2UZVA

Pka structures of indazole-pyridine series of akt inhibitors
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
336
structure length
336
Chain Sequence
VKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVMLVKHMETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKDGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFSEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords CAMP-DEPENDENT PROTEIN KINASE INHIBITOR ALPHA,
publication title Syntheses of Potent, Selective, and Orally Bioavailable Indazole-Pyridine Series of Protein Kinase B/Akt Inhibitors with Reduced Hypotension.
pubmed doi rcsb
source organism Bos taurus
total genus 108
structure length 336
sequence length 336
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2007-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2uzvA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2uzvA02
4LUEA 4KS8A 3TKIA 3POZA 3V8WA 4CV8A 4CMTA 2C5YA 4RX7A 4FV6A 4BICA 1BMKA 3QCSA 2QOBA 3AG9A 4IIRA 4C58A 4I21A 2PUNA 3COIA 4CGAA 2XP2A 2VZ6A 2VWVA 2RFEA 4IAFA 3R7VA 3ZBFA 5T3QA 2R3HA 3U9NA 5EQYA 5A4CA 5CSXA 3GC9A 3MPMA 4BL1A 3EWHA 5M4IA 4XRJA 4P2KA 2QLQA 4FV2A 4QMVA 2XIKA 4ZS4A 1XBBA 3V01A 4E6AA 1VEBA 5CALA 4EK8A 3GFEA 4O1PA 3BGZA 4HPTE 4DG3E 3L9LA 1STCE 2UW9A 3WIGA 4AGWA 5DRBA 1Q8ZA 2A19B 3C13A 4PNKA 3EZRA 2Y4IB 4H36A 4TZRA 5GIOE 4DH5A 4BKZA 3ZO4A 2QOQA 5AP4A 2YJSA 2VUWA 2UZDA 4D9TA 3QYZA 5AX3A 3NNXA 1CKIA 3DKGA 1WBPA 2OXDA 3FZTA 4WT6A 4DGGA 3LCSA 5EI2A 1ZMVA 2P2HA 3F88A 4RJ8A 3FWQA 4XBUA 4ACCA 4H3PA 2XUUA 3NUNA 5EW3A 5CF5A 4IDVA 4NIFA 2B54A 1ZOEA 4YLKA 4QP7A 3PIYA 3ULIA 4XG2A 4IE9A 4OTRA 4FSMA 4QTAA 3TNIA 2VWZA 5JRSA 4RFMA 2BZIB 4FEXA 1GNGA 4LL5A 4XCUA 5H8BA 4MF0A 4I6FA 2J7TA 3LJ2A 3QXOA 2B9JA 5GHVA 3TNWA 4EOQA 2JEDA 5JFSA 2W1ZA 2BROA 3D5UA 3LXNA 3TV7A 3EKKA 4F09A 4O0TA 3RNYA 3LCDA 4O91A 5AIKA 5CXZA 1YVJA 3BYVA 3E3PA 4FTMA 4C8BA 4WA9A 4JG7A 4LOQA 4PUZA 3CKXA 2C3JA 1AQ1A 2X7FA 4YTHA 3HV4A 2OK1A 3UDBA 4AGUA 1XBAA 4FV0A 4O2PA 4W9WA 3C5UA 4BZDA 2V55A 3VULA 3EN6A 4ENXA 3KRWA 4J95A 4O0VA 3GNIB 4YO6A 4O7RA 4BCIA 3NCGA 2PMLX 5HU3A 3UQFA 4P90A 2XJ2A 2PE2A 3UIMA 4CFWA 3TEIA 3CTQA 5J7HA 5DE2A 4ZJIA 2X9EA 3CR0A 3HZTA 4F4PA 4YR8A 4DYMA 3NNVA 3PXKA 4FV7A 4HW7A 2XA4A 2UW6A 3FMHA 4IJPA 4X3FA 4KBKA 3IGGA 4O7ZA 5I3RA 1A06A 4WOVA 3VHEA 4L01A 4KWPA 2BCJA 2QLUA 4LMUA 4ZY4A 3RCJA 5C8MA 4LRJA 4RZWA 5CZIA 4F63A 3ENHA 3UO5A 4EH9A 4Q9ZA 4NU1A 3E3BX 2HXQA 3QGWA 2QR7A 3DBEA 4EZ5A 3SW4A 3WF5A 4KNBA 3VBWA 2X39A 4A4XA 1AD5A 1DI9A 3NR9A 4WG5A 5GJFA 3BV3A 2PL0A 2QC6A 3DJ7A 3BZ3A 3SXRA 3LZBA 5T6KA 4AT3A 1BUHA 3ZFMA 4J71A 5FXSA 1PYXA 3C5IA 4RGJA 3R8MA 4C7TA 5L8KA 3LHJA 2OZAB 3T8OA 3BWJA 4M66A 3SC1A 2HAKA 4HCTA 4C61A 4L53A 3CTJA 3SLSA 1JSVA 3C7QA 3I5NA 3ZONA 2C5OA 4FICA 4E5AX 2QOLA 5IH6A 5HQ0A 3TZ7A 2EB2A 4YJNA 4C3PA 3P4KA 2WEIA 4AZSA 1UWJA 2EXCX 3MH0A 2WIPA 5CU0A 2QI8A 4GL9A 3QC4A 4L3JA 2J2IB 1RW8A 4KIOA 1H8FA 2OW3A 4DEGA 4IW0A 5IA0A 3ORIA 3GQIA 1E1VA 3CJGA 3DGKA 3ZEWA 3PIZA 2GHMA 5E8VA 1JWHA 3ENMA 2B52A 3F66A 4ITIA 1J91A 1SMHA 2EXMA 2VTIA 4IWDA 3UP2A 2OIBA 3BEGA 3E92A 3ZC5A 4BTMA 5DRDA 5KO1A 4ZIMA 1PXMA 3AOXA 5L2TA 3LMHA 4D2VA 4D4SA 4EK4A 2HIWA 1YHWA 2P3GX 2Y9QA 2YERA 2QHNA 3ZUUA 5IEXA 4FVQA 2GS6A 2YAAA 4BDEA 4BTJA 4FTLA 4AZFA 4E8AA 4EH8A 5LCJA 3P86A 4C4EA 1KE8A 5H3QA 4XG3A 5L2QA 3TWJA 4AE9A 3S00A 1VJYA 4CZYB 3AGMA 4I6HA 4CKIA 1APME 1DAWA 2J4ZA 4MXAA 2JAVA 2YM5A 3FLZA 2HCKA 5CU2A 4D2WA 1IAHA 4P4CA 3U6JA 4TL0A 4ZS0A 4DLJA 3DDQA 1FVRA 4NIFB 5DT0A 4NYEA 1Z57A 3Q3BA 2OXYA 4DEBA 5CEIA 3DB8A 5ETFA 5E9EA 4X3JA 4GYIA 4EORA 4FIGA 4F0FA 2QOCA 3RBWA 4K18A 4UWCA 4W4YA 4CTBA 1SVGA 3KRRA 4G6LA 4QMXA 2Y0AA 3NZ0A 3PLSA 4AAAA 1M2PA 2GFSA 4XOYA 2J0IA 1ZMWA 5ANDA 5K0XA 3IECA 4GK4A 3P5KA 2HZIA 3KRXA 3PXFA 4MQ2A 4MH7A 4Z9LA 3TXOA 4RC4A 2ZOQA 3Q96A 3DK6A 4Y46A 5HIDA 4I0TA 2ITOA 3PSCA 3TV6A 2JFMA 3L8VA 3JXWA 4FSYA 1IASA 4GFMA 1UU8A 5CVHA 5LXMA 5L4QA 5EDQA 1H28A 1YDRE 3G33A 2X4ZA 4PPAA 4QQJA 2CKQA 5FD2A 4F0GA 3TUBA 3VBVA 2I0VA 4F1TA 1J7UA 3D5WA 5DPVA 1PMNA 1K9AA 3QALE 2XH5A 3TJCA 3QFVA 5LVOA 5AP6A 3MYGA 3FV8A 2C1AA 3MY0A 3QAME 4I20A 2CNQA 5K5XA 4JIKA 1DAYA 1U4DA 2GCDA 3VS3A 4D2TA 3P78A 2ZJWA 3A99A 4OTDA 4BDDA 3RPYA 3FMEA 1F3MC 2G9XA 2W1FA 3LM5A 3E87A 3OD6X 4CD0A 4KB8A 4YTFA 5DHJA 4IBMA 4CRLA 4Y73A 3GCVA 1JBPE 3HNGA 2G2HA 2UW8A 3GI3A 2O5KA 3MIYA 4XS2A 4A9YA 1XWSA 3F6XA 3IG7A 3KKVA 3V5QA 3SGCA 2OWBA 3QKMA 4YLLA 3VNTA 2VWWA 4YJOA 4Q5HA 1FVVA 4UMTA 5FG8A 4HJOA 4CFVA 3KB7A 4ZZNA 4ARKA 4UALA 4LGHA 3DU8A 3BGPA 4IWOA 4BKJA 2ERZE 1YOMA 4DFZE 3MDYA 4EH3A 2ESMA 1JVPP 3HGKA 3R1NA 1LUFA 4PDOA 4B6LA 4BDGA 3OT8A 3LLTA 4PMSA 2XZSA 1PMUA 3CGOA 4RX8A 3BU6A 3Q4UA 2F2CB 2X1NA 4ZTMA 3DZQA 2Z7RA 3RAWA 4PTCA 3WILA 1OECA 3PVWA 3LVPA 4RWJA 3WZUA 1XHAA 2XNGA 2VTNA 3ZFYA 4QQCA 3HMMA 4AW0A 2W17A 3JUHA 3AC2A 3F3UA 4HNIA 5IEYA 4C4FA 4FKUA 3HMNA 4IX5A 4RX9A 5AUUA 4H3QA 4A07A 3Q04A 5EYMA 4R7BA 3KVWA 4ZK5A 3DAJA 4ANQA 4Z3VA 4ZZOA 4O27B 4PV0A 2WHBA 3COHA 3TDWA 1O6KA 3D9VA 3WZEA 3UIUA 4L3PA 3H9RA 1MUOA 3R7EA 3EFWA 1QPJA 4L44A 3EN7A 2ZM4A 1M17A 2W1IA 4JR3A 3F61A 5AM7A 2DYLA 3DLSA 3W2PA 1Q24A 1FGKA 