4S32A

Crystal structure of erk2 amp-pnp complex
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
351
structure length
346
Chain Sequence
AAAAGPQVFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Mitogen-activated protein kinase 1
publication title Crystal structure of ERK2 AMP-PNP complex
rcsb
source organism Rattus norvegicus
total genus 111
structure length 346
sequence length 351
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2015-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4s32A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4s32A01
3QCYA 1ZMWA 3C4FA 2EUFB 4IM0A 4UXQA 4CV9A 1IAJA 3Q32A 2YM5A 3R00A 4KWPA 5EKOA 1OMWA 2XNGA 2WMAA 2GQGA 2UZUE 5JFXA 2G2FA 2WMWA 4PDOA 2GPHA 5FDXA 4ZSEA 3UNKA 3BYOA 4NH1A 4HVHA 4X2JA 3NUNA 4GG7A 2CHLA 1LEWA 4D1XA 4XG4A 4APPA 5CU0A 4E20A 2W1CA 2IVUA 4V0GB 4I22A 3ORLA 4O7YA 4CTCA 1O9UA 3E7VA 3D2IA 3KB7A 5EM6A 3GQLA 5AAFA 3RCDA 3ZLYA 4WG4A 3LFSA 1W0XC 5IA4A 2WXVA 4U80A 1YVJA 2UW9A 2XCKA 5IEYA 4FL3A 3EB0A 3HA8A 4U3ZA 3O8UA 2R3GA 5M51A 3BLQA 3JYAA 1ZZ2A 4PP7A 4ZK5A 3UPXA 3ZFMA 4YO4A 2OKRA 4BBMA 1UWJA 3RZBA 2C6DA 4CZUA 2YDIA 3IOPA 3Q53A 4OTHA 3LFDA 2PUIA 1YXTA 3NLBA 2CN8A 3QQKA 4IADA 5C8KA 4CG9A 2WGJA 4G3CA 4EOQA 3GCVA 3T9IA 3QC9A 4U44A 2FSLX 4JQ7A 3IDBA 4ACHA 5IQFA 4O7RA 4B99A 2G2HA 5M09A 3GOPA 5HX8A 5L8JA 2HXLA 3FL5A 4HGTA 4L7SA 1FMOE 4NM5A 5AX9A 3NEWA 3Q4ZA 1FQ1B 4BB4A 3A7FA 1U46A 5FP5A 5TR6A 4B9DA 4CRLA 4OUCA 2GNJA 2ZJWA 1WBOA 4K11A 3FPMA 4U43A 1R0PA 4K0YA 3AG9A 3C5IA 5L8LA 2B54A 5HLPA 5KO1A 4UZHA 2YAAA 5CAUA 4M69B 3Q4CA 2XIZA 3IPHA 2VTSA 3C4ZA 5FXSA 5M4CA 3EQIA 4R3CA 5E1EA 3BLHA 5ANOA 3E8EA 4ASZA 4RZWA 4J95A 5TO8A 3P9JA 5HQ0A 3EZRA 1WBNA 3CS9A 1ZYCA 1KUTA 5CEPA 2NPQA 2BKZA 4FTOA 3PXYA 2OO8X 5HG8A 2OXYA 1KOBA 2JAVA 3NZ0A 4M68A 4M69A 3GI3A 4G5JA 3UPZA 4IACA 5KX8A 4QP3A 1MUOA 4RX8A 4BDJA 1QPDA 3AT4A 4J7BA 3QFVA 4FKJA 4E5BA 2JKQA 3R1YA 4JBPA 4FKLA 4XV2A 3MH3A 2JKMA 5HICA 3CPBA 2BHHA 3D94A 4QTBA 4BDAA 4P7EA 1U5RA 4TWPA 4K18A 1URCA 4KIPA 4PP9A 2XNEA 3RWPA 4AT4A 3P1AA 4ANMA 1U4DA 4RJ3A 3NX8A 5D9HA 4FGRA 4D55A 4I6QA 4CG8A 1P5EA 2BHEA 3Q5IA 5ANJA 2HENA 4C4FA 3MGYA 4NK9A 4GFMA 4I94A 4RT7A 5DYJA 5AR5A 4XBUA 1NVRA 4ZJIA 4EOLA 1JNKA 2UZTA 3HDMA 3NUXA 3E62A 4FKPA 4FIGA 2B53A 4C3FA 4EOIA 2X7FA 5F4NA 5DR9A 2PVYA 4O27B 5HD4A 3I81A 4Q5HA 4LV5A 4CFMA 2KTYA 4FSWA 3QTZA 3ZLSA 3F2RA 4J8MA 3BZ3A 3LFFA 2W1DA 4JBVA 4H39A 5AR8A 3V6RA 3ZLWA 3GT8A 2EVAA 4TY1A 4RIYB 4UALA 5L2TA 3IKAA 4GW8A 5HE3A 3DKFA 1OL2A 4NM7A 2I0YA 2WQEA 2HIWA 4QOXA 3UYSA 4E26A 3PVGA 1SNUA 2YCQA 5IQBA 2VTTA 1W82A 2ITWA 4EOJA 1XKKA 4DGGA 3ENMA 1ZYJA 2XEYA 2CGXA 3AGMA 4FYNA 4IWOA 5H8BA 3TKIA 4NWMA 3ZBXA 4A9SA 4EHGA 5GZ8A 3IQ7A 4F0GA 2XJ0A 5CSXA 2XKEA 4BWPA 5CXHA 2WQMA 2RFNA 2VO3A 4ZS0A 5JRQA 4G9CA 4IC8A 3VN9A 3JY0A 4V01A 3D7TB 4CYIA 3VW8A 4IEBA 4IFCA 4MD9E 1LP4A 4JBQA 3GU5A 4JAIA 3ROCA 3UG1A 3S00A 4W4VA 1M52A 4GUBA 4A9TA 5JFSA 1GZ8A 1FMKA 3I60A 5HORA 5HU9A 5K9IA 4FVQA 3BPRA 2W9ZB 3EQBA 4AUAA 4O86A 4GSBA 4EUUA 4QTAA 3LAUA 2B4SB 5L6OA 4ZLOA 4IWQA 2WOUA 2W1FA 3Q52A 1JKKA 4YJSA 3RPYA 3WOWA 3E88A 3MJ1A 4ZJVA 5J1WA 4BDHA 2UVZA 3CC6A 4TWNA 3VBQA 3IK3A 1AQ1A 3Q2JA 1L8TA 5FTGA 3ZRLA 2G15A 1JBPE 2DS1A 1SNXA 3MVHA 3HX4A 2R3QA 2ERKA 2F49A 3QQFA 2V55A 4EH5A 2WMSA 3OCBA 3ZMMA 3EYGA 3R8ZA 2ZMCA 1KOAA 3AC5A 3M2WA 3O71A 3I1AA 3MI9A 3E5AA 3HKOA 2ZAZA 4YJNA 3HEGA 2PZRA 4GEOA 4F7NA 3KF4A 5IA1A 1H01A 3ORPA 3Q4UA 5E92A 3S0OA 4BGGA 3RPRA 4XP3A 3U51A 3HAVA 3SOAA 2AYPA 4ACDA 2A0CX 1KE5A 1QMZA 3G9LX 3KL8A 1PKGA 4QYHA 5HU3A 1IRKA 4P2KA 4YUQA 1OI9A 5DMZA 5I3RA 1R1WA 1M14A 2X39A 1K3AA 4ZZMA 3B2TA 4PMMA 5LQFA 4GCJA 1W84A 3BQRA 2NO3A 4AE9A 4DLJA 4DEIA 4XMOA 3E7OA 2BPMA 1JKSA 4D1ZA 4HVDA 4YSJA 5L4QA 5JGBA 3LFAA 4HZRA 4Z3VA 5AR7A 4G16A 3UIXA 4FV5A 4PPCA 2JC6A 5EYMA 3RAIA 5ETCA 4DH3A 5FP6A 4RQKA 3RPVA 1E1XA 2BILB 3LMHA 1PYXA 4QRCA 3MFRA 4O22A 5FEEA 3R9HA 4K9YA 5CEMA 1ZXEA 2J5FA 4XG3A 2WMUA 2YCSA 4FV8A 1H26A 5AP0A 5J9YA 4AN2A 4NU1A 3GC7A 4R6VA 3PXRA 4CQEA 5AP4A 2VO0A 4H58A 2AUHA 4CZTA 3SGCA 3ZC6A 5KUPA 1GIHA 4FIHA 1T45A 4DFZE 2DQ7X 4TYHB 2RKUA 4BCIA 3FKOA 3ZSHA 5BUIA 3EQFA 4WUAA 5EDRA 3LCKA 5A4LA 3ORKA 3O8PA 5HEZA 3UTOA 4PMSA 2E2BA 4GUEA 4CMUA 1AGWA 1A06A 3VBYA 2ITNA 4M13A 5JT2A 1V0OA 5E8YA 2PWLA 3C9WA 4Y72A 3QWJA 3GC8A 1TVOA 4LFIA 3HP5A 4FTTA 4DTBA 3C1XA 3PLAE 3PY0A 4CFUA 2A27A 2RFSA 3ZTXA 4BCJA 3OOGA 5L2SA 1PXIA 4CFNA 2YLFA 4F1OA 5AV2A 2QKRA 4ZZOA 2YIYA 5DFPA 3N4VA 4XOYA 4MXOA 3LOKA 4X2NA 3FLNC 4YSMA 3C13A 4WHZA 2V62A 3OW3A 5HG9A 3R83A 4TWOA 4A4XA 2WQOA 1GZKA 3AGLA 4K8AA 3ITZA 3K54A 3DFCB 1R39A 2HZ4A 2ACXA 4MF1A 4AZEA 4BI2A 1JSVA 2HZIA 3NAYA 4XLVA 4GS6A 5IISA 4I93A 2VAGA 5CAQA 2ZM4A 3GB2A 2IVVA 3QGWA 4GIHA 4PUZA 4RLKA 5LCKA 3QTUA 4X3FC 4YO6A 1M2RA 2W9FB 3DAJA 4J1RA 3OCSA 4NIFB 4ANQA 4BDCA 4E7WA 3D4QA 2YIRA 4LUEA 3V5TA 4EUTA 2B52A 4IAAA 4AACA 1YXVA 2CKOA 3CR0A 2GFCA 3QU0A 2XBJA 3MESA 4E93A 1OGUA 3QD3A 1VR2A 1STCE 4JQEA 3ULIA 3P5KA 3ZHPC 4A4LA 3BQCA 3TL8A 3NYOA 4H3PA 4KKHA 4L42A 4FEWA 3NUYA 4O7TA 2Z7QA 4ACGA 3DT1A 3FMDA 4I5PA 4UEUA 3TDWA 4NIFA 5DR6A 3DZQA 3T3VA 4IJ9A 