1ZOHA

Crystal structure of protein kinase ck2 in complex with tbb-derivatives inhibitors
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
326
structure length
326
Chain Sequence
MSKARVYADVNVLRPKEYWDYEALTVQWGEQDDYEVVRKVGRGKYSEVFEGINVNNNEKCIIKILKPVKKKKIKREIKILQNLCGGPNIVKLLDIVRDQHSKTPSLIFEYVNNTDFKVLYPTLTDYDIRYYIYELLKALDYCHSQGIMHRDVKPHNVMIDHELRKLRLIDWGLAEFYHPGKEYNVRVASRYFKGPELLVDLQDYDYSLDMWSLGCMFAGMIFRKEPFFYGHDNHDQLVKIAKVLGTDGLNVYLNKYRIELDPQLEALVGRHSRKPWLKFMNADNQHLVSPEAIDFLDKLLRYDHQERLTALEAMTHPYFQQVRAAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords PROTEIN KINASE CK2, ALPHA SUBUNIT
publication title Inspecting the structure-activity relationship of protein kinase CK2 inhibitors derived from tetrabromo-benzimidazole.
pubmed doi rcsb
source organism Zea mays
total genus 111
structure length 326
sequence length 326
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2005-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1zohA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1zohA02
1OL2A 3ORMA 3R7GA 4WNMA 5DRBA 4QMQA 4ZZOA 1M7QA 1RE8A 1OMWA 2WFYA 4DBNA 1MRYA 2X4FA 4EC8A 3A7JA 4PPCA 1V0BA 2YJRA 4FKQA 2HZ4A 2BILB 2E9OA 5M06A 4U40A 4YBKA 5D9HA 3CY2A 4FIGA 5DH3A 5F4NA 3T9TA 2C3KA 1KE5A 4BIBA 4D1XA 4C2WA 4ZSAA 3U8WA 5AUUA 5CEKA 4FK3A 3EQPA 4RIWB 4XS2A 5GINE 1ZRZA 2YDJA 4BRXA 2C5NA 4PNKA 2OBJA 1H28A 5E91A 4JJRA 4EJ7A 5AP1A 2XKCA 4IZYA 4UWYA 3UC4A 3EL7A 3MH0A 3PG1A 4XV3A 2OLCA 5GJFA 3ANRA 3D14A 4PV0A 3G5DA 1PKDA 2LAVA 4M0YA 4AF3A 1SVEA 4CG8A 2C6TA 4FT0A 2VO7A 2OFVA 1VJYA 5A4QA 4A07A 3D5XA 4B0GA 3CKWA 5I4NA 1OKYA 2VX1A 4F9YA 4ZXTA 2VX3A 2XNNA 5HVKA 5JSMA 4C4FA 4O7TA 3JXWA 3LJ0A 5IA4A 2J50A 3PXQA 4QPMA 4FSMA 2REIA 3AMBA 4L3JA 1I09A 5TO8A 4F99A 3E64A 3KXZA 4L9IA 3LIJA 3U4WA 4F08A 3RPYA 3W32A 3SGCA 4L53A 3KMMA 4FYNA 3VS2A 1Q8WA 2UW7A 1R1WA 3C0GA 3HX4A 4EHEA 4BN1A 5HE0A 4O96A 3C4XA 5BUJA 2BDWA 1WVXA 1YI4A 3CP9A 3IW8A 3NMUF 1PHKA 4UMTA 3UPZA 3OBJA 1TQIA 1FVRA 4L42A 4RIOA 3UDBA 2VWZA 1OKWA 4BWXA 3FKNA 3QA0A 2G1TA 4XLVA 3DQWA 3Q52A 5BVEA 3S4QA 5F9EA 5JRQA 4DTBA 3T3VA 4O86A 1GZKA 4DEEA 3PVWA 4AFEA 4JLCA 3ZSIA 4M13A 5ANKA 4JBVA 4AZWA 3UZRA 2J7TA 2JFMA 2WMQA 3BCEA 3MVJA 4XOYA 4X2FA 4DG3E 2JIUA 4EOSA 2YM8A 2YCSA 4X3FC 4G5PA 3CGOA 5DR9A 3COHA 3VS7A 3WF5A 3LCSA 4Z55A 1OBGA 4CYJA 5IH5A 2QO7A 2ZVAA 3NEWA 2WTVA 4ZK5A 2G2HA 4ACCA 3EN5A 5FDXA 4HNIA 5A46A 1DI8A 5CF6A 3ZOSA 4GKIA 1KOBA 3GQLA 4R7BA 2FB8A 4NM5A 4CFNA 4IM0A 3MVHA 5KE0A 4ERKA 3QTQA 2ONLA 4M8TA 3EN7A 4WO5A 3QFVA 5AX9A 2XK7A 4K18A 5KZ0A 2P2IA 3HV4A 3UODA 3ZHPC 2CNUA 4BB4A 4G9CA 3L9PA 1OZ1A 1H08A 2JAVA 4S2ZA 4WG4A 3G6HA 1PMUA 4A9RA 3U6IA 3M2WA 1KOAA 4DE4A 1O6KA 3HAVA 2EB3A 4QMUA 5FEDA 4IB5A 4OW8A 1P14A 3WARA 5HVYA 4PTCA 