3EN5A 3ZCLA 4DG0E 4YPSA 5LMAA 4C4JA 1FBNA 2I0EA 3OOGA 3R1SA 2QQ7A 3ZO2A 4DFYA 4XG4A 4C35A 3GGFA 4BDFA 1FMKA 3ORZA 3EQBA 4QNYA 4IHPA 4AA4A 2BDJA 3BBWA 4QTBA 4AG8A 3OHTA 4O21A 4DT9A 4EQUA 3TUDA 2VWBA 2XIYA 1M7NA 3DFAA 5AADA 4K9YA 5H8EA 3HA8A 3QTXA 1YXUA 5BVOA 5ICPA 3K3JA 4IFCA 5J95A 5EOLA 3W2QA 4DCAA 3VUGA 4WO5A 1QPEA 1PMEA 4YZBA 4ZSLA 5I9XA 4UZDA 4QP9A 4ZSJA 3R9HA 5I4NA 3R9RA 3C9WA 4HYUA 5AR4A 4LFIA 4FR4A 3CD8A 4JL9A 1MRVA 4C33A 4MX9A 2NPQA 1H25A 3FMMA 3VWAA 5TT7A 5BVNA 5M44A 5AIRA 2ZVAA 4PP7A 4UN0C 4DEHA 4N6YA 3MN3A 3Q9ZA 5BVEA 4Z55A 4FIJA 3HV7A 2W1CA 3QL8A 3QKKA 3PSBA 2ONLC 3S4QA 3UMWA 4APPA 1S9IA 4F08A 2W1DA 3QX4A 3FY2A 1YKRA 2AC3A 1WBTA 4MNEA 4NFMA 5DYJA 4L7SA 2VTPA 2FVDA 2W5AA 4DBNA 3VS7A 3UOHA 2R3NA 4KD1A 4MBIA 1W0XC 5A6NA 3I81A 4AZVA 4QTEA 3DBFA 3NVMB 3CE3A 1OIYA 4IMYA 5CZHA 4NT4A 3FPMA 5IISA 2QKRA 2PVYA 2EU9A 2X2MA 1PMVA 3M1SA 2C4GA 4L3LA 4ZSEA 4EWHA 3A7FA 1VR2A 2YLEA 4DFLA 5FBOA 4O7TA 5CNNA 4NJ3A 3D5VA 4YPDA 5C1QB 3EYGA 3IK3A 2BALA 3LFBA 3SW7A 2WTKB 1G8SA 4CFFA 4EQMA 5EM7A 2XVDA 3O8PA 2KTYA 4ANLA 3ZU7A 3VVHA 1RDQE 3QYWA 1ZOGA 1JOWB 1H1PA 3PY3A 4A9UA 1F0QA 3AD6A 3SG9A 3DKFA 5HE3A 5E4HA 4BWKA 3II5A 3KREA 3SD0A 3TNQB 3F3VA 3OP5A 4F9BA 1GZ8A 3FQHA 4IQ6A 4QO9A 3ULZA 4WRGA 4FEQA 1G5SA 4HVSA 4OBPA 3WOWA 4JJRA 4QRCA 5GZ9A 3VS4A 5FXRA 4ITJA 2UW4A 4DINA 3ORTA 3HRFA 5M4FA 5A4TA 3FLSA 3P08A 3SXFA 2Y6OA 3HUBA 3UNJA 3OWPA 4S34A 2HY0A 2PVNA 3G6HA 1Q62A 4YC8A 2ZB0A 5CASA 4QMNA 2B9FA 2PVJA 3LXLA 4EOLA 3SDJA 2PU8A 4M15A 3PFQA 4E5WA 4IEBA 2UZOA 2WMAA 3ELJA 4RT7A 3FZ1A 1PF8A 3CGFA 2BRMA 4FMQA 3UIXA 4AZTA 3F3WA 4ZJJA 3GB2A 5E8XA 4IDTA 2GU8A 1H08A 3FKOA 4APCA 4CG9A 4OBOA 3VBYA 5HX8A 1T46A 3RAHA 3I1AA 4CFMA 3FI8A 4QMUA 4ACHA 4FTJA 1GIJA 5BVFA 5CT7A 5JN2A 4I4FA 5J1WA 2HZ4A 2VX1A 5EM8A 2A0CX 3HDNA 3LFFA 5ETIA 5AV1A 5KMMA 2OIDA 2CKOA 2PTKA 1OL1A 4O6LA 2GHGA 4C38A 4M14A 4BBEA 3KRJA 2VTSA 3E88A 4JRVA 4FTKA 4YC6A 1BLXA 4U44A 4BR3A 3UJGA 4ACMA 3E8NA 2CJMA 1PHKA 5JRQA 2BPMA 4E20A 4DA5A 3KXGA 2UZTA 3UYTA 2R64A 4BRXA 2VNWA 3QZGA 3TTJA 5HG5A 4AT5A 4FG8A 1KV2A 2OU7A 4PDSA 5C27A 4M3QA 4XV2A 3UPZA 2V5QA 5ANKA 5CSHA 3R01A 3ZSGA 3SQQA 5ACKA 3TT0A 3TZ8A 3UGCA 4UZHA 3PJ8A 4JI9A 4O7VA 3FEGA 3LCKA 4PDPA 3AC1A 4NH1A 3N4VA 1KWPA 1REKA 3OY3A 3GC8A 3RPVA 4FSUA 4FKQA 3QQUA 4EZ7A 2BDFA 4NSTA 1FINA 5DR6A 3EJ1A 4QMYA 2OFUA 2QO9A 2HK5A 2UZUE 3EZVA 1CDKA 2YIQA 5TKDA 4PMTA 4F1MA 4LOPA 2A2AA 2RIOA 3LQ8A 5LVLA 4QYHA 5B2LA 1EH4A 3VIDA 5CAPA 3E7VA 4MTAA 4XLIA 3OEZA 5HLNA 1IRKA 1J1CA 1GY3A 4GW8A 4DF3A 3ZSIA 1UU9A 4DH7A 2C5NA 3QQGA 4C02A 4J96A 5AFVA 1U54A 1Q41A 5H2UA 4L68A 2QR8A 2UVYA 5EHOA 5D7AA 5HBEA 5JGDA 3QWKA 3W2OA 4QQTA 3U4UA 2WAJA 1J7LA 2CN5A 3NLBA 4LUDA 4FK3A 3F5XA 2WGJA 4TKSA 3QD4A 5HG9A 5BVDA 1B38A 3G9NA 5K9IA 1MRUA 3PWDA 4PTEA 4RIYB 4FL3A 4NTSA 5KMJA 4J98A 1WCCA 4X2FA 3I0OA 3FXXA 4J7BA 2JIVA 2OJJA 1WBSA 2FSMX 1SVEA 3DTWA 3E7OA 3PVGA 4ITHA 5HIBA 4GU6A 4MKCA 3UG1A 3MESA 3QF9A 2I7QA 1JSUA 3VJNA 4BDJA 3KF4A 1Q8TA 5DOSA 3A7JA 3GU4A 5ACBC 1FQ1B 3FHRA 3R6XA 3TNPC 2WMVA 2UW5A 3LAUA 2AYPA 4PWNA 4QMTA 3G9LX 3TCPA 2QG5A 4U80A 3E8DA 3GBZA 4RA4A 5JSMA 3S2PA 3KXXA 4HGTA 4A9RA 4IANA 4J97A 1H1RA 1YQJA 2C6OA 3R7IA 4EH2A 2HZ0A 2YN8A 4WHZA 2R3IA 4GT3A 4HOKA 4L42A 3V51A 4O81A 5A54A 1XH9A 4FOBA 4AACA 3OVVA 3DJ5A 4O0XA 1WZYA 2P55A 2XRUA 5I9UA 4GRBA 3ZMMA 2RG5A 1B39A 4JIAA 4RJ4A 3KCFA 4N6ZA 3RI1A 2F9GA 5DR2A 4BIDA 5I9VA 3ATSA 3QHRA 2YZLA 2HWPA 5HICA 4ASEA 4W8DA 4BN1A 5CXHA 4RMZA 3R9NA 3NMUF 2NP8A 1R39A 5H9BA 3Q5ZA 3BU5A 1Q99A 2WOUA 3I79A 1RQQA 5EYCA 4LV5A 5FEQA 4R7IA 5L2IA 3NRMA 5CX9A 5EK7A 4RVMA 3T3UA 1YWRA 5A4QA 5A14A 1XKKA 5K4JA 4AT4A 2PWLA 3ITZA 5IG1A 4QP2A 4WD5A 3RPOA 4PQNA 3WIKA 2WTVA 2YIRA 3Q4CA 4FTAA 4JQ8A 2R4BA 5CEOA 2UZWE 5FEEA 3KULA 3TV4A 1Y6AA 3H9FA 4L7FA 4EUTA 2VX3A 4YSMA 1FVTA 3BWFA 3FI4A 3KEXA 4HVGA 2IW8A 4C4GA 4FTTA 3OW4A 2W4JA 3GU7A 3P23A 4IB0A 2R3LA 3LW0A 4GV1A 4PMMA 4PTGA 5I5ZA 5JKGA 2JIIA 1PXJA 2VO7A 5EOBA 1LPUA 3D2IA 4AGDA 4EI4A 3F2RA 4XNEA 2YABA 2JIUA 1BYGA 4M68A 3OMVA 1G8AA 5AP7A 3MIAA 3QD3A 5EHLA 3FMNA 2WMTA 5KHWA 4JBOA 4D5HA 3GC0A 4Y85A 1FGIA 5HIEA 4ZOGA 3NAYA 3W2CA 3MB7A 4R3PA 4L43A 2XB7A 4EOMA 1OPLA 5L8LA 3ZLWA 4MXZA 3VW6A 4D1ZA 5IDNA 2JKMA 3HYHA 2R3KA 3LCTA 4RX5A 3FPQA 3TI1A 2QOHA 4IXPA 4YURA 3D83A 4UMRA 2ZV7A 4I6QA 5KMKA 4AU8A 4FNYA 3Q9WA 4LGDA 4U79A 5D41A 4EL9A 2OI4X 4IH8A 2UUEA 2JKKA 4YZCA 4GKHA 3BPRA 1ZY5A 3SV0A 2X2KA 2BKKA 2ERKA 3HAMA 3KL8A 2A27A 5F95A 1QL6A 2CCIA 2W1GA 3F5GA 4N70A 5F94A 3W2SA 2BKZA 2GNHA 4CKJA 4IB3A 3OBGA 4B8LA 2YM8A 2B9HA 3EHAA 4HGLA 5CTPA 4FTUA 1ZYDA 4E4LA 2BTSA 3DK3A 5G1XA 1JKLA 2J5EA 5C8KA 1WBVA 3E62A 4FSWA 2UVZA 3MFUA 4G34A 4O0RA 4BCJA 4DGMA 3VS5A 5HBJA 4WSYA 4IAKA 3I6WA 1M52A 4GIIA 5CF8A 3CBLA 4R5SA 3DTCA 3OCSA 3VS0A 2VWUA 5IA1A 4GIHA 3U87A 2G2IA 4AOJA 2H34A 2BUJA 4FKWA 4TY1A 4HCUA 2C3KA 5GNKA 1YHSA 4FG7A 4X7QA 3JPVA 3V5PA 4KA3A 4TWOA 4X2GA 3NWWA 4ALWA 2BDWA 4F7SA 1OBDA 4EH4A 3RP9A 4MK0A 2J0JA 3R22A 4DGOA 5I9WA 3OG7A 2WMSA 1P4OA 4W8EA 4PF4A 3MH3A 5D12A 3R30A 3O7LD 3IO7A 3CY3A 4MYGA 4MBJA 4BZNA 5GZ8A 3NVKI 3PUPA 4D2PA 2W5HA 4QTDA 2C6DA 3DY7A 4ANMA 5HHWA 3W8QA 4AW1A 2PE1A 