2EXMA 3QZGA 4OT5A 5A4CA 5AEPA 2X6EA 3BU5A 5T6KA 2FSOX 4FIIA 1WBTA 2QKWB 2ZDTA 5H2UA 3VULA 2QR8A 2WTIA 3KN5A 4O1OA 3N4UA 4GJ3A 4QT1A 2BALA 2ZB0A 2WPAA 4RWKA 4UWBA 4ZSLA 5DH3A 5IF1A 4QTDA 5E7RA 2W1HA 1MRYA 4EZ3A 4DGLC 4AA4A 3M42A 1JKTA 4FV3A 2VZ6A 4XHKB 4ZTLA 4BCGA 2F7EE 1Q62A 2BAQA 2GHLA 4C8BA 4KSQA 3UVPA 3ZUVA 2WMRA 3QYWA 4B7TA 4EOOA 3LLTA 5AIKA 4HCUA 3RMFA 2XNMA 5AM7A 1SVGA 1OKVA 1PKDA 4XYFA 3FSKA 5AUYA 4D58A 3FMKA 3DXQA 3M11A 4BIBA 4O0WA 2Z8CA 4UMQA 1TQPA 4PMTA 5DPVA 2W1GA 4OTPA 2J2IB 1IEPA 5M4UA 4HPTE 3ALOA 5AUWA 5CY3A 4FUXA 4Q9SA 1OM1A 2WMXA 3SXRA 2OZOA 1VJYA 3MVLA 4ASDA 4CQGA 3BGPA 4NM0A 4M0YA 5IMXA 3R21A 4G3GA 1R78A 4FSRA 1M2QA 3IW4A 2R9SA 3GOKA 1WBSA 4BDKA 3SKCA 1OUKA 3KY2A 2JDOA 2BKKA 4IAIA 4RJ5A 3OCGA 2J0LA 4KIKA 2PVMA 3F9NA 2YACA 4AGWA 4BKYA 2JBPA 1UA2A 5A54A 3UDBA 4LGGA 5EI2A 5IU2A 1H0VA 3A7HA 5M08A 4IAKA 4OAUC 2WIHA 4LUDA 3RWQA 4ZTRA 4FK3A 5LMKA 4BDGA 3W16A 4QMOA 3G6HA 5HLWA 2VTAA 3BV2A 4RJ8A 4IB0A 3OMVA 3BI6A 4W9XA 4FV6A 2CCHA 1CKPA 3OW4A 3LFNA 1H1WA 5GJFA 3PYYA 4O7NA 4U79A 3V5QA 3L1SA 3POZA 4FKGA 5EDQA 3MB6A 2W4JA 3BWJA 4X3JA 3TZ9A 4D28A 4ZSAA 3CTJA 4Y73A 2W5BA 3KN6A 3P0MA 3H10A 4EC8A 4MYGA 5HNBA 4E6QA 2R4BA 3LCDA 3NRMA 3QZFA 3OUKA 1YWRA 3Q9ZA 3K2LA 4MCVA 3IONA 2VU3A 3TKHA 4C7TA 2BTSA 2WEIA 4HZSA 4DH5A 4PDYA 5IA5A 4MXXA 5EM5A 3GEQA 2QLUA 3FMEA 3ATTA 3WYXA 1M2PA 2C5OA 1OPJA 4EOKA 2W4KA 3P79A 3GFEA 5IA0A 4AA0A 3R7OA 4O83A 3H9RA 3LHJA 3M1SA 4X2KA 4XLIA 5C8MA 5H8EA 3W2QA 5DI1A 2Y6OA 4ZMEA 3PG3A 3NMUF 1DI8A 3FQEA 5CEIA 4G31A 3L8PA 5KBQA 4L01A 2PPQA 4U8ZA 4WT6A 4MNEA 2R3HA 4CGAA 3H9OA 2XM9A 1GZNA 1REJA 4DBXA 4O0VA 3ORNA 3ODZX 4QMSA 3ZEWA 3F6XA 2QOHA 3Q3BA 2CN5A 3PIXA 1SMHA 3TIZA 3VUHA 3H9FA 2LGCA 3HYHA 4QMLA 4QP1A 1M7NA 4TNBA 3NNWA 4B4LA 4Y8DA 4DEAA 5J1VA 2GNLA 2XIXA 4LL0A 3P78A 3GU8A 3WARA 3Q9WA 5IH5A 3ALNA 5I4NA 1NVQA 4DTKA 1L3RE 3DBEA 3FZRA 4KKGA 5ICPA 1KV2A 2R2PA 3S4QA 1LPUA 4BCMA 1SVHA 2XJ2A 3BLRA 3EWHA 4W4YA 3GFWA 2P2HA 4AOIA 5EG3A 5CT0A 4F0FA 1YDSE 3F5PA 4JX7A 5DT3A 4FNYA 5J9LA 3GU4A 2QOKA 3FZSA 3QQGA 3KRJA 1GZOA 1BX6A 2YAKA 3MTLA 4GYGA 1O6KA 2CLXA 3BHUA 3NUUA 1W7HA 4FZ6A 2J50A 4R1YA 2C5XA 1J7IA 4YJPA 4RX5A 2JGZA 3G0FA 4FTCA 5GJDA 1XH7A 4XX9A 3QRJA 5DG5A 3FMMA 2WTJA 2GU8A 4FKUA 4QYGA 5JRSA 4D2SA 3IDCA 3QC4A 2GNHA 4HVSA 4B0GA 5EW9A 2NNWB 3MA3A 4M97A 5H9BA 5ETAA 4FEQA 4IXPA 3R30A 3I4BA 2VTPA 2A1AB 2B9FA 2C5VA 2Y6MA 2OZAB 5HCZA 2YZAA 2VUWA 3CY3A 3HMPA 1YOJA 2WFYA 4RC4A 3PY1A 3VUGA 5EH0A 3HMNA 5JFVA 5EI6A 4ZTQA 4TW9A 3QRKA 1Q8ZA 2CMWA 3PJCA 4LOQA 5JZNA 2Y8OA 3BEAA 4KABA 3BWFA 5HCXA 5A9UA 3RBWA 5L8KA 4O81A 3PE2A 3QTWA 2VTNA 3L8VA 4J99A 4CFXA 3VS1A 5DT0A 3ZM9A 2VTIA 3KEXA 4FC0A 1GY3A 1DI9A 1RW8A 3BV3A 4AOJA 5ETFA 1FVVA 4FSQA 5FQDC 3OWJA 4A07A 3DU8A 3R02A 4UBAA 1H07A 4N57A 5FEQA 3SW4A 4IANA 1XBBA 3DKCA 3DK7A 1V0BA 2YITA 4O21A 4QYFA 5C26A 2A2AA 4XOZA 1JKLA 3G6GA 2PULA 4YMJA 3PTGA 3FE3A 2Y4IB 3SV0A 5LWMA 4HNFA 1IASA 3UNZA 5DBXA 4PNIA 1PXMA 3FY0A 5IPJA 3LQ8A 5C4LA 4ZTHA 5A14A 2OXXA 5ACBC 5BMSA 4UMPA 3I5NA 4ALVA 4EH8A 4A9RA 4D4YA 5CAOA 4IAZA 4YGAA 5FLFA 3ET7A 3IGOA 1IA9A 2CKQA 4PTEA 4X2GA 4V04A 5D10A 1UU3A 1JOWB 3F5GA 2E9UA 4OBQA 3E3PA 2AC3A 5I9UA 1UWHA 5CU4A 3UOJA 3LLAA 1P4OA 1XBAA 2BCJA 3CBLA 4XG2A 3F5UA 5E1SA 4YTIA 3PXKA 5BUEA 5AA8A 4BC6A 2FYSA 3KK9A 2QURA 5IKWA 1SZMA 1XH6A 4L67A 2IW9A 4MKCA 3ZXTA 4BWXA 5IA3A 4O84A 3OWLA 1H08A 1ZWSA 2J0MB 5FWKK 2XYNA 5CANA 4S2ZA 1J1BA 2OF4A 3Q6WA 4X6RA 3SQQA 4F63A 3GU7A 4B8LA 1XH9A 2Z7RA 3F7ZA 3SD0A 5LJJA 5BUJA 3IGGA 4S32A 4TRLA 3F5XA 5B7VA 2XUUA 3RHKA 2W5AA 3OBJA 4RSSA 2X7GA 4TTHB 3HAMA 4U81A 2W1IA 3TJCA 2X8DA 4E4MA 1OL1A 1RJBA 4GMYA 4QMUA 4MXZA 3WF6A 4FEVA 4ZMFA 3CLYA 4XP0A 2J5EA 2C6MA 1UKIA 4KSPA 2CCIA 5T68A 4YC6A 4CSVA 4CV8A 4GK2A 3NWWA 1CKIA 4EL9A 4RBLA 2BDWA 4FICA 5EW3A 3PUPA 4U5JA 1YDTE 2YM4A 5TKDA 5F9EA 2IO6A 2O2UA 4ANLA 2BRHA 3AQVA 4AS0A 2VTLA 1JWHA 4AE6A 5FM3A 2WTWA 2XKFA 4L9IA 4EHZA 3EQHA 5G1XA 4JXFA 3AC4A 3LW0A 3ORZA 2FGIA 3MWUA 5AV1A 2QI8A 4F7SA 4IIRA 3F66A 3KGAA 2FO0A 4HPUE 2REIA 3CGFA 4IZ7A 3FMNA 4L52A 2B0QA 3C4EA 5B2MA 3ZU7A 4CXAA 4RIXB 5IEXA 3COKA 4HYSA 1SVEA 1VYWA 4XG6A 3DY7A 2BAKA 1PRYA 5KMJA 4S34A 4FTMA 3RI1A 1JVPP 4ZTMA 3H30A 3T8OA 3QF9A 2ITUA 5K4JA 2XNPA 4AT5A 5HVKA 3PXQA 3HNGA 4U0IA 3DJ6A 5DIAA 4GU9A 4YTCA 3N51A 3A4PA 4CVAA 2GCDA 4KD1A 3RALA 5AP2A 5CSPA 1RQQA 4HYUA 2IVTA 4O0XA 2GS7A 3G2FA 1A9UA 4L43A 3MYGA 4ZTSA 3IO7A 3E93A 1Y57A 3BX5A 1Q4LA 3G9NA 3LMGA 1H00A 4FKQA 4H1JA 4RPVA 4TXCA 3S95A 5DN3A 2PVHA 3V5LA 4C0TA 3IW5A 4MQ1A 4ZOGA 3TTJA 2VTHA 3QD2B 3ORTA 4PL4A 3ZUUA 2R3MA 4RFMA 4IVBA 5K5NA 4D2TA 1FGKA 3WF8A 3VS2A 4KBAA 1OECA 4H3QA 4LMNA 2YN8A 4KIQA 5CVGA 3ZEPA 4JDHA 3QCQA 2OI4X 3ACKA 4FKIA 3C0HA 4KBCA 4QP9A 2ZMDA 3OOMA 2PZ5A 1OUYA 3OS3A 3FDNA 4V0GA 2C68A 4E5AX 4V05A 4FT9A 4KKEA 4M66A 4WSQA 3C50A 4ZP5A 5CASA 2ZM1A 3R6XA 5J5TA 4HGSA 1P2AA 2XIYA 4DGMA 2O64A 2YA9A 3UP2A 4F9AA 4XV3A 4BRXA 2V5QA 4FL2A 5ANKA 4EK6A 3OBGA 4O1PA 2WMBA 5DLSA 4D5HA 2FB8A 4JRVA 5DRDA 4EK8A 2VX1A 3U4WA 1PMNA 4D2VA 2PL0A 3FI8A 3ANQA 2PVNA 3CY2A 2RF9A 4YBKA 4RRVA 2ZV9A 1DS5A 5L2QA 3CE3A 1LEZA 2OIQA 