4RG0A 5D7VA 2HELA 2VGOA 4FV6A 4Y72A 4YTIA 4XJ0A 4OTPA 4AE6A 5AA9A 1KUTA 4XRLA 4U80A 4RZVA 3TNPC 5B0XA 1ZYLA 2OJIA 5FP6A 5J7HA 2W4JA 3ORTA 3LE6A 3T8OA 3QUDA 3KEXA 4MQ1A 3NNUA 4QMMA 2QOCA 2WNTA 4C33A 3ZBFA 3GCUA 1SNUA 5M07A 4KWPA 1GIJA 4IVCA 4RIXA 3VUKA 4BDAA 4Q5EA 3O8UA 3E62A 3BE2A 5L8JA 2VTSA 2B0QA 3AC4A 2CCHA 3I6WA 4BDGA 2F57A 3KRWA 3TNIA 4DF3A 5EKNA 5LMKA 3R00A 4B8MA 1I44A 3QCQA 4IANA 3Q2JA 2WTWA 3QC4A 1REJA 5H8EA 2GHMA 4LFIA 2QOFA 2V7OA 3DLSA 5KMIA 5L2SA 3SG9A 2WD1A 3LPBA 3RZFA 3ENHA 3PPJA 2H9VA 1WBVA 3AQVA 4JS8A 4U81A 3O8PA 3A61A 4R6VA 4WSQA 2W9ZB 1RQQA 3QTRA 2WZJA 3Q2MA 3ZC5A 2R3OA 4O21A 2UW5A 3KK9A 2WMSA 4MX9A 5AP3A 3UIBA 3ZRLA 4DFZE 1IAJA 3U55A 1UNHA 3CLYA 3KFAA 4CEGA 3QRJA 2X8EA 5HI2A 1H1PA 1WMKA 1YKRA 2HYYA 4YZBA 4LGDA 5E92A 4HW7A 4KIOA 3UYTA 3PE2A 2E2BA 5CT7A 3Q4TA 1TQPA 4PQNA 4YZCA 2CGUA 3O7LD 4D2RA 4DLJA 4YC3A 3CCNA 2EWAA 2UV2A 4MXOA 5FTQA 3WOWA 4E1ZA 3NVKI 1JKSA 2CDZA 2Z7SA 3DBEA 3Q9XA 2XNGA 4C35A 3P86A 3FI8A 5LVOA 3HA8A 4E5BA 5HBEA 3HDMA 3U9NA 4O84A 3R02A 2C6KA 1QCFA 5HO6A 4YPDA 3D83A 2UZBA 4DT8A 4PDOA 3EFJA 1OIQA 5DHJA 2W96B 3ZMMA 4K11A 4CQEA 3UNJA 2UW9A 2GTNA 2PMNX 5DNRA 3C5UA 2EU9A 4MD8E 2QLQA 3AT2A 2OZOA 1XH9A 1JKTA 2WOTA 3MY1A 4JL9A 2DS1A 2ITZA 2P55A 3RGFA 1NW1A 5ETCA 2A19B 2AC5A 3PLSA 2PUIA 4ZP5A 2QD9A 4LUDA 4G3DA 2PVMA 5LARA 4HVIA 1ZYJA 5I9WA 4PTEA 3CJFA 2UW4A 4QTAA 2O64A 4DH5A 2KULA 5J7BA 3RP9A 5KHWA 4FTLA 4KBAA 4NW6A 3NLBA 4Y73A 4YJVA 2JC6A 4DH1A 2X2LA 2C0IA 3LVPA 2YFXA 2NNWB 4WNPA 2WMUA 3DDQA 3R8LA 5E90A 4ZZNA 4V01A 5AWMA 1J3HA 2WMWA 5CZIA 3R21A 5JFXA 4K8AA 4M69A 3S95A 2HOGA 2QHNA 3FDNA 1IA9A 3AGMA 1WVWA 2YWPA 5KMMA 1ZWSA 2UW8A 5CWZA 3DAEA 2PULA 4A06A 4OTQA 3MIAA 1DAYA 3G15A 5BVDA 4NCTA 2XIRA 3KF7A 4I94A 2J6MA 5CNOA 3C7QA 5BNJA 4I1ZA 3VO3A 3R8PA 3ZFYA 4DGMA 2YEXA 4YLJA 2FVDA 3CR0A 3DQXA 3QTSA 4U42A 3WIGA 4TKSA 4ZJJA 3KXNA 4NUSA 1XHAA 4Y5QA 5FTGA 4F6UA 3VRYA 4EZ5A 2VD5A 3G33A 4R3PA 5IH6A 2PE1A 2XP2A 1XBAA 3FZTA 2B53A 4S34A 2Z7LA 3R7VA 5IQHA 4BGQA 4UN0C 3GENA 4XYFA 5H8BA 3REPA 4FG7A 3SC1A 3AC8A 3W8QA 5AR5A 2WEIA 1R0EA 4CT1A 5JGBA 1PXOA 5HE1A 3ZO3A 3UOKA 4IX5A 4YZ9A 3TXOA 4FSTA 4QMNA 3WZKA 5HORA 5DA3A 1ZY5A 2BRHA 3GU8A 2RIOA 3F3TA 3SOAA 2WTIA 3ZU7A 1GNGA 3GC7A 5EOLA 2P2HA 3R7OA 1CKJA 3P1AA 1JSUA 2QO9A 2CN5A 2W1FA 4XMOA 2YISA 3EIDA 4FKRA 1PXLA 4J95A 4X2JA 3UQFA 2V7AA 4LI5A 4QQTA 3QTIA 4W4VA 3RTPA 4QTBA 4D9UA 3PA3A 3ZBXA 5T6KA 3RM7A 4FTCA 4G6OA 3F5PA 4EI4A 2ITVA 3FZPA 4I6BA 3WILA 3LXPA 3OTUA 1YXUA 5DT4A 3VQUA 3JR1A 4YJRA 4U3YA 4L3PA 2XKEA 1RDQE 4O82A 2PMOX 2HIWA 3LQ8A 2YN8A 2GHGA 4DFBA 1YOLA 2F4JA 3LAUA 3Q6UA 4EH5A 2YAAA 5HLPA 3FBVA 4F7JA 2B9HA 3AC1A 3P78A 4C4GA 3MH1A 3GOKA 3RK7A 2JKKA 5HICA 2XF0A 1CM8A 1E1VA 2Z7RA 3PXRA 2XM9A 5HO8A 2ZV2A 3KVWA 