F0FA 5I9WA 3MTLA 2BDWA 2XKEA 4IX3A 2JIIA 4BRXA 1WBPA 4QMSA 3Q5IA 1H0VA 1XHAA 4LUEA 2IZTA 1WBSA 4WG5A 2WMVA 4GL9A 4HGSA 3R8MA 4J8NA 4L53A 4RWKA 4I20A 3UODA 4ZOGA 3P9JA 3G6HA 4QYHA 2BROA 3ZU7A 4F70A 4HYIA 3VS7A 4AU8A 2WHBA 3MY5A 4J8MA 1BUHA 3LE6A 1J7LA 3DOGA 4U3ZA 3EQCA 4FI1A 4IIRA 1M7QA 4L9IA 2QODA 4AP7A 2GSFA 3GP0A 3KB7A 4DEDA 2ITXA 2QI8A 4PPCA 4I6FA 3VS4A 4BCHA 4DN5A 4F9BA 3ZEWA 3S0OA 3NEWA 3O17A 4XCUA 3OZ6A 4EUUA 1P5EA 2JKKA 3LXLA 4Y95A 4QQTA 5EQPA 4W4VA 2XRUA 3QGWA 3FZRA 4MTAA 1VEBA 3LXKA 4JL9A 4JIKA 2XK8A 4K8AA 4TYGA 5EDPA 5FTOA 3UE4A 1E1VA 1OIRA 5HO8A 4BDGA 4XP0A 3MSSA 3HMPA 2WB8A 5CALA 3QFVA 3W18A 5HNIX 1YI4A 4IACA 3D94A 4FZFB 4KABA 4BFMA 4TWCA 4GFOA 4HNFA 5C4KA 4XEYA 3VC4A 2IVVA 2XA4A 3QX2A 1ZMUA 2V7AA 3FZPA 4RMZA 1O9UA 3F69A 4D9UA 3VRZA 2GHLA 3FI2A 2CN5A 4PP7A 2Z2WA 4MH7A 2YISA 4R8QA 4Y83A 1GAGA 3C4CA 4EH6A 5C01A 5CAVA 4CXAA 2ZOQA 3AC2A 3KA0A 4JXFA 4N0SA 4TY1A 2X4FA 4XS2A 5J95A 2UV2A 3K2LA 3TEIA 2WMUA 4JOAA 3O23A 4UMPA 5KKRC 2JAMA 4F4PA 3DBEA 3EJ1A 5CEQA 4A9UA 4ALUA 4C62A 3HV7A 4O91A 4ZLZA 4CLJA 5HE0A 3R1QA 2CGVA 4JVGA 4UMQA 4YZCA 3C13A 4G9CA 3Q32A 4ZEGA 4TYEA 3I6WA 4QTDA 3SC1A 2HXLA 1FQ1B 4FSTA 3TUDA 3HV6A 1SNXA 3NWWA 4GIHA 4XH6A 1IA8A 3CTJA 3JY9A 2BHHA 2OIDA 4IWOA 5CAOA 1W83A 2R3NA 3ZSIA 3NCGA 4AZFA 3VUHA 4GVJA 4FZ7A 2Y4IB 4BI0A 3KK8A 4RA4A 4X2KA 3WZKA 3II5A 3ZRLA 4FSUA 4JG7A 5JZJA 3POZA 4XRJA 4F1TA 2OF2A 5E1EA 3E88A 3ID6C 2YDJA 1B38A 4JRNA 5JK3A 3EL8A 4II5A 4PUZA 3W1FA 2RKUA 4NEUA 5EW8A 1LPUA 3WYYA 4C7TA 3SLSA 1PYXA 5M51A 3DKOA 3QQKA 5L6WL 2VO0A 4X2JA 5HCXA 3UOLA 3NYOA 3RGFA 4YBKA 4JX7A 2OKRA 4Y5QA 5JH6A 3FKLA 3Q9XA 3TNHA 3FZ1A 3T3UA 4BWKA 2WMRA 1LEWA 2WMWA 4QMNA 4ZSEA 1OPLA 1V0OA 4HYUA 1L3RE 3FLSA 3DY7A 5M53A 1QL6A 3SRVA 4HJOA 3P7BA 3W2RA 2XM9A 2EUFB 5GZ9A 4KSQA 3BU3A 4FZAB 5TF9A 1GIIA 4N57A 5CTPA 3MYGA 4MK0A 4XG4A 1ZYLA 4EONA 4I0TA 3AQVA 4TNBA 4GFGA 4FSRA 5DIAA 4JDKA 4GVAA 1JBPE 3DJ5A 4KBAA 4CT2A 1ZWSA 2OW3A 3ULZA 3BYMA 2W99B 4FIJA 5IA4A 3NYNA 3IDBA 4E5AX 2CHLA 4PTEA 4AA5A 3NCZA 5FTQA 2C6LA 4I5MA 3TDWA 4I6HA 1J91A 1I44A 4O0TA 5M56A 5J1WA 1VYZA 4QMVA 1OBGA 3I4BA 5HKMA 4QMPA 2PVFA 4ONAA 2F4JA 2B7AA 4DG0E 3KULA 3OP5A 5FEDA 5CENA 3UQGA 5LVMA 4C58A 1OGUA 3ZC5A 3R7UA 3CBLA 4FOCA 3SOAA 1OZ1A 5GINE 3U9NA 4AOIA 3GU4A 1GNGA 3CKXA 4FV2A 3A7GA 2WELA 1XJDA 2UZEA 3GQLA 3UPZA 4S32A 4ZSLA 4XBRA 4BDEA 3AT2A 3OOMA 1DI9A 2OXXA 3ORPA 4F7LA 2EWAA 4UMRA 5JZNA 2FUMA 3ENHA 5CT0A 3CE3A 3UIBA 5EQEA 2YA9A 1H26A 4HOKA 3UIUA 3VUDA 4ALWA 4F0IA 4CMUA 4F6WA 5IA3A 5L2TA 4O27B 2YWPA 3KMUA 2UW5A 2VTTA 3OG7A 4DTKA 4F7SA 1UU7A 1ZOHA 4HCUA 3KMWA 3LCOA 4AGCA 2IZRA 4O7VA 4PRJA 2VNWA 4CYJA 4EOJA 5C27A 3F5UA 2GS2A 4QQCA 2WGJA 4EC9A 2W4KA 1YXVA 4FVRA 5AP2A 4FEXA 5BX0A 3DV3A 3NX8A 4FX3A 2FYSA 2X7OA 3LFAA 1OVEA 4KIKA 4ANNA 5CQUA 4BYJA 5ICPA 3LMIA 4ACHA 3ZLSA 3MIAA 3ODZX 3ZFYA 3DBCA 1ZRZA 5J7BA 3BRBA 4F6UA 3ROCA 3LMHA 1IG1A 2QOLA 2GS6A 2NO3A 4DH8A 3LFEA 5CAUA 2YIQA 5I4NA 2RFNA 3PRIA 4FTQA 2J2IB 4MXOA 4TYHB 5FD2A 3NLBA 4M68A 3OY1A 2WQNA 4GU9A 1S9JA 5TT7A 4FYOA 1UKHA 3FZOA 4MQ2A 5DEWA 5FWKK 3WF9A 1VYWA 1LEZA 3MH1A 5TE0A 4U0IA 1H1WA 4ANMA 3D5XA 4C4HA 1KV1A 4YJTA 3PJCA 4B6LA 4BBMA 1K2PA 4K6ZA 5A4TA 3IDCA 4J97A 4QP7A 3O71A 5BVWA 3P5KA 4AFEA 4EI4A 1GIJA 5E9EA 4FG8A 2XCKA 3EB0A 4PF4A 2YM3A 3ZRMA 5ANGA 4CFUA 2P2IA 3OCTA 1H1QA 4NM0A 2GQRA 4N70A 4AT3A 4AFJA 2XUUA 3QTZA 4IDVA 5LCKA 2OJJA 2JBPA 3MPAA 3BLHA 4ZZNA 2V0DA 1Q8UA 2F7ZE 4AQCA 1Q8YA 3MH2A 3SXRA 4FUXA 3EQBA 1NW1A 4UXQA 5FBNC 4IADA 3QQHA 3S95A 3FL4A 4R77A 2WEVA 4E93A 4BC6A 4XP3A 4XLVA 4XV1A 4EQMA 5L6OA 3LKMA 3AMYA 4GT5A 4W9XA 3EZRA 3QRUA 1YI6A 2OJIA 3QXPA 4NKSA 2GDOA 2X0GA 4DA5A 5FTGA 3LFFA 1YQJA 2R64A 4JQ8A 3BI6A 4UBAA 4L3LA 4ZTLA 4H3PA 3ATSA 3REPA 3SGCA 4MXYA 2KTYA 3V5PA 5CEKA 5I9ZA 2GHMA 3VUIA 3VS0A 2EVAA 2O65A 2R7BA 4JAJA 4EOOA 1YHWA 