3D2KA 3UE4A 1YXXA 2UUEA 3OEZA 3UOHA 3LFCA 3AT3A 2F9GA 5DEYA 2BRNA 2PK9A 4QTCA 5F94A 2WO6A 3PJ3A 4AZTA 4C35A 4AF3A 3LE6A 4X3FB 3NYVA 4FV2A 5T3QA 2WEVA 2WNTA 3R28A 3R63A 4EK4A 3FLYA 1PYEA 4YJTA 2X1NA 2XF0A 3EZVA 2B9HA 3FUPA 3EH9A 4QQTA 2VNYA 4EH6A 3N4TA 4FKRA 5G6VA 4O7ZA 2IZSA 5KMLA 2IPXA 4MBJA 3NNUA 4FUYA 3QKLA 5HTIA 4E5WA 3PPJA 4X3FA 3HP2A 1MRVA 4MAOA 4WD5A 3DTWA 3ACJA 1PW2A 4O7LA 2CJMA 2W1ZA 2HW6A 3LZBA 4FTJA 4AFJA 2VWBA 2VNWA 4MWHA 3SAYA 3SVVA 5M53A 4FT7A 3BHTA 1S9IA 4RWIA 4NL0A 5DA3A 4EH9A 5EHYA 3LPBA 4FV9A 2ETRA 3VS3A 4EOSA 4USEA 1I44A 4X6QC 4YTHA 2X9FA 3QZHA 3NW7A 3DA6A 3GCSA 3NIZA 4CYJA 4EJNA 4BHZA 2O8YA 1CDKA 5KMMA 3FYKX 2EXEA 2NRUA 4WNPA 1E9HA 3PP0A 4FNWA 2YZLA 2HAKA 3D5UA 3CCNA 3V04A 1E1VA 3ZOSA 5TT7A 4F0IA 4RC3A 2GSFA 3QGYA 5AFVA 2W99B 3B2WA 3EFWA 2DWBA 3GC9A 3UQFA 3IS5A 4FNXA 4DITA 1H25A 2GS6A 3NCZA 3Q04A 1OBGA 5CLPA 3UOLA 3MB7A 1M7QA 1Y6AA 2X2MA 2UW8A 4OBOA 4Q5EA 4E4XA 4DHFA 3TDVA 4RWLA 3WF9A 3DDQA 4J71A 2VN9A 4EI4A 3R7VA 5CI6A 3NS9A 4JX3A 3L8SA 4OT6A 3V6SA 3WIKA 2Y4IC 4PTGA 3CD3A 4F08A 3POOA 1EH4A 2BZIB 3G90X 2XRUA 2JIVA 5HO8A 1YXSA 3L9NA 1XHAA 4QP7A 1H1QA 3BYSA 3CPCA 3P08A 4N70A 1OZ1A 2HY81 4NM3A 2YM3A 3UODA 4C37A 5KKRC 2W5HA 2GTNA 4QP2A 3P4KA 4BBFA 4FT5A 5E8TA 4C4GA 2G1TA 2QO2A 4WNMA 4BN1A 4BVUA 3O7LB 4BY9E 4E6CA 2X8IA 1UNGA 3DBFA 2JITA 3CIKA 4BCNA 3KMWA 3W55A 5HKMA 4D0XA 3ENHA 4J52A 3T3UA 4K1BA 3W2CA 3PVUA 2UZWE 4RIYA 4AXAA 4HYIA 4DEBA 2UZDA 4NCTC 3HVCA 5DR2A 3TUCA 4K2RA 4IE9A 3RHXA 2ITOA 4BCQA 5K5XA 3KFAA 2QOFA 1FOTA 3LCOA 4Z9LA 3QALE 2PZIA 4L68A 4IBMA 4XBRA 4D0WA 2GMXA 4CKRA 1KE8A 3CTHA 4IDVA 3E8NA 3VBTA 3VNTA 4GU6A 3AT2A 4LRKA 4BZDA 3BYUA 5I9VA 4LGDA 3QZIA 4IAYA 2X9EA 4MVFA 3DAEA 4E4LA 4FKOA 5JSMA 4DFUA 3D7TA 2R3IA 3GQIA 3QQHA 2HZ0A 4X7QA 5CSWA 3UQCA 3VAPA 3E87A 5IZFA 4FKWA 4OR5A 4C3PA 3TNQB 2YCFA 3GENA 3A2CA 2XKCA 3NVKI 5CYIA 4CKIA 5B0XA 5HNGA 5H8GA 4CCUA 3TV4A 2UVYA 3HRBA 1VEBA 4PF4A 3PWYA 4ASEA 2XMYA 3PRFA 2X8EA 1BL6A 4A9UA 5I3OA 3TTIA 2YWPA 5A4TA 1H4LA 5HHWA 5BVEA 4ANSA 4JLCA 4AZSA 2FSTX 5KBRA 3U6HA 1K9AA 1O6LA 3W2SA 3QYZA 1ZOHA 3FQSA 3OXIA 5GZAA 1ZZLA 3LFEA 4PV0A 3KRWA 1ZMVA 1Y8YA 5CENA 4EQUA 5CT7A 3VS0A 4JDJA 4F1TA 2OJIA 5J9ZA 4WOVA 3PA3A 4FZFB 5A6OA 4NYEA 4ZXTA 4EC9A 4L3PA 3BE9A 3TZ7A 3UZRA 3BIZA 5CZIA 1JAMA 2OFUA 3A61A 3HZTA 2PVKA 3NPCA 2UVXA 2VWIA 3D15A 4ITIA 5CI7A 5LVLA 3UQGA 4CNHA 4EOMA 4YU2A 5L2IA 3TKUA 4JQ8A 3RM6A 3ZDIA 3NDMA 4G34A 2J51A 2XVDA 4AFEA 5AUVA 4NEUA 3HV4A 3KRLA 5AMNA 1XH5A 3RPSA 4PRJA 4JG8A 4TT7A 2BTRA 3FI3A 4HVGA 1J7UA 1XO2B 2GQRA 3UMWA 3H0ZA 3HUCA 1DM2A 3F88A 1APME 4MBLA 5BPYA 4RJ4A 2EWAA 2G9XA 2XKDA 4EYJA 5K4IA 2RL5A 1P14A 1BL7A 4QQJA 4C59A 4GYIA 3UGCA 2XCHA 4DEDA 5LARA 2G2IA 3U6IA 3U55A 4R77A 4JI9A 2UV2A 1WBPA 1Q8YA 3KMMA 4JOAA 3QRTA 3DK6A 4LG4A 5EYKA 5CEKA 2F2UA 2C4GA 3QUPA 4WRGA 2J7TA 3WZJA 1FBNA 2QU5A 5AR4A 2C6KA 3IECA 4J53A 3PP1A 3NNVA 2C5YA 2UW6A 3QD4A 4F64A 1QCFA 3JS2A 4KINA 4TYHA 4M15A 4TYJA 2O65A 5C27A 4R8QA 4I20A 4IZAA 2PE1A 2YM7A 1PXPA 5FTQA 3CKXA 2C3JA 3VBVA 4ZAUA 3UO4A 4K33A 3RAHA 2C6TA 4EKKA 2IW6A 2WU7A 1BKXA 4GVAA 1BUHA 3DB8A 5ANDA 5CF4A 2WMTA 2RGPA 2C69A 5BVNA 5E8SA 4DCEA 4RQVA 4FV7A 4ANBA 3AMAA 5AUUA 4U6RA 1ZRZA 3EIDA 2F2CB 2QOBA 4QPMA 4BFMA 5AAGA 1ND4A 3RGFA 1Q97A 4IHPA 4FNZA 5L6WL 4GK4A 5AWMA 1SM2A 3SC1A 4LYNA 4IX3A 5EYDA 3FAAA 1OL7A 2ONLC 3KXMA 3QQJA 4O0UA 4EWHA 4BR3A 4JG6A 3SOCA 4YURA 3HA6A 1T46A 4MWIA 3ZSIA 4FEUA 1BLXA 4FKTA 4QYEA 2BUJA 4QTEA 4TPTA 4F6WA 5EQYA 4H36A 4QPAA 3SG9A 5I9YA 4GT4A 2PZPA 4GG5A 2R64A 3P7AA 4R3RA 3RK9A 4NKSA 5JQ8A 5CEQA 4TL0A 4HGLA 3RCJA 5GINE 2C0OA 4I5HA 2CGUA 4FVPA 4MQ2A 4M84A 1CSNA 3MW1A 4D4RA 3LKMA 4GJ2A 2WD1A 3O7LD 2ITZA 5DGZA 4FYOA 5AAEA 2ITTA 1O6YA 2WELA 1NT2A 2C0TA 3NCGA 1ZYDA 4QMNA 3FYJX 2X6DA 4X21A 2PYWA 3SX9A 4F09A 4RVLA 2V7OA 4O7WA 4AZFA 3K3IA 4C2WA 2XIKA 3KRRA 3UVRA 4QP4A 4E1ZA 3TM0A 1A48A 3VQHA 2Z60A 5FTOA 4DEEA 2VV9A 4ONAA 4PMPA 2BIYA 4QP6A 3HL7A 3BHHA 2C6LA 5ITAA 4GKIA 4O6LA 4D2RA 3LMIA 4U41A 5FGKA 1H24A 4JVGA 4LRJA 4B8MA 5DNRA 3UO5A 3VUTA 4E8AA 4QNAA 2UZLA 1YI6A 2ZYBA 3I7CA 4WA9A 3ZRKA 1ZY5A 1WVWA 1PXJA 1YI3A 2FSMX 4EONA 5CF6A 3G15A 3R8LA 4G17A 4YHFA 2C1BA 3E3BX 2YM8A 2CGVA 3F3TA 3OD6X 1FVTA 2IZRA 3A8XA 4LOPA 5GHVA 2PMNX 4FK6A 4OTWA 3V3VA 3UYTA 5L6PA 5JN2A 3DDPA 1QPCA 2ETKA 5EQEA 5F20A 4GRBA 3P7BA 4ZSGA 3V5JA 4NTSA 4FKVA 2YABA 4MTAA 5M4FA 4YC3A 2BIKB 4Y85A 2LAVA 1PXOA 2WTVA 2HK5A 3ZO4A 2BR1A 2UW3A 4IVCA 4XJ0A 3V8WA 4BTMA 3R22A 2VGPA 4P5ZA 4XV1A 5IUGA 4IH8A 2CSNA 1XBCA 1WBWA 2F7XE 3SW7A 4F4PA 3F3ZA 4C2VA 4ZY6A 5KNJA 3TIYA 4IX5A 4NUSA 1H28A 3QA0A 4O2PA 3A99A 2UZVA 5AR3A 5C4KA 3W2OA 4H05A 2GNIA 4YJRA 2Z02A 4C36A 2C1AA 3G51A 4FZAB 5IUIA 4CT2A 3VBWA 3W2RA 4BTFA 4AZWA 4I1ZA 3FHIA 4MXYA 5KMNA 1F5QA 2CNQA 3WZKA 3NIEA 3ODYX 5BMMA 5AM6A 4AT3A 3FMHA 3MPTA 5E90A 1CMKE 4G1WA 3DPKA 2PY3A 3O17A 2ZOQA 4AW5A 3OVVA 5AUTA 4Z7HA 4ASXA 3DLZA 1H0WA 1YW2A 4BDFA 3R9OA 1OBDA 4J98A 3RNYA 3LIJA 3ZLXA 4UX9A 1FINA 5HCYA 5HZNA 3HGKA 4DH7A 3QHRA 5HIDA 5I9ZA 1MP8A 1ZYLA 1OPLA 2GDOA 2JIIA 3BHVA 3I79A 4XV9A 5DVRA 3LXLA 2I1MA 5ANIA 5J79A 4DBNA 4U97A 3PJ8A 4L00A 