4C36A 3OT3A 5E9EA 5ANOA 3VBQA 4E4LA 3MBLA 1M52A 4TWPA 4MH7A 4EH9A 4RQVA 3FHIA 4F9BA 1LEZA 4RJ4A 5E8XA 4UXLA 2ITQA 3JVRA 2R5TA 1ERKA 4CMTA 4GL9A 3ZEPA 4O7ZA 2OGVA 2F9GA 3JUHA 2ZM3A 1V0PA 2XM8A 2QC6A 4RLLA 3SOCA 2C1AA 3ULIA 1QMZA 1MUOA 2I0HA 3KB7A 2YM5A 3NUXA 3SLSA 2O3PA 1KV1A 1HCLA 3UC3A 4H05A 4ASZA 4FV1A 4O7RA 4KSPA 4CV9A 2A4LA 4O0RA 2XK9A 4WOVA 4JX7A 1XH4A 4RVTA 4FV9A 4BKYA 5DG5A 4EH8A 2XA4A 5AUVA 4ZLZA 3PVGA 4TY1A 2FSLX 2JBOA 3LCTA 4A9TA 4YR8A 4ZS4A 2R2PA 5IQGA 4F4PA 5BUEA 4FNWA 3Q5IA 3PA4A 3LQ5A 3O17A 3ZYAA 2IPXA 3FMDA 4YLLA 1G8SA 3RPOA 4I6FA 2UW3A 4C8BA 3I4BA 1PMVA 1W7HA 4QOXA 5HCYA 5CALA 1JSVA 3GBZA 5EK7A 4IAFA 3UIMA 4C4JA 4EBWA 3D7TB 5CXHA 5AR7A 3LCDA 4RPVA 4FV8A 1H1QA 3DKOA 3GFEA 3KGAA 2EVAA 4IX3A 1AQ1A 4CKIA 3SW7A 3TUBA 4CT2A 2A1AB 3W2RA 3ORIA 5B2LA 2QG5A 5TE0A 2ZB1A 4BBMA 4YJSA 3HMOA 2IN6A 3RJCA 1ZOHA 2GS6A 3CQWA 3SVVA 3E5AA 5FXQA 4CNHA 5BUIA 3P4KA 4RFMA 3SA0A 1KWPA 3BGQA 3CIKA 3CPBA 1IG1A 5FEEA 1CSNA 1Z57A 3E8CA 4I24A 3RK5A 3ZRKA 3RCDA 1KE9A 4KS7A 3HL7A 2UVXA 3VW6A 3I79A 1ZMUA 3A7IA 2NO3A 2XIZA 4FKPA 4RT7A 5GJDA 2JD5A 3VVHA 5BYZA 2BPMA 2CPKE 3UNZA 3VUIA 4YNEA 5CAPA 3OF0A 1O6LA 3WZEA 4ZSEA 1UNLA 3F5GA 1YWVA 4N6YA 2IZUA 3AC3A 2IZSA 4KA3A 4BZOA 4MBIA 4UALA 4EHZA 2J0KA 3IDPA 3P7AA 3D15A 2ZDUA 3V6RA 3HRBA 2PY3A 1ZMVA 4ASXA 2ZAZA 1FINA 2XK4A 3IOKA 3FMLA 1X8BA 2X9EA 2OXXA 3PY3A 1XWSA 4FGRA 3KY2A 1JQHA 2ITNA 4QMSA 4ENXA 5CI7A 4YNOA 5CTPA 3KCKA 3HRFA 3MSSA 5AV2A 4EBVA 4BCMA 3QLFA 3QD2B 3A2CA 3R7EA 3AT4A 5IMEA 5C26A 3I1AA 5GNKA 4IWOA 3FL5A 4O38A 3VW8A 3DKCA 4IIRA 2PVFA 3FC2A 2VN9A 3V5QA 4DLIA 5CEPA 3PVBA 4I5MA 3F3WA 4AGUA 4CVAA 5A54A 4ZSLA 3L8VA 2W06A 3COIA 2W5BA 3MH3A 1J7IA 2Y0AA 4CSVA 2FGIA 4PTGA 4F1MA 1G5SA 3UZPA 4F1TA 4YUQA 5C27A 1R39A 2A0CX 2PZRA 3GCVA 4WRGA 4XP2A 4AT5A 4W8EA 5EM6A 4ACHA 2CKOA 2Y4IB 3QBNA 3QCYA 4LOQA 4GYIA 4Q2AA 5C8MA 1ND4A 1W83A 4CFUA 2I40A 4JDKA 4PDPA 4J98A 2PVYA 2YIQA 4USFA 3W55A 3ODYX 3EN4A 5LMAA 4O0UA 4FTUA 3GCPA 4O1PA 3C50A 4LV5A 1FMKA 4MXAA 4PL3A 3JY9A 2C69A 1OKZA 4R3CA 2P4IA 4YO4A 1PXIA 2C0TA 3NYNA 4E20A 3O23A 4P7EA 4NTSA 3QRTA 5AAGA 2HXLA 4L00A 3N4TA 2VTPA 2VX0A 4NEUA 3WZJA 3CGFA 4RJ6A 4R7IA 3DXPA 2PU8A 4QT1A 2ITOA 4W9WA 5AIKA 4AZVA 4OAVB 4CV8A 4X6RA 4LYNA 3DBDA 5IA0A 3TNQB 3V01A 5JT2A 4P90A 2ZM1A 2WQEA 3FI3A 4IWQA 2WTKB 3Q9WA 4B7TA 1XQZA 1U54B 3SAYA 5CASA 5JZNA 4TTHB 4JR3A 2V22A 4G3GA 4M84A 3ZO4A 3F2AA 3UJGA 3W1FA 4NW5A 3A8WA 4EWHA 4F70A 3QD4A 4MNFA 4U79A 5FXSA 2I7QA 4FBXA 2RKUA 3EOCA 4RJ7A 4EWQA 1UV5A 3QA8A 3CTJA 1J1CA 3EQBA 2X7FA 4FKJA 4QO9A 4A4XA 5AIRA 4FZAB 1YXVA 5HLNA 1H26A 5FM2A 2YZLA 2R3RA 3K3IA 4IW0A 5CSHA 3GU5A 4NH1A 3ZZEA 2XKDA 4O0WA 4IH8A 2R3LA 5IUIA 3MTFA 5H8GA 4IVAA 4UYAA 4JVGA 1PXNA 1W98A 5F20A 5HE2A 4AGDA 3S1HA 4KRDA 4BR3A 