1Z5MA

Crystal structure of n1-[3-[[5-bromo-2-[[3-[(1-pyrrolidinylcarbonyl)amino]phenyl]amino]-4-pyrimidinyl]amino]propyl]-2,2-dimethylpropanediamide complexed with human pdk1
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
286
structure length
275
Chain Sequence
PRKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEYLIFQKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTPPKLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-phosphoinositide dependent protein kinase-1
publication title Novel small molecule inhibitors of 3-phosphoinositide-dependent kinase-1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 75
structure length 275
sequence length 286
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2005-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1z5mA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1z5mA01
4PL4A 4QP9A 4RC3A 2GFCA 4XV1A 2J6MA 4D2RA 2BTRA 2Y4IB 4NFMA 5DH3A 1ATPE 3CQUA 3Q60A 4OW8A 5HESA 2QOKA 4EH7A 1CKIA 4ZJIA 1GIHA 1OPJA 3A8XA 5CX9A 4JQ8A 2IVSA 5KZ0A 4IVAA 3DZOA 3GNIB 4OBPA 3TZ9A 3ZLYA 4EH3A 4EI4A 3S1HA 4H05A 3NUYA 3ZXTA 5AUTA 1AD5A 5LMKC 4ZSGA 4O83A 3U9CA 4FMQA 3P9JA 5FQDC 2P0CA 4AG8A 1KE5A 4JBOA 4NIFA 2JEDA 2C3LA 5EYKA 4G9RA 3I7CA 1CDKA 3P86A 3PSBA 4WT6A 4RLLA 4V04A 4E4LA 2JIUA 3EWHA 3I1AA 4GK3A 5CEKA 2B4SB 4ZP5A 1U5QA 3QUPA 5ANIA 4O81A 1R0EA 4K1BA 5HU9A 3GVUA 5I3OA 1OUKA 3AC8A 4GRBA 2IN6A 3EMGA 4AT4A 3L8PA 2HELA 3MBLA 4OAVB 5EQEA 4PWNA 4O96A 3QL8A 4EYMA 3DAJA 4G3EA 4EJNA 4I5CA 4O1OA 1PMUA 4C4FA 3GU8A 3IW8A 4RC4A 3R6XA 1NVSA 5D7VA 4DYMA 4EZ7A 4QMUA 4O7WA 3H9RA 2JIVA 3QRTA 4ZSEA 3FXZA 5BUIA 3EZRA 2BMCA 2VNWA 2WO6A 1OIUA 2WMVA 4FODA 3QD4A 4QP3A 1KV2A 4GSBA 4OTFA 4R7IA 2VTQA 5JSMA 5E91A 2NNWB 5LVPA 4I6QA 2VNYA 4XS2A 1ZRZA 3O51A 5L2IA 3HAVA 4CNHA 3LXLA 5IEVA 4F0GA 1F5QA 3P7BA 4JXFA 4HYIA 4B9DA 4WOVA 3JYAA 5JQ5A 2PZIA 3VF8A 3NYOA 5A4LA 1IASA 3OT3A 1VYZA 3OY3A 4OR5A 4O27B 4WA9A 4D0WA 4AZVA 1OKZA 2B53A 2XNEA 2QG7A 4N4SA 4K2RA 1ZMUA 1F0QA 3V04A 2E9UA 4Q9ZA 3VUIA 3VQHA 3CY2A 2OIBA 3ZFMA 4C3FA 4EZ3A 2YM8A 5AWMA 3QZGA 3S4QA 3DNDA 1IA8A 4BYIA 4CRSA 3FLZA 4MF1A 4D2VA 4YO6A 3R8PA 1YI6A 1Q61A 2B9IA 3D7ZA 2I1MA 4QMZA 3THBA 2Z7QA 3WF9A 4ACMA 4ALWA 5HG8A 4KAOA 1LR4A 4ZS4A 3NVMB 4BDBA 4CG8A 3FMKA 3UNZA 3B8RA 3FYKX 4EH5A 4LOPA 4YHFA 5AUZA 3FI4A 3QA8A 2UZEA 1VR2A 3Q9YA 4GW8A 4I3ZA 3O7LD 4O0WA 4QMYA 4LYNA 2WU7A 5DPVA 4YC8A 5BUJA 4HCTA 2R0IA 3GU4A 3HRCA 5AA8A 5BQ0A 3U87A 3QA0A 3ZS5A 4HW7A 3C7QA 3A7FA 1R0PA 4NH1A 3Q5IA 1JOWB 3Q32A 4TPTA 4S30A 4G3CA 4IB0A 3EN5A 3ZSGA 5F95A 4E6AA 1BL6A 4BZNA 1TVOA 4DH5A 3IOPA 3WF8A 4EHEA 3F2NA 3P0MA 4AGWA 2CMWA 4C33A 3D2IA 2R7IA 2R3MA 3LJ1A 3QCXA 4FBXA 4I92A 4DGOA 4L52A 4YTFA 4YJPA 4U97A 4DFZE 4L43A 3HZTA 3QBNA 5A14A 3I5NA 4OTDA 3R7IA 4NTTA 1H1PA 5IH4A 4NZWB 3TNWA 3ZU7A 4QMMA 3D5WA 3Q53A 4WUAA 5AA9A 3TNQB 3DTWA 1JKSA 2ETMA 4NTSA 2CJMA 3K3IA 5H8EA 5D10A 1YHVA 1Q99A 3WIKA 1H27A 4Y5QA 5EHOA 3DK3A 3ZM9A 4QTDA 4KD1A 2XK6A 4BKJA 2GNJA 4FZ7A 2W4KA 3AC4A 2BZIB 1Q8WA 3VS6A 4UWBA 5C26A 3V6RA 4PMSA 3V01A 5HHWA 3R28A 4DFNA 3UP7A 1LUFA 5CNNA 2C69A 3OOMA 5GIOE 4B4LA 1I09A 3H4JA 3CKWA 3ORIA 1JAMA 4QP4A 4PP7A 5AUUA 3R00A 2UVXA 5JH6A 3EIDA 4NM0A 2HAKA 2C6LA 3D15A 4R7BA 3KXMA 5AUYA 5FD2A 5LXMA 2VGPA 5E8XA 4WSYA 4EQUA 1P4OA 3HV5A 3LCTA 4XG4A 3R8VA 1MQ4A 3PE2A 2Q0BA 3G0FA 3KCFA 4QYYA 3WI6A 5ETIA 3E8NA 2VWWA 4BCGA 2O5KA 3LOKA 2J0KA 3FHRA 1V1KA 1ZOGA 3MFTA 4NFNA 4ZEGA 4YPSA 1SM2A 3UOLA 1OM1A 3FY0A 4JJRA 1K9AA 4QTEA 4CEGA 4L9IA 5IDPA 3KXXA 1FVVA 4ALUA 3SXRA 4IVDA 3G6HA 1XBBA 1G8SA 5C4KA 4CQEA 4QYGA 2QHMA 3QGWA 4PF4A 2FH9A 2X6EA 2X9EA 5CXZA 2CCHA 3L9LA 3CKXA 3F3VA 3NVKI 4BF2A 4MQ1A 4D5HA 4ZLYA 3QF9A 3TUDA 4JBVA 3RPYA 4ASEA 2GQRA 5J7BA 4ZSLA 4LOQA 4CTCA 3RGFA 3VUMA 3IGOA 4JAIA 2IG7A 2H8HA 3HRFA 4XHKB 2V5QA 2YIWA 2X2KA 3MTFA 5EG3A 2VTIA 5LMAA 5IA5A 2QOOA 3ZRKA 4FNWA 4G34A 5K0KA 1XH7A 2YEXA 2IZUA 2QCSA 3POZA 4TN6A 3UO5A 4F7LA 2C0OA 2EXMA 3OBJA 5AR5A 5K5XA 5J9ZA 1PXNA 4I94A 4ZZMA 4DH8A 3PPKA 3HDNA 3V8WA 4GG5A 4OGRA 1OL5A 3GOPA 3ZSHA 3KVXA 5ETAA 2CGUA 3FLYA 5IH5A 1A48A 3NW5A 2ZV9A 2W99B 4XNEA 2HENA 5HBHA 2BROA 3R9DA 4JBPA 5JRQA 3NWWA 5L2SA 4OAUC 2F7ZE 3CXWA 1ZMWA 2ITQA 4FV8A 5GHVA 2CNUA 3TJDA 2EXCX 2P3GX 1H24A 2JBOA 3BRBA 3DFCB 4IZ7A 4M66A 4MXXA 5IMXA 4FV4A 1T46A 3ERKA 2UW7A 2WIPA 4RIYB 2AC3A 1H0WA 4FSUA 2NP8A 2VWUA 4FIEA 1OZ1A 4K0YA 3A4OX 1OL1A 1Q97A 1ZYCA 3I7BA 3JUHA 4J1RA 5HIEA 5L8KA 2OF4A 2H34A 4I4FA 4TZRA 4GU6A 4DEHA 2ITXA 2VTSA 3BX5A 4FKSA 3E3PA 1OKYA 2RFDA 4IAZA 4NL0A 5M08A 2NRUA 4B7TA 4X2KA 4AN9A 1NT2A 5DR6A 4W9WA 3I79A 4OT5A 5IA3A 4X3FA 3MN3A 5ANKA 3QCSA 4JRVA 3G9NA 3Q9XA 2YWPA 4JIAA 5CSXA 2PMNX 4Y73A 4CZYB 4YSJA 2J0LA 3SA0A 4O7NA 4U81A 4XG6A 3LQ8A 3OTUA 1PMVA 5CSWA 2GNFA 2YACA 4U44A 3NPCA 3RK9A 3EYGA 4L3JA 3E63A 1SVEA 4GL9A 2HYYA 4QT1A 5J8IA 5BVFA 4BTMA 4FTUA 1LP4A 4KS7A 4CFXA 1WVWA 2RFSA 2G01A 2QI8A 3GCQA 4Z16A 3SC1A 2ITZA 2W7XA 3WZUA 1QPDA 3OUNB 4AOJA 3QCQA 5FBOA 5I9YA 3CY3A 3OZ6A 4YNEA 3P08A 5H3QA 3H0YA 3QQLA 5B2KA 3U8WA 1WFCA 4ZTMA 4AWIA 3EB0A 4X2NA 5KO1A 4J95A 4XBRA 2XRWA 2IW9A 5KNJA 2PU8A 4X21A 3TZ7A 3R7VA 2HW7A 2HOGA 