4QMPA 4G9CA 5J1VA 4QP1A 5IQAA 3DNEA 3BQRA 3RHKA 1ZZLA 3WE8A 2ITTA 4FT7A 4OTWA 3CPCA 4DFUA 3FSKA 1OGUA 4D1XA 1Q4LA 4KKHA 4KRCA 2XNEA 2VTOA 3MSSA 4KIKB 4X2NA 1XO2B 4X2JA 5IQCA 4NCTC 4NKSA 3A4PA 1H0VA 1JKTA 4I94A 4R8QA 4U5JA 3W33A 4PPBA 4F9AA 2OF4A 3L9MA 3DDPA 3GOPA 3C0HA 5ANJA 5HNBA 2GTNA 2ZV2A 3LIJA 2BMCA 4XH6A 4DFXE 2I1MA 4FV8A 3D7TA 3KF7A 5DBXA 1KUTA 4IZAA 2AUHA 4FKGA 4CMUA 5E91A 3U4WA 4BCQA 4YBKA 4F1OA 5A4EA 3KULB 4CQGA 3OS3A 4TYGA 3BX5A 4GYGA 2VTHA 4FODA 5HVJA 1GZKA 4HZRA 5IQIA 1GOLA 4U6RA 3AMYA 3Q6UA 2DWBA 2PVFA 4EOPA 3NW6A 5A46A 3IW4A 5HG8A 4M67A 4FSNA 4IAIA 4EYJA 5D7VA 5HGIA 4RC2A 5F1ZA 4IZ7A 3UQCA 3K2LA 2WQOA 5TR6A 5J7BA 3FMKA 5JZNA 5C03A 4BZOA 5C4KA 3OUKA 3P1AA 4C2VA 3P9JA 1GAGA 2WB8A 3PDTA 2O3PA 3SXSA 5KMOA 4PL4A 4YJUA 3HMIA 4TYHA 4F99A 3LMIA 4GT5A 2Z7QA 3I4BA 1KOAA 3MVJA 3O96A 4XG7A 5HG7A 3HAVA 2RG6A 4BDBA 3RWQA 4DITA 3AC3A 1UA2A 3BKBA 3GC7A 4FTIA 4FEVA 4Z16A 4FUYA 3NDMA 4R3RA 1JSTA 3WE4A 5CQWA 2FB8A 3OUNB 3MTLA 2P4IA 3KGAA 4W4VA 4BBFA 1H01A 4AX8A 3PYYA 2E2BA 4BTKA 3BGQA 4FSRA 2UZEA 4ID7A 4DE4A 2ACXA 4FSQA 5CENA 1Y57A 4U45A 4DEIA 5JK3A 1SNUA 2YCSA 1CSNA 1O6YA 1OMWA 2XRWA 3COKA 3PZEA 4RLLA 4R7HA 5FUTA 5LCKA 5C26A 5L2SA 2RL5A 3G90X 4MBLA 4TTHB 4ZTHA 2XMYA 3ZDIA 5I0BA 4YJPA 3UO4A 3HV3A 4IAZA 4J8NA 4V04A 3RKBA 3V8SA 2KULA 4F6WA 3I0QA 4FKPA 4F9WA 3OFMA 4L6QA 2YFXA 3O0GA 3R83A 4HVDA 1YOLA 1J3HA 4ANSA 2QG7A 3UZPA 4E5BA 4UMUA 5AUTA 2ZYBA 4G3EA 2NO3A 4TN6A 2Z02A 5AV2A 3E8CA 2WTWA 4Q5EA 5D1JA 3PZHA 3QLGA 5M57A 1JKSA 3GU8A 4DFNA 5HNGA 3QUPA 2FSTX 3IDBA 5LVNA 4EJ7A 4ANNA 1YXTA 4K1BA 3ORPA 2YAKA 2JD5A 2ITQA 3EN9A 3QBNA 4ZLYA 3QGYA 2WFYA 1XBCA 2QO7A 4JDKA 3BEAA 3IONA 5AR8A 5DLSA 4ZJVA 5JGBA 3DNDA 1OB3A 4AE6A 4D4YA 4K11A 4WBBB 3TNHA 3GU6A 4G3CA 2UZNA 4H58A 4WG3A 2GFCA 2OJIA 2XIXA 1YDSE 2I6LA 4MWIA 4CTCA 2V0DA 3FMLA 3DLZA 3MPTA 4WNMA 4GVAA 1H24A 4FV4A 3R02A 5HE0A 4II5A 5ANEA 3MB6A 4RLKA 5I9ZA 5DEWA 2CGWA 4USEA 1V0PA 4W9XA 3LFNA 4D55A 2VV9A 3F2NA 3PXRA 3R21A 2YM7A 2YCRA 4RA5A 5HE1A 3RZFA 4AZWA 4U0IA 5KNJA 4LGGA 4UWYA 5DEYA 4AN9A 2BAQA 2FA2A 4B4LA 4Y72A 1M2QA 3DS6A 3QQLA 4OLIA 5J5SA 1NA7A 1PRYA 2O8YA 3N51A 3MJ1A 3UO6A 3G6GA 2GS2A 2NRYA 2DUVA 3CD3A 2CN8A 1ZLTA 1XH5A 2SRCA 1OPJA 3OWKA 3Q4ZA 2C47A 4UWBA 3I5ZA 4RQVA 5AA9A 3PJ1A 5KBQA 3I6UA 1ERKA 3ORNA 1GIHA 4AXAA 3D7TB 2HY81 3ID6C 4WRSA 3RM6A 2E9NA 3GUBA 4L00A 5BVWA 2QKWB 4Y5HA 4YJQA 3UQGA 2WU7A 5JT2A 4BDKA 2BZJA 2CNVA 4BY9E 4G2FA 3NUXA 3GP0A 2REIA 3TZ9A 3PWYA 4BVUA 3D7ZA 4DCEA 5JFXA 3VS2A 3CQUA 2BILB 3PXQA 3ACJA 2B0QA 1H4LA 5J79A 5I9YA 3EIDA 4BTFA 5IQDA 3MTFA 1J1BA 3QZIA 4TYEA 4KKEA 2ZAZA 2A4LA 2PPQA 1ZZ2A 1E1XA 3PG3A 3U6IA 2I0HA 1OUKA 3CQEA 5KBRA 3D4QA 4MXCA 4EEVA 2IZTA 3NYXA 5DA3A 2WELA 4TYHB 3QXPA 4U43A 4AGCA 4FK6A 4GK3A 5AUZA 4JG6A 2Q83A 4JAJA 4D0XA 2CLQA 2XK9A 2J51A 3F3ZA 3LXKA 4XLVA 5L6PA 5CF6A 2YISA 4NCTA 4RJ7A 1QMZA 3A62A 3R1YA 1ZYJA 4EOJA 2PVLA 4FI1A 5HE2A 2EB3A 3T3VA 4I41A 4B8MA 4FEWA 3ALOA 4FZAB 4ENYA 4X3FB 3FKLA 5E92A 3ZLYA 4ZY5A 3BCEA 2XNNA 3HA6A 4I5PA 3Q60A 4JR7A 3IQ7A 4Z7HA 1UWHA 4BGGA 3Q52A 3OC1A 4RRVA 2F4JA 3WARA 4CSVA 3G15A 1WBWA 5KKRB 5BYZA 5FEDA 2YM4A 4TWPA 3EFLA 5KMNA 5I3OA 4C3RA 4D2RA 1XH4A 1W82A 2BVAA 4DEEA 4XYFA 2X6EA 5E8UA 1WFCA 4O38A 2RFSA 4EHEA 2ZDUA 2YCFA 4G3DA 4OW8A 4AW2A 5CT0A 3ZZWA 5J5TA 4AQCA 5E8ZA 2XK8A 3FZPA 1PKDA 4JT3A 3LM0A 5DNRA 5TO8A 2YZAA 4C4HA 3VUHA 4CNHA 2X8IA 4ANOA 1P14A 3QWJA 1X8BA 4V0GA 4X6RA 4AF3A 2XEYA 5K5NA 2ZB1A 1PXNA 3MPAA 4JLCA 3NCZA 1GZNA 2YA9A 3A7IA 4JDJA 4X0MA 4XOZA 4A4LA 4CG8A 1QCFA 1LP4A 1ZOHA 4QMLA 4B0GA 4O2ZA 5EI6A 5F9EA 3NYVA 3BHUA 1V1KA 2CGUA 2CGXA 2XNMA 2R3FA 5CVGA 3SKCA 5IQFA 2WOTA 3PVUA 3QQJA 3VAPA 3PP0A 4O84A 5AJQA 4NWMA 4U3ZA 4R1YA 4B7TA 2Y7JA 2HXLA 4MAOA 2X7OA 4XEYA 2C1BA 5DGZA 2HW6A 1I09A 5BPYA 1V0OA 2R3MA 3W18A 4MEDA 3H10A 3ZBXA 4EBVA 4JBPA 4FKJA 1TQIA 1BKXA 3AT4A 4ZAUA 4FZDB 3U9CA 2WTDA 5JEBA 3UZTA 5DWRA 4FT9A 4TT7A 2WXVA 4O96A 4ZXTA 4JBQA 4CLIA 4NKAA 4MXYA 1OKWA 4FL1A 4JDIA 4KS7A 5AP2A 2VTLA 2X6DA 5BYLA 2WNTA 4O86A 5HEZA 5LMKC 4YGAA 5CANA 2B53A 4V01A 4YUQA 1XJDA 4FKOA 5DVRA 3QTQA 3EMGA 4PMPA 4DC2A 2R7BA 4EUUA 2XNBA 3P7AA 2R3RA 5ETAA 5B2MA 3TN8A 5HLWA 2H8HA 3GENA 1OI9A 2WIHA 3W2RA 3AMAA 4FKTA 3JY0A 3NIZA 4H39A 3D15A 3GVUA 3LE6A 3PRFA 3B8QA 3GT8A 4L45A 4LYNA 4OBQA 4ASZA 3GFWA 3LQ3A 3EFJA 3LFEA 4BCOA 3SG8A 1OL5A 3FJQE 4GEOA 2PUPA 2J5FA 2JBOA 3C0IA 3HP5A 3R63A 4MVFA 5IQGA 2F7ZE 4NK9A 2XF0A 3LFQA 3VRYA 3ZLSA 2CMWA 2Y6MA 4RFZA 3PXYA 4EHGA 3PIXA 3OOMA 3EQPA 3R7YA 2JDVA 2BRBA 2OJGA 3F69A 4QTCA 3BBTB 4ACDA 3D94A 3UOJA 2CDZA 3N4TA 3ANQA 3P0MA 4TXCA 4CVAA 4U81A 4R77A 3ZXZA 4FT5A 2HELA 1QPCA 5CQUA 4HVIA 3S0OA 3BYOA 4CCBA 2IG7A 3I7CA 4QP3A 1TQMA 4N4SA 1ZYSA 4YC3A 4F7LA 4WKQA 5BX0A 4BIEA 3S1HA 3OEFX 4FGRA 2JITA 3MVHA 2IWIA 2DS1A 1R78A 4F7NA 1TVOA 2VN9A 2CKEA 5GJGA 2UZVA 5EH0A 3ET7A 2YIYA 3KK8A 2OXXA 4FIIA 3FMDA 3QQFA 4EH7A 2EWAA 5AM6A 2JDSA 4RJ3A 2VTQA 2YJRA 3IGOA 4C36A 1WVYA 4NW6A 3BYUA 3U51A 4BCFA 3R0TA 4DTBA 5IMXA 4FV9A 5BNJA 1YXXA 3H9OA 1MP8A 3VUKA 2BHEA 5M08A 4UV0A 5HNIX 2JKQA 2PYWA 4FBXA 3FQSA 3JYAA 4IZYA 5FBNC 4MD8E 3Q9YA 4QOXA 3PA3A 4UEUA 3ORXA 3RMFA 3UVRA 3UVPA 3KMMA 