2XEZA 3ZO1A 1TQMA 4UWCA 3OHTA 4C61A 2QR7A 4FIJA 4W4WA 4DT9A 2Q83A 4DFXE 4W8EA 3TT0A 5E8VA 3PIYA 4FTRA 4YJUA 3QWKA 4N4SA 1Q99A 4IM3A 4I6FA 4RMZA 1YXUA 2XH5A 1YKRA 2QOQA 2XJ1A 4EH2A 2CDZA 2ESMA 3BEGA 4BDDA 3DXPA 5EQPA 3TZMA 2XNBA 3R7UA 5AV3A 3L9PA 2XK9A 3AXWA 1WCCA 4I0RA 2RG6A 3HV6A 4JG7A 3R8MA 2XBAA 4YLKA 5IQAA 3D0EA 1XQZA 3LFQA 4D2PA 4DH8A 5FBNC 4YTFA 3D9VA 4EHVA 4UN0C 2QD9A 3AD6A 5CNNA 3AOXA 2UZBA 3WYYA 2C6EA 1Q3DA 3LXKA 4YJOA 4RGJA 3W33A 4BCOA 3LQ3A 5IQHA 4Q2AA 4F7JA 4PY1A 3VQUA 3TACA 3NUSA 3FI2A 1HOWA 3EN5A 4FSTA 1BI8A 2YJRA 5HBJA 5H3QA 4M12A 2XYUA 3OG7A 3OTUA 3LJ2A 2X2LA 5LVNA 5AUXA 3VHKA 5IQCA 5I9XA 3K5UA 5BVWA 4WBBB 2IJMA 4E6DA 2VO7A 2XK4A 3AC3A 4YZ9A 4HNIA 4GFGA 4WNKA 5CSHA 5IG1A 4C57A 1B38A 4IWPA 1JQHA 4R3PA 3EN4A 3QCSA 5IA2A 1WMKA 3DNEA 4NJDA 4MEDA 3R73A 2RFDA 5ETIA 4AGDA 1H1PA 4MXAA 3WE8A 3DOGA 3C0IA 3PA5A 4HGEA 3HRCA 4L3LA 4EZ5A 4KNBA 2BDFA 3VS4A 2OBJA 2C3IB 1G3NA 2PVFA 3COMA 5BQ0A 2FUMA 4DTAA 4W9WA 4EEVA 3BBTB 3CXWA 3E64A 2F57A 5EDPA 3W10A 2OFVA 2VTRA 4LRMA 5A3XA 3HUBA 5D1JA 2IG7A 2I0EA 4WG3A 3LXNA 5F95A 4M0ZA 2WZJA 2OZAA 3R7GA 3UP7A 2DYLA 3RJCA 5EOLA 3OY3A 4G2FA 4I92A 2GQSA 3UVQA 3PFQA 2VTMA 3JR1A 3UC4A 3BGQA 4FKSA 5F1ZA 3SG8A 3E8DA 4W8DA 3UNJA 3FKLA 4EYMA 2QO9A 4YNOA 1UU8A 3BU3A 5D11A 3D5VA 4Q9ZA 3LXPA 3PVWA 4J96A 3EN6A 4MNFA 3O0GA 4KBKA 3ZBFA 3EMGA 4YZCA 3MPMA 3HECA 2VWZA 2PMOX 4FTUA 5GNKA 3UBDA 1KE6A 4C4EA 4LQMA 5KKRB 3OZ6A 1RDQE 3QHWA 2NP8A 3R01A 2BZJA 5HE1A 4FTAA 3SXFA 2HWOA 4FA2A 3F3WA 2QG5A 3V8SA 3BE2A 3VS5A 1S9JA 5KZ0A 3QUDA 3PJ2A 2VTJA 5AX3A 2PHKA 2XS0A 4UWYA 3VS7A 3OT3A 3FLWA 1Z57A 2P55A 3MV5A 5KMKA 2OJGA 2OU7A 2QU6A 1KSWA 1Q61A 4HOKA 2C3LA 3G0EA 1IR3A 4KB8A 5KZIA 2VWUA 3ANRA 3VC4A 3ORMA 2YEXA 5E8UA 2J4ZA 3FC1X 4DEGA 5HIBA 1ZARA 2WAJA 1LUFA 4ZS4A 4GFOA 4EZ7A 3F82A 3VJNA 3H0YA 3O2MA 3VO3A 3ATSA 2JKKA 4OTIA 4AQCA 3OUNB 4ZLZA 1NXKA 3U9CA 2PUUA 5BVDA 3FXZA 3Q96A 4JDKA 3MN3A 1GIJA 2HY0A 4HCTA 3WI6A 4BICA 2PMIA 2ZV2A 3JPVA 1IAHA 5J7BA 2A19B 3Q2MA 4G3EA 4QNYA 3T9TA 3R9RA 3DZOA 3S1HA 2PUNA 2W05A 2Z7LA 3MFSA 3COHA 4NCTA 3FZ1A 2GNGA 2YIWA 3R8PA 5EKNA 3I7BA 4WUNA 4RIOA 3MFUA 1BYGA 5I5ZA 4P90A 3EHAA 2CKPA 1PXNA 4APCA 3KVXA 2PSQA 5FXRA 5HESA 3KCKA 4AGUA 4FV4A 1RE8A 5CNOA 4DFNA 4ZSJA 5IQDA 5BYZA 4FIEA 3O8TA 4A4OA 4AW1A 3PPKA 4S33A 2O3PA 5AJQA 3BYMA 3PJ1A 4YPSA 3SRVB 5CU2A 2O0UA 2UZEA 1FVRA 3PSCA 3AMYA 3E8CA 1YOLA 3NR9A 5HOAA 3QTXA 2OH4A 4RJ7A 5CS6A 4Z55A 3VUIA 1VYZA 2WTKC 3DFAA 2OG8A 2Y7JA 3MSSA 4IDTA 4OTDA 4K77A 5JKGA 2PU8A 1MQ4A 1ZAOA 4O96A 1YI4A 5A46A 5HVYA 3CP9A 5HNIX 1Q8UA 4ANNA 3PLSA 5AP1A 4JJRA 2XNOA 4QMXA 4MX9A 2BFYA 3OF0A 1GJOA 1R0EA 2JEDA 4GT5A 2PUPA 4C4IA 3NUAA 5BNJA 2QG7A 4DFLA 2BRBA 3FBVA 3PRIA 4OW8A 2QC6A 5GIPE 1NW1A 2EXCX 4EH7A 4X2FA 4TKSA 4AZVA 4CEGA 4N6YA 3R2YA 3ZH8A 3GVUA 3H3CA 4RA4A 3W2PA 3FMLA 4D9TA 2ITQA 5EHLA 5B2LA 4QPSA 5IH6A 4AW0A 2W4OA 1B39A 5CF8A 4M67A 1J1CA 5I0BA 4FZ7A 4ENYA 3EKNA 3MDYA 3VBXA 4CFWA 4RIXA 4W4XA 4PL3A 2NRYA 3QA8A 1TKIA 4R5YA 4FBXA 2PE2A 3EFJA 3JVSA 4GKHA 3HMIA 3DGKA 1MQBA 2C30A 2V0DA 5HIEA 3F69A 4C34A 3A4OX 4LM5A 5E8WA 4UZDA 4C38A 2WMVA 4H1MA 4GV1A 4JL9A 3EQPA 4RFYA 2WMQA 1JLUE 4Y5QA 2YLEA 5FEDA 3U6JA 3DV3A 4ACCA 1KWPA 5GIOE 1P4FA 4DH1A 1GAGA 1OVEA 4ZEGA 2R3FA 3BELA 4JIAA 4ANOA 2XM8A 3SXSA 4LV8A 1U54B 4JIKA 2VX0A 4G3DA 2XZSA 4R78A 1ATPE 3NYNA 3ZFXA 2IVSA 4C4JA 4IB1A 3QLGA 4FX3A 2H8HA 4GVJA 3UMXA 4FTLA 2R0IA 4WO5A 1ERKA 4XH6A 5EW8A 2ITYA 4PTCA 4YLLA 2X81A 3MBLA 1U5QA 3W8QA 4AOTA 3ZCLA 3RVGA 3U54A 2QOLA 4H3BA 4I5CA 1G8AA 2OLCA 5HTCA 3EFKA 4FVRA 2X7OA 1U54A 3B8QA 4PQNA 2I6LA 5LWNA 3RINA 3EQRA 3B8RA 3RM7A 4OLIA 4PX6A 3KU2A 4ZJJA 1NVSA 4FSYA 2CLQA 3LVPA 3I0QA 3AMBA 4DG3E 3HMOA 4EBWA 3CD8A 3MS9A 3DQWA 3UIMA 2I0VA 3L9MA 4I3ZA 5FD2A 3RKBA 3UZPA 4CLJA 3ZZEA 5KCVA 3TEIA 1Y8GA 5C8NA 3TV6A 3Q6UA 4BYJA 2P0CA 3W1FA 1JPAA 3L9LA 4IB3A 3TNHA 5LMBA 4AA5A 4WSYA 5HE2A 5C03A 3TN8A 3L8XA 4QQCA 2YHVA 5HLNA 3D83A 4I4FA 3GUBA 4L3JA 3VWAA 4G6NA 3QQUA 4FG7A 4D9UA 4UMRA 4ZY4A 5IMEA 2EB3A 2X2KA 4NZWB 4C02A 4BI0A 2YERA 1U59A 3SA0A 2R3OA 4LGHA 1OIYA 2ONLA 3LJ1A 3PIZA 1BMKA 2E9VA 4I6HA 4I24A 4TN6A 3EQDA 1QPEA 2C0IA 4L8MA 3W18A 5CQUA 2WQBA 5CZHA 3F61A 3WZEA 2ZB1A 2UW4A 4M7IA 5C01A 3MVMA 5BVFA 4L7FA 4ACMA 4PWNA 2QODA 3LM0A 4JBOA 4JAJA 4NSTA 3QKKA 3S3IA 3PVBA 2WU6A 3EN9A 3PSBA 4WIHA 2ZV8A 5HBHA 4PPAA 3MIYA 5HI2A 4O7VA 2Y4PA 1ZMUA 4F9YA 4FEXA 3E63A 4BBEA 5CXZA 3RAKA 4IQ6A 1UU9A 5CU6A 3UJGA 2HYYA 3AD5A 1OKZA 4YLJA 3VHEA 5DOSA 3IDPA 4GIIA 2R3LA 2Y9QA 5CAVA 4MHAA 3FL4A 5LVMA 3PE1A 4UV0A 4XG9A 3C5UA 4CZYB 5M55A 3MA6A 4TYIA 3H4JA 5CWZA 3VUMA 3MFTA 3GXLA 4F1MA 3ZRMA 5M44A 1UNLA 4O82A 3R8UA 1OIUA 2R0UA 3EQGA 1LR4A 1BI7A 5CU3A 4E6AA 2BZHB 3N9XA 3ZM4A 2YCRA 2YM6A 3FLQA 3KULB 4KRDA 4WG5A 4F99A 5IUHA 3HV7A 1B6CB 3R1SA 1YOMA 2V7AA 4G6OA 4I21A 2BVAA 2P2IA 2CPKE 4BHNA 3R8VA 1WZYA 3HV5A 4QP8A 2B9JA 2P3GX 2JFMA 4HVIA 1FGIA 3O51A 4PDPA 3NNXA 5EK7A 4AG8A 5BYYA 3FEGA 1V1KA 3KXZA 4R5SA 3U8WA 4F9WA 4UYAA 3KULA 4CD0A 3QD0A 1JSTA 2W1EA 3SDJA 4DG2E 3GP0A 3I0OA 4J97A 3RK5A 4Z7GA 3CSVA 4E4NA 1XWSA 4AX8A 1Q3WA 4IVAA 2XP2A 4FGBA 4JT3A 4MF0A 