3LVPA 3QCYA 4BIEA 2DWBA 3TL8A 2IW6A 3PXYA 2IVUA 1FOTA 1MRYA 3LXPA 4YZBA 3AT3A 3QXPA 2OIQA 2VGOA 4RIOA 3R1NA 4RT7A 4IANA 3RZFA 5CANA 3MFUA 2BHEA 4EC9A 4ZY6A 4D2SA 3GI3A 4XP2A 5HLNA 2HY0A 2X9FA 4TWNA 4DITA 3GGFA 2IZTA 3E7VA 4JG6A 4K33A 1L8TA 3GUBA 5CT7A 3R04A 4Y8DA 5DRDA 4IB1A 4U8ZA 1OMWA 3EQRA 2G1TA 4KIOA 5AV1A 4F6UA 4MD7E 2PY3A 4QP6A 5J1WA 3KFAA 3MY5A 1UVRA 3R73A 2XK3A 2Z7LA 4HYHA 4FVPA 4M7IA 4PPAA 4XOYA 2HXLA 5HE3A 3VBXA 3VS2A 4DAWA 4C7TA 4LV5A 2JAMA 4XCUA 4IE9A 4R1VA 3P78A 4JDJA 1H4LA 5HCZA 4IZ5A 4YTIA 4O7RA 5E90A 3ZLXA 3COMA 1YI3A 4IWPA 3EL7A 3A62A 1HOWA 3R8LA 4JQEA 3LXKA 3FI3A 2J0JA 2BHHA 2P33A 3DNEA 4HZRA 4TY1A 4CFVA 3DPKA 5AADA 4H39A 5E8ZA 3LQ3A 1H25A 2ZMCA 2JKKA 4LRJA 3A2CA 2GSFA 1WAKA 2I6LA 5BUEA 5L2TA 4IVBA 3T9TA 4R1YA 4FTKA 2WU6A 3PZHA 3RMFA 2W1IA 3N4TA 1QL6A 2VU3A 3FKOA 4FUYA 3DA6A 4Y46A 3RCJA 3TXOA 4ERKA 2OJJA 2BZHB 2BKZA 3NYVA 3SKCA 3QTQA 3UG2A 4BCQA 3RI1A 4LOOA 3RK5A 4BBEA 2I7QA 2WQEA 5EDQA 3R7EA 2DQ7X 3BHUA 2W05A 4U3YA 4LQMA 2O65A 4MX9A 3GB2A 4ANSA 3PXQA 4C02A 4BDIA 3FLSA 4HNFA 4G6NA 2JAVA 3W2OA 2EB3A 3W16A 3MH3A 4ANQA 4UMPA 1O6YA 1JBPE 3NYNA 5CS6A 1YXXA 5AP1A 3LFDA 2BAKA 4FG7A 4QNAA 3QGYA 4S32A 5CF4A 3RPSA 4QMVA 1GNGA 4ACCA 3OHTA 3OY1A 5DR9A 2QONA 4D9UA 3KK9A 2YHVA 3D14A 4J99A 2CHLA 4RFMA 3LLTA 2J2IB 3R7YA 4RJ4A 3V5QA 1DS5A 3QZHA 1YOMA 4CMTA 5HU3A 3KN5A 4O6LA 3KRLA 5KHWA 5HNGA 4P2KA 4O2ZA 4PDOA 1G5SA 2ITTA 3LFAA 4NU1A 3ZUVA 4MBIA 1GAGA 3MTLA 3OCTA 1J7LA 5DG5A 3DBQA 4BDCA 1PW2A 2PVJA 4DCAA 3IW5A 2XP2A 2WHBA 4BDKA 3P4KA 3UVQA 2WMAA 1R3CA 1H28A 4CT1A 3O23A 3PVGA 5LVLA 3ANRA 1OL6A 2WEVA 5HVYA 2WTIA 1AGWA 4ZJVA 1XH5A 4ZAUA 4D9TA 4L3LA 3OW3A 1B39A 5HI2A 3FZPA 3MSSA 5DVRA 4ZSJA 3VIDA 3BHTA 4CV9A 4HPTE 2PUUA 3BQRA 4MWIA 4O0VA 3PJ3A 4Z3VA 2G9XA 4R5SA 2UVZA 4RG0A 4WO5A 3V8SA 3QTIA 4O0TA 3P7CA 3CTQA 4RIWB 3R8MA 3ZYAA 3BEGA 5H2UA 2UUEA 3EQGA 3F3ZA 1ERKA 1F3MC 5A6OA 5AUVA 3BU3A 3BZ3A 4BDEA 4FV5A 4KSPA 2A27A 5EYCA 5JGAA 2VZ6A 3DJ5A 4TKSA 3OCSA 2KTYA 4AW1A 3FAAA 2GCDA 3V5LA 3C50A 3EN4A 5CEPA 4Q5HA 4OBOA 3T3UA 3BYMA 5KKRB 5AR2A 2RG6A 2Z2WA 3ACKA 1UWHA 2YDJA 3O7LB 5H8GA 5C8NA 3IDPA 3OXZA 3QRUA 2YDIA 3Q4TA 4RQVA 4UN0C 4FKIA 4MH7A 2JC6A 2YJSA 2F49A 4BGHA 1Q8ZA 2JGZA 4PDPA 2XBAA 5A4TA 3KXNA 2GU8A 5DR2A 5BYLA 2ETKA 3BBWA 2PWLA 5FEQA 5HKMA 1U54B 1HCKA 1OB3A 3EN9A 3BU6A 3HEGA 5HG5A 3FMJA 4U79A 4D58A 4U7ZA 3OCBA 4JS8A 4FF8A 1XBCA 3EFLA 4TYHB 4YR8A 3E88A 5IF1A 3TV6A 5EDPA 2W1GA 3EJ1A 3LFCA 4AF3A 1MQBA 3VS4A 4M0ZA 4ITJA 4PNIA 4TYIA 5D9HA 4ORKA 1FPUA 3GCUA 3GOKA 5AR7A 4QMNA 2PE0A 4GS6A 4I93A 4AQCA 5J79A 4KKEA 4NJDA 4RJ8A 5E8TA 3RALA 2YAKA 3VBTA 3WIGA 3ZZWA 4ALVA 4EBVA 5J9YA 4X6RA 3QD3A 4JIKA 3MPAA 3PA5A 4W8DA 3ALOA 4RX7A 3L9PA 1WBOA 4JG7A 3VUTA 4QO9A 5EQPA 4K18A 2OBJA 5CEQA 3RAIA 4AZTA 4ZTQA 4E4NA 5A4CA 4CKRA 4KS8A 4ZY4A 1OL2A 1U59A 2YM3A 3PTGA 5AP4A 5FP6A 2A19B 2PVFA 4IB5A 2C6EA 1NA7A 4F4PA 2C0IA 4RLKA 2RG5A 2O0UA 2W1ZA 4RC2A 1WCCA 2B9FA 4I20A 5IQDA 4KKHA 2PZYA 3PLAE 3ZZEA 4RJ6A 1ZOEA 1Q8YA 2ZYBA 3KREA 2OZAB 4UYNA 4OTRA 4OTPA 2PZRA 4ZJJA 3SAYA 2XMYA 1H07A 3RWQA 2W17A 3HP5A 3Q52A 5E8UA 3SDJA 4MWHA 4CFWA 3AQVA 5CY3A 4H1JA 5ANOA 4U40A 1JLUE 4O38A 4FTLA 5KMJA 1KE8A 4C38A 4BY9E 3KCKA 4FV1A 2FO0A 5JFWA 3LM5A 1W98A 4CKIA 4ZSAA 2XK8A 3NMUF 2BALA 3MY0A 4RSSA 5BNJA 1G8AA 5ANJA 4CQGA 4O0SA 2QD9A 3GT8A 4GT3A 4EORA 5CAPA 5F9EA 1ZLTA 2CDZA 4J98A 4DFUA 2J0IA 2B55A 3WYXA 4FZ6A 4EH2A 1ZMVA 2C3IB 5E4HA 2BTSA 4I41A 4FIFA 4U9AA 4EEVA 5IQBA 3DV3A 3VS3A 2CNVA 3D94A 3FDNA 5DT4A 4D4VA 4TYJA 3W18A 4WG3A 2V22A 5AV4A 4ZLOA 4TWOA 3Q4UA 4M69B 3TTIA 3W2QA 5L8LA 4FUXA 3PA4A 2WTDA 3R1YA 5L6WL 4AA5A 3KVWA 5DFPA 1H1RA 2UVYA 3P23A 5AAEA 4YLJA 4USFA 1TKIA 3ZBFA 4Y5HA 4O91A 5C4LA 4DGLC 4E8AA 5HG9A 3IG7A 4A4XA 4FTNA 1Q4LA 4O2PA 5HD7A 3CJGA 3UZPA 4XX9A 2WTKB 4NSTA 2ZDTA 2W5HA 4UV0A 3ORLA 4D2WA 4DN5A 4BWXA 4FSMA 1XHAA 4ZLZA 2I40A 4FVQA 2ERZE 3QQGA 4MXOA 3K2LA 3I0QA 5J87A 2CKOA 3NLBA 1TQIA 4QOXA 3VBQA 2CLQA 5AEPA 3U4WA 3DXNA 2YA9A 3H3CA 4YURA 2WXVA 3P79A 4YLLA 4EH6A 1FGIA 3LCDA 3LJ2A 4RWJA 5EM6A 5JQ8A 1TQPA 3IKAA 4AZSA 4BZDA 2JFMA 3FLNC 1OBGA 3CGOA 3Q2MA 3O17A 3VHKA 3ANQA 1PXMA 1KOAA 4QYHA 3ZONA 4UX9A 1H1QA 1PRYA 5DE2A 4BGGA 2R3GA 4PDYA 3A7GA 4FX3A 4DH7A 5JKGA 5JK3A 2VX0A 5KKRC 5D12A 4JBQA 1SVHA 2JDSA 3BCEA 5BMMA 4N0SA 4ZK5A 3ROCA 2R7BA 3QWJA 4UEUA 4RFZA 3L8VA 3LM0A 2ZMDA 4QYFA 4YC6A 3WE4A 3LFQA 3C0GA 3A7HA 3HMOA 2OJIA 4HVGA 5EW9A 3H30A 2BRBA 4DBXA 4GT5A 1MUOA 4XG8A 4YJOA 4YZNA 3ALNA 1XH4A 3BQCA 3DCVA 3QX4A 3WZJA 1OIRA 1YDSE 3DK6A 3GQLA 2BAQA 3NDMA 3SOCA 3QTSA 4AAAA 4EOLA 5IQIA 2QKRA 3LFEA 4CYIA 1X8BA 5KMIA 3A7JA 3BIZA 3GC7A 3CD3A 2QC6A 4IWOA 3QHWA 2E9OA 3QLFA 3R2BA 3GC0A 1REJA 2GNGA 3R1QA 3TKIA 3MV5A 3NYXA 4O22A 3WOWA 4XBUA 2G15A 4A4OA 2PVRA 1H1WA 3N4VA 4FTIA 3C4FA 1OBDA 2XJ0A 4HNIA 3EFKA 2XVDA 5EI6A 2HW6A 3I6UA 1GZKA 2VAGA 3QQFA 5EDRA 2VTMA 1IEPA 1OIQA 3ET7A 4EOMA 3QD0A 3PY3A 3MB6A 4DCEA 2ZJWA 3BGQA 4MEDA 3UE4A 3BYUA 1HCLA 4FL3A 4NKAA 1ZYJA 4R5YA 4QMXA 3BGPA 3CD8A 3PVWA 3Q3BA 3N9XA 4XLVA 4B8LA 4HGLA 3ZH8A 4IAYA 1OL7A 2XB7A 3DBDA 1PXJA 3FMEA 3BYSA 1QCFA 4S31A 2BZJA 4RIYA 3VUDA 5LWMA 3GCSA 1U4DA 1KWPA 3AD5A 2QOBA 