5IQFA 2CGXA 5AV4A 3FYJX 2F2CB 5M4IA 4DGNA 2XNPA 3O71A 3OT8A 5L8LA 2JEDA 3QUEA 3UVPA 4AE9A 4MXXA 1Q8UA 4IM2A 3QHRA 3VRZA 2XEZA 4BKJA 3QAME 1WBOA 3F5UA 4PWNA 2BFYA 4X3JA 5J9ZA 4P5ZA 4YLKA 4E7WA 1BKXA 1OL1A 2OO8X 1ZMWA 4V05A 4D5HA 4D2WA 5LCKA 3ET7A 3OHTA 4LL0A 1EH4A 2X4ZA 4JR7A 4HVDA 5LXMA 1NXKA 3FLYA 1V0OA 4NM0A 3LMHA 3EJ1A 3IONA 2ITXA 3MYGA 2B9IA 3UQCA 2X2KA 1R0PA 2WTDA 3NUYA 5CSPA 1Y8YA 4N70A 5I9YA 2O5KA 4YJPA 5E1EA 4CD0A 4A7CA 5EYDA 1FVTA 4FTQA 4D2PA 2ITTA 5EM7A 3IW4A 2XCKA 4E6QA 2ETRA 4JNWA 2VO0A 4LMNA 4XEYA 4E93A 4FT3A 2HCKA 4BIDA 2PZYA 3FZRA 1H24A 5CSVA 3UQGA 1PXJA 2WQOA 4YJOA 4JDJA 5DI1A 1Q62A 4L8MA 4QP8A 5HG5A 1W0XC 4BCHA 5A9UA 4ZY5A 1OIUA 3OWLA 3VIDA 3S0OA 3ACJA 3KU2A 2X7GA 4FIJA 1XH7A 2ITWA 3GUBA 5B2MA 3PSDA 3E3BX 3FI2A 3LXKA 4PF4A 1M7NA 4D9TA 3LKMA 5DEYA 4C62A 5JRSA 2OICA 4KKHA 5BVKA 3WZDA 3OFMA 4H58A 4WBOA 5HIBA 4IB1A 2VWYA 3R9DA 4QYEA 5HCXA 5GZ8A 4JG7A 3OUKA 4AS0A 4UZDA 5CEQA 4MHAA 5KO1A 5M09A 1RW8A 5A6NA 4O7WA 3VF8A 1Q8YA 2GNIA 4XNEA 3HAMA 2W1HA 4JBOA 2C3JA 3R22A 4CCBA 5HLWA 2H8HA 4GIHA 1FBNA 2Z02A 4USEA 3OCGA 4BI0A 4CMUA 3VBYA 3VBXA 4AW0A 2JGZA 4UMUA 4Q9ZA 4M12A 4RX5A 4F7LA 4JT3A 3ZM4A 3FMNA 4BCKA 5AP0A 2P33A 2R9SA 3TL8A 3R2BA 3WI6A 2ONLC 3IK3A 2J0JA 2VNYA 4XRJA 1PRYA 2F49A 5I5ZA 4R78A 2VTTA 2XZSA 1W8CA 4ASEA 3DK3A 1S9IA 2PHKA 3CEKA 4O7SA 3FYKX 3D0EA 4YGAA 4D1SA 2ITPA 1PYEA 2ETMA 5HKMA 1YI6A 1APME 1Z5MA 2OSCA 4F0GA 1UVRA 3ZTXA 2BTRA 2B55A 2W17A 4KBCA 3UOLA 4CLJA 5FG8A 4FKGA 3A60A 1YVJA 3DOGA 4KUJA 5FBOA 2X7OA 2W5AA 2BALA 2R0IA 3DV3A 4FV7A 4BTJA 5J1VA 1GY3A 4P2KA 1W84A 4G5JA 4C34A 4MNEB 2J9MA 4JRVA 3R7IA 4YTFA 1OL7A 3U54A 3ZFXA 1NVSA 4S32A 5J87A 4L43A 1WBTA 2FUMA 3KRJA 3NNWA 4G3FA 4F6SA 2VTQA 4RC4A 1DI9A 4ZS0A 2QG7A 2VTJA 4PL5A 3QYZA 3RHKA 3FQSA 3LMIA 2EXMA 2UZDA 3Q9ZA 3MESA 3FAAA 3IECA 2A2AA 1OPLA 3HUBA 3SXFA 4DEAA 3QRUA 5FDPA 5L2TA 1MP8A 3JPVA 3VHEA 4X2GA 1G8AA 1H4LA 4LRJA 3MFUA 3L9NA 4DEDA 4FL2A 5BVWA 4BDDA 4K1BA 4QP1A 5DBXA 4EONA 3ORXA 4CXAA 3EQGA 4F65A 1YXSA 3GU6A 4M3QA 2AC3A 3HYHA 2Z60A 4GJ3A 4ZTMA 4ENYA 2QO2A 3GU4A 3QWKA 4HJOA 1LPUA 4ZIMA 1A06A 3FI4A 3PRIA 4RA5A 1JKLA 2YIXA 4GMYA 3CQEA 3GGFA 2CN8A 3NNXA 5CEOA 1SMHA 3SV0A 2CHLA 3CS9A 4HYUA 4DGLC 4QRCA 3SRVA 3KRRA 3EN9A 3IDBA 4PY1A 2V55A 1OM1A 3NW6A 5GIOE 2FSMX 3ORLA 4U0IA 4L68A 2QOIA 3THBA 4ZMFA 5IH4A 5I9XA 3QZIA 2VWIA 3DY7A 4GJ2A 2X39A 1KSWA 4I5PA 4YPSA 3T3UA 3QQLA 4U9AA 3SXSA 5LVPA 3MB7A 4M68A 4BF2A 3TT0A 3E7OA 3VULA 4CQGA 4GIIA 2CJMA 4C3PA 5D41A 4L7FA 3WE8A 3FL4A 2QCSA 3H9RA 4ITHA 4KIPA 3OG7A 2YLEA 5K4JA 3C1XA 4RZWA 4D4VA 4QMXA 4FZDB 3I0OA 2QU6A 5EI8A 5TT7A 4FKVA 3RBWA 3QRKA 2XCHA 4CLIA 3OP5A 3PSBA 4K6ZA 4BYIA 1VEBA 2WMXA 3GCQA 4GYGA 3POOA 4L01A 3TI1A 4IFCA 4E6CA 5C8KA 1Q4LA 4O6EA 2E9VA 3BE9A 4EHVA 