3EL7A 4UY9A 4Y83A 3DXNA 3TWJA 4Y46A 2W17A 4I41A 3ULZA 3MIAA 1UVRA 5DRBA 4KAOA 4O91A 4TNDA 4DINA 3V5PA 4XNEA 2V22A 1W8CA 2IZUA 4YZMA 2OW3A 4WBOA 3EOCA 2HXQA 1UU7A 3FHRA 3G33A 2BRGA 3NW5A 4FMQA 1WFCA 2O63A 3U9NA 3QCXA 5EHOA 3RPOA 3C0GA 4I0SA 3BU6A 2XIRA 2PZYA 1YDRE 3DS6A 5J7HA 2KULA 3DNDA 2BDJA 4FTKA 4QMPA 4QMVA 1PMEA 2DUVA 3C4WA 5A4QA 3LFBA 3OTVA 4BTKA 3BKBA 3MH2A 3RAWA 4UMTA 2E9PA 3WF5A 5D12A 3AC2A 3D14A 3QX4A 4BCHA 4RFZA 3RK7A 5J87A 5A4EA 4JNWA 4J8NA 3KXGA 3OP5A 4EK3A 5ANGA 2BRMA 3TNPC 5CEOA 3KKVA 4XG7A 3VF9A 1R3CA 5B2KA 2CNUA 2R3JA 1FPUA 4F9BA 5K0KA 1GOLA 5ANEA 3UC3A 4RG0A 2PVLA 4D4VA 5EM7A 2JAMA 5D7AA 4FOBA 4YHJA 2J9MA 3RTPA 3EFLA 4FTNA 5L2WA 4BKZA 2XRWA 4GH2A 2OICA 2ITVA 3W8LA 4A9YA 2Q0BA 3CJGA 4GK3A 4A06A 2GNFA 3HV3A 5FDPA 2F7ZE 3OXZA 4FT0A 3ID6C 1F0QA 4DAWA 3GCPA 1J3HA 4BKJA 2X4FA 4E73A 4USDA 3C4XA 3DKOA 2SRCA 5E8ZA 2YISA 1G5SA 5AV0A 4XP2A 4KS8A 5BVKA 3JXWA 5CVFA 5AADA 4I23A 3QXPA 4FSZA 3WF7A 2QLQA 4DT8A 3PXZA 3ZFYA 4RX7A 1OKWA 1XR1A 1I09A 3QTIA 1CKJA 1YQJA 3CKWA 4ITHA 1W83A 4IVDA 5CSVA 3MJ2A 2VTOA 4R7IA 1OPKA 3KA0A 4MD7E 3UIBA 1OIRA 5JZJA 4CFFA 4G5PA 2W96B 4DGNA 4EH4A 4TZRA 2G01A 3DTCA 5FG8A 3ZONA 5CF5A 5JGAA 2Z7SA 4IW0A 3LJ0A 1W98A 3EN7A 2YJSA 2OJJA 4IC7A 4EORA 5TE0A 1Q41A 3R1NA 3C4CA 3HLLA 2UW0A 4DE4A 1AD5A 4OTQA 3LM5A 2Y0AA 4S31A 3DQXA 4FG9A 3R71A 4L53A 4BZOA 2QQ7A 2VO6A 3WILA 3F7WA 3NUPA 3V01A 5KMIA 4EQMA 4LI5A 1YRPA 4MXCA 1KE9A 4WRSA 4RIWA 5TF9A 4QMYA 3PWDA 4RJ6A 2QHNA 2J0JA 4IAFA 2HOGA 5M06A 4ALWA 4A7CA 1VZOA 2QVSE 3PDTA 2OF2A 3EYHA 3GU6A 4QMQA 3KC3A 3ZXZA 2XK7A 3R04A 3FWQA 3TUBA 5BX0A 2VD5A 3TXOA 1HCKA 1PXLA 5EYCA 5HO6A 4ZTNA 4F65A 3Q4TA 1CM8A 5M56A 2IN6A 3U87A 2VTQA 2Q0NA 5HE0A 2UW5A 2XK3A 3WZDA 3GGFA 4F9CA 3HRFA 3O96A 1QL6A 3KQ7A 4KRCA 2ZV7A 3LQ5A 5IQIA 1UKHA 3NW6A 4ARKA 1XJDA 4XG8A 3K3JA 4Y5HA 3R0TA 3VRZA 5J5SA 4IMYA 2OGVA 3ZO3A 3RZFA 2ITPA 4FSMA 3DKGA 4DA5A 4D2WA 2UZNA 2XA4A 3MTFA 3I5ZA 2JDTA 4OBPA 4KS7A 2B9IA 5AR2A 4AWIA 2YIQA 5FM2A 3MY1A 5K0XA 3R9DA 1IA8A 2PVRA 2WB8A 5CX9A 4UMUA 4EOPA 3R1QA 2FA2A 4QO9A 5HX6A 5DE2A 1J91A 5KE0A 1ZY4A 3D5XA 3O23A 2C3KA 4U42A 4HJOA 3ROYA 2QOCA 5JQ5A 4RA5A 2X0GA 3CQWA 4FL1A 4RVMA 4WNOA 2PMLX 1PMUA 3MY5A 3ZS5A 4CLIA 3QLFA 5K3YA 3W32A 3ORIA 4RX9A 4DC2A 3A8WA 1YHVA 3DJ7A 2WIPA 4BCKA 3COIA 1YWVA 3OFMA 4NT4A 4PL5A 4D1SA 3VIDA 4DF3A 4F7LA 4YZDA 2FVDA 2R3KA 2RSVA 3SLSA 4EHEA 3WE4A 4DLIA 4AP7A 2C6IA 4O7SA 2CKEA 2GTMA 2HELA 1H27A 3ZC5A 5KHXA 4CTBA 3DBQA 5E4HA 4MBIA 2YFXA 2H6DA 3FZOA 2QOOA 3F2NA 1OL5A 2JD5A 3G5DA 3QXOA 4IB5A 4EKLA 5LOHA 2ZVAA 4RC2A 2HCKA 4BYIA 2JBOA 2GS2A 3BYVA 2E9OA 2QO7A 3DAKA 3R2BA 5E8XA 3QQLA 3QTRA 1DAWA 4OTFA 1PXKA 4XEYA 3OWPA 2XB7A 4U7ZA 1M17A 2FH9A 2WTKB 2BMCA 4NW5A 4NKAA 3FJQE 5JEBA 1F3MC 4LL5A 4USFA 3OROA 1ZYSA 2VWWA 1IG1A 3CGOA 3QKMA 4FSUA 4JDIA 2OXDA 4UB7A 4C62A 3II5A 2WTCA 4G3FA 4AAAA 5J95A 2C6OA 5AP3A 5CALA 3MVJA 3PG1A 3DLSA 4E3CA 2X4ZA 2OH0E 3QRIA 3SHEA 3OEFX 5FXQA 2BFXA 5CVHA 3Q9XA 4C4HA 3WBLA 4EJ7A 2BAJA 4EQCA 1KV1A 4NFMA 3WIGA 4KIKB 4AN3A 3ZDUA 2R3RA 3NSZA 4B6LA 4FR4A 3CEKA 3THBA 5IDPA 4BIEA 2WTDA 3FC2A 3DBCA 3KF7A 2XK8A 4DCAA 3KMUA 1XH8A 5D7VA 4BF2A 3O50A 1YWNA 1Z5MA 4TYEA 4YZNA 2RFEA 5IH4A 2AC5A 2OJFE 3MH1A 4FV1A 2JFLA 1YHSA 4XRLA 4ITJA 2YWVA 1OITA 1YHWA 2ZDUA 3F3VA 3DK3A 3P7CA 4NW6A 3KVWA 3OWKA 4YP8A 1OB3A 4YHTA 5AP6A 3KREA 4UXLA 2HZNA 2GHMA 5IQGA 1TQIA 1K2PA 2J90A 3IW8A 4G9RA 4Y95A 1J7LA 4CKJA 2WHBA 3CQEA 3ELJA 4R1VA 2YDJA 3EL8A 4CT1A 3A62A 4IM2A 3VS6A 4EK5A 5JK3A 5CQWA 3QTQA 1Y91A 3D7ZA 3P86A 4FV0A 4PPBA 3TV7A 4AU8A 4DFYA 3F3UA 4OTRA 4FODA 3PXFA 5HO7A 5LXMA 4QMTA 4NTTA 4BDEA 4ZY5A 3QX2A 4QMMA 4YR8A 3HDNA 5JFWA 1MRUA 4O0RA 4ERWA 1ZOGA 2EU9A 5DHJA 5A6NA 4IFGA 4R7HA 3FV8A 5C9CA 4IZYA 3BRBA 3TCPA 4DG0E 4MNEB 4ZLYA 4YZBA 4M8TA 2RIOA 3QL8A 4U3YA 3FSFA 4YPDA 3DBDA 5D41A 3A7GA 5EM8A 3V51A 4MD8E 2W06A 5HD7A 5HTBA 1URWA 5LCJA 4QYYA 3MY0A 5FRIA 4C58A 4BIDA 3FI4A 5I9WA 4I0TA 4O2ZA 4U40A 2A4LA 4XUFA 5EI8A 1WAKA 3PA4A 4MK0A 5AP5A 3E92A 4IJPA 1WBVA 4BGQA 4U9AA 5ACKA 3PZHA 2OIDA 4O38A 5J8IA 4RWJA 2VWVA 2JKOA 3OC1A 3VF8A 2W0JA 3FPQA 4OAVB 5IDNA 4FF8A 3TJDA 3KXNA 4GT3A 5KMOA 4BL1A 4XCUA 3GCUA 4NJ3A 3F2AA 5HBEA 1Q24A 3K5VA 5IEVA 5BYLA 2ITXA 3LCSA 4CFVA 4R7BA 3OCTA 5M4IA 1H8FA 4OTGA 4U45A 3BBWA 4FI1A 4ID7A 4RIWB 4CRSA 5LVOA 4YC8A 3ORXA 2UW7A 4BCPA 5AV4A 3ZUTA 3FQHA 1X8BA 2F4JA 2JDSA 4LMUA 4O0SA 4M14A 2GHGA 2VRXA 4AGCA 3GCQA 2PTKA 2I7QA 3A7JA 3C51A 4FTIA 3KCFA 4L45A 3R7IA 3VJOA 4N0SA 1PHKA 3DCVA 4PDSA 4RZVA 3AD4A 3Q9YA 3QUEA 3ZO2A 4C3RA 4YJVA 2P33A 4YNEA 1JSUA 4BWKA 3NAXA 1UNHA 5GJGA 4DFBA 1Q8TA 5E9EA 1V0PA 3Q60A 2H9VA 5CAPA 4ORKA 1PJKA 4BZNA 3FMJA 3OT8A 4RVTA 4O0TA 4DGOA 2I0HA 3VUDA 4EH3A 2QOIA 5BVOA 5EOBA 4BDBA 1G8SA 1REKA 3A7IA 3LCTA 1PMVA 2OK1A 2QHMA 3OXTA 4I5MA 3OY1A 2P4IA 3KRXA 3MH0A 2QONA 3VRYA 3CQUA 1PF8A 4Z16A 4XS2A 3WZUA 3UOKA 2JDRA 1OKYA 2YDKA 4D4SA 1WVYA 5HG7A 3VW6A 3UG2A 4KA3A 3RP9A 5JGDA 2XNNA 2YIXA 3VUKA 1SYKA 1HCLA 4OGRA 3I6UA 2E9NA 5FUTA 3CTQA 1GNGA 2B7AA 3ERKA 2I40A 2IZTA 3ZSGA 4O0YA 1NY3A 4ERKA 3DB6A 5DWRA 4EWQA 4QMWA 4BI1A 1CTPE 2R7IA 2BROA 4D5KA 4JR3A 3FZPA 