3OROA 2XVDA 2XZSA 1ZLTA 2BILB 4O7WA 3V6RA 2A2AA 4A9SA 5CVGA 4OAVB 3R1SA 1U54B 3ZYAA 2C3LA 5AP1A 1GJOA 2O63A 5DI1A 4FEVA 1YKRA 5HTIA 3FC1X 3KRWA 4YJRA 4WKQA 3OXIA 5AV0A 1GZKA 2JD5A 4AS0A 4BGQA 4ACDA 5IDNA 4WBOA 3KU2A 4FKIA 5IQHA 5CSWA 1NA7A 4CMOA 3PG1A 3ZDIA 2QOHA 2Z7QA 3BGZA 3H10A 4ZY6A 4CKRA 3A7JA 4NK9A 4DG3E 2R2PA 3R00A 2CJMA 3R7EA 1FOTA 4EWQA 3R83A 3RPOA 4PDPA 4DFNA 2BIYA 4NCTC 3U4WA 2OFUA 4TYIA 4Z9LA 4FKUA 4AG8A 4I5PA 4KRCA 3KXHA 4IX6A 5M4UA 4YNEA 3EN6A 2G2FA 2XYUA 3MW1A 1YHSA 4ASZA 4EHVA 3G9NA 4XMOA 4GRBA 3RWPA 5H8GA 3GC0A 4KIOA 3TXOA 4FUYA 4PV0A 2R3GA 4ZZMA 4FTUA 5BPYA 3F82A 4NSTA 3KXNA 1BMKA 3OUKA 1Q62A 2A1AB 4FV7A 4KKHA 4FOBA 4LOPA 4BVUA 3W2PA 3P78A 5EW3A 1T46A 5C8KA 4ERKA 2WEIA 4GV1A 2FSTX 4Y85A 4LMNA 3EQDA 3O8UA 5M4IA 2PVYA 5GIPE 5CAQA 5HEZA 3UZRA 3NW6A 5IZFA 2A27A 3E92A 2E2BA 3R9RA 4V01A 4BIEA 5HX6A 2I0EA 5LMAA 4ZY4A 4FKGA 2CKEA 4D1XA 2WD1A 5DGZA 2ONLA 3BKBA 2UW7A 4PMSA 3OC1A 4X3FB 4XOZA 3MS9A 3KKVA 3ZO3A 3UO5A 4KSPA 4L7FA 4K18A 3A7HA 4FTNA 3VS1A 4L46A 2ITTA 2R3FA 3MY1A 5LOHA 2XYNA 4B8MA 3DQXA 1P2AA 3PYYA 4WO5A 3R63A 3EL7A 3I0OA 3CEKA 2UZLA 3DKFA 3ACJA 3BWFA 2E9NA 2EB3A 4P90A 4H39A 4M84A 5AM7A 4S33A 2PWLA 3QALE 4X7QA 3B8QA 4ZSGA 4BB4A 5IQEA 2G2HA 3QHWA 1LR4A 2QD9A 4HCVA 5EDQA 4QYFA 4RVKA 3UVQA 3KMMA 3TZ9A 1WVWA 4M66A 3VN9A 2WU6A 4IFCA 4EORA 3EN5A 4YC8A 3SXFA 3G9LX 4OTGA 3RTPA 1U5RA 2C68A 2XH5A 2Y6MA 3RNYA 4HVGA 3LQ5A 2OJ9A 3QKKA 3I1AA 3RAHA 2BIKB 3N4UA 4J98A 5M08A 1TKIA 4G6LA 3LQ8A 3FXWA 4TWOA 5F4NA 3TL8A 3VBQA 2XP2A 2X7GA 5AIKA 4O86A 2XK9A 2WO6A 2W5BA 2BPMA 1SM2A 3MFTA 2WTVA 2VWIA 3O2MA 5BQ0A 5K4IA 4U5JA 2WMTA 3LM0A 1YW2A 3DZOA 2IW6A 1ZYDA 3OHTA 3C4XA 2HW6A 5AX9A 2J90A 3QQGA 2NP8A 3Q6WA 5E8SA 3IKAA 3KRRA 4O2PA 4DFYA 2B9IA 3BPRA 4A07A 4L00A 4B9DA 4BDJA 3PVBA 5B2MA 1IAJA 1FINA 4UWCA 3KFAA 4ENYA 3HV4A 4MBJA 2PVKA 3SHEA 3UGCA 4RWJA 1PXNA 4NWMA 4GK3A 4K77A 3NUYA 5IG1A 4AUAA 1BYGA 5BUJA 1YDSE 2JITA 2UW0A 4HCTA 5CYIA 3FPQA 5CU2A 4NTSA 3QQJA 5CS6A 4A06A 4C33A 5M07A 5EKOA 3VBXA 3TKUA 3KREA 2O0UA 5JN2A 3IOKA 2QHMA 3HDMA 5CT7A 2GQGA 4WIHA 3SG9A 3HRBA 4USEA 1PMVA 3Q2JA 3MH3A 5TOZA 4J52A 3FHIA 2GTNA 2QLQA 5DE2A 2X8EA 4BDKA 4IJ9A 2WTWA 4DEBA 2QLUA 3VBYA 1APME 2BRGA 3DQWA 5CQWA 4BWPA 3N4VA 4GKHA 3MI9A 3LHJA 3ODYX 5AP7A 2ZAZA 3KN6A 4OBQA 5HICA 3NPCA 4G5JA 5HE2A 3ZSHA 1YWVA 2VTNA 4FV0A 5ANJA 4S30A 4G9RA 1PYEA 3U9CA 2Z60A 3AD6A 4CCUA 2UW9A 4FVPA 4O0YA 3EQFA 2DS1A 2UZVA 2G2IA 2ETRA 1URCA 3GGFA 4IAKA 3SG8A 4HW7A 3P79A 2VTLA 3MN3A 1OKYA 3GC9A 3E5AA 1Q3WA 1PMNA 3BWJA 3BLQA 3NNVA 4HVHA 4F9AA 3RAKA 2OBJA 4KIKB 4E8AA 4AW2A 4BI2A 3BYUA 3UO6A 4LFIA 3DXQA 4XNEA 3H0YA 3Q9WA 4I41A 2XK3A 3BE2A 4QD6A 3R8VA 4PP9A 4AZEA 4KD1A 4D0WA 4QP9A 4R3RA 5AUZA 4KRDA 2ITOA 2B52A 1NY3A 4BL1A 3FMDA 2ZV7A 4XG6A 4XOYA 2W1DA 2XNMA 4Y8DA 2P33A 3M11A 4RFMA 4WG4A 4IH8A 4MBLA 1NXKA 2YM6A 4JDIA 2OH0E 3K5UA 1XH9A 1U46A 4F7NA 2ZMCA 4O7SA 4QMLA 3ZUVA 5GIOE 5HVYA 4DH5A 3QYWA 4U79A 4FT9A 4D2PA 4FK6A 4IE9A 1QCFA 1FVRA 3F88A 3B2TA 3F3VA 5FEEA 3R9NA 5D1JA 3VAPA 4BDCA 5LJJA 4FF8A 3FY0A 2P55A 3PSDA 3EFWA 4RZVA 4U80A 4O7ZA 2BRBA 3TV6A 3C5UA 1ZMWA 4FGRA 5CSHA 1PMEA 2VTHA 3PDTA 3DDQA 4O1PA 5M09A 2X9FA 4EQUA 5ETAA 2C6MA 4FEWA 4XG2A 3WF7A 3FI8A 3S3IA 4EOMA 1H8FA 4DE4A 2X7FA 3EQIA 4YZ9A 4D2VA 4PDYA 4FV4A 1W98A 4DFUA 2OZAB 3QCXA 1FMOE 3EKKA 4OTPA 3VUGA 2J7TA 3JPVA 1O6LA 2OWBA 3WI6A 4EKLA 2YABA 3PXZA 2FB8A 3CTHA 2PE0A 3NVMB 1YOJA 4CFVA 3R6XA 4DT9A 2KULA 4R3PA 4LGHA 3F2AA 2IN6A 2CCIA 3G0FA 3AD5A 1MP8A 4JDHA 3CC6A 2BR1A 4LUDA 2JDRA 2W1EA 2C4GA 3GU8A 4LGGA 4BHZA 4BCOA 4E3CA 5CU0A 3UC3A 2PUIA 3TG1A 4AZVA 4FTLA 3D2KA 4NZWB 3NMUF 4ACGA 2JFMA 5KX8A 3KCFA 3A62A 3EFLA 5DR6A 4TYHA 3NZ0A 4E1ZA 4GJ3A 4FYNA 3TNPC 2J0JA 3CLYA 5IDPA 1ERKA 2A0CX 2X39A 2UZOA 2Y9QA 4ZTSA 2PZRA 4FIHA 4YUQA 3NW7A 2OG8A 3ORXA 2GNIA 3LCSA 4FZ6A 