4EORA 5KMOA 3B8QA 2J2IB 3IKAA 1ZYCA 3FY2A 4ACGA 3NAYA 1BI8A 4A4LA 4BZDA 4DT9A 2F7XE 1XH6A 3HMNA 5EKOA 3II5A 3QC9A 3RAIA 4AGCA 3PYYA 4EOKA 2C5VA 2W1CA 3K5VA 4MTAA 2QOBA 2FYSA 2UZEA 2VTMA 5H3QA 4L44A 4TZRA 3AD6A 2J0MB 2C3LA 4TYHA 3DB6A 3C4ZA 5GHVA 2B7AA 2Z8CA 3NS9A 1YHWA 5AX3A 5KZIA 4JI9A 3RCJA 5LMKC 4MWHA 4FIHA 4V0GB 4OTFA 4KINA 4RGJA 3LZBA 5D10A 2PE2A 4AZTA 4FUYA 5AV1A 3MFSA 4FSNA 4OBPA 4NKAA 2RSVA 5DIAA 2JDVA 2R0UA 3IGOA 5AUWA 2VTAA 1Q24A 5EDQA 3WF7A 5AFVA 4EH7A 3P79A 4ZTRA 1URCA 3RAKA 5J9YA 3QQUA 3R1SA 5AP6A 3QZHA 3IQ7A 4ALUA 4NU1A 1BLXA 4FSRA 4QYGA 3W2QA 5AUXA 1Q97A 5IDPA 3TEIA 4D4SA 2OIDA 2JDRA 3I7CA 5DEWA 4FZ6A 4QQJA 3PJ8A 3CJGA 5FEQA 5A4TA 4IE9A 3PZHA 4QMTA 4FV4A 5EG3A 5I9ZA 2BRNA 4GFOA 2OWBA 3R8MA 3G9NA 1L8TA 4AN9A 2C4GA 2W9FB 1YHVA 3CD8A 4FSYA 2BZKB 1FGKA 1U59A 1SYKA 1STCE 4HCUA 5IQIA 2W0JA 4WRSA 4WG3A 3MVLA 4LG4A 4I41A 2XS0A 5CI6A 4WT6A 5EHLA 4YURA 3F61A 4GSBA 4HZRA 4M0ZA 4RMZA 1IEPA 3TZ8A 4M66A 5JK3A 4PMPA 4GG5A 1SZMA 4DFYA 1A48A 4I23A 1OL6A 3VHKA 3BQRA 4AT4A 2E9PA 3PPZA 3GC8A 2XK6A 1GZ8A 3F3ZA 3GT8A 3R1YA 2C47A 4C3FA 4F1OA 2I0VA 2JDOA 1IASA 4PPAA 2XKFA 1J7LA 4UV0A 2HWOA 4NIFA 2WMBA 4R1YA 3SRVB 3PVUA 1ZXEA 1Q8TA 4PNIA 5EQYA 2H96A 1OBDA 3PFQA 2HZNA 4CRLA 4OGRA 4MWIA 3GFWA 2UUEA 3HMMA 3E8DA 4M97A 3ZLYA 3L9LA 5BVOA 4PL4A 1OUKA 5KUPA 3ZFMA 5J95A 5AR4A 4IZ7A 2GPHA 4PMMA 3VJNA 1YWNA 1OGUA 4UXQA 3ANQA 3A8XA 1GOLA 1VZOA 2HW7A 5AUYA 3OCBA 1JBPE 3BHUA 3HV5A 3FXWA 1XH8A 5AP7A 3HGKA 2Y4IC 2WU6A 4E3CA 3UZTA 3H30A 4EK8A 4RC3A 3KL8A 2HENA 4DC2A 3UOHA 4UYNA 5TF9A 4XH6A 4FEWA 2BAKA 1XO2B 4N4SA 2NRYA 1IAHA 4R77A 3HP5A 3ZDIA 5FP5A 3L8PA 4RX7A 5L6OA 4FL3A 2XIYA 2C6EA 3TDWA 3SDJA 3OWKA 4O22A 4EUUA 3KMUA 4IX6A 3FEGA 3D5UA 2OXYA 3ORKA 4X3FA 5AM6A 4C3RA 5IA3A 4AQCA 4YTHA 4OTWA 3A99A 1PKGA 4MCVA 2ESMA 3OCTA 2Y9QA 3DTWA 4DFNA 3TDVA 4F09A 2OI4X 3K2LA 3DS6A 3O2MA 3U9CA 4X2NA 4ANMA 2R7IA 1Q8ZA 3KMWA 3L8XA 4NKSA 5CU6A 2C6LA 1YHSA 2G15A 5IUGA 3Q4CA 3UBDA 1H00A 4H1MA 2IW9A 3EZRA 1LEWA 5CZHA 3PXZA 5CENA 2WTKC 4BDIA 5KNJA 4ID7A 4YHJA 2CGVA 4DH7A 3KK8A 4XG6A 1TQMA 3FPQA 3ZO2A 4AP7A 2Q83A 2PL0A 3QZFA 4A4OA 4QMLA 5EQPA 3BRBA 5CF8A 1F0QA 1PMEA 2GCDA 4WNKA 5AMNA 3LM0A 4GEOA 3FSKA 4MBJA 5AP2A 4C2VA 5HTIA 1BL6A 3VS3A 3NUNA 3Q96A 1UNGA 4AN2A 3DFCB 3P9JA 4IWDA 3ZUTA 2OZAA 4CTBA 2UZNA 3C13A 2IVUA 4G34A 4RVLA 1WBPA 4O7YA 4U41A 5EM8A 3MVMA 1Q99A 4RIXB 3V5TA 1B39A 2RF9A 2G9XA 2WIPA 4QYYA 3EQIA 4NFMA 3SXRA 3OWPA 2A27A 3U87A 4AWIA 4EK5A 1TKIA 2GFSA 2X8DA 1YDRE 4C4IA 2PWLA 3ORPA 4ALWA 3WIKA 3DXNA 3EH9A 4AW5A 2VU3A 3H3CA 3B8RA 2B54A 4EQMA 2XBJA 4YJTA 3CPCA 3D2KA 3QL8A 5E8VA 1UKIA 3OROA 5ETFA 3VUGA 1B6CB 3ZC6A 3RNYA 4OT5A 3QGYA 5HU9A 3GC0A 2R7BA 3JYAA 2CKPA 3CKXA 4BY9E 3EB0A 4TPTA 3L1SA 1ZOGA 2UVZA 2BAQA 