3FL4A 3R8ZA 1B6CB 4IAAA 5IZFA 1PKGA 4RG0A 4O82A 4O83A 2GQRA 2WTCA 3Q2JA 3NGAA 4L9IA 5HTBA 4CYJA 3GCQA 3QZFA 4JBVA 4BWXA 1Y8GA 4U40A 3QHWA 2RFDA 2RSVA 2XS0A 4D28A 3TDVA 4BC6A 4DTAA 2PK9A 2ETRA 3A61A 4GG7A 2JC6A 2PE0A 2YDJA 1UVRA 3EB0A 5AA8A 2C6TA 4EBWA 3UE4A 5IMEA 4TNBA 4YHTA 5FXQA 1LEZA 4E1ZA 3FZOA 5HD7A 2R0UA 3KXZA 4BDAA 1JNKA 3VRZA 4FF8A 4GK2A 4MQ1A 4IFGA 4YNEA 3ZXTA 3LKMA 3QKLA 4C62A 3MVMA 4YZ9A 4DEDA 2WZJA 1YI6A 3ZDUA 2PUIA 3V5JA 1Q61A 2QU5A 4YJRA 1YWNA 1I44A 5KZ0A 2VX0A 4RWLA 2X81A 3KXNA 4F7JA 4O7SA 5ANOA 2W9ZB 4WBOA 4IADA 4J1RA 3EQFA 4KKGA 2LAVA 1UNLA 2R5TA 5FTQA 5CF4A 1O6LA 5M51A 4FZ6A 2IVVA 5IUGA 3KCKA 4I1ZA 1CM8A 3IS5A 3UOLA 4FTQA 4O22A 4E4NA 5C01A 3EQIA 3R7OA 1OM1A 2XJ0A 2XJ1A 4D2SA 5M07A 1OL7A 2W4KA 3KQ7A 4FYOA 2XK4A 2UV2A 3AMBA 3CJFA 3V5WA 5EG3A 2QONA 4WUAA 5L3AA 3V3VA 4GSBA 3VS1A 4QMWA 2JDRA 3MW1A 2O63A 4AUAA 3FE3A 4K6ZA 3ZUTA 2ITWA 2X4FA 4USFA 4JS8A 3VJOA 5C4LA 2R3JA 3HMOA 3DJ6A 4IVBA 5JGAA 3MVLA 2FSOX 4KSPA 4OT6A 2ITPA 3NIEA 4X2KA 5CSWA 3FUPA 5C8NA 3O7LB 3DBDA 3RAKA 4LOOA 5IQEA 4LQMA 4NM5A 1GJOA 4HVHA 4ASXA 2H6DA 4EHZA 4ZLOA 2V7AA 4MNEB 5H8GA 4B99A 4U41A 3ODZX 1HCKA 5M53A 2ZDTA 2OKRA 1OL2A 4IM2A 3UBDA 4J52A 3IDCA 1H1SA 4K2RA 1YW2A 4FNXA 4LI5A 5M56A 3UC3A 1QPDA 4AWIA 5LMKA 5HVYA 4U3YA 5KMIA 2ETKA 3KN6A 2XK6A 3QTSA 4ZTNA 3W10A 3EQCA 3W8LA 4U9AA 3WZKA 5M55A 3VS6A 4OAUC 2WU6A 1YI3A 5C9CA 4BCGA 4IX4A 3O8TA 1W8CA 2VTJA 3C50A 3O71A 4FT0A 4FTOA 3GOKA 2QU6A 3UP7A 3QC9A 4S33A 3SX9A 1UV5A 4ZLZA 1ZYCA 4XUFA 2QOFA 3OXZA 4YZMA 2C6KA 2IVUA 5EDRA 2WD1A 4MD7E 4NJDA 3RVGA 3V6SA 1ZY4A 2OSCA 5EQEA 5EYKA 1Z5MA 4FTRA 3EL7A 2CKPA 3BU3A 5LJJA 5CLPA 5HO7A 5KCVA 2ONLA 4RVLA 1PXIA 4GFGA 3WF6A 5DMZA 4R78A 3GEQA 2CGVA 4OTHA 5E7RA 4LG4A 4BI0A 5J9LA 5D10A 4DTKA 4XG6A 4QQ5A 5CVFA 4IZ5A 3MFSA 2PZ5A 4A9TA 3ZLXA 4O7NA 1RJBA 3FL5A 4JDHA 2PHKA 2GNLA 4OGRA 4AP7A 4BI1A 4EHVA 4S2ZA 4EK6A 5HTCA 2FO0A 4RZVA 4OTFA 4U97A 3ZSHA 3ZYAA 5IPJA 4BCHA 4I5MA 5E8TA 2E9PA 3V6RA 3ROCA 2BAKA 3IW6A 3BLHA 3KRLA 4HPUE 3A8XA 4U7ZA 3GCSA 4FIHA 2C3LA 3UG2A 3DXPA 1H1QA 2Z8CA 5EM5A 4O6EA 1SZMA 3RGFA 3HRBA 3MWUA 4I24A 3LFSA 4ZZMA 3GCPA 4QP4A 3UNKA 4I23A 4YZDA 5KX8A 4R3CA 5JH6A 3QRIA 5DH3A 4EOSA 3MFRA 3SRVA 4W4XA 3QUEA 2JDOA 4G16A 5K4IA 4I6BA 4ORKA 4FT3A 3OY1A 2WTIA 3R00A 3R7UA 3TIZA 3DT1A 1P2AA 4C57A 4EC9A 3D5XA 3MH2A 5AP5A 3RWPA 4G3GA 1R0PA 4ONAA 2R0IA 1W98A 2QO2A 4UYAA 4ALUA 5HCZA 1OIRA 5HO6A 3ORKA 4LM5A 4BF2A 2XYNA 3NUPA 5M06A 4GUEA 4BDHA 3EQRA 2H9VA 3TJDA 3QA8A 2UW0A 5E1SA 3V5LA 4F64A 2XIRA 3L8PA 1U5RA 3HECA 4LMNA 4CT1A 2BAJA 3LPBA 2C30A 4GKIA 4GU9A 2BZKB 4IACA 2X8DA 4FKVA 2W5BA 3QTZA 2VWIA 5IU2A 1M7QA 4NFNA 4XG9A 3SOAA 5TF9A 3UVQA 4DG2E 3AXWA 3MA3A 3TM0A 3ZH8A 4BFMA 1KV1A 3P7BA 2VGPA 4M84A 4XX9A 4IM0A 3R8PA 1A9UA 1JQHA 1ATPE 4FC0A 5BVKA 3BLQA 2VTTA 1WVXA 4NUSA 4BKYA 1UKHA 2VNYA 3C4XA 4FKSA 5AR2A 4I22A 3LJ0A 4UBAA 3VF8A 1U54B 2YEXA 3HDMA 2BTRA 4Q2AA 1P5EA 3UNZA 1Y6BA 4JX7A 5GIPE 3HKOA 4L8MA 3QCXA 1PY5A 5EM6A 4JX3A 3H3CA 2Z7LA 3VW8A 5BQ0A 5ETCA 1JAMA 4FZFB 3PJ3A 2WQEA 1TKIA 1OIQA 1Z9XA 4ZP5A 3Q53A 3GXLA 1NY3A 5LWNA 3EKNA 2YM3A 2GNJA 3FXZA 4M69A 4BDCA 2NNWB 4DHFA 3IKAA 1Q5KA 3BELA 3M2WA 3RPSA 2W9FB 3BHTA 4YBJA 2VU3A 1YXSA 3NYNA 3VQHA 3W55A 4AS0A 1IAJA 4KBCA 2Z60A 3A2CA 5IQBA 4KBAA 3PTGA 3C4EA 1SYKA 2E9OA 5EI8A 2WQMA 3CS9A 1IA9A 3ZTXA 4QMOA 2W7XA 4A06A 5HORA 3GCUA 5FRIA 1BI7A 2RF9A 4XV3A 5JMSA 2PVKA 4O0SA 4BBMA 1ZAOA 2XK3A 3FKNA 2OZAA 1ZMUA 2C6LA 2VRXA 3ETAA 4G1WA 4YHJA 5FQDC 2P0CA 4FOCA 1ZXEA 3KFAA 3LLAA 3PPZA 2FSLX 3WYXA 2EUFB 3MH1A 3OF0A 2YDKA 4BHZA 1H00A 2BRNA 3OTVA 4TYIA 3FI3A 3LQ5A 3PJCA 3R28A 4QYEA 3DKCA 3E64A 2BIKB 2Z2WA 4OR5A 4BCPA 4YHFA 4HGSA 1Q8WA 1OUYA 4S32A 2GPHA 2QOKA 4Y5QA 5CEQA 5A6OA 3TKHA 2OJFE 5G6VA 2XYUA 2G1TA 2Z7SA 3PPJA 3ZEPA 3TIYA 4F9CA 2V62A 2W06A 5CWZA 3EOCA 3BE9A 4CRSA 2CLXA 1CTPE 4DH3A 3VN9A 3U55A 2R3OA 2GHLA 1H1WA 2WO6A 2B4SB 3EQHA 1Y8YA 3EQGA 4FE2A 3HEGA 4NEUA 4CFUA 3SRVB 4BI2A 3L9NA 2OO8X 2UVXA 2GNFA 4X6QC 5FTOA 2C5XA 1JPAA 2B9IA 4Y8DA 2V22A 1VYWA 4EH6A 3FAAA 4E7WA 4UX9A 1BL7A 5FDXA 2IO6A 3AT2A 3ALNA 3HMPA 4IX6A 4C34A 4DGNA 3G0FA 4TPTA 1FMOE 3RINA 5HBHA 4AN2A 4UYNA 4CCUA 4JRNA 4OAVB 1WBNA 4JOAA 5DT3A 4MHAA 4S30A 3VUMA 2J0LA 3HRCA 3O8UA 4EH5A 5BMSA 2WTKC 3D0EA 3BE2A 4I0SA 5IUIA 3CXWA 2C3IB 2P2IA 4FV3A 1OPKA 2J6MA 4NM0A 2F2UA 3VBTA 1REJA 2EXEA 4GFOA 3LJ1A 1Y91A 4EWQA 3UMXA 2R7IA 3BYSA 4ANBA 5D9HA 4DH8A 3CPBA 4S31A 4XP0A 4AA5A 4N57A 4FTNA 2ITYA 2XKFA 3OCBA 3PPKA 3QU0A 4H1MA 3A60A 3EL8A 5KHXA 3SHEA 5FWKK 2W96B 4HNFA 4XHKB 3F9NA 5T68A 3HL7A 4AA0A 2GMXA 4L46A 3C1XA 5FTGA 2ZV8A 3HVCA 4PX6A 5CU4A 4RIWA 5LVPA 2W99B 2IW6A 4YU2A 3AC8A 2OLCA 4EZ3A 3BI6A 1JKKA 3DV3A 2OJ9A 1SNXA 4JG8A 1PXKA 2R3QA 4FV5A 4AZEA 3M11A 4PL3A 1O9UA 4EOKA 2BR1A 2GNIA 3BYMA 1T45A 5HCXA 4FVPA 4BWPA 2QD9A 3GQLA 3ZOSA 2W05A 4EJNA 5J87A 3C4CA 4AW5A 4IVCA 4BHNA 4E6DA 2QOOA 3IW8A 3JVRA 3HX4A 3QCYA 3QRUA 3K3IA 4RPVA 4XP3A 3LMGA 4ERWA 3UYSA 4P7EA 2IZUA 4YO4A 3RK7A 3DAKA 4YSJA 4TWNA 4D0WA 5EKNA 1AGWA 4XMOA 3LOKA 4M69B 4NM7A 4ZSGA 5BUJA 4CMOA 3DXNA 3OZ6A 4BDIA 5A9UA 4DN5A 3EN4A 4EOOA 4C3FA 4USDA 2YITA 3P79A 2H96A 4ALVA 1IG1A 2OF2A 