4IZ5A 4IX6A 3QAME 5C1QB 4CCBA 4IWDA 3PSDA 4HCVA 3FLSA 4RVKA 3KXHA 1Q8WA 5JMSA 4F6UA 5IQEA 4TWCA 2ZM3A 2H34A 3FKNA 4KIOA 4O6EA 5GZ9A 4QD6A 4PNKA 2WKMA 4FG8A 5M07A 2BZKB 2J0IA 4M3QA 5EFQA 2B55A 4BDIA 3C7QA 1OL6A 3IW7A 4HW7A 3BHYA 4FTQA 3REPA 3VVHA 3PY3A 4MH7A 1Q5KA 3QRUA 1DAYA 4P4CA 4XRJA 4BGHA 5JH6A 4KUJA 3V8TA 1ZOEA 2IW8A 1GIIA 2C47A 3KK8A 2CGWA 2HWPA 3BCEA 4ZZNA 5AUZA 4BCFA 2W7XA 5TOZA 4L6QA 2VWYA 5LVPA 2HW7A 3U4UA 3EKKA 3GBZA 3V5WA 4DEHA 3EQCA 3P23A 3IOKA 2RG5A 3MPAA 3ZZWA 2VGOA 4F70A 2JIUA 5HGIA 3A60A 3GC0A 1ZLTA 1WVXA 3IW6A 5L3AA 5KHWA 3PZEA 3JUHA 2ERZE 2H96A 4I6BA 5DEWA 4QMZA 4AN9A 4JR7A 5M57A 4P5QA 1XH4A 3TI1A 4BTJA 1PY5A 3AC1A 2CNVA 4F6SA 4L46A 2JLDA 2GFSA 3ETAA 5E91A 2OSCA 3UIUA 3UZTA 2R7BA 2VWXA 3CJFA 3FXXA 4FOCA 3R9NA 3NGAA 2EB2A 2PE0A 3ZYAA 5AA9A 4X0MA 5LMAA 4HYHA 4L44A 5AIRA 3UO6A 2QNJA 4FIFA 4FSNA 3TG1A 4UYNA 2OWBA 3AC8A 3KXXA 1H1SA 2PVJA 4YBJA 2Z2WA 4ZIMA 3FZTA 2R5TA 3Q5ZA 3FLZA 3TNWA 4I4EA 4JRNA 3BGZA 2B1PA 5HVJA 4TYGA 3D5WA 4N6ZA 4YJQA 3R7EA 3SRVA 4ALUA 2ETMA 2R3PA 2JDVA 2XK6A 4LOOA 4ENXA 4IX4A 2VX3A 3GNIB 4FZDB 3S2PA 3TNIA 2C5NA 2J6MA 4CMOA 2IWIA 5FBOA 2J0KA 3HMMA 3PPZA 4QQ5A 2WQNA 1QPJA 3DJ5A 4JS8A 4DN5A 3R7YA 5CTPA 5AP7A 1Z9XA 4AW2A 3FXWA 2OJ9A 3FY2A 3JVRA 3QBNA 4C33A 3EJ1A 3IG7A 3JY9A 4II5A 4NFNA 4S30A 3TZ8A 5LMKC 3I6WA 1KE7A 4GL9A 2UZOA 4CMTA 1H1RA 1NA7A 1Y6BA 1OIQA 4FE2A 2O5KA 4RLLA 4EBVA 2QCSA 3TUDA 2WOTA 3QTSA 5DT4A 4G6LA 3RNIA 5HG5A 3NVMB 4FT3A 4K6ZA 2OIBA 2R3NA 4WKQA 3NYXA 1UV5A 4DYMA
chains in the Genus database with same CATH superfamily
3QCYA 1ZMWA 3C4FA 2EUFB 4IM0A 2IF8A 4UXQA 4CV9A 1IAJA 3Q32A 2YM5A 3R00A 4KWPA 5EKOA 1OMWA 2XNGA 2WMAA 2GQGA 2UZUE 5JFXA 2G2FA 2WMWA 4PDOA 2GPHA 5FDXA 4ZSEA 3UNKA 3BYOA 4NH1A 4HVHA 4X2JA 3NUNA 4GG7A 2CHLA 1LEWA 4D1XA 4XG4A 4APPA 5CU0A 4E20A 4I6LA 2W1CA 2IVUA 4V0GB 4I22A 3ORLA 4O7YA 4CTCA 1O9UA 3E7VA 3D2IA 3KB7A 5EM6A 3GQLA 5AAFA 3RCDA 3ZLYA 4WG4A 3LFSA 1W0XC 5IA4A 2XAMA 2WXVA 4U80A 1YVJA 2UW9A 2XCKA 5IEYA 4FL3A 3EB0A 3HA8A 4U3ZA 3O8UA 2X0QA 2R3GA 5M51A 3BLQA 3JYAA 1ZZ2A 4PP7A 4ZK5A 3UPXA 3ZFMA 4YO4A 1W2CA 2OKRA 4BBMA 1UWJA 3RZBA 2C6DA 4CZUA 2YDIA 3IOPA 3Q53A 4OTHA 3LFDA 2PUIA 1YXTA 3NLBA 2CN8A 3QQKA 4IADA 5C8KA 4CG9A 2WGJA 4G3CA 4EOQA 3GCVA 3T9IA 3QC9A 4U44A 2FSLX 4JQ7A 3IDBA 4ACHA 5IQFA 4O7RA 4B99A 2G2HA 5M09A 3GOPA 5HX8A 5L8JA 2HXLA 3FL5A 4HGTA 4L7SA 1FMOE 4NM5A 5AX9A 3NEWA 3Q4ZA 1FQ1B 4BB4A 3A7FA 1U46A 5FP5A 5TR6A 4B9DA 4CRLA 4OUCA 2GNJA 2ZJWA 1WBOA 4K11A 3FPMA 4U43A 1R0PA 4K0YA 3AG9A 3C5IA 5L8LA 2B54A 5HLPA 5KO1A 4UZHA 2YAAA 5CAUA 4M69B 3Q4CA 2XIZA 3IPHA 2VTSA 3C4ZA 5FXSA 5M4CA 3EQIA 4R3CA 5E1EA 3BLHA 5ANOA 3E8EA 4ASZA 4RZWA 4J95A 5TO8A 3P9JA 5HQ0A 3EZRA 1WBNA 3CS9A 1ZYCA 1KUTA 5CEPA 2NPQA 2BKZA 4FTOA 3PXYA 2OO8X 5HG8A 2OXYA 1KOBA 2JAVA 3NZ0A 4M68A 4M69A 3GI3A 4G5JA 3UPZA 4IACA 5KX8A 4QP3A 1MUOA 4RX8A 4BDJA 1QPDA 3AT4A 4J7BA 3QFVA 4FKJA 4E5BA 2JKQA 3R1YA 4JBPA 4FKLA 4XV2A 3MH3A 2JKMA 5HICA 3CPBA 2BHHA 3D94A 4QTBA 4BDAA 4P7EA 1U5RA 4TWPA 4K18A 1URCA 4KIPA 4PP9A 2XNEA 3RWPA 4AT4A 3P1AA 4ANMA 1U4DA 4RJ3A 3NX8A 5D9HA 4FGRA 4D55A 4I6QA 4CG8A 1P5EA 2BHEA 3Q5IA 5ANJA 2HENA 4C4FA 3MGYA 4NK9A 1G8KA 4GFMA 4I94A 4RT7A 1VLRA 5DYJA 5AR5A 4XBUA 1NVRA 4ZJIA 4EOLA 1JNKA 2UZTA 3HDMA 3NUXA 3E62A 4FKPA 4FIGA 2B53A 4C3FA 4EOIA 2X7FA 5F4NA 5DR9A 2PVYA 4O27B 5HD4A 3I81A 4Q5HA 4LV5A 4CFMA 2KTYA 4FSWA 3QTZA 3ZLSA 3F2RA 4J8MA 3BZ3A 3LFFA 2W1DA 4JBVA 4H39A 5AR8A 3V6RA 3ZLWA 3GT8A 2EVAA 4TY1A 4RIYB 4UALA 5L2TA 3IKAA 4GW8A 5HE3A 3DKFA 1OL2A 4NM7A 2I0YA 2WQEA 2HIWA 4QOXA 3UYSA 4E26A 3PVGA 1SNUA 2YCQA 5IQBA 2VTTA 1W82A 4JMQA 2ITWA 4EOJA 1XKKA 4DGGA 3ENMA 1ZYJA 2XEYA 2CGXA 3AGMA 4FYNA 4IWOA 5H8BA 3TKIA 4NWMA 3ZBXA 4A9SA 4EHGA 5GZ8A 3IQ7A 4F0GA 2XJ0A 5CSXA 2XKEA 4BWPA 5CXHA 2WQMA 2RFNA 2VO3A 4ZS0A 5JRQA 4G9CA 4IC8A 3VN9A 3JY0A 4V01A 3D7TB 4CYIA 3VW8A 4IEBA 4IFCA 4MD9E 1LP4A 4JBQA 3GU5A 4JAIA 3ROCA 3UG1A 3S00A 4W4VA 1M52A 4GUBA 4A9TA 5JFSA 1GZ8A 1FMKA 1OGYA 3I60A 2X0OA 5HORA 5HU9A 5K9IA 4FVQA 3BPRA 2W9ZB 3EQBA 4AUAA 4O86A 4GSBA 4EUUA 4QTAA 3LAUA 4DHJA 2B4SB 5L6OA 4ZLOA 4IWQA 2WOUA 2W1FA 3Q52A 1JKKA 4YJSA 3RPYA 3WOWA 3E88A 3MJ1A 4ZJVA 5J1WA 4BDHA 2UVZA 3CC6A 4O4CA 4TWNA 3VBQA 3IK3A 1AQ1A 3Q2JA 1L8TA 5FTGA 3ZRLA 2G15A 1JBPE 2DS1A 1SNXA 3MVHA 3HX4A 2R3QA 4DDGA 2ERKA 2F49A 3QQFA 2V55A 4EH5A 2WMSA 3OCBA 3ZMMA 3EYGA 3R8ZA 3AKLA 2ZMCA 1KOAA 3AC5A 3M2WA 3O71A 3I1AA 3MI9A 3E5AA 3HKOA 2ZAZA 4YJNA 3HEGA 2PZRA 4GEOA 4F7NA 3KF4A 5IA1A 1H01A 3ORPA 3Q4UA 5E92A 3S0OA 4BGGA 3RPRA 4XP3A 3U51A 3HAVA 3SOAA 2AYPA 4ACDA 2A0CX 1KE5A 1QMZA 3G9LX 3KL8A 1PKGA 4QYHA 5HU3A 1IRKA 4P2KA 4YUQA 1OI9A 5DMZA 5I3RA 1R1WA 1M14A 2X39A 1K3AA 4ZZMA 3B2TA 4PMMA 5LQFA 4GCJA 1W84A 3BQRA 2NO3A 4AE9A 4DLJA 4DEIA 4XMOA 3E7OA 2BPMA 1JKSA 4D1ZA 4HVDA 4YSJA 5L4QA 5JGBA 3LFAA 4HZRA 4Z3VA 5AR7A 4G16A 3UIXA 4FV5A 4PPCA 2JC6A 5EYMA 3RAIA 5ETCA 4DH3A 5FP6A 4RQKA 3RPVA 1E1XA 2BILB 3LMHA 1PYXA 4QRCA 3MFRA 4O22A 5FEEA 3R9HA 4K9YA 5CEMA 1ZXEA 2J5FA 4XG3A 2WMUA 2YCSA 4FV8A 1H26A 5AP0A 5J9YA 4AN2A 4NU1A 3GC7A 4R6VA 3PXRA 4CQEA 5AP4A 2VO0A 4H58A 2AUHA 4CZTA 