3NGAA 3G90X 4FL1A 4JRNA 4UMQA 4GK3A 3MPAA 4FODA 2WKMA 4AAAA 4W4WA 1ZOEA 2JAMA 3FUPA 3TZMA 1H25A 3V8WA 1BMKA 4X6QC 4PDYA 2W1ZA 4OBOA 4BTKA 1JKKA 5K0XA 2QHMA 1H27A 2YDKA 2PVHA 2YIYA 4U44A 5BX0A 3FY0A 5JQ8A 4ZTNA 3ZSHA 3JY0A 1PYXA 1DM2A 4XG9A 5CAOA 1T45A 4CKRA 1OB3A 4II5A 2BRGA 3IW6A 3E8NA 1ATPE 3D5VA 4TYIA 3LXNA 4JAJA 1CKIA 3V04A 3F5XA 3R7YA 4F0FA 2JLDA 4CFMA 3FC1X 3LFQA 1K3AA 4FR4A 1XBBA 4DTKA 2PTKA 3QQHA 3QU0A 3RPVA 1F3MC 2GS7A 1XBCA 1ZY4A 5HG9A 4AUAA 4BTMA 4FTRA 4KBKA 2G01A 2R3HA 4KD1A 4EQCA 5CLPA 5JGDA 5E4HA 3TV4A 2R3KA 2ZMCA 3UVRA 4EOJA 5B7VA 3O8TA 2YIRA 3BPRA 5DN3A 5JKGA 5LMBA 4ZTSA 5AADA 4OBQA 5EM5A 4CZTA 4XV2A 4I92A 3FQHA 3NIZA 3FKOA 2YABA 5CU0A 4G3CA 5F94A 1ZYSA 4GT3A 1YDTE 4UMRA 4WD5A 3QKLA 3QQKA 2QOLA 4BGGA 5CF5A 4RVMA 5KHXA 3BZ3A 5J8IA 4G17A 5IISA 4E4NA 3EQDA 2GDOA 1OL5A 3FWQA 3AG9A 3IG7A 4LQMA 1FMOE 4FKTA 2HY0A 4IDTA 5C4KA 4M69B 4D0WA 1FPUA 5ETIA 4FMQA 4KABA 3TIYA 3RHXA 2WOUA 4JDHA 4FKWA 4I5CA 4KS8A 4EOMA 4M15A 2R3JA 5IQDA 4FT9A 5HD7A 5HX6A 2XJ1A 1KV2A 1XH5A 2C0OA 1J7UA 3Q4ZA 2ITYA 3R28A 3JS2A 4RWKA 5M55A 3BEGA 3RAWA 2XH5A 2W4KA 3GP0A 3U51A 4DTAA 2YM6A 2JKQA 5ANGA 3NDMA 4MYGA 3G51A 3TCPA 4OTGA 1UA2A 3ORNA 2GMXA 3I0QA 2KTYA 2OZAB 1H1WA 4LRMA 3OW3A 4R5YA 4EOLA 3HA6A 3R8VA 3SD0A 5HOAA 3P08A 4Y83A 3HRCA 4DEGA 1U5RA 5AV0A 4D28A 2BROA 5KX8A 4UWBA 3GCSA 4GRBA 2GSFA 3V8TA 3VBWA 3OMVA 3PUPA 4ACDA 2RG5A 5EHOA 4EK6A 3UMXA 4M14A 4EC9A 5GIPE 3DA6A 5EH0A 3UVQA 4I20A 2O2UA 4ANQA 5A14A 4IADA 4RJ8A 3V5PA 5CVFA 5KMKA 4O7LA 4ANSA 3ATSA 3N4UA 4YP8A 1UKHA 4I6QA 2HK5A 4YU2A 2YCRA 5DOSA 4FF8A 5M44A 2QOHA 3TACA 3VWAA 5HTCA 4IJPA 5AM7A 1MQ4A 4GUBA 4DFUA 3HLLA 3BLHA 3QUPA 2OJFE 4HGTA 3A62A 3SW4A 1YRPA 4DITA 5TR6A 1TVOA 1S9JA 1DS5A 4WHZA 5L8KA 2XNMA 4G6NA 4C4EA 4QNYA 5DYJA 3KVXA 4ZSGA 3PJ3A 4KB8A 4QMYA 4AX8A 5H9BA 3QYWA 4EKLA 4BCOA 3R04A 5CYIA 4O81A 1WVYA 4NJDA 4CZUA 4FICA 3PXFA 3LQ3A 2RFNA 3DKGA 5BYYA 4C02A 2E9UA 4YHTA 3UMWA 5CAQA 3ATTA 3DU8A 4E4MA 2R3IA 4LGHA 4MEDA 3NZ0A 1U46A 3OUNB 3OBGA 3NUPA 4JBPA 4DEHA 1PF8A 3BQCA 2QNJA 3EYHA 4IC8A 4OTHA 4N57A 2UZLA 3DZOA 4PMTA 2J5FA 3QLGA 2AUHA 4PUZA 3ZM9A 1Q61A 3AC2A 5CQWA 2W1GA 4PDSA 4BWPA 2VZ6A 5K9IA 5IUHA 3S3IA 5DT0A 3PXKA 3PPKA 2DWBA 2CLXA 2OIBA 5FBNC 3ZUVA 3PWYA 3NPCA 3CY3A 3DDPA 2BAJA 5AEPA 3G0EA 4UB7A 5AAEA 3I5ZA 2C6DA 4NM3A 2QU5A 5JFSA 3ZSGA 3C4EA 2XVDA 3BGZA 3U6JA 1PY5A 3H0ZA 3W8LA 5M4CA 5HTBA 4DFLA 2QI8A 3NWWA 3OTVA 3I5NA 3VC4A 4AOTA 3R2YA 4FKUA 2IZRA 3V5WA 4HOKA 4KKGA 2WQNA 1MQBA 3HP2A 4GFGA 5CS6A 3IDCA 4F9WA 4AOIA 4C58A 2IW6A 4I22A 4XG7A 5FD2A 4BKZA 4USDA 3DNDA 4BGHA 3H0YA 4IZ5A 4O1OA 2I1MA 4EH6A 4EK3A 2JIIA 2QKWB 3PY1A 5AR8A 5GJGA 4CKJA 4GS6A 4RFYA 3OXIA 4K9YA 4NJ3A 3MW1A 3QD0A 5E8UA 5IU2A 3IW7A 4V04A 2VV9A 3D5WA 4YZDA 3W2SA 3MI9A 