4MF1A 4OUCA 2IVSA 2IJMA 2UW3A 1KE9A 3MS9A 2JAMA 3O50A 1S9JA 3H0YA 5J9ZA 4RWIA 1URCA 3R8VA 4F65A 3C0GA 3I60A 4RSSA 4A7CA 3I7BA 3C4ZA 2WQNA 2JKOA 3BRBA 5E8YA 4BCNA 2OH0E 2PMNX 3AT3A 4RQKA 2HW7A 2J90A 2PUUA 2XK7A 2XM9A 4YJVA 3AC4A 3CLYA 3WYYA 3R2BA 1V0BA 3O17A 4QT1A 2PMOX 3LXPA 2X9FA 2QHMA 5J8IA 3PJ2A 4YNOA 4FUXA 5AV3A 4L52A 4PDYA 2PY3A 1Q8UA 2JFLA 2PULA 4QYGA 5L2WA 4UMPA 4JQEA 3ZS5A 3F82A 1GIIA 3LFCA 3QTRA 4M0YA 2V7OA 4QPAA 2YWVA 2C68A 5M09A 3ZRLA 3E8EA 2YM6A 5E1EA 5FGKA 2ZM3A 3VBQA 3PLAE 2IPXA 3ANRA 3R8LA 4PY1A 3M42A 4GG5A 2YIXA 4W4WA 4F6SA 4KINA 3A7GA 3NUUA 4IWPA 5KUPA 4U8ZA 3CY2A 2UZBA 3TUCA 1XR1A 3FHIA 2GSFA 3UOKA 4IVDA 4QPMA 3WBLA 3MI9A 2IN6A 2XM8A 2VO3A 4TYJA 1YI4A 2PMIA 3F3TA 5DT4A 3VO3A 2ETMA 1IA8A 3QD2B 2XNPA 3RTPA 4E6QA 2XKDA 4DT8A 4M8TA 4KABA 3W32A 4PRJA 2X2LA 3F7WA 1H07A 4O0YA 2I40A 2OGVA 3KXHA 3SA0A 3QZHA 3DA6A 4ASDA 1U59A 5JFWA 4CT2A 4HZSA 1LEWA 3BV2A 2O0UA 5AX9A 4M12A 3AC5A 3O2MA 1L3RE 4R5YA 2QCSA 4K33A 2WMRA 5IA4A 4I3ZA 4MCVA 3OT3A 3R2YA 3NSZA 3VBXA 3SOCA 4CZUA 2RKUA 5KMLA 4ACGA 4HYIA 3ZUVA 3FI2A 5BYYA 4CV9A 3PP1A 3ZZEA 2UZLA 1PJKA 3BHHA 3OTUA 1HCLA 1CKJA 4G31A 4MWHA 4I92A 4BYJA 4NZWB 2YWPA 4LRMA 3RALA 2F49A 2PZPA 4BGHA 3KMWA 2XCHA 5CEMA 2WMXA 3NW5A 2GNGA 2IW9A 2R2PA 3NNUA 4RIWB 2YCQA 4QP8A 5ITAA 3BHVA 4MXOA 3QRJA 2JGZA 5IQHA 4C59A 3NUAA 2ITNA 3EH9A 1YWVA 3FLNC 5EKOA 4A9SA 3O23A 1DS5A 5B2KA 4XG8A 5EHYA 2GQGA 1MQ4A 4OTGA 4ZMEA 3G2FA 4GT4A 4F0IA 5DG5A 3DQXA 4OT5A 4X21A 4RFYA 4RIOA 4G6OA 4UXLA 5JFVA 1M2RA 4G5PA 4K0YA 3FC2A 4PNIA 3ZM4A 2VGOA 5HLPA 2HOGA 2IZSA 3IW7A 3U6HA 4FKIA 5IF1A 4BCKA 1XQZA 3F7ZA 4TWCA 3DKOA 3QQHA 5AP3A 4IWQA 4DFBA 1F5QA 5HCYA 1MRYA 3EYHA 4LL0A 3LFDA 2BFXA 3KK9A 4HYHA 3B8RA 5AV0A 1XH8A 5JQ5A 1YDTE 4M13A 4EK3A 3DK7A 3ZO1A 2BRGA 2X8EA 3RJCA 3BQCA 3ZRMA 2FGIA 1PXOA 2OICA 4GUBA 3V04A 3NUSA 2Y4PA 2ITXA 4I5HA 5CNOA 4P5QA 5CU6A 4CQEA 3QRTA 4G3FA 3H4JA 4G6NA 5IH5A 4M97A 5JZJA 3WF8A 2XNOA 3C4WA 4FEUA 5CAOA 3PA5A 4UY9A 1NVQA 4J53A 2B1PA 4Q9SA 3R9OA 4I93A 4EC8A 5CYIA 5HU9A 3F2AA 1NW1A 3VUIA 3ZO3A 2XBJA 2BHHA 2P33A 1OITA 1IR3A 2WMBA 3NUYA 2C5VA 3OROA 5IA2A 3K5UA 2AC5A 1Q97A 3OBJA 1Q3DA 3FYJX 1R3CA 4O7LA 3VUDA 2PVHA 5CI6A 3OXIA 4F70A 1H0WA 3SAYA 3GU5A 1ZYLA 5HOAA 2PZIA 2J9MA 4IJ9A 2IVTA 4J99A 3O51A 4CXAA 3CQWA 5AWMA 1UKIA 3PRIA 5AUXA 4ERKA 4ZEGA 2VTMA 4WNPA 4C4IA 4OTQA 4I5CA 3ERKA 4ZMFA 2WMQA 3AD5A 4TW9A 2O65A 4FNWA 5CU3A 4L67A 3T9IA 1RE8A 2NRUA 4YJTA 4WNOA 4PPCA 5F20A 5CAVA 3NYOA 2R9SA 3D2KA 4AFEA 2W1HA 5EFQA 4YTIA 4XBRA 4R1VA 4E6CA 5LVMA 4O0WA 3H0ZA 1DM2A 2W1EA 3DBCA 5TE0A 4BGQA 3CP9A 4NM3A 4RVKA 5DN3A 4WIHA 5LQFA 3R71A 2WKMA 4JAIA 4KSQA 4TNDA 5IEVA 4EK5A 1JLUE 3N4UA 5EDPA 4UB7A 3R7GA 5IUHA 3RHXA 1SVHA 4BIBA 2BRHA 2VTAA 3ZFXA 5JQ8A 1HOWA 1URWA 4RWKA 1W7HA 3NNWA 3Q9XA 5CSVA 1K3AA 3RZBA 4TRLA 3KMUA 2C69A 4FKRA 3PSDA 2XBAA 1NT2A 3S95A 1FPUA 4C0TA 4FX3A 3N9XA 4QYYA 4FZ7A 1BL6A 3TACA 5AP1A 2LGCA 2RFNA 3Q32A 3FZSA 3QTUA 5AP0A 2R3PA 2XIZA 5EQPA 3L8SA 1SM2A 2WQBA 5AMNA 3Q2MA 1OKYA 3KU2A 3ODYX 4K77A 2C6EA 3RAIA 1M14A 1YOJA 2JDTA 4H3BA 2F7XE 3BIZA 4ZTRA 5D11A 5TOZA 5AEPA 5LARA 2VO6A 5IA5A 4IC7A 4F9YA 1VZOA 3WF9A 4ZSAA 4RBLA 2E9VA 3PVBA 2Y4IC 4I4EA 2C0OA 4QYFA 4FSTA 5HO8A 4IAYA 4D4RA 3FZRA 3IW5A 4E4MA 3MFTA 4DBXA 4KIQA 3PE2A 5IH4A 4RIYA 3DPKA 4C37A 3HV6A 2GTMA 3QCQA 4PP9A 2F7EE 3NX8A 3ORMA 4NTTA 3DAEA 4KIPA 3RNIA 2CHLA 3AQVA 3C51A 3JS2A 3PA4A 4V0GB 4D58A 2BIYA 4G9RA 3Q6WA 4YMJA 5EW8A 1FOTA 4HYSA 2VO0A 1NXKA 1OL6A 4CYIA 2IZRA 2GDOA 4EONA 1K2PA 2HZNA 3Q4TA 4DLIA 4AOTA 3WZJA 5ANGA 3TZMA 3W16A 2C6IA 2OIQA 3TG1A 3UTOA 4RJ6A 3KY2A 3HUCA 4O7WA 1UNGA 3AGLA 4XP2A 2HWOA 4FA2A 4GCJA 3NPCA 1ND4A 3NW7A 4YTCA 2WEVA 2WTJA 2FUMA 5AR5A 3DOGA 2ZM1A 5HI2A 2G01A 2Y8OA 4BCMA 5E8WA 4QMQA 2ZV9A 1MQBA 4FYNA 2BFYA 1KE5A 3KA0A 4D4VA 4FTCA 5E90A 3CC6A 3FLQA 5IA3A 4RVTA 4OTIA 4UXQA 3QUDA 3ZRKA 2CNUA 2XCKA 3R73A 3OCGA 5IKWA 4V05A 4YJSA 4BYIA 1A48A 2DQ7X 5K0KA 5CEPA 3F5PA 1J7IA 3E93A 3VUTA 1PXPA 3OXTA 4UMQA 1WVWA 3FYKX 5FLFA 1CKPA 4Y83A 5A3XA 2QURA 2VWYA 3IOPA 3RK9A 4DAWA 2G2FA 4QP6A 3KVXA 5KE0A 5CS6A 3CSVA 5L8JA 1U5QA 3MA6A 2XEZA 4JQ7A 3PXZA 4QMSA 4O7YA 2VTRA 4A4OA 5FP5A 5ANIA 2ITVA 3B2WA 3QX2A 4KAOA 4RIXA 3DFCB 1VYZA 4WUNA 4Y95A 3L9PA 4PL5A 2X0GA 1KOBA 3FC1X 2OG8A 2WMUA 3G51A 3QRKA 2OBJA 2VAGA 3FDNA 4MD9E 5DFPA 5B0XA 5K3YA 4MXXA 3V8TA 4F6UA 3KXMA 1OZ1A 2FH9A 1P4FA 3REPA 5FM3A 2UW7A 3ROYA 5AUYA 3FQEA 4H05A 1KSWA 2G15A 3H30A 3PE1A 5CY3A 4KRDA 3B2TA 4GH2A 2FYSA 3JR1A 3A4OX 3D14A 3IPHA 5HX6A 3K5VA 4EQCA 5CEKA 5DIAA 2JBPA 2QOIA 1LR4A 3BHYA 1KE7A 3UC4A 4E4XA 5AAEA 5HTIA 4FG9A 3DQWA 1XH7A 3KC3A 3HV5A 4FIFA 4QD6A 1W83A 3LFAA 4H1JA 4RC3A 3UIBA 1TQPA 3L1SA 4QPSA 4CZTA 5CSPA 3FSFA 4FGBA 4RJ5A 4C2WA 4O1OA 5CI7A 5J9YA 2C6MA 4AFJA 1H26A 1WBOA 4GS6A 1R1WA 3DCVA 4AOIA 3PG1A 3R1QA 5AV4A 2VWXA 5A4LA 3E63A 4FIEA 4CFNA 4M7IA 2OH4A 3RPRA 4WSQA 3CTHA 3K54A 5AR7A 2J0MB 2PVMA 3RK5A 4IVAA 4CEGA 4EKLA 1PXLA 4GJ2A 4CFXA 5GINE 3IOKA 3VQUA 2PSQA 4XJ0A 3ATTA 1PYEA 2Q0NA 4U42A 2B7AA 4WG4A 5HKMA 3V5TA 4EYMA 3QLFA 1YRPA 1OKZA 2I0YA 1OKVA 3CEKA 2B55A 3ZC6A 3OCTA 3OW3A 2Q0BA 2CPKE 3AD4A 4G17A 4DGLC 1UU7A 2WPAA 3MY1A 4HCVA 