5HG9A 3FAAA 4EOLA 2WIHA 4HGTA 4G31A 2W1FA 2OJFE 2PVJA 5EYDA 4RA5A 3NSZA 3JS2A 4U9AA 4XHKB 3ZBFA 3TACA 4WSYA 2WOUA 3RM6A 3DNDA 1F0QA 2WNTA 1PKDA 1XKKA 1MRUA 4TPTA 1ZZLA 3GT8A 2W1CA 5HLWA 4NFMA 3WIGA 4EJ7A 3GNIB 2GNGA 3A7IA 4NJDA 2IZUA 5DG5A 1MUOA 5DMZA 5IUHA 3R8ZA 3HLLA 1PMUA 1F5QA 1ZY4A 4QYGA 3GENA 5HVJA 4KWPA 3ZOSA 4PDSA 4AT4A 3RPRA 5M4FA 1FVTA 4QP3A 5C4LA 3QLGA 4CZTA 3QC4A 1PXIA 3PE2A 4QMYA 4ZSAA 5IQFA 5FEQA 4NH1A 2FSMX 4DG2E 4EC8A 1DAWA 3UP7A 1ZXEA 4AXAA 5J5SA 3RAIA 3SQQA 3CSVA 3WILA 2ZVAA 3DNEA 3QU0A 3Q4ZA 4FZDB 4ZMFA 5BYZA 2LAVA 4FT0A 3U6IA 3R8LA 4YMJA 3F6XA 5CASA 3COKA 1YDRE 2OFVA 3RWQA 5FDXA 2X2LA 2YACA 4KNBA 4YJUA 5ANEA 2VO3A 4XRLA 4A7CA 4EZ5A 2ITVA 5EQYA 4ANBA 2BRHA 4L7SA 3VJNA 2QO2A 5LMKA 1Y91A 4LL5A 1IRKA 3F3WA 5D10A 3E64A 2ZB0A 3CPBA 3MBLA 3W2CA 4IVDA 3CQUA 3FC2A 4AN9A 3KF7A 3VS3A 4ZY5A 1Q8TA 4L6QA 2PVHA 1CTPE 4G2FA 2Z7LA 4YTFA 4AAAA 1U54A 2QNJA 2OGVA 4M15A 4F63A 4O0SA 3UG1A 3L9NA 5HOAA 4BHNA 4QPSA 2X8IA 1JNKA 4DLIA 3OBGA 4TRLA 3VW6A 4QP8A 2ERZE 4U81A 4IC7A 2B1PA 3D0EA 4FNYA 3FSFA 3E8NA 3RM7A 2VO6A 2YWVA 5DH3A 3R30A 3HAVA 3DAKA 2I6LA 3QZHA 4LI5A 4FVQA 1W8CA 2UW3A 3H3CA 1WAKA 3QWKA 4TKSA 4NM5A 2VGPA 2Y8OA 5E91A 2GS7A 2CKOA 4UXLA 4RVLA 3ZONA 3L9MA 5EG3A 2PE1A 3O7LB 3HGKA 3UZPA 2Y7JA 2QR7A 4PWNA 4RWLA 4WUAA 1RJBA 3CQWA 2ERKA 5A3XA 2ZDTA 4C38A 4F9CA 1PXMA 2ZM3A 5AUXA 4E4MA 3UDBA 5BVKA 1OL5A 3R8PA 3PRFA 1OL6A 1JKLA 2YCQA 2HY0A 4ANOA 1NVSA 2RFDA 2UZDA 4HPTE 3PTGA 4MYGA 4X2NA 3P4KA 3U8WA 1Y8YA 2PMLX 3ANRA 3FZSA 3POOA 4FGBA 3A99A 4DITA 3C7QA 4R1YA 3EH9A 3MB7A 4D4VA 4Q5HA 1SMHA 2BVAA 2R4BA 4Q5EA 3WF6A 3TNQB 3SW7A 1PXOA 4OT6A 3THBA 3SVVA 3RPYA 4KAOA 4UYNA 4S2ZA 3UTOA 4R6VA 1W82A 2PMNX 5J79A 4BY9E 4IW0A 3KXXA 5DA3A 3V8TA 3OT8A 4KS7A 2GFCA 4X3FA 3ZLYA 4U41A 3QKMA 4TN6A 3R9HA 3KXZA 4WT6A 4FL3A 4V05A 5AA8A 4HZSA 3R7IA 3EIDA 4XV3A 1UWJA 3H4JA 4UY9A 5F1ZA 1PRYA 3AC4A 3NUSA 3VBTA 3QZGA 1Q24A 4OTHA 4E4LA 5AEPA 3KQ7A 2IVSA 3EN9A 3FLQA 3QA0A 1PKGA 3FQEA 3PSCA 5EYCA 4DGNA 5IQBA 3LZBA 4GJ2A 4GT3A 4K0YA 2YM8A 3CS9A 5FLFA 4FTOA 4JQEA 4B0GA 2Z02A 3JXWA 5EHOA 3E8EA 3P7CA 3QX4A 5EH0A 4C4IA 2YIRA 4Y73A 5JGDA 1Z57A 5CEIA 2XF0A 4IM3A 2XNEA 4C57A 3EHAA 5A4LA 4XUFA 4KBCA 2R7IA 3R1NA 4AZTA 4EOQA 4B99A 2JKQA 4UMUA 1ZOEA 2R3KA 3PWYA 1ZARA 4ZK5A 2VU3A 3D5VA 2XBAA 4AZWA 3QC9A 2C1AA 2O3PA 2YFXA 3O96A 5L2QA 2YZLA 2XNOA 4MNEB 3ZUTA 4G6OA 1WZYA 2X9EA 4MF0A 5ETCA 4U44A 3TN8A 4IAAA 3FQHA 4C3PA 3R9OA 3MFRA 3RCDA 4E5BA 5HZNA 2J0IA 5DFPA 2ZV9A 4WRSA 4DH7A 1R0EA 4WRGA 4FTKA 4QO9A 3GU7A 3KGAA 5AIRA 3ZXZA 5K0XA 3MPTA 5AFVA 1MRVA 2YCFA 1WFCA 2PZPA 4LRJA 2SRCA 5HGIA 4BICA 4USDA 4CZYB 2JGZA 4BGGA 3ET7A 3R2BA 2BAJA 4U43A 4MEDA 2NPQA 3RAWA 4XP2A 1XH8A 4I22A 3E3BX 3HP2A 4JJRA 4RG0A 4Y5HA 1M2QA 2XKFA 3HUCA 3Q04A 3BEAA 3I5ZA 4ID7A 2R0UA 4HVIA 3SA0A 2WTKC 3KCKA 4QMQA 3HVCA 2J4ZA 4J7BA 5EK7A 5JMSA 2NNWB 1W0XC 4E20A 2QO7A 3L9PA 4Z55A 3K3IA 4PMPA 4F9WA 3TM0A 2J5EA 4F99A 2HK5A 3COHA 2IPXA 3DA6A 4ZJVA 1IA9A 3TTIA 3BHVA 4C0TA 3FLWA 3EQHA 3E7OA 2ZM4A 4RJ4A 2QG7A 4O7RA 1U59A 3P1AA 4AW5A 4CMTA 2XK7A 4MD8E 3DZQA 1ZMVA 3U55A 3RPVA 4YBJA 2BZKB 4JR7A 5B2KA 5F94A 1SYKA 5AP6A 2PHKA 5H9BA 3W8QA 4FL2A 3UNJA 3OXZA 4L3PA 4PL4A 5C8MA 3LW0A 4U40A 3OF0A 3R0TA 2JDOA 2W17A 5JKGA 5EM8A 1OB3A 2W96B 5D9HA 4TZRA 5AP0A 2YCSA 5KKRB 1ND4A 2WTJA 1MQ4A 3AC3A 4GT4A 4KKEA 4JI9A 4IFGA 3FMEA 3QTWA 4W9WA 4KA3A 5CWZA 5FM3A 1KE7A 3FXZA 3VRYA 3U6JA 3TUCA 1R1WA 4NYEA 1Q4LA 4RZWA 3QLFA 4IB1A 4FBXA 4ZS4A 4RLKA 3GEQA 5ANOA 3UMWA 2E9VA 1XWSA 2J0KA 5EI8A 1OM1A 4G16A 4L52A 3ZH8A 4ASXA 5J7HA 1XBCA 4NW6A 2IVUA 2PUPA 1PJKA 3L9LA 4OUCA 5AR4A 5CSPA 3CD8A 4EOKA 2BZJA 3R73A 4HGEA 2YJRA 3MFSA 4CFWA 4DYMA 3DKCA 1OUYA 1FBNA 2J9MA 1YWRA 4J99A 1OECA 1QPJA 5IF1A 4GIIA 3QF9A 4R5YA 3FV8A 4LYNA 1ZY5A 4F7JA 4OR5A 3BQCA 4H1MA 2YM4A 1PF8A 4MF1A 5IA5A 4IBMA 3V51A 