2OU7A 3G6GA 4GUEA 4TT7A 4LV8A 2PUNA 4CGAA 4C36A 3LW0A 3LFNA 4CVAA 3AOXA 2OWBA 5CENA 3HRBA 3Q04A 3BPRA 3RTPA 3BWFA 4I22A 3SXFA 4D2TA 1PXPA 3DBEA 4B6LA 1IR3A 4O82A 4RWLA 3ZO1A 4C4IA 2VWXA 2CN5A 3FMMA 3NUPA 4BL1A 1BI8A 4RIXB 3WE8A 4AGDA 4DH1A 3DS6A 3K5VA 4P7EA 5CEOA 2FB8A 4EK5A 4BCFA 1XJDA 4RFYA 4MTAA 4IB3A 5HCYA 4FZDB 4FEQA 1SYKA 3HL7A 3OWLA 4RWIA 4AOTA 4BCPA 3HDMA 4UXQA 4CRLA 2BIKB 4EHVA 3C1XA 2GMXA 4DEIA 1YHWA 4ANOA 1XO2B 1URCA 3UMXA 2ZAZA 3TZ8A 2C6DA 4A07A 5CASA 3QYZA 2VO0A 2QKWB 2UZWE 5CF5A 3DQXA 4FL1A 2ITOA 3ZO3A 4XUFA 3IPHA 4QTCA 2W1EA 2QR8A 2WMUA 4UMTA 5EFQA 4DH3A 3PIYA 1QPJA 3RKBA 4GH2A 4O1PA 3OP5A 4DG0E 1WVXA 2GDOA 4D28A 4TL0A 5HQ0A 4ID7A 2BKKA 5FGKA 4C4JA 1DI9A 4M68A 4EUUA 2PVNA 2ITVA 2WKMA 2YM4A 4OUCA 4M84A 3PRIA 3FJQE 3KF7A 4XV2A 4XOZA 3UO6A 3DKGA 3OMVA 4M0YA 2UZTA 4KIKB 3VBVA 4AN3A 3NUXA 5HVKA 5IQGA 2PE2A 1UKIA 4I24A 4M13A 5LVOA 3H9OA 3R8ZA 1PYEA 5HO8A 4HVDA 4M12A 2F57A 5EW8A 3NNXA 1JKKA 3U6IA 3COKA 4F63A 3CEKA 4USDA 1KSWA 4JI9A 1M2RA 5E8SA 4TNDA 3VUKA 5HVJA 5IEXA 3BWJA 4ITHA 2VTAA 3QFVA 2JKOA 2V55A 2YIRA 3FSFA 4LUEA 4PTGA 3SOAA 3TWJA 4QTAA 1CKJA 3ENMA 1G3NA 4EK3A 1Q8TA 2IZRA 3MIYA 3U9NA 3TIYA 3ZSIA 4DFLA 3TNHA 1BI7A 1H00A 4KINA 4OTQA 4XJ0A 3ZFYA 5J9LA 2JDOA 5GJGA 4BI0A 3LQ5A 4I1ZA 4CT2A 5IU2A 4P90A 1MP8A 4F99A 4M8TA 3AGLA 2P2HA 4MD8E 4N6YA 2GQSA 3ZO2A 2RFNA 4IFCA 4UYAA 1REKA 4YJSA 3M2WA 3BELA 5KCVA 2Y4IC 4BC6A 4CG9A 5M09A 4CZUA 3F3UA 4JX7A 5A54A 5K0XA 3TT0A 2XNOA 4ARKA 3E8DA 4I0RA 5J1VA 4JL9A 1W8CA 3UGCA 3EQFA 3B8QA 4QMPA 3PXFA 2ZV2A 4MKCA 2X81A 5A46A 4CFNA 3V5WA 4PMPA 1FBNA 1J1BA 1H08A 1IRKA 3QC4A 3S3IA 5E9EA 5C8KA 3R02A 4IX3A 2V0DA 4C3RA 4CMUA 3SVVA 4DEAA 1XH9A 3MPMA 3B2TA 3SLSA 4DEGA 1YWVA 5LCKA 3F6XA 4ENXA 4R3PA 3HA8A 5CTPA 5BYYA 3VS5A 3ZLSA 5I5ZA 4H3BA 4AACA 2R5TA 3FZTA 5CVFA 5AM6A 4R3RA 3F9NA 2QVSE 4ZMFA 5J5TA 4WRGA 4J7BA 5HD4A 5IA4A 3C13A 4R8QA 4DTBA 1VJYA 3PP1A 3IDCA 4E5AX 2PZ5A 3JY0A 3OC1A 3FMDA 3PG1A 4QPSA 1H26A 3DJ6A 5HLWA 2C1AA 3NUNA 3WF5A 4FTOA 3RZBA 2UW8A 3COHA 4ZY5A 1ZWSA 3AMYA 5AAGA 5EQYA 3PWDA 4D0XA 4ZIMA 2XK7A 3EN7A 4P5QA 3ELJA 3RJCA 3TJCA 5M44A 3W10A 3D9VA 3VULA 4V01A 3PDTA 3MGYA 5J7HA 4EWQA 2JFLA 3M1SA 3NCZA 4FIGA 4BB4A 4F1MA 2XCHA 4GKIA 3AGMA 3F7ZA 3RAHA 3SX9A 4LRMA 1KUTA 5DA3A 2WTVA 4E73A 2B9JA 3GEQA 4KIQA 3Q96A 2ZM1A 3OROA 4TWPA 2FA2A 2RFEA 3IQ7A 4F9WA 3TDWA 2OI4X 3KN6A 3ZUUA 4FTMA 2PMOX 5IA2A 2VWVA 4FG8A 1YWRA 2ZB1A 3NGAA 4RPVA 4RIWA 4YHJA 3ZDIA 1M52A 5LCJA 2C0TA 1V0OA 3UIUA 5A6NA 3ZO4A 1IAJA 1YXSA 1WBPA 5HX6A 2HXQA 1QPCA 5L2WA 4OLIA 3EFJA 5CVGA 3OBGA 4FKRA 2EUFB 4N70A 3F5GA 2PSQA 4A7CA 4APCA 4CSVA 3ODZX 5BMSA 1UU3A 2B7AA 3CGFA 5I9XA 2FSMX 3E7OA 2PULA 1YW2A 3BLRA 5CSPA 2BAJA 4UZDA 4Z7GA 5CYIA 3VHEA 1CMKE 1Q24A 2VTNA 3R21A 5HEZA 5M55A 4MF0A 2IO6A 4V05A 3D0EA 2QO2A 2GS2A 3IOKA 3TNIA 3CIKA 3KRWA 3F2RA 3AXWA 2BZKB 4RGJA 4FOCA 1YXVA 3NUUA 4CTBA 3RM6A 3DXPA 3W2CA 5E7RA 4NUSA 2XH5A 2QR7A 2WTWA 1U54A 1DAWA 1U5RA 1ZYLA 4WRSA 4WNPA 3NEWA 2PUPA 3SW4A 5I9UA 1ZYDA 3ZEPA 4C57A 4TYHA 4U3ZA 3I6WA 4LG4A 4O6EA 4RJ7A 1Q3DA 2GHLA 3TTJA 4EHZA 4FKGA 2GFSA 3BV3A 2OXXA 3OG7A 3R71A 5IQAA 3PE1A 2OK1A 2XF0A 2JBPA 4QMQA 3TUBA 3W2RA 1QPEA 3MJ2A 1FVRA 1KV1A 5EYDA 2ITUA 5BVOA 2Z7RA 3PXRA 2RF9A 4BBMA 3R9NA 2WZJA 5AP5A 3DB6A 2XM9A 3BV2A 2BCJA 4IZAA 4IMYA 4TW9A 3R9HA 3NNVA 5IQEA 2OICA 3TEIA 3FXXA 3O71A 5DIAA 5AX3A 2QU6A 4JDKA 4RJ3A 2J4ZA 3ZUTA 1PMNA 4EUTA 3WZEA 4IC8A 1PJKA 5EHYA 5TO8A 4MNFA 2BFXA 5AMNA 5I9ZA 2GNHA 4KUJA 3DBFA 4I5MA 3VRZA 4HVHA 4BR3A 3UQGA 1PKDA 5FEDA 4AX8A 2R3RA 4C4GA 3R7UA 3NZ0A 4AU8A 4KNBA 4X0MA 4E4XA 1V0PA 4UMRA 2OZAA 1UKHA 3FQSA 3ORMA 5F1ZA 4MXCA 3NRMA 1P5EA 4G3FA 4F7NA 2GPHA 2YCRA 4FE2A 3AD6A 2YCSA 2R3FA 5HIBA 4FIHA 3NX8A 1I44A 3EL8A 4O0YA 2I0EA 4E6QA 5IEYA 4DG3E 5DEYA 2OJGA 5IG1A 4EOSA 1R39A 5EM7A 4UWYA 1T45A 4UMQA 3TKUA 2O64A 4UALA 5KMKA 2C5VA 4F70A 2I0YA 4BCMA 2C3JA 4C35A 3T8OA 3VQUA 1WBNA 4YMJA 4AFJA 1ZARA 4EC8A 5IQHA 3EHAA 4JAJA 3LPBA 3NW7A 4L7FA 2WQMA 3FSKA 4YBKA 3P7AA 3RVGA 4HJOA 3C51A 4CCBA 3N51A 4FGBA 4JR3A 2XNPA 5BVNA 5HX8A 5JN2A 2VO3A 5GIPE 3PA3A 2JDTA 5E92A 4IVCA 2OJ9A 1SNXA 3S0OA 3CQEA 5DT0A 2OKRA 3GCPA 4O7SA 4M69A 2XCKA 1CSNA 1Y6BA 5JGBA 2BUJA 5AUXA 2C6IA 3I0OA 1R1WA 3VNTA 2CKQA 2F2UA 4D1XA 5HTBA 2ACXA 3EQBA 4DEBA 4GYGA 4IBMA 3TNPC 4WD5A 4IDVA 5FLFA 5LVMA 4IAKA 4AT5A 2XKCA 4QMSA 4YZ9A 4QMWA 5A3XA 3AC2A 4FZAB 4PPBA 1LPUA 3FEGA 4KKGA 2LAVA 3E5AA 2B52A 3KXGA 4OTWA 3D7TA 5DI1A 3V51A 3WZKA 5FXRA 3LIJA 4BGQA 2WAJA 2WFYA 4MNEB 4S33A 4NWMA 2EVAA 5J5SA 5KMMA 1V0BA 4GFMA 4Q2AA 3C0IA 3ENHA 3O8PA 3LAUA 3RPRA 3F3WA 4ZTNA 2PMLX 4FEWA 3H9FA 4U43A 3MESA 3F88A 2YM7A 1E9HA 4NT4A 3U6HA 4QPAA 3SG8A 3CC6A 3RPOA 5DMZA 5TT7A 2XIYA 4O7VA 3DKOA 3SHEA 4R77A 3NSZA 2JDRA 3BBTB 2R64A 2Y6OA 5E8VA 3K5UA 3ZC6A 4EOQA 5KE0A 1XH6A 3QQUA 3QRIA 2YIQA 2C5OA 4I5HA 4DC2A 3OEZA 5AAFA 4DHFA 2YLEA 1UA2A 5G6VA 3MFSA 3TDVA 4W8EA 2R3PA 2QG5A 1RE8A 2R3HA 3PSCA 5LVNA 3ZC5A 2W06A 2FGIA 3FKNA 3F3TA 5L3AA 2W1FA 2YDKA 4F1TA 5HBJA 4FV7A 4I23A 2OH0E 4EH4A 4TRLA 4UBAA 5IUIA 5DBXA 3CPBA 1ZYSA 2YM6A 2VRXA 4TWCA 4S34A 5CF8A 4EJ7A 3QHRA 3DFAA 1DM2A 2JKMA 3D4QA 2W1HA 4WBOA 2FSOX 