4XV9A 1BI8A 4KUJA 4FVRA 4OTPA 5AUWA 1OVEA 3F5UA 1ZWSA 5GJDA 1CMKE 3MV5A 3TKUA 3NEWA 4J8MA 3A7HA 2YLFA 4E93A 5AAFA 4E26A 4ZTLA 3FBVA 3G0EA 1H27A 2E9UA 2O64A 3U54A 3MGYA 5BMMA 2GS7A 4E73A 5B7VA 5LOHA 3DXQA 2GQSA 4D5KA 1L8TA 1E9HA 4NL0A 3UPXA 3T9TA 4AN3A 5FDPA 1R0EA 1UNHA 4MNFA 1NVSA 3BLRA 5AAGA 3RM7A 3QQKA 5E8SA 4ZY6A 2C0IA 2PZYA 4DH1A 4YLJA 4QMMA 3TTIA 1KE6A 3UODA 4P5ZA 2QODA 1ZARA 4FV1A 4IC8A 2O2UA 1BX6A 5AR3A 4KIKA 3C4FA 1U46A 3NAXA 2OZOA 2PVRA 3JY9A 2ZMCA 5EYDA 4ZTSA 4QNAA 3A8WA 3SVVA 4IM3A 3HP2A 4QMZA 3THBA 3OWJA 1DI8A 4Z7GA 5M4CA 2PZRA 3W1FA 4XV1A 3WI6A 5HVKA 5CAUA 4X3FC 1UU3A 4I0RA 3L8XA 4YP8A 2ITUA 2YDIA 2YIWA 3ZM9A 3U8WA 2HENA 1Q3WA 3Q5IA 5HESA 3MBLA 3COMA 3VF9A 4DEAA 5KKRC 3NS9A 4EOIA 1IEPA 1PW2A 3VHKA 5HD4A 4RIXB 4YZNA 1G3NA 4EKKA 3ACKA 3MJ2A 5LMBA 2ZMDA 4CLJA 2YACA 3UZRA 1Q8YA 5KZIA 2ITZA 4IX3A 2XKEA 5LWMA 5AUVA 2C0TA 4FL2A 5F4NA 3PY1A 4JVGA 5IDPA 2YHVA 2X7GA 4G5JA 2QVSE 3IDPA 4M0ZA 3P7CA 3FY0A 4E3CA 2JLDA 3CIKA 4NW5A 3QD0A 3FLYA 4GMYA 2EVAA 2VD5A 3FLWA 4FKLA 2J0KA 5BUIA 5EW9A 1ZRZA 3CKWA 4LV8A 4GVJA 2XKCA 2CSNA 3EFKA 3POOA 4FSZA 4N0SA 5FP6A 2QNJA 4B9DA 4BB4A 2A1AB 1XH6A 1YXVA 2BZHB 2WMWA 3R9DA 1OBGA 4FNZA 4JXFA 1NVRA 2W0JA 4JNWA 3LCOA 3DZOA 4CKRA 4O0UA 3HLLA 2W4OA 2R3GA 1YHVA 3PY0A 4LRKA 4IB1A 2RGPA 5DI1A 5GZAA 5BUEA 4ZTQA 1GZOA 3JVSA 5M4UA 3MY5A 3DB6A 3G5DA 5DR9A 3RCDA 3CCNA 1WMKA 2OFVA 2J50A 1W84A 3QTIA 3EQDA 3R8UA 3KN5A 4D9UA 5CAQA 3QTWA 2HYYA 3E5AA 4XRLA 3ZHPC 3DBQA 3QA0A 4K8AA 4D1SA 3TL8A 5HZNA 4HGEA 3OWLA 4WNKA 3WF7A 2F57A 5FM2A 3S3IA 1OIUA 3FXWA 4GJ3A 5L6WL 3VC4A 3ORLA 3FMJA 3R04A 3WZDA 5L6OA 4IB5A 1WAKA 2CCHA 4R6VA
chains in the Genus database with same CATH superfamily
4LUEA 4KS8A 3TKIA 3POZA 3V8WA 4CV8A 4CMTA 2C5YA 4RX7A 4FV6A 4BICA 1BMKA 3QCSA 2QOBA 3AG9A 4IIRA 4C58A 4I21A 2PUNA 3COIA 4CGAA 2XP2A 2VZ6A 2VWVA 2RFEA 4IAFA 3R7VA 3ZBFA 5T3QA 2R3HA 3U9NA 5EQYA 5A4CA 5CSXA 3GC9A 3MPMA 4BL1A 2IEWA 3EWHA 5M4IA 4XRJA 4P2KA 2QLQA 4FV2A 4QMVA 2XIKA 4ZS4A 1XBBA 3V01A 4E6AA 1VEBA 5CALA 4EK8A 3GFEA 4O1PA 3BGZA 4HPTE 4DG3E 3L9LA 1STCE 2UW9A 3WIGA 4AGWA 5DRBA 1Q8ZA 2A19B 3C13A 4PNKA 3EZRA 2Y4IB 4H36A 4TZRA 5GIOE 4DH5A 4BKZA 3ZO4A 2QOQA 5AP4A 2YJSA 2VUWA 2UZDA 4D9TA 3QYZA 5AX3A 3NNXA 1CKIA 3DKGA 1WBPA 2OXDA 3FZTA 4WT6A 4DGGA 3LCSA 5EI2A 1ZMVA 2P2HA 3F88A 4RJ8A 3FWQA 4XBUA 4ACCA 4H3PA 2XUUA 3NUNA 5EW3A 5CF5A 4IDVA 4NIFA 2B54A 1ZOEA 4YLKA 4QP7A 3PIYA 3ULIA 4XG2A 4IE9A 4OTRA 4FSMA 4QTAA 3TNIA 2VWZA 5JRSA 4RFMA 2BZIB 4FEXA 1GNGA 4LL5A 4XCUA 5H8BA 4MF0A 4I6FA 2J7TA 3LJ2A 3QXOA 2B9JA 5GHVA 3TNWA 4EOQA 2JEDA 5JFSA 2W1ZA 4O7TA 2BROA 3D5UA 3LXNA 3TV7A 3EKKA 4F09A 4O0TA 3RNYA 3LCDA 4O91A 5AIKA 5CXZA 1YVJA 3BYVA 3E3PA 4FTMA 4C8BA 4WA9A 4JG7A 4LOQA 4PUZA 3CKXA 2C3JA 1AQ1A 2X7FA 4YTHA 3HV4A 2OK1A 3UDBA 4AGUA 1XBAA 4FV0A 4O2PA 4W9WA 3C5UA 4BZDA 2V55A 3VULA 3EN6A 4ENXA 3KRWA 4J95A 4O0VA 3GNIB 4YO6A 4O7RA 4BCIA 3NCGA 2PMLX 5HU3A 3UQFA 4P90A 2XJ2A 2PE2A 3UIMA 4CFWA 3TEIA 3CTQA 5J7HA 5DE2A 4ZJIA 2X9EA 3CR0A 3HZTA 4F4PA 4YR8A 4DYMA 3NNVA 3PXKA 4FV7A 4HW7A 2XA4A 2UW6A 3FMHA 4IJPA 4O4EA 4X3FA 4KBKA 3IGGA 4O7ZA 5I3RA 1A06A 4WOVA 3VHEA 4L01A 4KWPA 2BCJA 2QLUA 4LMUA 4ZY4A 3RCJA 5C8MA 4LRJA 4RZWA 5CZIA 4F63A 3ENHA 3UO5A 4EH9A 4Q9ZA 4NU1A 3E3BX 2HXQA 3QGWA 2QR7A 3DBEA 4EZ5A 3SW4A 3WF5A 4KNBA 3VBWA 2X39A 4A4XA 1AD5A 1DI9A 3NR9A 4WG5A 5GJFA 3BV3A 2PL0A 2QC6A 3DJ7A 3BZ3A 3SXRA 3LZBA 5T6KA 4AT3A 1BUHA 3NFGB 3ZFMA 4J71A 5FXSA 1PYXA 3C5IA 4RGJA 3R8MA 4C7TA 5L8KA 3LHJA 2OZAB 3T8OA 3BWJA 4M66A 3SC1A 2HAKA 4HCTA 4C61A 4L53A 3CTJA 3SLSA 1JSVA 3C7QA 3I5NA 3ZONA 2C5OA 4FICA 4E5AX 2AQXA 2QOLA 5IH6A 5HQ0A 3TZ7A 2EB2A 4YJNA 4C3PA 3P4KA 2WEIA 4AZSA 1UWJA 2EXCX 3MH0A 2WIPA 5CU0A 2QI8A 4GL9A 3QC4A 4L3JA 2J2IB 1RW8A 4KIOA 1H8FA 2OW3A 4DEGA 4IW0A 5IA0A 3ORIA 3GQIA 1E1VA 3CJGA 3DGKA 3ZEWA 3PIZA 2GHMA 5E8VA 1JWHA 3ENMA 2B52A 3F66A 4ITIA 1J91A 1SMHA 2EXMA 2VTIA 4IWDA 3UP2A 2OIBA 3BEGA 3E92A 3ZC5A 4BTMA 5DRDA 5KO1A 4ZIMA 1PXMA 3AOXA 5L2TA 3LMHA 4D2VA 4D4SA 4EK4A 2HIWA 2XAMA 1YHWA 2P3GX 2Y9QA 2YERA 2QHNA 3ZUUA 5IEXA 4FVQA 2GS6A 2YAAA 4BDEA 4BTJA 4FTLA 4AZFA 4E8AA 4EH8A 5LCJA 3P86A 4C4EA 1KE8A 5H3QA 4XG3A 5L2QA 3TWJA 4AE9A 3S00A 4LDTA 1VJYA 4CZYB 3AGMA 4I6HA 4CKIA 1APME 1DAWA 2J4ZA 4MXAA 2JAVA 2YM5A 3FLZA 2HCKA 5CU2A 4D2WA 1IAHA 4P4CA 3U6JA 4TL0A 4ZS0A 4DLJA 3DDQA 1FVRA 4NIFB 5DT0A 4NYEA 1Z57A 3Q3BA 2OXYA 4DEBA 5CEIA 3DB8A 5ETFA 5E9EA 4X3JA 4GYIA 4EORA 4FIGA 4F0FA 2QOCA 3RBWA 4K18A 4UWCA 4W4YA 4CTBA 1SVGA 3KRRA 4G6LA 4QMXA 2Y0AA 3NZ0A 3PLSA 4AAAA 1M2PA 2GFSA 4XOYA 2J0IA 1ZMWA 5ANDA 5K0XA 3IECA 4GK4A 3P5KA 2HZIA 3KRXA 3PXFA 4MQ2A 4MH7A 4Z9LA 3TXOA 4RC4A 2ZOQA 3Q96A 3DK6A 4Y46A 5HIDA 4I0TA 2ITOA 3PSCA 3TV6A 2JFMA 3L8VA 3JXWA 4FSYA 1IASA 4GFMA 1UU8A 5CVHA 5LXMA 5L4QA 5EDQA 1H28A 1YDRE 3G33A 2X4ZA 4PPAA 4QQJA 2CKQA 5FD2A 4F0GA 3TUBA 3VBVA 2I0VA 4F1TA 1J7UA 3D5WA 5DPVA 1PMNA 1K9AA 3QALE 1XMMA 2XH5A 3TJCA 3QFVA 5LVOA 5AP6A 3MYGA 3FV8A 2C1AA 3MY0A 3QAME 4I20A 2CNQA 5K5XA 4JIKA 1DAYA 1U4DA 2GCDA 3VS3A 4D2TA 3P78A 2ZJWA 3A99A 4OTDA 4BDDA 3RPYA 3FMEA 1F3MC 2G9XA 2W1FA 3LM5A 3E87A 3OD6X 4CD0A 4KB8A 4YTFA 5DHJA 4IBMA 4CRLA 