2VV9A 3JY0A 2QC6A 3O0GA 3VUTA 1V1KA 4RIXB 4OLIA 3F3TA 4NT4A 4E6QA 1UU8A 2WAJA 2B53A 4H3BA 4CZUA 4RBLA 3IO7A 4F64A 4C35A 2PVNA 2FO0A 1PXLA 3M2WA 3OMVA 4JBOA 5CLPA 5FM2A 4BZOA 3C5IA 3BZ3A 1OKVA 5E8TA 5A46A 4GCJA 5AUWA 3KY2A 2IJMA 2QOQA 3VHEA 3SOCA 3UC4A 5IMEA 4CTBA 2VTSA 1H08A 4NKAA 4GFMA 3MPMA 3I60A 3V3VA 2OIBA 4ZTHA 2OZAA 4I6BA 2CKPA 1W84A 1J1BA 1ZYSA 2BALA 2QKWB 4U42A 2XB7A 4EHZA 4O83A 3ORIA 3P0MA 1ZYCA 2QO9A 1XO2B 4YC6A 4ACCA 2GNFA 3DGKA 3I6UA 1J7UA 4O0UA 3T9TA 4FKLA 3HV5A 4O38A 5F20A 4FT5A 5I9YA 3U6HA 4TW9A 3A60A 3TV4A 3ZFXA 3GOPA 3DXPA 2HY81 3V5WA 4ZLYA 4JBQA 4W8EA 2VWYA 3MY0A 3V5QA 4BR3A 3QD0A 5HCZA 3W8LA 2VWXA 4D4SA 4U45A 4ITIA 4I1ZA 3E87A 5HNGA 3R21A 1GOLA 5JQ5A 3Q4UA 4IZ7A 3VNTA 2IVTA 5FXSA 5KCVA 5JFSA 2ITQA 3KVWA 3EKNA 3PJ1A 5D41A 3FBVA 4IX4A 5DOSA 3BYVA 5LWNA 1MQBA 2B9FA 3PUPA 3QTRA 5IQAA 3MJ1A 2R3QA 4X6QC 4D55A 5C1QB 5LXMA 3FEGA 1CM8A 2J6MA 3BX5A 4FL1A 3UYSA 4D2WA 5KO1A 2F57A 4W4YA 3UZTA 2XK6A 4AOTA 4C8BA 5GJGA 4FG7A 3E7VA 4WOVA 4EBVA 4QP4A 3QRTA 3OD6X 4V0GB 3F5XA 2V55A 3KK9A 5TO8A 1HCLA 2C5YA 2VWVA 3C0IA 3DBDA 3N51A 4D0XA 4RX9A 2V22A 4UALA 3ZSGA 4E6AA 1KSWA 4O7NA 3QRJA 4LRKA 4NL0A 5D7VA 5JFVA 3PJ2A 4WUNA 4FSWA 2JAVA 2UW4A 3C1XA 2QCSA 4FKSA 4FKOA 3QBNA 4RJ3A 4AN3A 4APCA 4MCVA 2F7EE 2W9ZB 4K33A 5LARA 5E7RA 3VULA 5HQ0A 3ZO4A 4IZ5A 3VS6A 2BRMA 1A9UA 3EYHA 4QMZA 3NDMA 4FKTA 4YHTA 4FT3A 3R7VA 4I5CA 4MWIA 4O0WA 3TZ8A 4D9TA 4O2ZA 1WBOA 3EQGA 4MXAA 5J9ZA 4Y72A 5DNRA 3CIKA 5D11A 2F9GA 2C0TA 2CCHA 3G33A 3LFNA 2RFEA 3BU5A 4YR8A 4QPMA 2Y0AA 4YLLA 5CXHA 4BBEA 2FSOX 2O64A 3V5LA 3I5NA 3TCPA 4C3RA 4G17A 4O82A 2YIWA 4CNHA 4P5QA 5BMMA 5C26A 3DFCB 4LOQA 1FGKA 5E8ZA 1K3AA 2BMCA 3OT3A 4EH4A 5TKDA 4KINA 2Q0NA 3H30A 4DCAA 2BUJA 2CGXA 3LJ2A 2GNJA 5CF8A 4JBPA 4KKGA 3I79A 3NGAA 4RJ8A 2XK4A 1F3MC 5HIEA 3Q2MA 4OTIA 3WARA 4FSZA 5HE1A 5LWMA 1DM2A 4DEGA 5CXZA 5DHJA 4BDAA 3P08A 3QTQA 2XMYA 2YIYA 3BGQA 1Q3DA 2C5VA 3NUNA 3F3ZA 4M8TA 3C4WA 5ANDA 5E8UA 4AE6A 1OIQA 1QPEA 5FBOA 5KMNA 4R7BA 5CSXA 4Q2AA 4FNZA 4RGJA 3MH0A 2HWPA 4TNDA 5FGKA 1M2RA 4CFNA 4O0RA 1BI7A 3IOPA 5I0BA 3K3JA 2XIYA 2WQOA 1BI8A 1OPKA 4WBBB 4YZDA 3VW8A 3V8WA 3JR1A 4OBOA 3B2WA 4IX5A 4OTWA 3TIYA 5DN3A 3HECA 3GB2A 1M7NA 4DFLA 5HTBA 4R5SA 4EK3A 5ITAA 2JDSA 1HCKA 1YXTA 2VWBA 4RFZA 4CRSA 4CGAA 4FKQA 1JLUE 2A4LA 4J71A 5EKNA 2AC5A 3MESA 3BHYA 2J51A 1OUKA 3DS6A 5ACBC 4PL3A 3AT4A 5IEVA 1BLXA 2XIXA 3DTCA 1H07A 2JKMA 3PE1A 4YO4A 4ZMEA 4QRCA 2BTSA 4PMTA 5HCYA 5KZ0A 5CF5A 5FDPA 5FXRA 5TR6A 3ELJA 2AUHA 3H9OA 4TWPA 5E8XA 3W16A 2HENA 4K2RA 3HP5A 4HYHA 4F08A 4M7IA 3COIA 2CSNA 2OIQA 4UWBA 3FMMA 5G6VA 4DCEA 5AR3A 4EH5A 5IEXA 4G3DA 2R3OA 4P2KA 3AT3A 2JBOA 4IB3A 2PVMA 3DLSA 2VO7A 1STCE 4K1BA 2PVRA 4UB7A 3UOKA 2ITPA 5IPJA 4O96A 3D9VA 1UNHA 5HU3A 2EU9A 2I1MA 4CEGA 2RL5A 2CGWA 5IMXA 3E3PA 3GCVA 1H0WA 5EM5A 3CP9A 3Q96A 3PP0A 3GC7A 4ZTRA 4F6SA 3UYTA 1VJYA 2XJ1A 3D7ZA 1KV2A 4IDTA 3F9NA 4D2SA 3NAYA 1RQQA 1ZZ2A 3DB8A 3QRIA 2BCJA 2QOCA 4I24A 4J96A 1KE5A 1PXJA 4QP2A 4KS8A 2XJ2A 5HIBA 5H2UA 3VHKA 3GCSA 1XBBA 5B0XA 2B4SB 5A4QA 5L8LA 3FWQA 3ZC6A 2WTDA 2HZIA 2X1NA 2VTPA 3I7BA 5CI7A 1OIYA 3BEGA 4CCBA 4NM7A 2UZNA 4I0SA 1O6KA 3WZJA 4RX5A 2VGOA 2I7QA 2R0IA 3FZTA 5LVOA 5K5XA 3PPJA 4PDOA 4CRLA 3HA6A 2QKRA 3WYXA 4R3CA 5FP5A 1H1SA 3FKNA 4FV6A 3KXMA 2XNPA 4C2VA 1Q99A 3EZVA 3RHKA 1H25A 3D15A 4X0MA 5IH4A 4EYMA 3FI4A 3IW7A 3FMJA 3TI1A 5JGAA 4BBFA 3C50A 4IZYA 4PPAA 1KOBA 2C47A 4XV2A 4E6CA 3AC8A 1J1CA 3KF4A 4H36A 3BIZA 2VNYA 3DAEA 2W4OA 2B9JA 4AA0A 4RC2A 1Q61A 3SD0A 3UG2A 4ZAUA 4ZLOA 3ZEPA 4O6LA 5AJQA 2VTQA 4FC0A 3W2QA 4WSQA 4RJ7A 1WVXA 3OY3A 3LM5A 3COMA 4WD5A 3R7YA 2OXDA 2B55A 2YZAA 5IEYA 5KMLA 5HIDA 4M14A 2C5XA 3ITZA 4BCNA 3FY2A 2O8YA 4L8MA 5AR2A 3VUMA 4H1JA 4A4LA 4MNEA 1QPCA 2ACXA 3LJ0A 5FP6A 4AZSA 2I0HA 3OWLA 3QUPA 4APPA 4DGLC 3BELA 4FODA 4O21A 3EQRA 3OW3A 