4YZCA 5CZIA 2PYWA 3PRFA 1P2AA 3FZRA 4ASZA 4EL9A 2QNJA 4NM5A 2VWIA 2RL5A 2UZLA 4GFOA 3TI1A 3R8UA 4FTQA 3QU0A 5CVHA 4FEUA 3AD4A 5I0BA 1YXTA 3EQHA 2QOCA 4W4YA 4PDSA 1ND4A 4APPA 3C9WA 5HLPA 5ETFA 1K2PA 3UOHA 3HV7A 4G16A 4FT7A 2A0CX 2HWOA 2W4OA 3FY2A 3CQWA 4AP7A 3DTCA 3MVLA 5JZJA 1ZZLA 3EH9A 4FV0A 5TOZA 4DGNA 3WBLA 3TCPA 2SRCA 3DLSA 4NCTA 1CM8A 4M67A 1UV5A 2X1NA 4UZHA 3ATTA 2OFVA 2ZVAA 1JVPP 3BE9A 3U55A 1LEZA 5CALA 3VJNA 4EOPA 3LCOA 3UOKA 4F9BA 1S9JA 3V5TA 2XJ1A 4E93A 3VJOA 3QRKA 2GTNA 3PPJA 3KC3A 2PZPA 4O86A 5FDPA 5EOLA 3EQPA 5LARA 2QQ7A 3VBWA 2WPAA 4O7TA 1WMKA 3BU5A 5CI6A 2R3NA 2YIXA 3JVSA 5HBEA 3F66A 4W4VA 2X2LA 3OS3A 2C5NA 2AUHA 2IWIA 3CR0A 3I4BA 1UNLA 4D4YA 5AFVA 1S9IA 3Q2JA 1BUHA 3N4UA 2FUMA 5L6PA 5EM5A 2XYUA 4G9CA 3UG1A 4A06A 1YQJA 4RIXA 4D2PA 4LMNA 5IMEA 3KMUA 4DTAA 5AM7A 4EQMA 3DDPA 2REIA 5AP3A 5EI8A 5ACBC 4GKHA 2RKUA 4YBJA 2BRGA 4K6ZA 4WIHA 4MHAA 1AQ1A 2ITYA 3Q9WA 4O0UA 3HMIA 3ORKA 4FC0A 3RNIA 1PMEA 3CJFA 4YJQA 4LGDA 4C2VA 3KL8A 2UW9A 1SNUA 4P4CA 5K3YA 1MRVA 4FTTA 4LM5A 4BDDA 4E1ZA 2NPQA 1GZNA 5CAVA 4X2FA 2YZAA 5AP2A 4E5WA 3Q4ZA 1XR1A 5L6OA 5FXSA 3IS5A 4XG2A 5F4NA 2ZM4A 3RNYA 3W55A 2C6MA 5M57A 3L1SA 3WF7A 3MFRA 4ITIA 4BZOA 3VRYA 3UZTA 4OTGA 3PJ8A 4FOBA 2W1CA 3D2KA 1JSUA 1VEBA 2UW6A 3H10A 3CP9A 2J5FA 5CAQA 2VX1A 2R3QA 2YCFA 3GFWA 3HMMA 2DS1A 3O2MA 4EKLA 2QHNA 2Z8CA 3KF4A 4KIKA 3Q6WA 4C4HA 3PVUA 5HE1A 4DT8A 1KE6A 1WVYA 3DKCA 3JS2A 4UB7A 2PVYA 2Z02A 1BMKA 4PPCA 4TYEA 3HAMA 3HMPA 3IONA 4G3DA 3RBWA 1O6LA 1OIYA 4L42A 3NUAA 2ZDUA 3G51A 5AJQA 3ZLWA 3UYTA 4IX6A 4NK9A 5EH0A 3KXZA 2R4BA 4MK0A 5M53A 1L3RE 2YN8A 3LFBA 3MH1A 2CKPA 5BPYA 1B38A 4EWHA 2YABA 4HPUE 2C30A 2Y9QA 4QP7A 4FKLA 5AV2A 5FDXA 2VN9A 2PUIA 4FG9A 2BDWA 4GEOA 4EH8A 2ZV7A 3OWJA 5JGDA 5JMSA 1FGKA 4NM7A 4AW5A 5DYJA 4V0GB 2W5AA 4EHGA 3PLSA 3MDYA 3OWPA 1UU7A 2F7EE 3EOCA 4XLIA 4Y72A 4K9YA 2YZLA 2VTTA 3G33A 5HOAA 4JOAA 5CU2A 3U6JA 2CLXA 4C4EA 3IDBA 4IM0A 3UPXA 5ANGA 3U4UA 3DT1A 2WMBA 4GCJA 2B1PA 2R0UA 3GC9A 4BDJA 3DJ7A 4HCVA 4C34A 3ID6C 4ZZNA 5CQUA 5K4JA 1UU8A 4Y85A 5BVEA 3UYSA 3Q6UA 4BDFA 1E1XA 5KUPA 1UNHA 2X8DA 3FHIA 3PJ1A 3VBYA 4BHZA 4X3JA 3UQFA 2J0MB 4QP2A 1R78A 2A4LA 2ITWA 3R9OA 4II5A 4ZXTA 2WB8A 3EKKA 3KB7A 4EOIA 2XRUA 4YLKA 3A4PA 4O84A 4U6RA 3PP0A 3E92A 2YFXA 3QD2B 3GFEA 4I0SA 5ACKA 5CAUA 2ONLA 2F4JA 4J71A 4E26A 3BLQA 2PTKA 1BL7A 4PV0A 4PY1A 1FVTA 3S95A 4LGGA 5HNIX 2QOHA 3EZVA 4W9XA 3KRRA 1YXUA 1BYGA 2X7FA 1P4FA 2EU9A 5HE2A 4H1MA 1ZY5A 1WZYA 5HO7A 4IJPA 4AGUA 4C3PA 3IK3A 1Y91A 3NAXA 4DBNA 4WSQA 3GU7A 3PYYA 2JITA 5AV0A 4FKVA 3UTOA 5C1QB 2CCIA 4A9UA 2OFUA 5L4QA 1OECA 2VTJA 2JLDA 3ORNA 4HGSA 5HE0A 3QKMA 4IAIA 3W8LA 5B2LA 3KMWA 2R3KA 3E64A 3O8UA 4BFMA 1OI9A 1Z9XA 2IVVA 2Y0AA 4FSQA 4FYOA 4G1WA 4IAAA 4JVGA 4HGTA 4I6BA 4FKJA 4XRJA 4GMYA 5CSHA 1W82A 2W5BA 3HMNA 4FV2A 3ROYA 4ZZOA 3R63A 3KRJA 4YUQA 4DGMA 1YOJA 2EWAA 3RAKA 4DFXE 3SRVB 1DAYA 4F08A 1J7IA 4BCIA 2Z7SA 4KABA 4M97A 4YGAA 2DUVA 4IHPA 2KULA 4O7ZA 3IW7A 4C59A 4I6HA 4PTCA 4Q9SA 1OVEA 1NVRA 3QX2A 2O63A 1YRPA 4CXAA 3QUEA 4RX5A 4YTCA 4BI2A 3VF9A 3QZIA 4FSYA 4JG8A 4YO4A 5DOSA 5FUTA 3FQEA 2PVMA 5FBNC 5ETCA 1EH4A 3PJCA 4Y95A 3VVHA 3LE6A 4D5KA 5HIDA 5AUWA 3ZMMA 3KQ7A 2A2AA 4XG3A 5IISA 3NCGA 5JRSA 3V5PA 1OPLA 5J95A 2WD1A 3TIZA 3W2SA 4ANNA 4TTHB 2Q0NA 4AE6A 4BWKA 4RVKA 1RJBA 2OW3A 5F20A 5CT0A 2VD5A 4L53A 4U42A 2WMQA 2FVDA 2O3PA 2LGCA 3FXWA 4XYFA 2GHGA 3MWUA 1H1SA 1FMOE 2X8EA 4IX5A 4FTCA 5CF6A 4J96A 1GY3A 4F7JA 5D41A 3CS9A 3ZXZA 3VUHA 2YERA 3F82A 3C4WA 3VO3A 2YLFA 3GQIA 3QUDA 1B6CB 1STCE 3L8SA 3BYOA 3HUCA 4EZ5A 5DN3A 4HOKA 3OVVA 4GV1A 3LHJA 3R1SA 4QRCA 4DTKA 5IUHA 2ETRA 3KULB 1DI8A 1OPKA 4PUZA 4L67A 2VUWA 3DAKA 3DZQA 4BDAA 4BKZA 1XH8A 5HORA 4BICA 2FYSA 1JKTA 1OITA 2B9HA 4CZTA 1J3HA 4IM3A 3ZOSA 2FSTX 3E87A 3FZSA 3FL4A 4FSNA 1VYWA 2BDJA 5IPJA 2XA4A 2BVAA 2CGXA 3DOGA 4JDHA 4IC7A 4QMOA 3OTVA 3NAYA 3PUPA 3VS7A 3KRXA 4R3CA 5CEIA 2C1BA 3DKFA 5EHLA 3W1FA 4J8NA 5ANDA 3TN8A 4QNYA 4GYIA 4DLJA 3SGCA 3TV4A 2XM8A 4PX6A 2WTKC 3PY0A 2GTMA 5GJDA 3EFWA 4K77A 2C5XA 4DINA 3FZOA 3PZEA 5FM3A 1K3AA 3OFMA 3FL5A 3QRJA 4G6OA 4PMMA 5IH6A 4AE9A 4ZMEA 4HYSA 1U46A 3FLQA 4L44A 2XNMA 5D7AA 2XS0A 2CSNA 3C4ZA 3TZMA 1PXIA 4OTIA 1YDTE 2O8YA 4KBCA 4KIPA 3AMBA 4FKQA 1E1VA 2WMTA 5I9VA 4NKSA 4AZEA 4CYJA 5BX0A 3MI9A 4L3PA 3JXWA 3C5UA 4QQ5A 2XKEA 5DT3A 4IADA 4OT6A 3JR1A 4FYNA 2XIRA 3BLHA 4IFGA 5LOHA 1PYXA 2V7AA 3RP9A 4TYGA 3BEAA 3RK7A 1PF8A 4KWPA 1SZMA 2X8IA 4LMUA 1H0VA 2C3KA 2UW4A 2ITPA 4FV6A 3KXHA 2EB2A 2XK9A 3JY9A 3TV7A 2NRYA 3VS0A 3W8QA 4F65A 2OXYA 1J7UA 5IKWA 2OO8X 4A9YA 4IWDA 3NS9A 2AC5A 2QLUA 1JWHA 2HZ0A 2QOIA 2Y7JA 1M2QA 4FV3A 1Q5KA 3UVRA 3VC4A 3V5JA 5EK7A 3LMIA 4X2GA 5D11A 4JLCA 4ANLA 3E8EA 2PVKA 3GXLA 4JR7A 3AT2A 4FNZA 5I4NA 3TUCA 3UQCA 2JKQA 3UBDA 3R22A 2XNNA 2ZV8A 2Y4PA 5BVDA 2BR1A 2OLCA 4OBQA 5CAOA 4RA5A 3VAPA 4CLIA 5TKDA 3V8TA 2ERKA 2J50A 4FGRA 4ANMA 3Q9ZA 3VW8A 5T3QA 4MNEA 2R9SA 4ACHA 2G2HA 1A9UA 4LFIA 4J8MA 5LMBA 4FR4A 1IAHA 4K11A 4Z7HA 4I4EA 4Z9LA 5GJFA 2DYLA 2UZVA 3ZCLA 5HTIA 1W84A 4BIBA 5EYMA 2IZSA 1UWJA 3OOGA 4FKTA 4S2ZA 4DT9A 2IJMA 4BWPA 3G5DA 5DGZA 2C6KA 4M14A 2GNLA 4G3GA 3EKNA 2ZM3A 3FI2A 