4Y73A 3GCVA 1JBPE 3HNGA 2G2HA 2UW8A 3GI3A 2O5KA 3MIYA 4XS2A 4A9YA 1XWSA 3F6XA 3IG7A 3KKVA 3V5QA 3SGCA 2OWBA 3QKMA 4YLLA 3VNTA 2VWWA 4YJOA 4Q5HA 1FVVA 4UMTA 5FG8A 4HJOA 4CFVA 3KB7A 4ZZNA 4ARKA 4UALA 4LGHA 3DU8A 3BGPA 4IWOA 4BKJA 2ERZE 1YOMA 4DFZE 3MDYA 4EH3A 2ESMA 1JVPP 3HGKA 3R1NA 1LUFA 4PDOA 4B6LA 4BDGA 3OT8A 3LLTA 4PMSA 2XZSA 1PMUA 3CGOA 4RX8A 3BU6A 3Q4UA 2F2CB 2X1NA 4ZTMA 3DZQA 2Z7RA 3RAWA 4PTCA 3WILA 1OECA 3PVWA 2X0QA 3LVPA 4RWJA 3WZUA 1XHAA 2XNGA 2VTNA 3ZFYA 4QQCA 3HMMA 4AW0A 2W17A 3JUHA 3AC2A 3F3UA 4HNIA 5IEYA 4C4FA 4FKUA 3HMNA 4IX5A 4RX9A 5AUUA 4H3QA 4A07A 4DHZA 3Q04A 5EYMA 4R7BA 3KVWA 4ZK5A 3DAJA 4ANQA 4Z3VA 4ZZOA 4O27B 4PV0A 2WHBA 3COHA 3TDWA 1O6KA 3D9VA 3WZEA 3UIUA 4L3PA 3H9RA 1MUOA 3R7EA 3EFWA 1QPJA 4L44A 3EN7A 2ZM4A 1M17A 2W1IA 4JR3A 3F61A 5AM7A 2DYLA 3DLSA 3W2PA 1Q24A 1FGKA 3EN5A 3ZCLA 4DG0E 4YPSA 5LMAA 4C4JA 1FBNA 2I0EA 3OOGA 3R1SA 2QQ7A 3ZO2A 4DFYA 1G8JA 4XG4A 4C35A 3GGFA 4BDFA 1FMKA 3ORZA 3EQBA 4QNYA 4IHPA 4AA4A 2BDJA 3BBWA 4QTBA 4AG8A 3OHTA 4O21A 4DT9A 4EQUA 3TUDA 2VWBA 2XIYA 1M7NA 3DFAA 5AADA 4K9YA 5H8EA 3HA8A 3QTXA 1YXUA 5BVOA 5ICPA 3K3JA 4IFCA 5J95A 5EOLA 3W2QA 4DCAA 3VUGA 4WO5A 1QPEA 1PMEA 4YZBA 4ZSLA 5I9XA 4UZDA 4QP9A 4ZSJA 3R9HA 5I4NA 3R9RA 3C9WA 4HYUA 5AR4A 4LFIA 4FR4A 3CD8A 4JL9A 1MRVA 4C33A 4MX9A 2NPQA 1H25A 3FMMA 3VWAA 5TT7A 5BVNA 5M44A 5AIRA 2ZVAA 4PP7A 4UN0C 4DEHA 4N6YA 3MN3A 3Q9ZA 5BVEA 4Z55A 4FIJA 3HV7A 2W1CA 3QL8A 3QKKA 3PSBA 2ONLC 3S4QA 3UMWA 4APPA 1S9IA 3TMOA 4F08A 2W1DA 3QX4A 3FY2A 1YKRA 2AC3A 1WBTA 4MNEA 4NFMA 5DYJA 4L7SA 2VTPA 2FVDA 2W5AA 4DBNA 3VS7A 3UOHA 2R3NA 4KD1A 4MBIA 1W0XC 5A6NA 3I81A 4AZVA 4QTEA 3DBFA 3NVMB 3CE3A 1OIYA 4IMYA 5CZHA 4NT4A 3FPMA 5IISA 2QKRA 2PVYA 2EU9A 2X2MA 1PMVA 3M1SA 2C4GA 4L3LA 4ZSEA 4EWHA 3A7FA 1VR2A 2YLEA 4DFLA 5FBOA 2XANA 5CNNA 4NJ3A 3D5VA 4YPDA 5C1QB 3EYGA 3IK3A 2BALA 3LFBA 3SW7A 2WTKB 1G8SA 4CFFA 4EQMA 5EM7A 2XVDA 3O8PA 2KTYA 4ANLA 3ZU7A 3VVHA 1RDQE 3QYWA 1ZOGA 1JOWB 1H1PA 3PY3A 4A9UA 1F0QA 3AD6A 3SG9A 3DKFA 5HE3A 5E4HA 4BWKA 3II5A 3KREA 3SD0A 3TNQB 3F3VA 3OP5A 4F9BA 1GZ8A 3FQHA 4IQ6A 4QO9A 3ULZA 4WRGA 4FEQA 1G5SA 4HVSA 4OBPA 3WOWA 4JJRA 4QRCA 5GZ9A 3VS4A 5FXRA 4ITJA 2UW4A 4DINA 3ORTA 3HRFA 5M4FA 5A4TA 3FLSA 3P08A 3SXFA 2Y6OA 3HUBA 3UNJA 3OWPA 4S34A 2HY0A 2PVNA 3G6HA 1Q62A 4YC8A 2ZB0A 5CASA 4QMNA 2B9FA 2PVJA 3LXLA 4EOLA 3SDJA 2PU8A 4M15A 3PFQA 4E5WA 4IEBA 2UZOA 2WMAA 3ELJA 4RT7A 3FZ1A 1PF8A 3CGFA 2BRMA 4FMQA 3UIXA 4AZTA 3F3WA 4ZJJA 1ST4A 3GB2A 5E8XA 4IDTA 2GU8A 1H08A 3FKOA 4APCA 4CG9A 4OBOA 3VBYA 5HX8A 1T46A 3RAHA 3I1AA 4CFMA 3FI8A 4QMUA 4ACHA 4FTJA 1GIJA 5BVFA 5CT7A 5JN2A 4I4FA 5J1WA 2HZ4A 2VX1A 5EM8A 2A0CX 3HDNA 3LFFA 5ETIA 5AV1A 5KMMA 2OIDA 2CKOA 2PTKA 1OL1A 4AXDA 4O6LA 2GHGA 4C38A 4M14A 4BBEA 3KRJA 2VTSA 3E88A 4JRVA 4FTKA 4YC6A 1BLXA 4U44A 4BR3A 3UJGA 4ACMA 3E8NA 2CJMA 1PHKA 5JRQA 2BPMA 4E20A 4DA5A 3KXGA 2UZTA 3UYTA 2R64A 4BRXA 2VNWA 3QZGA 3TTJA 5HG5A 4AT5A 4FG8A 1KV2A 2OU7A 4PDSA 5C27A 4M3QA 4XV2A 3UPZA 2V5QA 5ANKA 5CSHA 3R01A 3ZSGA 3SQQA 5ACKA 3TT0A 3TZ8A 3UGCA 4UZHA 3PJ8A 4JI9A 4O7VA 3FEGA 3LCKA 4PDPA 3AC1A 4NH1A 3N4VA 4QDEA 1KWPA 1REKA 3OY3A 3GC8A 3RPVA 4FSUA 4FKQA 3QQUA 4EZ7A 2BDFA 4NSTA 1FINA 5DR6A 3EJ1A 4QMYA 2OFUA 2QO9A 2HK5A 2UZUE 3EZVA 1CDKA 2YIQA 5TKDA 4PMTA 4F1MA 4LOPA 2A2AA 2RIOA 3LQ8A 5LVLA 4QYHA 5B2LA 1EH4A 3VIDA 5CAPA 3E7VA 4MTAA 4XLIA 3OEZA 5HLNA 1IRKA 1J1CA 1GY3A 4GW8A 4DF3A 3ZSIA 1UU9A 4DH7A 2C5NA 3QQGA 4C02A 4J96A 4DHIB 5AFVA 1U54A 1Q41A 5H2UA 4L68A 2QR8A 2UVYA 5EHOA 5D7AA 5HBEA 5JGDA 3QWKA 3W2OA 4QQTA 3U4UA 2WAJA 1J7LA 2CN5A 3NLBA 4LUDA 4FK3A 3F5XA 2WGJA 4TKSA 3QD4A 5HG9A 5BVDA 1B38A 3G9NA 5K9IA 1MRUA 3PWDA 4PTEA 4RIYB 4FL3A 4NTSA 5KMJA 4J98A 1WCCA 4X2FA 3I0OA 3FXXA 4J7BA 2JIVA 2OJJA 1WBSA 2FSMX 1SVEA 3DTWA 3E7OA 3PVGA 4ITHA 5HIBA 4GU6A 4MKCA 3UG1A 3MESA 3QF9A 2I7QA 1JSUA 3VJNA 4BDJA 3KF4A 1Q8TA 5DOSA 3A7JA 3GU4A 5ACBC 1FQ1B 3FHRA 3R6XA 3TNPC 2WMVA 2UW5A 3LAUA 2AYPA 4PWNA 4QMTA 3G9LX 3TCPA 2QG5A 4U80A 3E8DA 3GBZA 4RA4A 5JSMA 3S2PA 3KXXA 4HGTA 4A9RA 4IANA 4J97A 1H1RA 1YQJA 2C6OA 3R7IA 4EH2A 2HZ0A 2YN8A 4WHZA 2R3IA 4GT3A 4HOKA 4L42A 3V51A 4O81A 5A54A 1XH9A 4FOBA 4AACA 3OVVA 4AXEA 3DJ5A 4O0XA 1WZYA 2P55A 2XRUA 5I9UA 4GRBA 3ZMMA 2RG5A 1B39A 4JIAA 4RJ4A 3KCFA 4N6ZA 3RI1A 2F9GA 5DR2A 4BIDA 5I9VA 3ATSA 3QHRA 2YZLA 2HWPA 5HICA 4ASEA 4W8DA 4BN1A 5CXHA 4RMZA 3R9NA 3NMUF 2NP8A 1R39A 5H9BA 3Q5ZA 3BU5A 1Q99A 2WOUA 3I79A 1RQQA 5EYCA 4LV5A 5FEQA 4R7IA 5L2IA 3NRMA 5CX9A 5EK7A 4RVMA 3T3UA 1YWRA 5A4QA 5A14A 1XKKA 5K4JA 4AT4A 2PWLA 3ITZA 5IG1A 4QP2A 4WD5A 3RPOA 4PQNA 3WIKA 2WTVA 2YIRA 3Q4CA 4FTAA 4JQ8A 2R4BA 5CEOA 2AEGA 2UZWE 5FEEA 3KULA 3TV4A 1Y6AA 3H9FA 4L7FA 4EUTA 2VX3A 4YSMA 1FVTA 3BWFA 3FI4A 3KEXA 4HVGA 2IW8A 4C4GA 4FTTA 3OW4A 2W4JA 3GU7A 3P23A 4IB0A 2R3LA 3LW0A 4GV1A 4PMMA 4PTGA 3TYKA 5I5ZA 5JKGA 2JIIA 1PXJA 2VO7A 5EOBA 1LPUA 3D2IA 4AGDA 4EI4A 3F2RA 4XNEA 2YABA 2JIUA 1BYGA 4M68A 3OMVA 1G8AA 5AP7A 3MIAA 3QD3A 5EHLA 3FMNA 2WMTA 5KHWA 4JBOA 4D5HA 3GC0A 4Y85A 1FGIA 5HIEA 4ZOGA 3NAYA 3W2CA 3MB7A 4R3PA 4L43A 2XB7A 4EOMA 1OPLA 5L8LA 3ZLWA 4MXZA 3VW6A 4D1ZA 5IDNA 4AQKA 2JKMA 3HYHA 2R3KA 3LCTA 