4GK2A 4UEUA 4EH7A 4BCKA 2RIOA 4CG9A 3H9RA 5A4EA 1WMKA 3RHXA 5KNJA 4B8LA 4BTFA 2XIKA 3DBFA 2C1BA 3AC5A 3R28A 5K9IA 3V01A 3R7OA 4RJ6A 3CD3A 3CQEA 3KN5A 2HAKA 3PG3A 3B8RA 4BDHA 4IC8A 3OFMA 2GQSA 2VRXA 2CLQA 4PMMA 3UBDA 4YZMA 2EXCX 4OT5A 3RNIA 5JEBA 3DFAA 2YIXA 4IWDA 3BHHA 2BZIB 3F66A 4D2TA 5IQCA 2CN8A 4N6ZA 5M4CA 4BWXA 4PQNA 2PZIA 4IJPA 3DK6A 3QTUA 3PPZA 4EK4A 1YXXA 3T8OA 2Z7RA 5EDRA 5LMBA 3LIJA 5CANA 4A4XA 4DH1A 2JLDA 4WHZA 4YTIA 4UYAA 2GMXA 3G51A 4JX3A 3PJ8A 3ZLXA 5AAEA 2BAQA 1ZAOA 2C0IA 3JUHA 3UNKA 4RRVA 3F61A 3C4FA 3EWHA 5HLPA 3RALA 4CG8A 5BVEA 3JYAA 3OCSA 5D12A 4DC2A 1FMKA 4EOIA 1OIUA 2VX0A 4FIEA 3LFSA 3ZUUA 3OCGA 5KBRA 3NIEA 5KHWA 1T45A 2QHNA 3G6GA 4FTIA 1H1PA 3PVGA 4MAOA 4R7IA 1IAHA 1XH5A 2QOIA 3HYHA 3PFQA 3L1SA 4JRVA 3PZHA 1NVQA 2IO6A 2ZV8A 1OI9A 2XM8A 2YCRA 4ZP5A 5KHXA 2FVDA 3A8XA 3MWUA 2WQMA 5BYYA 3SW4A 1CKJA 1VZOA 3LVPA 3HNGA 3QGYA 5CNNA 2OLCA 4IVCA 1PY5A 1RW8A 3M42A 1KOAA 1Q8WA 4PNIA 2R3MA 2DUVA 2F49A 2XNBA 3Q52A 4O7TA 3GFEA 2XEZA 3R02A 4XV9A 4JAIA 5HESA 2E9PA 2RF9A 4WNPA 3NNXA 4LV5A 3LPBA 3IGGA 2C5OA 4RIYB 4I4EA 2C6KA 2G1TA 2ONLC 3HMMA 4W8DA 3VF8A 1KUTA 3MVLA 3UOJA 2H8HA 4QYEA 2VTJA 4MQ1A 4F9YA 4UX9A 4NU1A 5LQFA 1Q41A 3ZMMA 1CSNA 5CF6A 4O84A 5CVFA 2C3IB 4ANSA 5HG8A 3T9IA 4RX8A 1R0PA 2C6OA 4YZBA 3D5UA 3IONA 5AP5A 4MWHA 3IQ7A 1XH6A 5KMJA 5EOBA 5HE3A 3GCUA 4DFBA 3TTJA 4YPSA 3UQFA 3A61A 1OMWA 2UVXA 3AMBA 3ORMA 3WF5A 5KZIA 1NVRA 3ROYA 2Z8CA 2X2KA 3HDNA 4HGLA 4QQJA 3OEFX 3PXQA 3HL7A 3QZIA 4RIXA 5HO7A 3F2RA 3KRLA 5G1XA 1ZYJA
chains in the Genus database with same CATH superfamily
3KXGA 3DPKA 4FV9A 3FI3A 1QMZA 3HMIA 5H8EA 4KBKA 4UZDA 4ZS0A 5EW9A 4C34A 3OWPA 2QVSE 3EN7A 4QT1A 3A4OX 4YSJA 2HYYA 4O22A 5L2IA 3NUAA 2Z7SA 4ASDA 5HBHA 4DEEA 1KE6A 4E73A 5A6OA 3TV7A 3TNWA 2BTRA 4BIBA 4DLJA 3A8WA 4MBIA 4BF2A 5CEOA 5HNBA 4GW8A 4DBXA 4RVTA 3IGOA 4R1VA 4RWIA 4X3JA 5EFQA 4R7HA 2ZMDA 3L8PA 4J1RA 1K9AA 2ITNA 4D5HA 4D4YA 3OWJA 4QTCA 3LFBA 4OTFA 4FV3A 1OPJA 2FGIA 5B2LA 2PZ5A 4C61A 2CNUA 3GUBA 4YZNA 3D7TA 4QMMA 3BHTA 2OK1A 1RE8A 4M13A 5GNKA 2XKDA 4GUEA 4MXZA 4X2GA 5ANIA 2ESMA 1XBAA 3VVHA 5AUTA 3ORLA 1REKA 1Y8GA 2PY3A 4YURA 1M17A 2B9HA 3WE4A 1SVHA 3BQRA 4CLIA 1X8BA 3NAXA 2WOTA 2XIRA 4OTQA 2LGCA 4F09A 4DTBA 1OKZA 2X0QA 4BDDA 3LQ3A 5AWMA 5HBEA 1L8TA 4MD7E 3S1HA 3PIZA 4XG9A 3ATTA 5C03A 4BI1A 2C0OA 2W1GA 3ULIA 4BCPA 4YTCA 4DTAA 5FRIA 2HCKA 1BL6A 2CMWA 2Y4IC 3K54A 3QTXA 4TWNA 4B7TA 3A2CA 3ZZWA 4V0GA 1P4OA 5JGBA 4O0XA 5AM6A 1TQPA 4Q9SA 4A9RA 4CD0A 3D5WA 3TWJA 4AW0A 3C4ZA 3FJQE 3L8VA 3MFUA 4TL0A 5BVOA 1ST0A 4YP8A 5CAPA 3CJFA 4E7WA 4PNKA 5IA2A 3O7LD 3MA3A 3KRXA 4ITJA 4L3JA 3RKBA 3S2PA 4EJNA 4CVAA 3FQSA 5CZHA 2WQEA 2YHVA 3WE8A 4C59A 5JFWA 4MHAA 4EK5A 4NW5A 4FG9A 4BZNA 4QTEA 5L2WA 4RFYA 1RDQE 3UDSA 2FH9A 4EKKA 4GKIA 4C4FA 3OUNB 5CX9A 4NIFB 4ZSJA 1JKKA 4I5HA 2H96A 2I0YA 3AC1A 1OL2A 4FTJA 2IWIA 1JVPP 2GFSA 4QMXA 3G5DA 5ETIA 3W2SA 5FXQA 3I81A 3PLSA 1Y57A 2WMBA 5FG8A 5LVNA 3GBZA 3MIYA 4DINA 5F95A 2OJGA 2YN8A 3FMKA 3FXXA 3JVSA 4YGAA 2WTCA 4FNWA 3LJ1A 1OBDA 3U54A 3HKOA 5HORA 3ORTA 1H24A 2A98A 5IUGA 5CU4A 1JWHA 4L67A 2HOGA 4IM0A 2OH4A 4HVDA 2UZTA 4WNKA 4DEHA 2QU5A 3AKLA 2HZNA 2QOBA 4QNYA 1JOWB 2VD5A 4QP1A 4BTJA 4LM5A 4H05A 3QUEA 4CT1A 4U6RA 4FJVA 5K4JA 2CGUA 4I0RA 2C69A 1PXPA 3ORNA 4TYJA 4DAWA 1HOWA 2J0LA 4MKCA 2WMSA 4F1MA 1Q8ZA 3ZRKA 3PXKA 3DDPA 2VAGA 3F7ZA 1B39A 4CFFA 4JG8A 3LCDA 4YJPA 1KE8A 2R9SA 1G3NA 3OWKA 2P2HA 4O6EA 1BL7A 4AW1A 2GNLA 3EQPA 3DKGA 3FLNC 4FIGA 5BVNA 1YI3A 5LCJA 2R3RA 1FVVA 2OSCA 3R01A 4RC3A 3D2IA 5AP4A 3P7AA 3CGOA 4AA4A 4ITHA 4CFMA 5DRDA 2YAAA 1KWPA 1CDKA 1R3CA 3RPSA 5HVKA 1PW2A 5T6KA 4G1WA 4BDIA 1JSUA 5IH6A 3ACKA 4GEOA 3VO3A 4ZTQA 3SAYA 1TVOA 2OXYA 5FQDC 4GG5A 2PULA 2IW9A 4G3EA 5M44A 1YHVA 4YSMA 5E1SA 4EWHA 1Y6AA 5B7VA 3GC8A 4JLCA 2ETKA 3E8DA 4IEBA 4ASEA 3PLAE 