3SGCA 3ZC6A 5KUPA 1GIHA 4FIHA 1T45A 4DFZE 2DQ7X 4TYHB 2RKUA 4BCIA 3FKOA 3ZSHA 5BUIA 3EQFA 4WUAA 5EDRA 3LCKA 5A4LA 3ORKA 3O8PA 5HEZA 3UTOA 4PMSA 2E2BA 4GUEA 4CMUA 1AGWA 1A06A 3VBYA 2ITNA 4M13A 5JT2A 1V0OA 5E8YA 2PWLA 3C9WA 4Y72A 3QWJA 3GC8A 1TVOA 4LFIA 3HP5A 4FTTA 4DTBA 3C1XA 3PLAE 3PY0A 4CFUA 2A27A 2RFSA 3ZTXA 4BCJA 3OOGA 5L2SA 1PXIA 4CFNA 2YLFA 3NFFB 4F1OA 5AV2A 2QKRA 4ZZOA 2YIYA 5DFPA 3N4VA 4XOYA 4MXOA 3LOKA 4X2NA 3FLNC 4YSMA 3C13A 4WHZA 2V62A 3OW3A 5HG9A 3R83A 4TWOA 4A4XA 2WQOA 1GZKA 3AGLA 4K8AA 3ITZA 3K54A 3DFCB 2AQXA 1R39A 2HZ4A 2ACXA 4MF1A 4AZEA 4O4BB 4BI2A 1JSVA 2HZIA 3NAYA 4XLVA 4GS6A 5IISA 4I93A 2VAGA 5CAQA 2ZM4A 3GB2A 2IVVA 3QGWA 4GIHA 4PUZA 4RLKA 5LCKA 3QTUA 4X3FC 4YO6A 1M2RA 2W9FB 3DAJA 4J1RA 3OCSA 4NIFB 4ANQA 4BDCA 4E7WA 3D4QA 2YIRA 4LUEA 3V5TA 4EUTA 2B52A 4IAAA 4AACA 1YXVA 2CKOA 3CR0A 2GFCA 3QU0A 2XBJA 3MESA 4E93A 1OGUA 3QD3A 1VR2A 1STCE 4JQEA 3ULIA 3P5KA 3ZHPC 4A4LA 3BQCA 3TL8A 3NYOA 4H3PA 4KKHA 4L42A 4FEWA 3NUYA 4O7TA 2Z7QA 4ACGA 3DT1A 3FMDA 4I5PA 4UEUA 3TDWA 4NIFA 5DR6A 3DZQA 3T3VA 4IJ9A 2EXMA 3QZGA 4OT5A 5A4CA 5AEPA 2X6EA 3BU5A 5T6KA 2FSOX 4FIIA 1WBTA 2QKWB 2ZDTA 5H2UA 3VULA 2QR8A 2WTIA 3KN5A 4O1OA 3N4UA 4GJ3A 4QT1A 2BALA 2ZB0A 2WPAA 4RWKA 4UWBA 4ZSLA 5DH3A 5IF1A 4QTDA 5E7RA 2W1HA 1MRYA 4EZ3A 4DGLC 4AA4A 3M42A 1JKTA 4FV3A 2VZ6A 4XHKB 4ZTLA 4BCGA 2F7EE 1Q62A 2BAQA 2GHLA 4C8BA 4KSQA 3UVPA 3ZUVA 2WMRA 3QYWA 4B7TA 4EOOA 3LLTA 5AIKA 4HCUA 3RMFA 2XNMA 5AM7A 1SVGA 1OKVA 1PKDA 4XYFA 3FSKA 5AUYA 4D58A 3FMKA 3DXQA 3M11A 4BIBA 4O0WA 2Z8CA 4UMQA 1TQPA 4PMTA 5DPVA 2W1GA 4OTPA 2J2IB 1IEPA 5M4UA 4HPTE 3ALOA 5AUWA 5CY3A 4FUXA 4Q9SA 1OM1A 2WMXA 3SXRA 2OZOA 1VJYA 3MVLA 4ASDA 4CQGA 3BGPA 4NM0A 4M0YA 5IMXA 3R21A 4G3GA 1R78A 4FSRA 1M2QA 3IW4A 2R9SA 3GOKA 1WBSA 4BDKA 3SKCA 1OUKA 3KY2A 2JDOA 2BKKA 4IAIA 4RJ5A 3OCGA 2J0LA 4KIKA 2PVMA 3F9NA 2YACA 4AGWA 4BKYA 2JBPA 1UA2A 5A54A 4DDIA 3UDBA 4LGGA 5EI2A 5IU2A 1H0VA 3A7HA 5M08A 4IAKA 4OAUC 2WIHA 4LUDA 3RWQA 4ZTRA 4FK3A 5LMKA 4BDGA 3W16A 4QMOA 3G6HA 5HLWA 2VTAA 3BV2A 4RJ8A 4IB0A 3OMVA 3BI6A 4W9XA 4FV6A 2CCHA 1CKPA 3OW4A 3LFNA 1H1WA 5GJFA 3PYYA 4O7NA 4U79A 3V5QA 3L1SA 3POZA 4FKGA 5EDQA 3MB6A 2W4JA 3BWJA 4X3JA 3TZ9A 4D28A 4ZSAA 3CTJA 4Y73A 2W5BA 3NFGB 3KN6A 3P0MA 3H10A 4EC8A 4MYGA 5HNBA 4E6QA 2R4BA 3LCDA 3NRMA 3QZFA 3OUKA 1YWRA 3Q9ZA 3K2LA 4MCVA 3IONA 2VU3A 3TKHA 4C7TA 2BTSA 2WEIA 4HZSA 4DH5A 4PDYA 5IA5A 4MXXA 5EM5A 3GEQA 2QLUA 3FMEA 3ATTA 3WYXA 1M2PA 2C5OA 1OPJA 4EOKA 2W4KA 3P79A 3GFEA 5IA0A 4AA0A 3R7OA 4O83A 3H9RA 3LHJA 3M1SA 4X2KA 4XLIA 5C8MA 5H8EA 3W2QA 5DI1A 2Y6OA 4ZMEA 3PG3A 3NMUF 1DI8A 3FQEA 5CEIA 4G31A 3L8PA 5KBQA 4L01A 2PPQA 4U8ZA 4WT6A 4MNEA 2R3HA 4CGAA 3H9OA 2XM9A 1GZNA 1REJA 4DBXA 4O0VA 3ORNA 3ODZX 4QMSA 3ZEWA 3F6XA 2QOHA 3Q3BA 2CN5A 3PIXA 1SMHA 3TIZA 3VUHA 3H9FA 2LGCA 3HYHA 3PUFC 4QMLA 4QP1A 1M7NA 4TNBA 3NNWA 4B4LA 4Y8DA 4DEAA 5J1VA 2GNLA 2XIXA 4LL0A 3P78A 3GU8A 3WARA 3Q9WA 5IH5A 3ALNA 5I4NA 1NVQA 1G8JA 4DTKA 1L3RE 3DBEA 3FZRA 4KKGA 5ICPA 1KV2A 2R2PA 3S4QA 1LPUA 4BCMA 1SVHA 2XJ2A 3BLRA 3EWHA 4W4YA 3GFWA 2P2HA 4AOIA 5EG3A 5CT0A 4F0FA 1YDSE 3F5PA 4JX7A 5DT3A 4FNYA 5J9LA 3GU4A 2QOKA 3FZSA 3QQGA 3KRJA 1GZOA 1BX6A 2YAKA 3MTLA 4GYGA 1O6KA 2CLXA 3BHUA 3NUUA 1W7HA 4FZ6A 2J50A 4R1YA 2C5XA 1J7IA 4YJPA 4RX5A 2JGZA 3G0FA 4FTCA 5GJDA 1XH7A 4XX9A 3QRJA 5DG5A 3FMMA 2WTJA 2GU8A 4FKUA 4QYGA 5JRSA 4D2SA 3IDCA 3QC4A 2GNHA 4HVSA 4B0GA 5EW9A 2NNWB 3MA3A 4M97A 5H9BA 5ETAA 4FEQA 4IXPA 3R30A 3I4BA 2VTPA 2A1AB 2B9FA 2C5VA 2Y6MA 2OZAB 5HCZA 2YZAA 2VUWA 3CY3A 3HMPA 1YOJA 2WFYA 4RC4A 3PY1A 3VUGA 3ML1A 5EH0A 3HMNA 5JFVA 5EI6A 4ZTQA 4TW9A 3QRKA 1Q8ZA 2CMWA 3PJCA 4LOQA 5JZNA 2Y8OA 3BEAA 4KABA 3BWFA 5HCXA 5A9UA 3RBWA 5L8KA 4O81A 3PE2A 3QTWA 2VTNA 3L8VA 4J99A 4CFXA 3VS1A 5DT0A 3ZM9A 2VTIA 3KEXA 4FC0A 1GY3A 1DI9A 1RW8A 3BV3A 4AOJA 5ETFA 1FVVA 4FSQA 5FQDC 3OWJA 4A07A 3DU8A 3R02A 4UBAA 1H07A 4N57A 5FEQA 3SW4A 4IANA 1XBBA 2XANA 3DKCA 3DK7A 1V0BA 2YITA 4O21A 4QYFA 5C26A 2A2AA 4XOZA 1JKLA 3G6GA 2PULA 4YMJA 3PTGA 3FE3A 2Y4IB 3SV0A 5LWMA 4HNFA 1IASA 3UNZA 5DBXA 4PNIA 1PXMA 3FY0A 5IPJA 3LQ8A 5C4LA 4ZTHA 5A14A 2OXXA 5ACBC 5BMSA 4UMPA 3I5NA 4ALVA 4EH8A 4A9RA 4D4YA 5CAOA 4IAZA 4YGAA 5FLFA 3ET7A 3IGOA 1IA9A 2CKQA 4PTEA 4X2GA 1TZDA 4V04A 5D10A 1UU3A 1JOWB 3F5GA 2E9UA 4OBQA 3E3PA 2AC3A 5I9UA 1UWHA 5CU4A 3UOJA 3LLAA 1P4OA 1XBAA 2BCJA 3CBLA 4XG2A 3F5UA 5E1SA 4YTIA 3PXKA 5BUEA 5AA8A 4BC6A 2FYSA 3KK9A 2QURA 5IKWA 1SZMA 1XH6A 4L67A 2IW9A 4MKCA 3ZXTA 4BWXA 5IA3A 4O84A 3OWLA 1H08A 1ZWSA 2J0MB 5FWKK 2XYNA 5CANA 4S2ZA 2XARA 3W0QA 1J1BA 2OF4A 3Q6WA 4X6RA 3SQQA 4F63A 3GU7A 4B8LA 1XH9A 2Z7RA 3F7ZA 3SD0A 5LJJA 5BUJA 3IGGA 4S32A 4TRLA 3F5XA 5B7VA 2XUUA 3RHKA 2W5AA 3OBJA 4RSSA 2X7GA 4TTHB 3HAMA 4U81A 2W1IA 4DHIB 3TJCA 2X8DA 4E4MA 1OL1A 1RJBA 4GMYA 4QMUA 4MXZA 3WF6A 4FEVA 4ZMFA 3CLYA 4XP0A 2J5EA 2C6MA 1UKIA 4KSPA 2CCIA 5T68A 4YC6A 4CSVA 4CV8A 4GK2A 3NWWA 1CKIA 4EL9A 4RBLA 2BDWA 4FICA 5EW3A 3PUPA 4U5JA 1YDTE 2YM4A 5TKDA 5F9EA 2IO6A 2O2UA 4ANLA 2BRHA 3AQVA 4AS0A 2VTLA 1JWHA 4AE6A 5FM3A 4QDEA 2WTWA 2XKFA 4L9IA 4EHZA 3EQHA 5G1XA 4JXFA 3AC4A 3LW0A 