3K3JA 5KX8A 1GIIA 4JDIA 4PMTA 1H8FA 4N6ZA 4NCTC 3FZ1A 3UVPA 5GZ8A 4QMTA 4O21A 4UXLA 2XZSA 1IA9A 2HCKA 1JSTA 3MB7A 5HICA 3HV6A 4E5BA 2QO9A 2W96B 4XP0A 3ITZA 4IM2A 1QMZA 2V7OA 3SD0A 3DQWA 3EYHA 2QU5A 3BE2A 3UOJA 3DDQA 4FKWA 3FPQA 5TE0A 3F5UA 1XKKA 1APME 3JVRA 5FTOA 5M06A 4I6FA 4CMOA 3DAEA 4YJUA 4B0GA 3CBLA 4XV9A 3QKLA 4F64A 2WTCA 4FTRA 4QP1A 3NIZA 4O0XA 4WNOA 3RHXA 2R3JA 1OGUA 4AW0A 3LFSA 5LWNA 2YITA 3SXSA 2VWZA 5CZHA 5CEMA 1KE9A 2GS7A 3BI6A 4MYGA 4AFEA 4ASDA 4M3QA 3FWQA 5CNOA 2G2IA 5FG8A 2JDVA 4R6VA 4BCKA 2E9NA 3T9IA 4RRVA 2UZNA 3HKOA 2E9VA 3R7GA 4JQ7A 4LL5A 2R2PA 3LXNA 3FV8A 4FIIA 3PSDA 3GCVA 4DEEA 3ETAA 1IG1A 1YOLA 2GHMA 3LCSA 4QQTA 1PXLA 3O8TA 2J7TA 3HX4A 2UW3A 5E8YA 5CU4A 5LQFA 4YJRA 5B0XA 3UODA 4ZS0A 2G2FA 4EOOA 3QTRA 4MBLA 1PKGA 1WBTA 4IXPA 5AR4A 4QTBA 4A9TA 2XYNA 2XUUA 5JFSA 3SW7A 4BBFA 3R7OA 1XBAA 4ZTSA 2PE1A 3I81A 2A1AB 3ZEWA 3P5KA 1SMHA 3V3VA 3E8CA 3RWPA 2F2CB 3D83A 2XIZA 4A9SA 3AG9A 1PXOA 2ZOQA 4E3CA 2UZUE 2CPKE 2WOTA 5C03A 4ACGA 3PY1A 4AA0A 3OXTA 4ANBA 3QYWA 1W83A 3C4CA 2ESMA 2VTLA 4YTHA 3MY1A 2YAAA 1UU9A 3KK8A 4GT4A 1YVJA 4FT0A 2RIOA 5AR3A 4NIFB 5FRIA 4D4SA 4F0IA 4BYJA 4YU2A 4H3PA 5JEBA 4AXAA 1O6KA 3BKBA 1OKWA 2XNGA 4R7HA 3ZHPC 2VTRA 2VO7A 3KU2A 4WHZA 1W7HA 1ZZ2A 5IA1A 5GNKA 3D5UA 5AR8A 5EKNA 5IUGA 3UNKA 3GENA 2C4GA 2W4JA 3MH0A 2UZOA 1WBWA 2XNBA 2BIYA 2UZDA 4RA4A 4XRLA 5AIRA 3HV4A 5C01A 4E20A 4O0RA 4QYEA 4D4RA 4YHTA 3LLAA 4NM3A 4MBJA 3HP2A 2WEIA 4L6QA 5DWRA 5EM8A 4RVLA 4WG4A 5FP5A 4CD0A 4X2JA 4EK4A 5KMNA 3L9MA 5K5NA 1RDQE 2HZ4A 4KRCA 4C61A 3JPVA 3H0ZA 4FVRA 4XEYA 3ORTA 4G31A 4DLIA 2AYPA 4NYEA 3B2WA 4YJVA 4BVUA 2OG8A 3F5PA 3FPMA 4FI1A 3OW4A 2YJRA 5FEEA 2PL0A 4CFMA 4WBBB 4ERWA 2P55A 4BHNA 4L46A 3PG3A 1KE7A 4FSWA 3MW1A 2BPMA 5C27A 5GZAA 2X7GA 3UZRA 4HCUA 5CU6A 4QQJA 4XP3A 4WUNA 4GG7A 3ORXA 1JKLA 3TKHA 1UNGA 3CTHA 3COIA 3UDBA 4EK6A 5L2QA 5I9WA 3GC8A 4E6CA 5HO6A 1PXKA 4B8MA 1M14A 1Q41A 3LMGA 2UW5A 3MIAA 4J52A 2HWPA 5LMKA 1Y8GA 2WNTA 3C0HA 3OT8A 4IZYA 2J9MA 1GZOA 3QTXA 2X4ZA 4LRKA 3HLLA 4QD6A 5A4QA 3A7IA 4L00A 2BFYA 2C6TA 2WELA 4F7SA 3DU8A 3Q5ZA 5FTGA 3OCGA 4LGHA 4GJ3A 4GIIA 5CSVA 3DLZA 1A06A 2YCQA 2X2MA 3GU5A 5AP0A 2WGJA 4EH9A 4E6DA 5JFXA 3K54A 5H9BA 3OWKA 1O9UA 2ONLC 5M4IA 2OJFE 3C4XA 3DBCA 2JD5A 4BTKA 4R78A 2VWBA 4PL5A 3RM7A 3FLWA 3ORZA 3UNJA 4RX8A 3U54A 3MVHA 2F7XE 4U0IA 5IQCA 3BHHA 2J51A 4HGEA 1P14A 2C5YA 4GJ2A 4O7YA 2XIKA 2YISA 3F7WA 2WMXA 4FSZA 4EK8A 3PWYA 5CU3A 4ONAA 3VW6A 4ASXA 3ODYX 3M42A 3G0EA 4QPMA 4I5PA 4JX3A 3RCDA 4HVIA 2WQNA 2GQGA 3TG1A 3KGAA 3LJ0A 3SG9A 1Y8YA 2BRMA 2WMSA 3MVMA 4IDTA 4V0GA 3LMHA 3FMNA 2Y8OA 4F6SA 3MA6A 2VTPA 3HV3A 3VS1A 3FI8A 3R30A 3HNGA 3HUBA 4LL0A 4YZMA 5I3RA 5BVKA 2X7OA 2JIIA 3R01A 3IO7A 4IJ9A 4EQCA 1ZXEA 2O2UA 1ZY4A 4XH6A 3SQQA 1MRUA 3EN6A 4HVSA 2CGVA 4Q5EA 1KOBA 3HVCA 3KEXA 4LUDA 4TNBA 3DY7A 3ATSA 3BYVA 5HG7A 1M7QA 2XKFA 4UY9A 4FL2A 3ZFXA 3W32A 2R3LA 2IW8A 4AZFA 5M4FA 2HZNA 5CWZA 3QWKA 4WKQA 3QQHA 4XG9A 5M56A 4FSTA 4H58A 2OIDA 1PHKA 2QO7A 4QMLA 3L9NA 3U51A 2Q83A 3G9LX 3PXKA 4FKOA 3DXQA 3CCNA 3OUKA 4EKKA 4ACDA 4CCUA 3CTJA 2VV9A 3FQHA 4FT3A 4IACA 4J97A 3REPA 4OTHA 3DB8A 4GK4A 4MXAA 4WG5A 4FZFB 2PPQA 1FQ1B 4AW2A 3PIXA 2VTHA 1YHSA 3FE3A 5FM2A 1YKRA 2XEYA 4GVAA 5HNBA 3BHVA 4C0TA 2B0QA 4MQ2A 4NEUA 4G2FA 2H9VA 2NO3A 5TF9A 5BYZA 4LI5A 5DLSA 4PL3A 3TACA 4AUAA 4K8AA 5KHXA 2V62A 4RWKA 4YP8A 3O50A 4IQ6A 5L8JA 4AZWA 4FEXA 1PY5A 4AS0A 4PTEA 3FMHA 4PRJA 3FKLA 4CV8A 2CNQA 4U5JA 2C47A 4L01A 4B99A 4C62A 3ZBXA 4JNWA 3HGKA 4MCVA 2PVHA 5F94A 5DHJA 2XIXA 3ULZA 3ORPA 4FK6A 4BCJA 3E3BX 2PVLA 4FEVA 4KB8A 4MXZA 3PVBA 5AIKA 4HYUA 3M11A 4FICA 4FK3A 4X7QA 3W33A 3SRVA 2XBJA 4C2WA 4UWCA 3QTWA 4DGGA 3UPZA 2FSLX 3IGGA 3MVJA 2HK5A 4MAOA 4ZOGA 2YIYA 2YM5A 5B7VA 4H36A 4DFYA 3UMWA 1Q3WA 3F61A 4FKPA 3HECA 2IVTA 3O96A 4XG7A 3AC5A 4Y83A 3MH2A 5T6KA 5A4EA 5JFVA 4F9YA 5E1SA 5ANEA 2XKDA 3A60A 4U80A 4IX4A 4UMUA 4KBAA 3S00A 1JPAA 3R2YA 4YSMA 1GZ8A 3LFFA 3RAWA 4BRXA 3F5XA 5K4IA 2X4FA 1JQHA 2ZB0A 3G15A 3PFQA 4DFBA 3PJ2A 5KZIA 3QQJA 4FTJA 4F0FA 4D55A 5KMLA 4IEBA 4F9CA 5M4CA 4RJ5A 4AN2A 1SVGA 4FSRA 3WF6A 4E7WA 4FKUA 3UO4A 4BI1A 5AP7A 3ZTXA 4RBLA 4D1ZA 3T3VA 4A9RA 1YDRE 5FTQA 3UJGA 2XK4A 4G5JA 3I5ZA 5T68A 4CKJA 2R3OA 3RINA 3RPVA 4BCNA 1VZOA 4F1OA 5E1EA 4NW6A 2PMIA 3QXOA 3UIMA 1Q62A 4H3QA 2E2BA 3ZM4A 5HGIA 2W9ZB 3QKKA 4XMOA 5FWKK 5D1JA 4YC3A 3I60A 2EXEA 5CXHA 5M51A 4BKYA 2F9GA 4N57A 2W1DA 4U45A 5DEWA 1Z57A 3RHKA 4ENYA 3QALE 3HYHA 4YZDA 4CFUA 3MPTA 4AT3A 4CFFA 3G90X 3KULA 4HZSA 3ZRLA 4E4MA 2RSVA 4J53A 5BVWA 4BDHA 2J90A 2WIHA 2IPXA 3II5A 5EKOA 3OXIA 4BCOA 5JT2A 4XV3A 2GS6A 5IDNA 3CLYA 2E9PA 3G2FA 4FT9A 5HCXA 5GINE 4WNMA 4X3FB 1M2PA 1BX6A 4EBWA 2PK9A 5TR6A 3CSVA 5H8BA 5M07A 1Q8UA 2I0VA 3F2AA 4G17A 4GVJA 3Q4CA 2BDFA 2HY81 1NXKA 3BHYA 1H01A 3DGKA 4G5PA 2QODA 4G6LA 4NW5A 1XQZA 3CPCA 5EW3A 4ZTRA 5B2MA 4A4LA 4YJNA 4KRDA 3UIXA 3NR9A 4JRNA 4C37A 2VTOA 2Y6MA 5DNRA 5GZ9A 2WMRA 3FC2A 1Y57A 3OD6X 2I0HA 4RQKA 3UC4A 2QOQA 4FTAA 3W2PA 3WILA 2XEZA 5DRBA 4NJ3A 3TM0A 3O0GA 2WMWA 4KA3A 4BIDA 4RZWA 4RX9A 5ICPA 4DA5A 5KMOA 3C4EA 3HA6A 4L7SA 3D5XA 2P4IA 3IECA 2QLQA 2ITNA 2QOFA 2UZBA 3UC3A 3NW6A 