1FOTA 2YLFA 4TWCA 3OOMA 3Q9YA 4L3LA 4DHFA 5DVRA 5EDRA 5CAUA 5M4UA 4ASDA 3TIZA 2BHEA 4N6ZA 3TUDA 3COKA 4O2PA 2OF4A 2CKQA 3A7FA 2CSNA 5I9UA 2X1NA 3BV3A 1H0WA 3DNEA 3M11A 2HY81 3EQCA 1WCCA 4G16A 4PP9A 4Q5HA 3PG3A 5CU4A 2QKRA 3R6XA 2C5OA 3F69A 4GFMA 5AR2A 3UIUA 4XCUA 1Y6AA 5IA2A 2AYPA 4S31A 5A6OA 4PP7A 4BDBA 5BVFA 4FUXA 4GT4A 5HG8A 4DA5A 4ORKA 4W9XA 3MGYA 3OOGA 4IHPA 1O9UA 4J8NA 5B2KA 3V5JA 3BIZA 3PWDA 2CNVA 4E5AX 4FEUA 4M67A 4BCQA 1Y57A 5JN2A 2FSTX 1QPJA 2JDSA 4TWNA 4C57A 2QODA 5A4CA 3CE3A 1VYZA 3PIXA 2HAKA 3ZLWA 3OY1A 5ACKA 4L67A 3ZZWA 3CTQA 3FE3A 3K54A 4Y85A 3P23A 2QOQA 4NFNA 1OKVA 1WBNA 2BTSA 4OTIA 4GV1A 4QTDA 4ANOA 4D2SA 5JH6A 2VWUA 3QXPA 5F1ZA 4ZEGA 3Q04A 2OH4A 4FZFB 4AA4A 3R30A 3ETAA 3D9VA 1J1BA 5L2WA 4QMOA 1V1KA 3Q32A 4RFZA 3H10A 3QTXA 4TRLA 1IR3A 2IJMA 3UO5A 5ANIA 2UZOA 3OW4A 5CSXA 2EUFB 5IKWA 3OC1A 4MAOA 5BQ0A 4L7SA 4E4XA 2F7EE 4MF1A 3BWFA 1H07A 2J0IA 4BIEA 2W7XA 3NR9A 4BICA 4NM7A 1H1SA 3FHRA 2B9FA 3HNGA 3EL8A 4AW1A 1NY3A 3KF4A 4I0TA 1YI3A 3C4FA 5DR2A 3PXYA 1CTPE 3R73A 5DFPA 2VWWA 1Q3WA 2P3GX 4CGAA 2C1BA 3FMHA 2GFCA 5I3OA 2R3QA 4GKHA 1ZYDA 2LGCA 3PTGA 4QP3A 2BKZA 3W16A 5TOZA 4QP6A 1Z9XA 4K33A 3QQGA 4X2KA 1E9HA 2RFSA 5HNGA 1L3RE 3TZ9A 4DG0E 1SVHA 3PP1A 4U97A 3AC5A 3IGGA 2BIYA 3QWJA 3VS6A 4UEUA 3F2RA 2FH9A 3WE4A 2BMCA 2YZAA 2QOKA 4NSTA 3QX2A 4U43A 5HE3A 4W4XA 5HBHA 2O0UA 3KXMA 5IDNA 1KE7A 1PXMA 4XV9A 4UY9A 3WF8A 4KKEA 4D1ZA 5K5XA 2Z2WA 4FVRA 4FEXA 1BYGA 4MD9E 3ZXTA 5KMLA 2JFLA 3RZBA 4LMUA 4AGWA 4DEBA 4NT4A 4O0XA 4L46A 2IVSA 3ROCA 2V62A 4G2FA 3W10A 4H36A 4IACA 3MV5A 3O50A 4XG2A 2VO6A 3FLZA 3Q5ZA 5FTOA 2OJJA 5C9CA 3PLAE 3KKVA 2OJ9A 3NW7A 4KRCA 3QQJA 3ZO1A 2VTLA 3PIYA 3ID6C 4J8MA 1OVEA 2WU7A 3EFLA 4XUFA 4BBFA 4F9CA 1GJOA 4BI2A 3DPKA 4QNAA 4C59A 3TKIA 2WB8A 5HZNA 1Y8GA 1MRVA 5AV3A 5E8WA 2WIHA 4YZNA 2WMTA 5CVHA 3NYVA 1CDKA 2GNJA 1NT2A 3FMEA 4O7VA 4FSWA 5CF4A 3PP0A 2PMLX 3EFWA 3ROYA 4KIKA 5IMXA 3ALOA 3FJQE 3BU5A 3TNWA 2FO0A 2X8IA 3PY0A 4DGGA 1ZZLA 4FEQA 5DGZA 3KCFA 4HNFA 4IB3A 1JSTA 3WZUA 3ERKA 5CEIA 4DBXA 3M42A 2OJGA 3ZCLA 5ACBC 4J1RA 2NPQA 4FTTA 2RL5A 2VGPA 2XNOA 3MDYA 4TWOA 5LWNA 3LLTA 4AN3A 3FV8A 3NX8A 4E6AA 2WAJA 4ZLOA 3BI6A 3O0GA 3QCXA 1QPDA 5FWKK 4EQUA 5IEXA 4G1WA 4EZ3A 4Q9SA 2BVAA 2RFDA 2I6LA 3KULA 4HCTA 4BDCA 3ALNA 2J0LA 3RVGA 2UZUE 3DTCA 3O96A 3SKCA 4C37A 3TZ7A 3FSFA 4HVGA 3F3VA 2CNQA 2C6MA 5CSWA 4UWCA 1LR4A 1O6YA 1OPJA 4IC7A 5D1JA 3K3JA 1IRKA 3R9OA 2Y4PA 1VR2A 4EH3A 3E87A 1M2RA 5BYLA 3F7ZA 1P4FA 3AT3A 3VS4A 3AOXA 2VTOA 3TV6A 4X7QA 5FXRA 4S30A 4DEIA 1LP4A 5LVNA 4OT6A 4WKQA 4DGOA 5KKRB 3UYSA 1BI7A 4EUTA 3E63A 4NTTA 3FLWA 2PYWA 2R3GA 4B99A 4BTFA 4CFWA 2H34A 3TKUA 4DCEA 5IQBA 4WNOA 5ANJA 3FMKA 4BI1A 5M4FA 1SNXA 3EQHA 5FM3A 3HUCA 4J52A 4YJUA 2WHBA 4BDHA 5J79A 2WTJA 