4RX5A 3FPQA 3TI1A 2QOHA 4IXPA 4YURA 3D83A 4UMRA 2ZV7A 4I6QA 5KMKA 4AU8A 4FNYA 3Q9WA 4LGDA 4U79A 5D41A 4EL9A 2OI4X 4IH8A 2UUEA 2JKKA 4YZCA 4GKHA 3BPRA 2XALA 1ZY5A 3SV0A 2X2KA 2BKKA 2ERKA 3HAMA 3KL8A 2A27A 5F95A 1QL6A 2CCIA 2W1GA 3F5GA 4N70A 5F94A 3W2SA 2BKZA 2GNHA 4CKJA 4IB3A 3OBGA 4B8LA 2YM8A 2B9HA 3EHAA 4HGLA 5CTPA 4FTUA 1ZYDA 4E4LA 2BTSA 3DK3A 5G1XA 1JKLA 2J5EA 5C8KA 1WBVA 3E62A 3AKJA 3AKLA 4FSWA 2UVZA 3MFUA 4G34A 4O0RA 4BCJA 4DGMA 3VS5A 5HBJA 4WSYA 4IAKA 3I6WA 1M52A 4GIIA 5CF8A 3CBLA 4R5SA 3DTCA 3OCSA 3VS0A 2VWUA 5IA1A 4GIHA 3U87A 2G2IA 4AOJA 2H34A 2BUJA 4FKWA 4TY1A 4HCUA 2C3KA 5GNKA 1YHSA 4FG7A 2IF8A 3JPVA 4X7QA 3V5PA 4KA3A 4TWOA 4X2GA 3NWWA 4ALWA 2BDWA 4F7SA 1OBDA 4EH4A 3RP9A 4MK0A 2J0JA 3R22A 4DGOA 5I9WA 3OG7A 2WMSA 1P4OA 4W8EA 4PF4A 3MH3A 5D12A 3R30A 3O7LD 3IO7A 3CY3A 4MYGA 4MBJA 4BZNA 5GZ8A 3NVKI 3PUPA 4D2PA 2W5HA 4QTDA 2C6DA 3DY7A 4ANMA 5HHWA 4QEBA 3W8QA 4AW1A 2PE1A 4QMPA 4G9CA 5J1VA 4QP1A 5IQAA 3DNEA 3BQRA 3RHKA 1ZZLA 3WE8A 2ITTA 4FT7A 4OTWA 3CPCA 4DFUA 3FSKA 1OGUA 4D1XA 1Q4LA 4KKHA 4KRCA 2XNEA 2VTOA 3MSSA 4KIKB 4X2NA 1XO2B 4X2JA 5IQCA 4NCTC 4NKSA 3A4PA 1H0VA 1JKTA 4I94A 4R8QA 4U5JA 3W33A 4PPBA 4F9AA 2OF4A 3L9MA 3DDPA 3GOPA 3C0HA 5ANJA 5HNBA 2GTNA 2ZV2A 3LIJA 2BMCA 4XH6A 4DFXE 2I1MA 4FV8A 3D7TA 3KF7A 5DBXA 1KUTA 4IZAA 2AUHA 4FKGA 4CMUA 5E91A 3U4WA 4BCQA 4YBKA 4F1OA 5A4EA 3KULB 4CQGA 3OS3A 4TYGA 3BX5A 4GYGA 2VTHA 4FODA 5HVJA 1GZKA 4HZRA 5IQIA 1GOLA 4U6RA 3AMYA 3Q6UA 2DWBA 2PVFA 4EOPA 3NW6A 5A46A 3IW4A 5HG8A 4M67A 3KIOC 4FSNA 4IAIA 4EYJA 5D7VA 5HGIA 4RC2A 5F1ZA 4IZ7A 3UQCA 3K2LA 2WQOA 5TR6A 5J7BA 3FMKA 5JZNA 5C03A 4BZOA 5C4KA 3OUKA 3P1AA 4C2VA 3P9JA 1GAGA 2WB8A 3PDTA 2O3PA 3SXSA 5KMOA 4PL4A 4YJUA 3HMIA 4TYHA 4F99A 3LMIA 4GT5A 2Z7QA 3I4BA 1KOAA 3MVJA 3O96A 4XG7A 5HG7A 3HAVA 2RG6A 4BDBA 3RWQA 2X0PA 4DITA 3AC3A 1UA2A 3BKBA 3GC7A 4FTIA 4FEVA 4Z16A 4FUYA 3NDMA 4R3RA 1JSTA 3WE4A 5CQWA 2FB8A 3OUNB 3MTLA 2P4IA 3KGAA 4W4VA 4BBFA 1H01A 4AX8A 3PYYA 2E2BA 4BTKA 3BGQA 4FSRA 2UZEA 4ID7A 4DE4A 2ACXA 4FSQA 5CENA 1Y57A 4U45A 4DEIA 5JK3A 3UDZA 1SNUA 2YCSA 1CSNA 1O6YA 1OMWA 2XRWA 3COKA 3PZEA 4RLLA 4R7HA 5FUTA 4O4BB 5LCKA 5C26A 5L2SA 2RL5A 3G90X 4MBLA 4TTHB 4ZTHA 2XMYA 3ZDIA 5I0BA 4YJPA 3UO4A 3HV3A 4IAZA 4J8NA 4V04A 4AXFA 3RKBA 3V8SA 2KULA 4F6WA 3I0QA 4FKPA 4F9WA 3OFMA 4L6QA 2YFXA 3O0GA 3R83A 4HVDA 1YOLA 1J3HA 4ANSA 2QG7A 3UZPA 4E5BA 4UMUA 5AUTA 2ZYBA 4G3EA 2NO3A 4TN6A 2Z02A 5AV2A 3E8CA 2WTWA 4Q5EA 5D1JA 3PZHA 3QLGA 5M57A 1JKSA 3GU8A 4DFNA 5HNGA 3QUPA 2FSTX 3IDBA 5LVNA 4EJ7A 4ANNA 1YXTA 4K1BA 3ORPA 2YAKA 2JD5A 2ITQA 3EN9A 3QBNA 4ZLYA 3QGYA 2WFYA 1XBCA 2QO7A 4JDKA 3BEAA 3IONA 5AR8A 5DLSA 4ZJVA 5JGBA 3DNDA 1OB3A 4AE6A 4D4YA 4K11A 4WBBB 3TNHA 3GU6A 4G3CA 2UZNA 4H58A 4WG3A 2GFCA 2OJIA 2XIXA 1YDSE 2I6LA 4MWIA 4CTCA 2V0DA 3FMLA 3DLZA 3MPTA 4WNMA 4GVAA 1H24A 4FV4A 3R02A 5HE0A 4II5A 5ANEA 3MB6A 4RLKA 5I9ZA 5DEWA 2CGWA 4USEA 1V0PA 2X0OA 4W9XA 3LFNA 4D55A 2VV9A 3F2NA 3PXRA 3R21A 2YM7A 2YCRA 4RA5A 5HE1A 3RZFA 4AZWA 4U0IA 5KNJA 4LGGA 4UWYA 5DEYA 4AN9A 2BAQA 2FA2A 4B4LA 4Y72A 1M2QA 3DS6A 3QQLA 4OLIA 5J5SA 2ZFYA 3VONA 1NA7A 1PRYA 2O8YA 3N51A 3MJ1A 3UO6A 3G6GA 2GS2A 2NRYA 2DUVA 3CD3A 2CN8A 1ZLTA 1XH5A 2SRCA 1OPJA 3OWKA 3Q4ZA 2C47A 4UWBA 3I5ZA 4RQVA 5AA9A 3PJ1A 5KBQA 3I6UA 1ERKA 3ORNA 1GIHA 4AXAA 3D7TB 2HY81 3ID6C 4WRSA 3RM6A 2E9NA 3GUBA 4L00A 5BVWA 2QKWB 4Y5HA 4YJQA 3UQGA 2WU7A 5JT2A 4BDKA 2BZJA 2CNVA 4BY9E 4G2FA 3NUXA 3GP0A 2REIA 3TZ9A 3PWYA 4BVUA 3D7ZA 4DCEA 5JFXA 3VS2A 3CQUA 2BILB 3PXQA 3ACJA 2B0QA 1H4LA 5J79A 5I9YA 3EIDA 4BTFA 5IQDA 3MTFA 1J1BA 3QZIA 4O4FA 4TYEA 4KKEA 2ZAZA 2A4LA 2PPQA 1ZZ2A 1E1XA 3PG3A 3U6IA 2I0HA 1OUKA 3CQEA 5KBRA 3D4QA 4MXCA 4EEVA 2IZTA 3NYXA 5DA3A 2WELA 4TYHB 3QXPA 4U43A 4AGCA 4FK6A 4GK3A 5AUZA 4JG6A 2Q83A 4JAJA 4D0XA 2CLQA 2XK9A 2J51A 3F3ZA 3LXKA 4XLVA 5L6PA 5CF6A 2YISA 4NCTA 4RJ7A 1QMZA 3A62A 3R1YA 1ZYJA 4EOJA 2PVLA 4FI1A 5HE2A 2EB3A 3T3VA 4I41A 4B8MA 4FEWA 3ALOA 4FZAB 4ENYA 4X3FB 3FKLA 5E92A 3ZLYA 4ZY5A 3BCEA 2XNNA 3HA6A 4I5PA 3Q60A 4JR7A 3IQ7A 4Z7HA 1UWHA 4BGGA 3Q52A 3OC1A 4RRVA 2F4JA 3WARA 4CSVA 3G15A 1WBWA 5KKRB 5BYZA 5FEDA 2YM4A 4TWPA 3EFLA 5KMNA 5I3OA 4C3RA 4D2RA 1XH4A 1W82A 2BVAA 4DEEA 4XYFA 2X6EA 5E8UA 1WFCA 4O38A 2RFSA 4EHEA 2ZDUA 2YCFA 4G3DA 4OW8A 4AW2A 5CT0A 3ZZWA 5J5TA 4AQCA 5E8ZA 2XK8A 3FZPA 1PKDA 4JT3A 3LM0A 5DNRA 5TO8A 2YZAA 4C4HA 3VUHA 4CNHA 2X8IA 4ANOA 1P14A 3QWJA 1X8BA 4V0GA 4X6RA 4AF3A 2XEYA 5K5NA 3W0RA 2ZB1A 1PXNA 3MPAA 4JLCA 3NCZA 1GZNA 2YA9A 3A7IA 4JDJA 4X0MA 4XOZA 4A4LA 4CG8A 1QCFA 1LP4A 1ZOHA 4QMLA 4B0GA 4O2ZA 5EI6A 5F9EA 3NYVA 3BHUA 1V1KA 2CGUA 2CGXA 2XNMA 2R3FA 5CVGA 3SKCA 5IQFA 2WOTA 3PVUA 3QQJA 3VAPA 3PP0A 4O84A 5AJQA 4NWMA 4U3ZA 3W0QA 4R1YA 4B7TA 2Y7JA 2HXLA 4MAOA 2X7OA 4XEYA 2C1BA 5DGZA 2HW6A 1I09A 5BPYA 1V0OA 2R3MA 3W18A 4MEDA 3H10A 3ZBXA 4EBVA 4JBPA 4FKJA 1TQIA 1BKXA 3AT4A 4ZAUA 4FZDB 3U9CA 2WTDA 5JEBA 3UZTA 5DWRA 4FT9A 4TT7A 2WXVA 4O96A 4ZXTA 4JBQA 4F78A 4CLIA 4NKAA 4MXYA 1OKWA 4FL1A 4JDIA 4KS7A 5AP2A 2VTLA 2X6DA 5BYLA 2WNTA 4O86A 5HEZA 5LMKC 4YGAA 5CANA 2B53A 4V01A 4YUQA 2NYAA 1XJDA 4FKOA 5DVRA 3QTQA 3EMGA 4PMPA 4DC2A 2R7BA 4EUUA 2XNBA