3MYGA 4YPDA 4BN1A 2YWVA 5JZNA 1CTPE 1OUYA 3UIBA 1NY3A 2C6OA 3KY2A 4BDGA 3CE3A 4DG2E 4RVTA 3BGZA 4GIHA 3FMLA 5FXQA 1M17A 4F9AA 3A99A 2BRHA 3ZRMA 4FA2A 5AV3A 4GU9A 2CN8A 4USEA 1GOLA 2UW0A 4KSQA 3LCKA 3ZDUA 3EQCA 3R0TA 3A61A 4GFGA 2WQOA 4GK2A 2PHKA 2R3IA 4EOJA 3LKMA 5CQWA 2P2IA 3QAME 3WARA 2W0JA 2OXDA 1ZOHA 4L45A 3R83A 5EI2A 4L68A 3POOA 4O7LA 3PPZA 2RGPA 2OZOA 3E93A 1WBVA 2CGWA 3GBZA 3WYYA 1Y6AA 4M15A 4C58A 4KBKA 2H96A 5M4UA 2BRNA 3GU6A 1BLXA 5E8WA 1NVQA 3QC9A 5G1XA 5CLPA 4RZVA 1TQMA 5C9CA 4FNYA 4IH8A 2OSCA 3FUPA 4TXCA 4DEDA 1Z5MA 3SV0A 3PIZA 3QLGA 3D5VA 2J5EA 4W4XA 3QQKA 3MJ1A 4MD9E 5KBRA 4W4WA 5AP6A 4EYJA 2WTJA 3IW4A 2C68A 3AC3A 2XJ2A 4EOKA 3LZBA 3OF0A 2BILB 4D1SA 3FYJX 3WZDA 4DF3A 5IQFA 4IAFA 3E62A 4WNKA 5AX9A 3KKVA 2VO6A 2QURA 3MS9A 4ZTHA 3L8XA 3EQDA 3OEFX 5IA0A 1JNKA 2OGVA 1XWSA 2CKEA 5LJJA 3P1AA 1FMKA 2VWYA 3V6SA 1WBSA 4MXYA 5KBQA 3ACJA 3NUSA 4FT5A 4X6QC 5CI7A 5EOBA 1BKXA 3DK7A 4EONA 1YI4A 2WQBA 3GP0A 4BCHA 2HZIA 4FIJA 1J91A 4I21A 3QTUA 4PP9A 5K9IA 3D7TB 3ULIA 2GNIA 3AMAA 2WOUA 3VUGA 3QZFA 1FINA 5A9UA 1NW1A 4JT3A 4C8BA 1GIJA 3A8WA 3MA3A 4IW0A 4MVFA 4BTJA 5HZNA 1LEWA 3S2PA 2B54A 3NNUA 4AA4A 1ZAOA 3VWAA 3AC1A 4IIRA 4PQNA 5C8MA 4P5ZA 4BTFA 3FC1X 5ITAA 5IZFA 3R9RA 3KMMA 3UP2A 3AT4A 3F69A 3EQIA 2HIWA 3IW6A 4IWQA 4RMZA 5CU0A 4L8MA 4ZTLA 1YWNA 4PNKA 4F09A 4YNOA 1JSVA 2QOLA 2X0GA 4FV9A 3KA0A 2X6DA 3QTZA 4YJTA 2OF2A 3PXZA 4U41A 3NNWA 4RVMA 4QQCA 3VN9A 2UV2A 2W9FB 5HTCA 1M7NA 2OH4A 4I0TA 1W0XC 4CLJA 4FNXA 3C5IA 1J1CA 3NIEA 4AOIA 2VX3A 1URWA 4AGCA 3FBVA 1RW8A 4GUBA 4F6WA 4Z55A 2H6DA 1RQQA 1GJOA 1OKVA 1CKPA 2Z60A 4QP8A 4X3FC 4DE4A 2X39A
chains in the Genus database with same CATH superfamily
4PL4A 4QP9A 4RC3A 2GFCA 4XV1A 2J6MA 4D2RA 2BTRA 2Y4IB 4NFMA 5DH3A 3W0NA 1ATPE 3CQUA 3Q60A 4OW8A 5HESA 2QOKA 4EH7A 1CKIA 4ZJIA 1GIHA 1OPJA 3A8XA 5CX9A 4JQ8A 2IVSA 5KZ0A 4IVAA 3DZOA 3GNIB 4OBPA 3TZ9A 3ZLYA 4EH3A 4EI4A 3S1HA 4H05A 3NUYA 3ZXTA 5AUTA 1AD5A 5LMKC 4ZSGA 4O83A 3U9CA 4FMQA 3P9JA 5FQDC 2P0CA 4AG8A 1KE5A 4JBOA 4NIFA 2JEDA 2C3LA 5EYKA 4G9RA 3I7CA 1CDKA 3P86A 3PSBA 4WT6A 4I6LA 4RLLA 4V04A 4E4LA 1VLRA 2JIUA 3EWHA 3I1AA 4GK3A 5CEKA 2B4SB 4ZP5A 1U5QA 3QUPA 5ANIA 4O81A 1R0EA 4K1BA 5HU9A 3GVUA 5I3OA 1OUKA 3AC8A 4GRBA 2IN6A 3EMGA 4AT4A 3L8PA 2HELA 3MBLA 4OAVB 5EQEA 4PWNA 4O96A 3QL8A 4EYMA 3DAJA 4G3EA 4EJNA 4I5CA 4O1OA 1PMUA 4C4FA 3GU8A 3IW8A 4RC4A 3R6XA 1NVSA 5D7VA 4DYMA 4EZ7A 4QMUA 4O7WA 3H9RA 4F78A 2JIVA 3QRTA 4ZSEA 3FXZA 4LDTA 5BUIA 3EZRA 2BMCA 2VNWA 2WO6A 1OIUA 2WMVA 4FODA 3QD4A 4QP3A 1KV2A 4GSBA 4OTFA 4R7IA 2VTQA 5JSMA 5E91A 2NNWB 5LVPA 4I6QA 2VNYA 4XS2A 1ZRZA 3O51A 5L2IA 3HAVA 4CNHA 3LXLA 5IEVA 4F0GA 1F5QA 3P7BA 4JXFA 4HYIA 4B9DA 4WOVA 3JYAA 5JQ5A 4AQKA 2PZIA 3VF8A 3NYOA 5A4LA 1IASA 3OT3A 1VYZA 3OY3A 4OR5A 4O27B 4WA9A 4D0WA 4AZVA 1OKZA 2B53A 2XNEA 2QG7A 4N4SA 4K2RA 1ZMUA 1F0QA 3V04A 2E9UA 4Q9ZA 3VUIA 3VQHA 3CY2A 2OIBA 3ZFMA 4C3FA 4EZ3A 2YM8A 5AWMA 3QZGA 3S4QA 3W0OA 3DNDA 1IA8A 4BYIA 4CRSA 3FLZA 4MF1A 4D2VA 4YO6A 3R8PA 1YI6A 1Q61A 2B9IA 3D7ZA 2I1MA 4QMZA 3THBA 2Z7QA 3WF9A 4ACMA 3BL7A 4ALWA 5HG8A 4KAOA 1LR4A 4ZS4A 3NVMB 4BDBA 4CG8A 3FMKA 3UNZA 3B8RA 3FYKX 4EH5A 4LOPA 4YHFA 5AUZA 3FI4A 3QA8A 2UZEA 1VR2A 3Q9YA 4GW8A 4I3ZA 3O7LD 4O0WA 4QMYA 4LYNA 2WU7A 5DPVA 4YC8A 5BUJA 4HCTA 2R0IA 3GU4A 3HRCA 5AA8A 5BQ0A 3U87A 3QA0A 3ZS5A 4HW7A 3C7QA 3A7FA 1R0PA 4NH1A 3Q5IA 1JOWB 3Q32A 4TPTA 4S30A 4G3CA 4IB0A 3EN5A 3ZSGA 5F95A 4E6AA 1BL6A 4BZNA 1TVOA 4DH5A 3IOPA 3WF8A 4EHEA 3F2NA 3P0MA 4AGWA 2CMWA 4C33A 3D2IA 2R7IA 2R3MA 3LJ1A 3QCXA 4FBXA 4I92A 4DGOA 4L52A 4YTFA 4YJPA 4U97A 4DFZE 4L43A 3HZTA 3QBNA 5A14A 3I5NA 4OTDA 3R7IA 4NTTA 1H1PA 5IH4A 4NZWB 3TNWA 3ZU7A 4QMMA 3D5WA 3Q53A 4WUAA 5AA9A 3TNQB 3DTWA 1JKSA 2ETMA 4NTSA 2CJMA 3K3IA 5H8EA 5D10A 1YHVA 1Q99A 3WIKA 1H27A 4Y5QA 5EHOA 3DK3A 3ZM9A 4QTDA 4KD1A 2XK6A 4BKJA 2GNJA 4FZ7A 2W4KA 3AC4A 2BZIB 1Q8WA 3VS6A 4UWBA 5C26A 3V6RA 4PMSA 3V01A 5HHWA 3R28A 4DFNA 3UP7A 1LUFA 5CNNA 2C69A 3OOMA 5GIOE 4B4LA 1I09A 3H4JA 3CKWA 3ORIA 1JAMA 4QP4A 4PP7A 5AUUA 3R00A 2UVXA 5JH6A 3EIDA 4NM0A 2HAKA 2C6LA 3D15A 4R7BA 3KXMA 5AUYA 5FD2A 5LXMA 2VGPA 5E8XA 4WSYA 4EQUA 1P4OA 3HV5A 3LCTA 4XG4A 3R8VA 1MQ4A 3PE2A 2Q0BA 3G0FA 3KCFA 4QYYA 3WI6A 5ETIA 3E8NA 2VWWA 4BCGA 2O5KA 3LOKA 2J0KA 3FHRA 1V1KA 1ZOGA 3MFTA 4NFNA 4ZEGA 4YPSA 1SM2A 3UOLA 1OM1A 3FY0A 4JJRA 1K9AA 4QTEA 4CEGA 4L9IA 5IDPA 3KXXA 1FVVA 4ALUA 3SXRA 4IVDA 2ZFYA 3G6HA 1XBBA 1G8SA 5C4KA 4CQEA 4QYGA 2QHMA 3QGWA 4PF4A 2FH9A 2X6EA 2X9EA 5CXZA 2CCHA 3L9LA 3CKXA 3F3VA 3NVKI 4BF2A 4MQ1A 4D5HA 4ZLYA 3QF9A 3TUDA 4JBVA 3RPYA 4ASEA 2GQRA 5J7BA 4ZSLA 4LOQA 4CTCA 3RGFA 3VUMA 3IGOA 4JAIA 2IG7A 2H8HA 3HRFA 4XHKB 2V5QA 2YIWA 2X2KA 3MTFA 5EG3A 2VTIA 5LMAA 5IA5A 2QOOA 3ZRKA 4FNWA 4G34A 5K0KA 1XH7A 2YEXA 2IZUA 4QEBA 2QCSA 3POZA 4TN6A 3UO5A 4F7LA 2C0OA 2EXMA 3OBJA 5AR5A 5K5XA 5J9ZA 1PXNA 4I94A 3W0PA 4ZZMA 4DH8A 3PPKA 3HDNA 3V8WA 1G8JA 4GG5A 4OGRA 1OL5A 3GOPA 3ZSHA 3KVXA 5ETAA 2CGUA 3FLYA 5IH5A 1A48A 3NW5A 2ZV9A 2W99B 4BJJA 4XNEA 2HENA 5HBHA 2BROA 3R9DA 4JBPA 5JRQA 3NWWA 5L2SA 4OAUC 2F7ZE 3CXWA 1ZMWA 2ITQA 4FV8A 2A98A 5GHVA 2CNUA 3TJDA 2EXCX 2P3GX 1H24A 