4O1OA 5AV1A 4DEIA 5AP3A 4ALVA 5T68A 2Y6OA 4RX7A 3N9XA 4D5KA 3QCQA 2VUWA 4AGUA 4ERWA 2J50A 1TFFA 4FTRA 4Z7GA 4QDVA 3PSBA 4I23A 4D1ZA 3RP9A 2W1IA 4BTKA 4D2RA 3CR0A 2BAKA 4S34A 1M2PA 4IM2A 4ZJJA 4ARKA 5JT2A 1YXUA 4IMYA 4TXCA 3PXYA 5EM6A 2DWBA 4BKJA 4C3FA 3RVGA 4QNAA 4YJSA 2DQ7X 3H9FA 2R3IA 1JKSA 2YEXA 4O4FA 3GQIA 1WBNA 5F9EA 4UWYA 3IW4A 5BYLA 3MVMA 4NCTA 4OTDA 3ZO1A 3QTIA 1JPAA 1V0PA 3QCYA 4FNXA 2WIPA 3LXPA 4RQVA 3VBWA 3S4QA 4ZIMA 4JS8A 4YNOA 3OW4A 2PU8A 1H00A 3R9DA 1TZDA 3GU6A 3W0QA 5CZIA 3FYKX 4RIWB 4RQKA 1YVJA 3G90X 4GG7A 5DBXA 1AGWA 3V5TA 3F2NA 1XMMA 3JVRA 3ORZA 3CGFA 1PXKA 1B6CB 4BDBA 3ANQA 3RINA 2ZB1A 5CEPA 2WU7A 4FICA 2H34A 3LLAA 4M0ZA 3VUKA 1UKIA 2FA2A 4ZJIA 5IU2A 3IW6A 3NRMA 3DU8A 4I4FA 4M67A 4YLKA 4H58A 4EHGA 3NS9A 5L2SA 3TUBA 5IQGA 3HAMA 4FT7A 5JQ8A 4C2WA 1H27A 3DJ6A 3E8CA 2BFXA 2BFYA 3OBJA 4LMUA 2PPQA 5DT4A 5HX8A 4TT7A 2CDZA 3UIMA 2W1ZA 3AGMA 4QMOA 4QTAA 3OS3A 4PX6A 3PA4A 5GJDA 2YLEA 3ZBXA 2UUEA 3W32A 3QHRA 1DI8A 1JSTA 2R3LA 1CMKE 4EYJA 4R78A 2UZWE 4FIFA 3AOXA 5H8BA 5GJFA 4FTAA 1UV5A 4D4RA 2F2UA 2Q83A 2PK9A 2E9OA 1J7LA 4LL0A 1YRPA 4JIAA 5EHLA 2QQ7A 1LUFA 2G01A 5LMKC 2BZHB 2VZ6A 1M52A 4DGMA 3O8TA 3CKWA 3CXWA 3G2FA 4WG3A 5BUIA 2A19B 3ENMA 1U5QA 4WNMA 4M97A 4CYIA 4IWPA 5BMSA 4BJJA 5IA0A 3DBQA 3LFDA 4CV8A 4KUJA 4GYGA 1E1XA 3PXRA 2ZM1A 3ZFMA 4EOPA 3DAJA 3VQHA 5DT0A 2R3PA 3VS5A 4ACMA 3W55A 4DGOA 1YOLA 2XEYA 5A4CA 2AEGA 1UNLA 2I0VA 4QTBA 3DXNA 4C37A 3BBWA 4RPVA 4MX9A 4OGRA 2W0JA 3V5JA 3AMAA 4IQ6A 4C4GA 4A4OA 4MXXA 4ZZOA 2X4ZA 5DPVA 3LXNA 4GUBA 3NUXA 3NR9A 1TQIA 4DFZE 1GZ8A 3LLTA 3PJ3A 2QOOA 4P5ZA 3VF9A 2PMOX 4JBVA 4EK8A 3DB6A 4FTCA 3LCKA 4ZTNA 3TKIA 3N4TA 3Q4TA 4BCFA 3EMGA 3GXLA 3IW5A 2C3KA 4MNFA 1IASA 3PUFC 3U87A 3BCEA 4AXFA 3GI3A 1UWHA 5EI6A 1SVEA 4FV1A 3EFJA 4IXPA 3DK3A 4NUSA 2WMQA 1W7HA 2B0QA 2X0PA 3IW8A 5IH5A 4D1SA 3G0EA 5A6NA 3NUPA 4I93A 3NW5A 4YJNA 5E92A 5FUTA 5GZ8A 4N4SA 3MV5A 4G6NA 2WTKB 4XBUA 5ETFA 3GOKA 5LVLA 5L8KA 2DYLA 2XRWA 4RC4A 4GS6A 3RK9A 2RG5A 2W06A 2OF4A 3RK7A 4YLJA 4QQ5A 2BKZA 4I3ZA 2ITUA 4LG4A 3TZ7A 4JMQA 3D7TB 3FHRA 4DHFA 3NNUA 2JEDA 2RSVA 2EXMA 3E93A 3O8PA 3R04A 4RIYA 1G8SA 5LVPA 2G9XA 1W2CA 3E62A 4HPUE 3QL8A 4AACA 2W5HA 3OVVA 3ZO2A 4X3FC 3LOKA 5I9UA 4FSNA 3EOCA 4MVFA 3WZDA 1P14A 3KIOC 4GK4A 5I9XA 3DTWA 3PIXA 2W4JA 5M06A 4AF3A 2Y4PA 4HNIA 3CPCA 4EH3A 3CY3A 2QU6A 3BHUA 4AOJA 1G8KA 3ORKA 4EH8A 4G3FA 3DCVA 4BCGA 4U97A 5C8NA 4M0YA 1MRYA 4AN2A 3UOHA 5AX3A 5E8YA 1UVRA 4DFXE 4L44A 4L68A 4OAUC 2F2CB 3PXFA 1Z5MA 2PUNA 3V04A 2CPKE 2CNVA 5E4HA 3EFKA 4XYFA 3SX9A 2AQXA 4BZDA 4M69B 4YTHA 4EBWA 3R71A 2VX1A 2GNHA 4U7ZA 2EB2A 3FUPA 3F5PA 3QZFA 3WF8A 3MDYA 3PWDA 3P23A 5EI2A 3R7GA 4LOOA 5E8VA 3A4PA 2BDJA 2BHEA 1VR2A 1WCCA 4MUQA 3ZDUA 3QD2B 4BKYA 3Q4CA 4QYYA 3NUUA 3Q9YA 4YJOA 2ZV2A 3SDJA 3ETAA 4GYIA 4ANLA 5EM7A 2JIVA 2UW6A 4X6RA 4YPDA 3MA6A 5HU9A 5J1VA 4ORKA 1Z9XA 2UVYA 4G3CA 4QMUA 3UVRA 4DGGA 5EYMA 3QQLA 5M55A 4IB0A 3EN4A 3UDTA 4IVBA 2ZJWA 2PMIA 3QAME 2UVZA 2Q0BA 3IK3A 3FYJX 1NT2A 2YERA 3UP2A 3G15A 4KIPA 2YDIA 1BKXA 3PVWA 3QTSA 3FKOA 4JDJA 3FMNA 3QCSA 4AX8A 1R39A 4QMTA 2XANA 4J95A 1LP4A 3HMOA 3KL8A 4JR3A 4BGHA 3PY3A 3DJ7A 5IQDA 5EHYA 3PIYA 3UVPA 5HTCA 4PL5A 2VTRA 4I94A 4P4CA 1GIHA 2X2MA 4FKJA 4QOXA 3PA5A 4RT7A 4YJVA 3VS2A 4HVSA 2CNQA 5E90A 4CQGA 4H3QA 3AG9A 3OTVA 4CQEA 3GCPA 3RI1A 3PY1A 3Q5ZA 3HA8A 4CSVA 5CU6A 2OZOA 3QRKA 4Z3VA 4XG7A 1OL1A 5CF4A 1YDTE 4A9TA 5ANKA 3KRJA 5L6PA 3UJGA 4KIQA 3I7CA 5KMMA 2PVLA 5D7AA 3BE9A 3D83A 4YJQA 4C4JA 5KMKA 5K5NA 2BRNA 4CTCA 2JDVA 5I5ZA 1BX6A 3T3VA 3IPHA 3PVUA 5T3QA 2QG5A 3TDVA 3CY2A 4IAZA 4RSSA 3ZLWA 4D28A 4JQ7A 3AD4A 2WMXA 4RLLA 5H3QA 4LQMA 2NRUA 1UU3A 4ANQA 4BCQA 2X81A 2OI4X 5DEYA 4L43A 4CKJA 3FMHA 1XH4A 4HYSA 2HZ0A 4G34A 1DAYA 2R5TA 4NIFA 5IUIA 5EOLA 1AQ1A 3ZM4A 2XCHA 2PUUA 3LFCA 2VWZA 1H1RA 4G5PA 4EK6A 4WNOA 