3ORZA 2FGIA 3MWUA 5AV1A 2QI8A 4F7SA 4IIRA 3F66A 3KGAA 2FO0A 4HPUE 2REIA 3CGFA 4IZ7A 3FMNA 4L52A 2B0QA 3C4EA 5B2MA 3ZU7A 4CXAA 4RIXB 5IEXA 3COKA 4HYSA 1SVEA 1VYWA 4XG6A 3DY7A 2BAKA 1PRYA 3TYKA 5KMJA 4S34A 4FTMA 3RI1A 1JVPP 4ZTMA 3H30A 3T8OA 3QF9A 2ITUA 5K4JA 2XNPA 4AT5A 5HVKA 3PXQA 3HNGA 4U0IA 3DJ6A 5DIAA 4GU9A 4YTCA 3N51A 3A4PA 4CVAA 2GCDA 4KD1A 3RALA 3PFYA 5AP2A 5CSPA 1RQQA 4HYUA 2IVTA 4O0XA 2GS7A 3G2FA 1A9UA 4L43A 3MYGA 4ZTSA 3IO7A 3E93A 1Y57A 3BX5A 1Q4LA 3G9NA 3LMGA 1H00A 4FKQA 4H1JA 4RPVA 4TXCA 3S95A 5DN3A 2PVHA 3V5LA 4C0TA 3IW5A 4MQ1A 4ZOGA 3TTJA 2VTHA 3QD2B 3ORTA 4PL4A 3ZUUA 2R3MA 4RFMA 4IVBA 5K5NA 4D2TA 1FGKA 3WF8A 3VS2A 4KBAA 1OECA 4H3QA 4LMNA 2YN8A 4KIQA 5CVGA 3ZEPA 4JDHA 3QCQA 2OI4X 3ACKA 4FKIA 3C0HA 4KBCA 4QP9A 2ZMDA 3OOMA 2PZ5A 1OUYA 3OS3A 3FDNA 4V0GA 2C68A 4E5AX 4V05A 4FT9A 4KKEA 4M66A 4WSQA 3C50A 4ZP5A 5CASA 2IEWA 2ZM1A 3R6XA 5J5TA 4HGSA 1P2AA 2XIYA 4DGMA 2O64A 2YA9A 3UP2A 4F9AA 4XV3A 4BRXA 2V5QA 4FL2A 5ANKA 4EK6A 3OBGA 4O1PA 2WMBA 5DLSA 4D5HA 2FB8A 4JRVA 5DRDA 4EK8A 2VX1A 3U4WA 1PMNA 4D2VA 2PL0A 4O4EA 3FI8A 3ANQA 2PVNA 3CY2A 2RF9A 4YBKA 4RRVA 2ZV9A 1DS5A 5L2QA 3CE3A 1LEZA 2OIQA 3D2KA 3UE4A 1YXXA 2UUEA 3OEZA 3UOHA 3LFCA 4QDVA 3W0SA 3AT3A 2F9GA 5DEYA 2BRNA 2PK9A 4QTCA 5F94A 2WO6A 3PJ3A 4AZTA 4C35A 4AF3A 3LE6A 4X3FB 3NYVA 4FV2A 5T3QA 2WEVA 2WNTA 3R28A 3R63A 4EK4A 3FLYA 1PYEA 4YJTA 2X1NA 2XF0A 3EZVA 2B9HA 3FUPA 3EH9A 4QQTA 2VNYA 4EH6A 3N4TA 4FKRA 5G6VA 4O7ZA 2IZSA 5KMLA 2IPXA 4MBJA 3NNUA 4FUYA 3QKLA 5HTIA 4E5WA 3PPJA 4O4FA 4X3FA 3HP2A 1MRVA 4MAOA 4WD5A 3DTWA 3ACJA 1PW2A 4O7LA 2CJMA 2W1ZA 2HW6A 3LZBA 4FTJA 4AFJA 2VWBA 2VNWA 4MWHA 3SAYA 3SVVA 5M53A 4FT7A 3BHTA 1S9IA 4RWIA 4NL0A 5DA3A 4EH9A 5EHYA 3LPBA 4FV9A 2ETRA 3VS3A 4EOSA 4USEA 1I44A 4X6QC 4YTHA 2X9FA 3QZHA 3NW7A 3DA6A 3GCSA 3NIZA 4CYJA 4EJNA 4BHZA 2O8YA 1CDKA 5KMMA 3FYKX 2EXEA 2NRUA 4O4DA 1E9HA 3PP0A 4WNPA 4FNWA 2YZLA 2HAKA 3D5UA 3CCNA 3V04A 1E1VA 3ZOSA 5TT7A 4F0IA 4RC3A 3P5JC 2GSFA 3QGYA 5AFVA 2W99B 3B2WA 3EFWA 2DWBA 3GC9A 3UQFA 3IS5A 4FNXA 4DITA 1H25A 2GS6A 3NCZA 3Q04A 1OBGA 5CLPA 3UOLA 3MB7A 1M7QA 1Y6AA 2X2MA 2UW8A 4OBOA 4Q5EA 4E4XA 4DHFA 3TDVA 4RWLA 3WF9A 3DDQA 4J71A 2VN9A 4EI4A 3R7VA 5CI6A 3NS9A 4JX3A 3L8SA 4OT6A 3V6SA 3WIKA 2Y4IC 4PTGA 3CD3A 4F08A 3POOA 1EH4A 2BZIB 3G90X 2XRUA 2JIVA 5HO8A 1YXSA 3L9NA 1XHAA 4QP7A 1H1QA 3BYSA 3CPCA 3P08A 4N70A 1OZ1A 2HY81 4NM3A 2YM3A 3UODA 4C37A 5KKRC 2W5HA 2GTNA 4QP2A 3P4KA 4BBFA 4FT5A 5E8TA 4C4GA 2G1TA 2QO2A 4WNMA 4BN1A 4BVUA 3O7LB 4BY9E 4E6CA 3KIOC 2X8IA 1UNGA 3DBFA 2JITA 3CIKA 4BCNA 3KMWA 3W55A 5HKMA 4D0XA 3ENHA 4J52A 3T3UA 4K1BA 3W2CA 3PVUA 2UZWE 4RIYA 4AXAA 4HYIA 4DEBA 2UZDA 4NCTC 3HVCA 5DR2A 3TUCA 4K2RA 4IE9A 3RHXA 2ITOA 4BCQA 5K5XA 3KFAA 2QOFA 1FOTA 3LCOA 4Z9LA 3QALE 2PZIA 4L68A 4IBMA 4XBRA 4D0WA 2GMXA 4CKRA 1KE8A 3CTHA 4IDVA 3E8NA 3VBTA 3VNTA 4GU6A 3AT2A 4LRKA 4BZDA 3BYUA 5I9VA 4LGDA 3QZIA 4IAYA 2X9EA 4MVFA 3DAEA 4E4LA 4FKOA 5JSMA 4DFUA 3D7TA 2R3IA 3GQIA 3QQHA 2HZ0A 4X7QA 5CSWA 3UQCA 3VAPA 1XMLA 3E87A 5IZFA 4FKWA 4OR5A 4C3PA 3TNQB 2YCFA 3GENA 3A2CA 2XKCA 3NVKI 5CYIA 4CKIA 5B0XA 5HNGA 5H8GA 4CCUA 3TV4A 1W2DA 2UVYA 3HRBA 1VEBA 4PF4A 3PWYA 4ASEA 2XMYA 3PRFA 2X8EA 1BL6A 4A9UA 5I3OA 3TTIA 2YWPA 5A4TA 1H4LA 5HHWA 5BVEA 4ANSA 4JLCA 4AZSA 2FSTX 5KBRA 3U6HA 1K9AA 1O6LA 3W2SA 3QYZA 1ZOHA 1ST0A 3FQSA 3OXIA 5GZAA 1ZZLA 3LFEA 4PV0A 3KRWA 1ZMVA 1Y8YA 5CENA 4EQUA 5CT7A 3VS0A 4JDJA 4F1TA 2OJIA 5J9ZA 3VONA 4WOVA 3PA3A 4FZFB 5A6OA 4NYEA 4ZXTA 4EC9A 4L3PA 3BE9A 3TZ7A 3UZRA 3BIZA 5CZIA 1JAMA 2OFUA 3A61A 3HZTA 2PVKA 3NPCA 2UVXA 2VWIA 3D15A 4ITIA 5CI7A 5LVLA 3UQGA 4CNHA 4EOMA 4YU2A 5L2IA 3TKUA 4JQ8A 3RM6A 3ZDIA 3NDMA 4G34A 2J51A 2XVDA 4AFEA 3W0OA 5AUVA 4NEUA 3HV4A 3KRLA 5AMNA 1XH5A 3UDTA 3RPSA 1TFFA 4PRJA 4JG8A 4TT7A 2BTRA 3FI3A 4HVGA 1J7UA 1XO2B 2GQRA 3UMWA 3H0ZA 3HUCA 1DM2A 3F88A 1APME 4MBLA 5BPYA 4RJ4A 2EWAA 2G9XA 2XKDA 4EYJA 5K4IA 2RL5A 1P14A 1BL7A 4QQJA 4C59A 4GYIA 3UGCA 2XCHA 4DEDA 5LARA 2G2IA 3U6IA 3U55A 4R77A 4JI9A 2UV2A 1WBPA 1Q8YA 3KMMA 4JOAA 3QRTA 3DK6A 4LG4A 5EYKA 5CEKA 2F2UA 2C4GA 3QUPA 4WRGA 2J7TA 3WZJA 1FBNA 2QU5A 5AR4A 2C6KA 3IECA 4J53A 3PP1A 3NNVA 2C5YA 2UW6A 3QD4A 4F64A 1QCFA 3JS2A 4KINA 4TYHA 4M15A 4TYJA 2O65A 5C27A 4R8QA 4I20A 4IZAA 2PE1A 2YM7A 1PXPA 5FTQA 3CKXA 2C3JA 3VBVA 4ZAUA 3UO4A 4K33A 3RAHA 2C6TA 4EKKA 2IW6A 2WU7A 1BKXA 4GVAA 1BUHA 3DB8A 5ANDA 5CF4A 2WMTA 2RGPA 2C69A 5BVNA 5E8SA 4DCEA 4RQVA 4FV7A 4ANBA 3AMAA 5AUUA 4U6RA 1ZRZA 3EIDA 2F2CB 2QOBA 4QPMA 4BFMA 5AAGA 1ND4A 3RGFA 1Q97A 4IHPA 4FNZA 5L6WL 4GK4A 5AWMA 1SM2A 3SC1A 4LYNA 4IX3A 5EYDA 3FAAA 1OL7A 2ONLC 3KXMA 3QQJA 4O0UA 4EWHA 4BR3A 4JG6A 3SOCA 4YURA 3HA6A 1T46A 4MWIA 3ZSIA 4FEUA 1BLXA 4FKTA 4QYEA 2BUJA 4QTEA 4TPTA 4F6WA 5EQYA 4H36A 2X0PA 4QPAA 5I9YA 3SG9A 4GT4A 2PZPA 2A98A 4GG5A 2R64A 3P7AA 4R3RA 3RK9A 4NKSA 5JQ8A 5CEQA 4TL0A 4AXEA 4HGLA 3RCJA 5GINE 2C0OA 4I5HA 2CGUA 4FVPA 4MQ2A 4M84A 1CSNA 3MW1A 4D4RA 3LKMA 4GJ2A 2WD1A 3O7LD 2ITZA 5DGZA 4FYOA 5AAEA 2ITTA 1O6YA 2WELA 1NT2A 2C0TA 3NCGA 1ZYDA 4QMNA 3FYJX 2X6DA 4X21A 2PYWA 3SX9A 4F09A 4RVLA 2V7OA 4O7WA 4AZFA 3K3IA 4C2WA