2JBOA 3BRBA 3DFCB 4IZ7A 4M66A 4MXXA 5IMXA 4AAYA 4FV4A 1T46A 3ERKA 2UW7A 2WIPA 4RIYB 2AC3A 1H0WA 4FSUA 2NP8A 2VWUA 4FIEA 1OZ1A 4K0YA 3A4OX 1OL1A 1Q97A 1ZYCA 3I7BA 3JUHA 4J1RA 5HIEA 5L8KA 2OF4A 2H34A 4I4FA 4TZRA 4GU6A 4DEHA 2ITXA 2VTSA 3BX5A 4FKSA 3E3PA 1OKYA 2RFDA 4IAZA 4NL0A 5M08A 2NRUA 4B7TA 4X2KA 4AN9A 1NT2A 5DR6A 4W9WA 3I79A 4OT5A 5IA3A 4X3FA 3MN3A 5ANKA 3QCSA 4JRVA 3G9NA 3Q9XA 2YWPA 4JIAA 5CSXA 2PMNX 4Y73A 4CZYB 4YSJA 2J0LA 3SA0A 4O7NA 4U81A 4XG6A 3LQ8A 3OTUA 1PMVA 5CSWA 2GNFA 2YACA 4U44A 3NPCA 3RK9A 3EYGA 4L3JA 3E63A 3NFFB 1SVEA 4GL9A 2HYYA 4QT1A 5J8IA 5BVFA 4BTMA 4FTUA 1LP4A 4KS7A 4CFXA 1WVWA 2RFSA 2G01A 2QI8A 3GCQA 4Z16A 3SC1A 2ITZA 2W7XA 3WZUA 1QPDA 3OUNB 4AOJA 3QCQA 5FBOA 5I9YA 3CY3A 3OZ6A 4YNEA 3P08A 5H3QA 3H0YA 3QQLA 5B2KA 3U8WA 1WFCA 4ZTMA 4AWIA 3EB0A 4X2NA 5KO1A 4J95A 4XBRA 2XRWA 2IW9A 5KNJA 2PU8A 4X21A 3TZ7A 3R7VA 2HW7A 2HOGA 3LVPA 3QCYA 4BIEA 2DWBA 3TL8A 2IW6A 3PXYA 2IVUA 1FOTA 1MRYA 3LXPA 4YZBA 3AT3A 3QXPA 2OIQA 2VGOA 3BLAA 4RIOA 3R1NA 4RT7A 4IANA 3RZFA 5CANA 3MFUA 2BHEA 4EC9A 4ZY6A 4D2SA 3GI3A 4XP2A 5HLNA 2HY0A 2X9FA 4TWNA 4DITA 3GGFA 2IZTA 3E7VA 4JG6A 4K33A 1L8TA 3GUBA 5CT7A 3R04A 4Y8DA 5DRDA 4IB1A 4U8ZA 1OMWA 3EQRA 2G1TA 4KIOA 5AV1A 4F6UA 4MD7E 2PY3A 4QP6A 5J1WA 3KFAA 3MY5A 1UVRA 3R73A 2XK3A 2Z7LA 4HYHA 4FVPA 4M7IA 4PPAA 4XOYA 2HXLA 5HE3A 3VBXA 3VS2A 4DAWA 4C7TA 4LV5A 2JAMA 4XCUA 4IE9A 4R1VA 3P78A 4JDJA 1H4LA 5HCZA 4IZ5A 4YTIA 4O7RA 5E90A 3ZLXA 3COMA 1YI3A 4IWPA 3EL7A 3A62A 1HOWA 3R8LA 4JQEA 3LXKA 3FI3A 2J0JA 2BHHA 2P33A 3DNEA 4HZRA 4TY1A 4CFVA 3DPKA 5AADA 4H39A 5E8ZA 3LQ3A 1H25A 2ZMCA 2JKKA 4LRJA 3A2CA 2GSFA 1WAKA 2I6LA 5BUEA 5L2TA 4IVBA 3T9TA 4R1YA 4FTKA 2WU6A 3PZHA 3RMFA 2W1IA 3N4TA 1XMLA 1QL6A 2VU3A 3FKOA 4FUYA 3DA6A 4Y46A 3RCJA 3TXOA 4ERKA 2OJJA 2BZHB 2BKZA 3NYVA 3SKCA 3QTQA 3UG2A 4BCQA 3RI1A 4LOOA 3RK5A 4BBEA 2I7QA 2WQEA 5EDQA 3R7EA 2DQ7X 3BHUA 2W05A 4U3YA 4LQMA 2O65A 4MX9A 3GB2A 4ANSA 3PXQA 4C02A 4BDIA 3FLSA 4HNFA 3W0QA 4G6NA 2JAVA 3W2OA 2EB3A 3W16A 3MH3A 4ANQA 4UMPA 1O6YA 1JBPE 3NYNA 5CS6A 1YXXA 5AP1A 3LFDA 2BAKA 4FG7A 4QNAA 3QGYA 4S32A 5CF4A 3RPSA 4QMVA 1GNGA 4ACCA 3OHTA 3OY1A 5DR9A 2QONA 4D9UA 3KK9A 2YHVA 3D14A 4J99A 2CHLA 4RFMA 3LLTA 2J2IB 3R7YA 4RJ4A 3V5QA 1DS5A 2X0OA 1YOMA 3QZHA 4CMTA 3KN5A 4O6LA 5HU3A 3KRLA 5KHWA 5HNGA 4P2KA 4O2ZA 4PDOA 1G5SA 2ITTA 3LFAA 4NU1A 3ZUVA 4MBIA 1GAGA 3MTLA 3OCTA 1J7LA 5DG5A 3DBQA 4BDCA 1PW2A 2PVJA 4DCAA 3IW5A 2XP2A 4DHJA 2WHBA 4BDKA 3P4KA 3UVQA 2WMAA 1R3CA 1H28A 4CT1A 3O23A 3PVGA 5LVLA 3ANRA 1OL6A 2WEVA 5HVYA 2WTIA 1AGWA 4ZJVA 1XH5A 4ZAUA 4D9TA 4L3LA 3OW3A 1B39A 5HI2A 3FZPA 3MSSA 5DVRA 4ZSJA 3VIDA 3BHTA 4CV9A 4HPTE 2PUUA 3BQRA 4MWIA 4O0VA 3PJ3A 4Z3VA 2G9XA 4R5SA 2UVZA 4RG0A 4WO5A 3V8SA 3QTIA 4O0TA 3P7CA 3CTQA 4RIWB 3R8MA 3ZYAA 3BEGA 5H2UA 2UUEA 3EQGA 3F3ZA 1ERKA 1F3MC 5A6OA 5AUVA 3BU3A 3BZ3A 4BDEA 4FV5A 4KSPA 2A27A 5EYCA 5JGAA 2VZ6A 3DJ5A 4TKSA 3OCSA 2KTYA 4AW1A 3FAAA 2GCDA 3V5LA 3C50A 3EN4A 5CEPA 4Q5HA 4OBOA 3T3UA 3BYMA 5KKRB 5AR2A 2RG6A 2Z2WA 3ACKA 1UWHA 2YDJA 3O7LB 5H8GA 5C8NA 3IDPA 3OXZA 3QRUA 2YDIA 3Q4TA 4RQVA 4UN0C 4FKIA 4MH7A 2JC6A 2YJSA 2F49A 3TMOA 4BGHA 1Q8ZA 2JGZA 4PDPA 2XBAA 5A4TA 3KXNA 2GU8A 5DR2A 5BYLA 2ETKA 3BBWA 2PWLA 5FEQA 5HKMA 1U54B 1HCKA 1OB3A 3EN9A 3BU6A 3HEGA 5HG5A 3FMJA 4U79A 4D58A 4U7ZA 3OCBA 4JS8A 4FF8A 1XBCA 3EFLA 4TYHB 4YR8A 3E88A 5IF1A 3TV6A 5EDPA 2W1GA 3EJ1A 3LFCA 4AF3A 1MQBA 3VS4A 4M0ZA 4ITJA 4PNIA 4TYIA 5D9HA 4ORKA 1FPUA 3GCUA 3GOKA 5AR7A 4QMNA 2PE0A 4GS6A 4I93A 4AQCA 5J79A 4KKEA 4NJDA 4RJ8A 5E8TA 3RALA 2YAKA 3VBTA 3WIGA 3ZZWA 4ALVA 4EBVA 5J9YA 4X6RA 3QD3A 4JIKA 3MPAA 3PA5A 4W8DA 3ALOA 4RX7A 3L9PA 1WBOA 4JG7A 3VUTA 4QO9A 5EQPA 4K18A 2OBJA 5CEQA 3RAIA 4AZTA 4ZTQA 4E4NA 5A4CA 4CKRA 4KS8A 4ZY4A 1OL2A 1U59A 2YM3A 3PTGA 5AP4A 5FP6A 2A19B 2PVFA 4IB5A 2C6EA 1NA7A 4F4PA 2C0IA 4RLKA 1W2DA 2O0UA 2RG5A 2W1ZA 4RC2A 1WCCA 2B9FA 3W0RA 4I20A 5IQDA 4KKHA 2PZYA 3PLAE 3ZZEA 4RJ6A 1ZOEA 1Q8YA 2ZYBA 3KREA 2OZAB 4UYNA 4OTRA 4OTPA 2PZRA 4ZJJA 3SAYA 2XMYA 1H07A 3RWQA 2W17A 3HP5A 3Q52A 5E8UA 3SDJA 4MWHA 4CFWA 3AQVA 5CY3A 4H1JA 5ANOA 4U40A 1JLUE 4O38A 4FTLA 5KMJA 1KE8A 4C38A 4BY9E 3KCKA 4FV1A 2FO0A 5JFWA 3LM5A 1W98A 4CKIA 4ZSAA 2XK8A 3NMUF 2BALA 3MY0A 4RSSA 5BNJA 1G8AA 5ANJA 4CQGA 4O0SA 2QD9A 3GT8A 4GT3A 4EORA 5CAPA 5F9EA 1ZLTA 2CDZA 4J98A 4DFUA 2J0IA 2B55A 3WYXA 4FZ6A 4EH2A 1ZMVA 2C3IB 5E4HA 2BTSA 4I41A 4FIFA 4U9AA 4EEVA 5IQBA 3DV3A 3VS3A 2CNVA 3TYKA 3D94A 3FDNA 5DT4A 4D4VA 4TYJA 3W18A 4WG3A 2V22A 5AV4A 4ZLOA 4TWOA 3Q4UA 4M69B 3TTIA 3W2QA 5L8LA 4FUXA 3PA4A 2WTDA 3R1YA 5L6WL 4AA5A 3KVWA 5DFPA 1H1RA 2UVYA 3P23A 5AAEA 4YLJA 4USFA 1TKIA 3ZBFA 4Y5HA 4O91A 5C4LA 4DGLC 4E8AA 5HG9A 3IG7A 4A4XA 4FTNA 1Q4LA 4O2PA 5HD7A 3CJGA 3BL9A 3UZPA 4XX9A 2WTKB 4NSTA 2ZDTA 2W5HA 4UV0A 3ORLA 4D2WA 4DN5A 4BWXA 4FSMA 1XHAA 4ZLZA 3UDZA 2I40A 4FVQA 2ERZE 3QQGA 4MXOA 3K2LA 3I0QA 5J87A 2CKOA 3NLBA 1TQIA 4QOXA 3VBQA 2CLQA 5AEPA 3U4WA 3DXNA 2YA9A 3H3CA 4YURA 2WXVA 3P79A 4YLLA 4EH6A 1FGIA 3LCDA 3LJ2A 4RWJA 5EM6A 5JQ8A 1TQPA 3IKAA 4AZSA 4BZDA 2JFMA 3FLNC 1OBGA 3CGOA 3Q2MA 3O17A 3VHKA 3ANQA 1PXMA 1KOAA 4QYHA 3ZONA 4UX9A 1H1QA 1PRYA 