3PPKA 3AGLA 3QWJA 4UMTA 4A9YA 4NM3A 4AGDA 4XX9A 4Y46A 4BKZA 4N6YA 1JAMA 2XIZA 2H6DA 4PTGA 5HG7A 3UPXA 1DS5A 3GU5A 4EOSA 2ITZA 5DLSA 4UN0C 3E63A 1Y6BA 1GZOA 3NNWA 2WQBA 2CLXA 2ITWA 3FMLA 3FLYA 4O0VA 2XNNA 1XH7A 2HWOA 4J53A 1H28A 4QPAA 4GSBA 2H9VA 4L42A 2YLFA 5J8IA 3ZTXA 3Q60A 2XS0A 3RBWA 1JKTA 3SXSA 5IISA 2C30A 2BDFA 4FMQA 4F65A 3BYOA 5J9YA 1M14A 2UW8A 4ENXA 3MVHA 4DT8A 4FSQA 4YHFA 1FPUA 4FKVA 4OTRA 3P86A 2JIUA 3L8XA 4IVAA 4PPBA 3ML1A 4BDFA 4PY1A 5HO6A 2VTIA 4I21A 4S31A 3SRVB 2PSQA 4ZTMA 3OCBA 2GHGA 2FSLX 3TT0A 5CNOA 4IWQA 4Q9ZA 3QUDA 5AUVA 3F3UA 2NYAA 4FTTA 5CEMA 1OITA 4RJ5A 4K11A 4FSMA 3FSKA 4HZRA 3C51A 4F1OA 1W2DA 3M1SA 4JNWA 4BN1A 5AUUA 3PA3A 2I40A 4NJ3A 2G15A 3TJCA 3TZMA 3KEXA 1U4DA 1EH4A 5CY3A 4DH3A 2JKOA 4QMWA 5KE0A 5AV2A 4EZ7A 4FE2A 2J5FA 5AAFA 3UNZA 4CKIA 3EYGA 3HEGA 4XG3A 3DT1A 2RG6A 2AC3A 3D4QA 4BCIA 2V5QA 3V6SA 5HBJA 3HMNA 3KULB 2JDTA 4YU2A 1JQHA 4UV0A 2ITYA 4EUTA 3SV0A 4EEVA 4I6QA 2RGPA 5DT3A 5AR5A 4FA2A 2GCDA 4QDEA 3W0SA 1SZMA 2VTOA 1GZNA 4FKWA 1G8AA 3PY0A 3F5GA 3GVUA 4ZXTA 2OO8X 4E4NA 2V62A 3GCQA 5DWRA 2WXVA 5A54A 1CKPA 5HD4A 2PYWA 3OTUA 3H0ZA 2PTKA 1CKIA 4E26A 2IG7A 3TIZA 1JSVA 3VBVA 4IAFA 5DR9A 3QQFA 4FKPA 1XR1A 4C4EA 5GHVA 4YC3A 5BNJA 3WIKA 3HX4A 5JSMA 4M3QA 3NYVA 4XJ0A 3UO4A 4BCJA 3NYXA 2GPHA 4FTMA 2ZDUA 3R22A 1ZOGA 3VJOA 5AR8A 5AR7A 3MB6A 4C36A 2BKKA 3UQCA 4V04A 3KC3A 3F7WA 1REJA 2YITA 4GH2A 5L8JA 4I92A 3I0QA 3U4UA 3UIXA 5CU3A 5AA9A 5M57A 4XG8A 5C9CA 3UDZA 4BYIA 2J0MB 5BUEA 4LV8A 5GZAA 3ALNA 2CKQA 2XARA 1URWA 5A9UA 2YM5A 4GU6A 4JG6A 3ALOA 2X6EA 4RIWA 4YO6A 3TMOA 2GU8A 4DEAA 2P3GX 2WTIA 3ERKA 5AUYA 5I3RA 5BVDA 4PTCA 5IKWA 3GFWA 2YJSA 4X21A 3HRFA 5AV3A 2XKCA 1J3HA 2WMAA 3FDNA 4GMYA 4MD9E 4AT5A 2C6IA 4QP6A 1S9IA 1J7IA 4O7YA 2R3JA 2RFSA 2XNGA 1V0BA 3FLZA 3PFYA 4O4BB 1AD5A 3IG7A 3Q9ZA 2YDKA 4YHJA 4M12A 1IEPA 4F0GA 4EH2A 4IANA 5JRSA 3HRCA 2UZUE 2W1HA 2W7XA 4MXCA 3OOGA 5KUPA 1P4FA 1WBWA 3IDPA 2PE2A 4C02A 1A48A 4FSYA 4TTHB 5HHWA 5HD7A 3C9WA 2W5AA 4BCMA 5IA1A 2NRYA 3MVJA 5J87A 2VTMA 2OICA 4W4WA 4LGDA 3FE3A 5L4QA 1OKWA 3RMFA 2E9UA 2W9FB 2YM7A 3W33A 3WZUA 5E8WA 1GY3A 2QR8A 2ZYBA 4FV5A 3NVKI 3RZFA 3Q53A 5DRBA 2PZYA 3U51A 2IW8A 3C4EA 5KMIA 3BV2A 1UA2A 4DBNA 1KE9A 4FV8A 5EYKA 2VTAA 3W2OA 3PP1A 3RCJA 3LFQA 5AADA 3CCNA 4IZAA 2QOKA 4OW8A 3A7FA 2O5KA 3RZBA 5DYJA 3O50A 1Q97A 3BU6A 5HG5A 4FEUA 4EL9A 2C6EA 4IB5A 2P0CA 1UU9A 2WZJA 2XJ0A 3WBLA 2HW7A 4CV9A 5JRQA 4K9YA 4U3YA 2IEWA 3VWAA 2HXQA 4RVMA 3PZEA 2C5NA 3ZCLA 5I3OA 4EQCA 5HLNA 4IAIA 4L01A 1WVYA 1R78A 3SKCA 1PHKA 2IZSA 4UZHA 1FGIA 1E9HA 2WFYA 4FIIA 2OU7A 3HUBA 4IHPA 2VX3A 4E5WA 5AV4A 4E4XA 5AMNA 3FL5A 3LMGA 3LCTA 3CTQA 2VWUA 4G3GA 4KB8A 4XLIA 3S00A 4L45A 1SVGA 2WPAA 1H01A 2B54A 4Z16A 2V7OA 3TKHA 5BVFA 5L3AA 4IAYA 1G5SA 1UNGA 2W05A 2UZBA 5AAGA 4BIDA 1XQZA 4LRMA 1H4LA 5JFXA 3WOWA 3QD4A 3OEZA 5DR2A 3HZTA 3C0GA 1Q5KA 5CSVA 5ACKA 4AWIA 3W10A 3BGPA 2GTMA 3QA8A 3MJ2A 3ZZEA 1A06A 2R3HA 3RK5A 4RIOA 3Q3BA 3QQUA 1I09A 4EH9A 5K0KA 1SNUA 1TQMA 4U8ZA 3BBTB 4FEQA 3VIDA 1YWNA 3KVXA 4EHEA 2O2UA 3ZS5A 1ATPE 2XBJA 3ZM9A 3TJDA 4DF3A 5J9LA 4B4LA 3O51A 5DVRA 2JFLA 5K3YA 3R8UA 2HZ4A 4O7LA 2AYPA 4WA9A 5J5TA 2QOFA 2X6DA 1YOMA 1YXSA 3C0HA 4O81A 2HELA 3LAUA 2YAKA 4FKRA 3NIZA 3QXOA 3IECA 3L8SA 4E6DA 3MTFA 1IR3A 4OBPA 3DK7A 2PL0A 3OXTA 3QKLA 3VQUA 3BLRA 3R2YA 4EZ3A 3CJGA 5KBQA 2F7XE 3QD3A 4JT3A 4FR4A 3ZHPC 3QYZA 4AGWA 1WBTA 4CFXA 5IQIA 2REIA 1QPDA 4X2FA 5CVHA 5CI6A 4BTMA 5A14A 2X8DA 3BV3A 2HIWA 4USFA 2C3JA 3HV3A 2WKMA 3BYSA 3DLZA 5KMOA 4NFNA 2VN9A 3K5VA 4AE9A 2C6DA 5I9VA 3TNIA 1WBVA 3R1YA 4P7EA 4W4XA 2VWWA 2QURA 1O6YA 4NTTA 2P4IA 3FPMA 2JC6A 5HI2A 4D58A 3AXWA 2QONA 3WZEA 4M69A 3V8SA 3IS5A 3UMXA 2ETMA 2C6TA 3Q6UA 3MGYA 4FK3A 1OL7A 3ZXTA 3RJCA 4Z7HA 4O4DA 2EXEA 3D14A 4F0FA 5I9WA 3MTLA 2BDWA 2XKEA 4IX3A 2JIIA 4BRXA 1WBPA 2ZFYA 