5DE2A 4BGGA 2R3GA 4PDYA 3A7GA 4FX3A 4DH7A 5JKGA 5JK3A 2VX0A 5KKRC 5D12A 4JBQA 1SVHA 2JDSA 3BCEA 5BMMA 4N0SA 4ZK5A 3ROCA 2R7BA 3QWJA 4UEUA 4RFZA 3L8VA 3LM0A 2ZMDA 4QYFA 4YC6A 3WE4A 3LFQA 3C0GA 3A7HA 3HMOA 2OJIA 4HVGA 5EW9A 3H30A 2BRBA 4DBXA 4GT5A 1MUOA 4XG8A 4YJOA 4YZNA 3ALNA 1XH4A 3BQCA 3DCVA 3QX4A 3WZJA 1OIRA 1YDSE 3DK6A 3GQLA 2BAQA 3NDMA 3SOCA 3QTSA 4AAAA 4EOLA 5IQIA 2QKRA 3LFEA 4CYIA 1X8BA 5KMIA 3A7JA 3BIZA 3GC7A 3CD3A 2QC6A 4IWOA 3QHWA 2E9OA 3QLFA 3R2BA 3GC0A 1REJA 2GNGA 3R1QA 3TKIA 3MV5A 3NYXA 4O22A 3WOWA 4XBUA 2G15A 4A4OA 2PVRA 1H1WA 3N4VA 2XAOA 4FTIA 3C4FA 1OBDA 2XJ0A 4HNIA 3EFKA 2XVDA 5EI6A 2HW6A 3I6UA 1GZKA 2VAGA 3QQFA 5EDRA 2VTMA 1IEPA 1OIQA 3ET7A 4EOMA 3QD0A 3PY3A 3MB6A 4DCEA 2ZJWA 3BGQA 4MEDA 3UE4A 3BYUA 3KIOC 1HCLA 4FL3A 4NKAA 1ZYJA 4R5YA 4QMXA 3BGPA 3CD8A 3PVWA 3Q3BA 3N9XA 4XLVA 4B8LA 4HGLA 3ZH8A 4IAYA 1OL7A 2XB7A 3DBDA 1PXJA 3FMEA 3BYSA 1QCFA 4S31A 2BZJA 4RIYA 3VUDA 5LWMA 3GCSA 1U4DA 1KWPA 3AD5A 2QOBA 2OU7A 3G6GA 4GUEA 4TT7A 4LV8A 2PUNA 4CGAA 4C36A 3LW0A 3LFNA 4CVAA 3AOXA 2OWBA 5CENA 3HRBA 3Q04A 3BPRA 3RTPA 3BWFA 4I22A 3SXFA 4D2TA 1PXPA 3DBEA 4B6LA 1IR3A 4O82A 4RWLA 3ZO1A 4C4IA 2VWXA 2CN5A 3FMMA 3NUPA 4BL1A 1BI8A 4RIXB 3WE8A 4AGDA 4DH1A 3DS6A 3K5VA 4P7EA 5CEOA 2FB8A 4EK5A 4BCFA 1XJDA 4RFYA 4MTAA 4IB3A 5HCYA 4FZDB 4FEQA 1SYKA 3HL7A 3OWLA 4RWIA 4AOTA 4BCPA 3HDMA 4UXQA 4CRLA 2BIKB 4EHVA 3C1XA 2GMXA 4DEIA 1YHWA 4ANOA 1XO2B 1URCA 3UMXA 2ZAZA 3TZ8A 2C6DA 4A07A 5CASA 3QYZA 2VO0A 2QKWB 2UZWE 5CF5A 3DQXA 4FL1A 2ITOA 3ZO3A 4XUFA 3IPHA 4QTCA 2W1EA 2QR8A 2WMUA 4UMTA 5EFQA 4DH3A 4AXFA 3PIYA 1QPJA 3RKBA 4GH2A 3ML1A 4O1PA 3OP5A 4DG0E 1WVXA 2GDOA 4D28A 4TL0A 5HQ0A 4ID7A 2BKKA 5FGKA 4C4JA 1DI9A 4M68A 4EUUA 2PVNA 2ITVA 2WKMA 2YM4A 4OUCA 4M84A 3PRIA 3FJQE 3KF7A 4XV2A 4XOZA 3UO6A 3DKGA 3OMVA 4M0YA 2UZTA 4KIKB 3VBVA 4AN3A 3NUXA 5HVKA 5IQGA 2PE2A 1UKIA 4I24A 4M13A 5LVOA 3H9OA 3R8ZA 1PYEA 5HO8A 4HVDA 4M12A 2F57A 5EW8A 3NNXA 1JKKA 3U6IA 3COKA 4F63A 3W0SA 3CEKA 4USDA 1KSWA 4JI9A 1M2RA 5E8SA 4TNDA 3VUKA 5HVJA 5IEXA 3BWJA 4ITHA 2VTAA 3QFVA 2JKOA 2V55A 2YIRA 3FSFA 4LUEA 4PTGA 3SOAA 3TWJA 4QTAA 1CKJA 3ENMA 1G3NA 4EK3A 1Q8TA 2IZRA 3MIYA 3U9NA 3TIYA 3ZSIA 4DFLA 3TNHA 1BI7A 1H00A 4KINA 4OTQA 4XJ0A 3ZFYA 5J9LA 2JDOA 5GJGA 4BI0A 3LQ5A 4I1ZA 4CT2A 5IU2A 4P90A 3NFGB 1MP8A 4F99A 4M8TA 3AGLA 2P2HA 4MD8E 4N6YA 2GQSA 3ZO2A 2RFNA 4IFCA 4UYAA 1REKA 4YJSA 3M2WA 3BELA 5KCVA 2Y4IC 4BC6A 4CG9A 5M09A 4CZUA 3F3UA 4JX7A 5A54A 5FXRA 5K0XA 3TT0A 2XNOA 4ARKA 3E8DA 4I0RA 5J1VA 4JL9A 1W8CA 3UGCA 3EQFA 3B8QA 4QMPA 3PXFA 2ZV2A 4MKCA 2X81A 5A46A 4CFNA 3V5WA 4PMPA 1FBNA 1J1BA 1H08A 1IRKA 3QC4A 3S3IA 5E9EA 5C8KA 3R02A 4IX3A 2V0DA 4C3RA 4CMUA 3SVVA 4DEAA 1XH9A 3MPMA 3B2TA 3SLSA 4DEGA 1YWVA 5LCKA 3F6XA 4ENXA 4R3PA 3HA8A 5CTPA 5BYYA 3VS5A 3ZLSA 5I5ZA 4H3BA 4AACA 2R5TA 3FZTA 5CVFA 5AM6A 4R3RA 3F9NA 2QVSE 4ZMFA 5J5TA 4WRGA 4J7BA 5HD4A 5IA4A 3C13A 1ST0A 4R8QA 4DTBA 1VJYA 3PP1A 3IDCA 4E5AX 2PZ5A 3JY0A 3OC1A 3FMDA 3PG1A 4QPSA 1H26A 3DJ6A 5HLWA 2C1AA 3NUNA 3WF5A 4FTOA 3RZBA 2UW8A 3COHA 4ZY5A 1ZWSA 3AMYA 5AAGA 5EQYA 3PWDA 4D0XA 4DDGA 4ZIMA 2XK7A 3EN7A 4P5QA 3ELJA 3RJCA 3TJCA 5M44A 3W10A 3D9VA 3VULA 4V01A 3PDTA 3MGYA 5J7HA 4EWQA 2JFLA 3M1SA 3NCZA 4FIGA 4BB4A 4F1MA 2XCHA 4GKIA 3AGMA 3F7ZA 3RAHA 3SX9A 4LRMA 1KUTA 5DA3A 2WTVA 4E73A 2B9JA 3GEQA 4KIQA 3Q96A 2ZM1A 3OROA 4TWPA 2FA2A 2RFEA 3IQ7A 4F9WA 3VONA 3TDWA 2OI4X 3KN6A 3ZUUA 4FTMA 2PMOX 5IA2A 2VWVA 4FG8A 1YWRA 2ZB1A 3NGAA 3O5AA 4RPVA 4RIWA 4YHJA 3ZDIA 1M52A 5LCJA 2C0TA 1V0OA 3UIUA 5A6NA 3ZO4A 1IAJA 1YXSA 1WBPA 5HX6A 2HXQA 1QPCA 5L2WA 4OLIA 2XALA 3EFJA 5CVGA 3OBGA 4FKRA 2EUFB 4N70A 3F5GA 2PSQA 4A7CA 4APCA 4CSVA 3ODZX 5BMSA 1UU3A 2B7AA 3CGFA 5I9XA 2FSMX 3E7OA 2PULA 1YW2A 3BLRA 5CSPA 2BAJA 4UZDA 4Z7GA 5CYIA 3VHEA 1CMKE 1Q24A 2VTNA 3R21A 5HEZA 5M55A 4MF0A 2IO6A 4V05A 3D0EA 2QO2A 2GS2A 3IOKA 3TNIA 3CIKA 3KRWA 3F2RA 3AXWA 2BZKB 4RGJA 4FOCA 1YXVA 4O4EA 3NUUA 4CTBA 3RM6A 3DXPA 3W2CA 5E7RA 4NUSA 2XH5A 2QR7A 2WTWA 1U54A 1DAWA 1U5RA 1ZYLA 4WRSA 4WNPA 3NEWA 2PUPA 3SW4A 5I9UA 1ZYDA 3ZEPA 4C57A 4TYHA 4U3ZA 3I6WA 4LG4A 4O6EA 4RJ7A 1Q3DA 2GHLA 3TTJA 4EHZA 4FKGA 4JMQA 2GFSA 3BV3A 2OXXA 3OG7A 3R71A 5IQAA 3PE1A 2OK1A 2XF0A 2JBPA 4QMQA 3TUBA 3W2RA 1QPEA 3MJ2A 1FVRA 1KV1A 5EYDA 2ITUA 5BVOA 2Z7RA 3PXRA 2RF9A 4BBMA 3R9NA 2WZJA 5AP5A 3DB6A 2XM9A 3BV2A 2BCJA 4IZAA 4IMYA 4TW9A 3R9HA 3NNVA 5IQEA 2OICA 3TEIA 3FXXA 3O71A 5DIAA 5AX3A 2QU6A 4JDKA 4RJ3A 2J4ZA 3ZUTA 1PMNA 4EUTA 3WZEA 4IC8A 1PJKA 5EHYA 5TO8A 4MNFA 2BFXA 5AMNA 5I9ZA 2GNHA 4KUJA 3DBFA 4I5MA 3VRZA 4HVHA 4BR3A 3UQGA 1PKDA 5FEDA 4AX8A 2R3RA 4C4GA 3R7UA 3NZ0A 4AU8A 4KNBA 4X0MA 4E4XA 1V0PA 4UMRA 2OZAA 1UKHA 3FQSA 3ORMA 5F1ZA 4MXCA 3NRMA 1P5EA 4G3FA 4F7NA 2GPHA 2YCRA 4FE2A 3AD6A 2YCSA 2R3FA 5HIBA 4FIHA 3NX8A 1I44A 3EL8A 4O0YA 2I0EA 4E6QA 5IEYA 4DG3E 5DEYA 2OJGA 5IG1A 4EOSA 1R39A 5EM7A 4UWYA 1T45A 4UMQA 3TKUA 2O64A 4UALA 5KMKA 2C5VA 4F70A 2I0YA 4BCMA 2C3JA 4C35A 3T8OA 3VQUA 1WBNA 4YMJA 3UDTA 4AFJA 1ZARA 4EC8A 5IQHA 3EHAA 4JAJA 3LPBA 3NW7A 4L7FA 2WQMA 3FSKA 4YBKA 3P7AA 3RVGA 4HJOA 3C51A 4CCBA 3N51A 4FGBA 4JR3A 2XNPA 5BVNA 5HX8A 5JN2A 2VO3A 5GIPE