4QMSA 3Q5IA 1H0VA 1XHAA 4LUEA 2IZTA 1WBSA 4WG5A 2WMVA 4GL9A 4HGSA 3R8MA 4J8NA 3W0RA 4L53A 4RWKA 4I20A 3UODA 4ZOGA 3P9JA 3G6HA 4QYHA 2BROA 3ZU7A 4F70A 4HYIA 3VS7A 4AU8A 3BL9A 2WHBA 2IF8A 3MY5A 1BUHA 3LE6A 4J8MA 3DOGA 4U3ZA 3EQCA 4FI1A 4IIRA 1M7QA 4L9IA 2QODA 4AP7A 2GSFA 3GP0A 3KB7A 4DEDA 2ITXA 2QI8A 4PPCA 4I6FA 3VS4A 4BCHA 4DN5A 4F9BA 3ZEWA 3S0OA 3NEWA 3O17A 4XCUA 3OZ6A 4EUUA 1P5EA 2JKKA 3LXLA 4Y95A 4QQTA 5EQPA 4W4VA 2XRUA 3QGWA 3FZRA 4MTAA 1VEBA 3LXKA 4JL9A 4JIKA 2XK8A 4K8AA 4TYGA 5EDPA 5FTOA 3UE4A 1E1VA 1OIRA 5HO8A 4BDGA 4XP0A 3MSSA 3HMPA 2WB8A 5CALA 3QFVA 3W18A 5HNIX 1YI4A 4IACA 3D94A 4FZFB 4KABA 4BFMA 4TWCA 4GFOA 4HNFA 5C4KA 4XEYA 3VC4A 2IVVA 2XA4A 3QX2A 1ZMUA 2V7AA 3FZPA 3P5JC 4RMZA 1O9UA 3F69A 4D9UA 3VRZA 4AQKA 2GHLA 3FI2A 2CN5A 4PP7A 2Z2WA 4MH7A 2YISA 4R8QA 4Y83A 1GAGA 3C4CA 4EH6A 5C01A 5CAVA 4CXAA 2ZOQA 3AC2A 3KA0A 4DHZA 4JXFA 4N0SA 4TY1A 2X4FA 4XS2A 5J95A 2UV2A 3K2LA 3TEIA 2WMUA 4JOAA 3O23A 4UMPA 5KKRC 2JAMA 4F4PA 3DBEA 3EJ1A 5CEQA 4A9UA 4ALUA 4C62A 3HV7A 4O91A 4ZLZA 4CLJA 3NFGB 4LV7A 5HE0A 3R1QA 2CGVA 4JVGA 4UMQA 4YZCA 3C13A 4G9CA 3Q32A 4ZEGA 4TYEA 3I6WA 4QTDA 3SC1A 2HXLA 1FQ1B 4FSTA 3TUDA 3HV6A 1SNXA 3NWWA 4GIHA 4XH6A 1IA8A 3CTJA 3JY9A 2BHHA 2OIDA 4IWOA 5CAOA 3BLAA 1W83A 2R3NA 3ZSIA 3NCGA 4AZFA 3VUHA 4GVJA 4FZ7A 2Y4IB 4BI0A 3KK8A 4RA4A 2XALA 4X2KA 3WZKA 3II5A 3ZRLA 4FSUA 4JG7A 5JZJA 3POZA 4XRJA 4F1TA 2OF2A 5E1EA 3E88A 3ID6C 2YDJA 1B38A 4JRNA 5JK3A 3EL8A 4II5A 4PUZA 3W1FA 2RKUA 4NEUA 5EW8A 1LPUA 3WYYA 4C7TA 3SLSA 1PYXA 5M51A 3DKOA 3QQKA 5L6WL 2VO0A 4X2JA 5HCXA 3UOLA 3NYOA 3RGFA 4YBKA 4JX7A 2OKRA 4Y5QA 5JH6A 3FKLA 3Q9XA 3TNHA 3FZ1A 3T3UA 4BWKA 2WMRA 1LEWA 2WMWA 4QMNA 4ZSEA 1OPLA 1V0OA 4HYUA 1L3RE 3FLSA 3DY7A 5M53A 1QL6A 3SRVA 4HJOA 3P7BA 3W2RA 2XM9A 2EUFB 5GZ9A 4KSQA 3BU3A 4FZAB 5TF9A 1GIIA 4N57A 5CTPA 3MYGA 4MK0A 4XG4A 1ZYLA 4EONA 4I0TA 3AQVA 4TNBA 4GFGA 4FSRA 5DIAA 4JDKA 4GVAA 1JBPE 3DJ5A 4KBAA 4CT2A 1ZWSA 2OW3A 3ULZA 3BYMA 2W99B 4FIJA 5IA4A 3NYNA 3IDBA 4E5AX 1XMLA 2CHLA 4PTEA 4AA5A 3NCZA 5FTQA 2C6LA 4I5MA 4DDIA 3TDWA 4I6HA 1J91A 1I44A 4O0TA 5M56A 5J1WA 1VYZA 4QMVA 1OBGA 3I4BA 5HKMA 4QMPA 2PVFA 4ONAA 2F4JA 2B7AA 4DG0E 3KULA 3OP5A 5FEDA 5CENA 3UQGA 5LVMA 4C58A 1OGUA 3ZC5A 3R7UA 3CBLA 4FOCA 3SOAA 1OZ1A 5GINE 3U9NA 4AOIA 3GU4A 1GNGA 3CKXA 4FV2A 3A7GA 2WELA 1XJDA 2UZEA 3GQLA 3UPZA 4S32A 4ZSLA 4XBRA 4BDEA 3AT2A 3OOMA 1DI9A 2OXXA 3ORPA 4F7LA 2EWAA 4UMRA 5JZNA 2FUMA 3ENHA 5CT0A 3CE3A 3UIBA 5EQEA 2YA9A 1H26A 4HOKA 3UIUA 3VUDA 4ALWA 4F0IA 4CMUA 4F6WA 5IA3A 5L2TA 4O27B 2YWPA 3KMUA 2UW5A 2VTTA 3OG7A 4DTKA 4F7SA 1UU7A 1ZOHA 4HCUA 3KMWA 3LCOA 3NFFB 4AGCA 2IZRA 4O7VA 4PRJA 2VNWA 4CYJA 4EOJA 5C27A 3F5UA 2GS2A 4DHJA 4QQCA 2WGJA 4EC9A 2W4KA 1YXVA 4FVRA 5AP2A 4FEXA 5BX0A 3DV3A 3NX8A 4FX3A 2FYSA 2X7OA 3LFAA 1OVEA 4KIKA 4ANNA 5CQUA 4BYJA 5ICPA 3LMIA 4ACHA 3ZLSA 3MIAA 3ODZX 3ZFYA 3DBCA 1ZRZA 5J7BA 3BRBA 4FRFA 3ROCA 4F6UA 3LMHA 1IG1A 2QOLA 2GS6A 2NO3A 4DH8A 3LFEA 5CAUA 2YIQA 5I4NA 2RFNA 3PRIA 4FTQA 2J2IB 4MXOA 4TYHB 5FD2A 3NLBA 4M68A 3OY1A 2WQNA 4GU9A 1S9JA 5TT7A 4FYOA 1UKHA 3FZOA 4MQ2A 5DEWA 5FWKK 3WF9A 1VYWA 1LEZA 3MH1A 5TE0A 4U0IA 1H1WA 4ANMA 3D5XA 4C4HA 1KV1A 4YJTA 3PJCA 4B6LA 4BBMA 1K2PA 4K6ZA 5A4TA 3IDCA 4J97A 4QP7A 3O71A 5BVWA 3P5KA 4AFEA 4EI4A 1GIJA 5E9EA 4FG8A 2XCKA 3EB0A 4PF4A 2YM3A 3ZRMA 5ANGA 4CFUA 2P2IA 3OCTA 1H1QA 4NM0A 2GQRA 4N70A 4AT3A 4AFJA 2XUUA 3QTZA 4IDVA 5LCKA 2OJJA 2JBPA 3MPAA 3BLHA 4ZZNA 2V0DA 1Q8UA 2F7ZE 4AQCA 1Q8YA 3MH2A 3SXRA 4FUXA 4LDTA 3EQBA 1NW1A 4UXQA 5FBNC 4IADA 3QQHA 3S95A 3FL4A 4R77A 2WEVA 4E93A 4BC6A 4XP3A 4XLVA 4XV1A 4EQMA 5L6OA 3LKMA 3AMYA 4GT5A 4W9XA 3EZRA 3QRUA 1YI6A 2OJIA 3QXPA 4NKSA 2GDOA 2X0GA 4DA5A 5FTGA 3LFFA 1YQJA 2R64A 4JQ8A 3BI6A 4UBAA 4L3LA 4ZTLA 4H3PA 3ATSA 3REPA 3SGCA 4MXYA 2KTYA 3V5PA 5CEKA 5I9ZA 2GHMA 3VUIA 3VS0A