3DB8A 1U5QA 3FLQA 3QXOA 3MA6A 4K0YA 3CQUA 1M2PA 2VWXA 3BU6A 3E7VA 2O8YA 3C0HA 3OZ6A 3HMIA 3RI1A 2XRUA 3WF9A 2C3IB 3F2NA 4TYEA 5E8ZA 1YDSE 5DWRA 3BELA 2V0DA 2Q0NA 3O51A 3BLRA 3LFNA 2PSQA 2UW6A 5IQEA 3MN3A 4J99A 1K2PA 2FA2A 3E8EA 2C30A 3N9XA 5I3RA 5IPJA 1FQ1B 4OTRA 4AXAA 3HZTA 4ITJA 5L6PA 4ZTLA 2IW8A 5F95A 2PE0A 2UVYA 3F7WA 3OD6X 4GUEA 4D4YA 2XK8A 3BBTB 2VNWA 3AD4A 3V6SA 4G6LA 1Y91A 1JLUE 2BDFA 3RPSA 5CX9A 2YJSA 2OFUA 1M2QA 4RBLA 5AP4A 2PPQA 1J91A 2XYNA 5K0KA 4HYSA 3CC6A 4JQ7A 5BMSA 5GZ9A 1Q41A 2Y6MA 2GNLA 4I4FA 2R4BA 3MJ1A 3P7BA 4L6QA 4JG8A 1YW2A 4D55A 3TM0A 1F5QA 2YERA 2IZTA 4PPBA 5J5TA 4IWPA 3MTLA 4DAWA 2B4SB 1WFCA 3QTUA 1PXPA 4I0SA 4I93A 3TTJA 2VRXA 4IX4A 4HPUE 3WF6A 4NCTC 4XBRA 2BR1A 5IG1A 4JQ8A 4U6RA 3R9RA 5M57A 3QQFA 4OLIA 2JKOA 4AZEA 5M56A 2W4OA 4CMOA 3UP7A 5C03A 3UNKA 3PRFA 2CMWA 2XJ2A 3KXHA 5AJQA 3TNHA 1M14A 2PZ5A 4HGEA 4XV1A 2J51A 4FNXA 2I0EA 3Q60A 3FMMA 5A3XA 5JZJA 5KBQA 3N51A 4QMZA 4YJNA 3QGWA 4KIKB 3R8ZA 2W1EA 4QPAA 2ZYBA 4YZMA 2B52A 5DE2A 4QP9A 3BYOA 2Z7QA 5D7AA 5A4EA 2WQBA 3RAHA 2ACXA 3RWQA 4Z3VA 1GIIA 2PK9A 4FZ7A 3UG2A 4QQ5A 3BKBA 3OXTA 4JAIA 4ONAA 4IB0A 2YM4A 3OVVA 3OS3A 2VWBA 4TT7A 4O27B 4QMVA 3UG1A 4C61A 4EYMA 4J97A 2YCFA 5BPYA 1Q3DA 4B8LA 4BCIA 3VNTA 4CTCA 3FZSA 4EJNA 4Z16A 3W2OA 2XBAA 1G3NA 4I3ZA 4WBBB 2ITUA 3DKFA 3KULB 1OITA 3R63A 5CY3A 3WYXA 4IZAA 5M51A 4M7IA 4U3ZA 3HECA 4GCJA 4QD6A 3GU7A 4U5JA 4CFFA 4O0YA 4AOJA 2DUVA 4RWJA 2PUUA 4ZJIA 5T3QA 5IEYA 2WPAA 3D94A 2YAKA 4D58A 4RVKA 2Y8OA 3RK9A 5EYMA 4BVUA 2NRUA 4P5QA 4GT5A 4EK4A 4LRKA 4IXPA 3NUUA 3H4JA 3TJDA 4FTJA 5E8SA 3GEQA 3SX9A 2QURA 2UZVA 4S33A 4XG8A 5CNNA 5HIDA 4CRSA 5LVLA 4F63A 1GZNA 4AW2A 4BZNA 2BRMA 1U4DA 3ELJA 3MH2A 2BRBA 3KXGA 1ZZ2A 3C9WA 4IFGA 3TWJA 3U4UA 3R83A 2PVNA 3I6UA 4RX9A 4O7NA 3WYYA 2GNFA 4ZAUA 2E9NA 4NYEA 3AXWA 4FSQA 4QP7A 2BDJA 3GXLA 1H8FA 2YHVA 5FLFA 5C01A 2W99B 3KRLA 4ZY6A 4F7NA 5L4QA 3PIZA 5J1WA 2WO6A 4C7TA 2OG8A 3GI3A 1GZOA 3PSCA 4HYIA 3DBFA 2XIKA 3TKHA 3R1QA 2FSOX 4UBAA 4D0XA 1FVVA 4FTNA 5BVNA 2JITA 5KCVA 4XOZA 2R64A 5IEVA 1XKKA 2ERKA 3BV2A 1OPKA 3OEZA 4R8QA 2YM3A 4A9YA 3B2WA 4DINA 2X9FA 2HZIA 3FLNC 5ITAA 4EYJA 5C1QB 4XBUA 2C68A 3E92A 4D4RA 4NWMA 3KQ7A 5CU3A 4FTOA 2XNBA 3DK7A 3NAXA 1HCKA 4LM5A 3E93A 4WUNA 3G2FA 5G6VA 1QPEA 2I0YA 5HEZA 4TYHB 4D2TA 3BHTA 4IAAA 1BX6A 1AGWA 2OIQA 2IVTA 3BBWA 4MXYA 5KBRA 4JG6A 2XUUA 3EKKA 3NYOA 3QX4A 4OUCA 4QTCA 3CTHA 3I81A 2YITA 4WIHA 3KREA 4QP4A 1AD5A 4J53A 3CSVA 2ZDTA 4WG5A 3HDNA 2X2MA 5T68A 3MFRA 3F82A 3VBVA 3HMPA 3ZLXA 2RGPA 4D2VA 5HNIX 2HZ0A 5J9LA 1PXKA 4ANLA 2GQRA 2GS2A 4FA2A 2ZV7A 3DXQA 3H9FA 3QHWA 5EI6A 3UGCA 4UX9A 3MIYA 3NVMB 4F7SA 2GTMA 3DBQA 3PJCA 2VTRA 4YHFA 5AUTA 4FSZA 4AU8A 5EDPA 3D7TA 3R1NA 4I21A 3EQRA 1P5EA 5AA8A 4J7BA 2WXVA 4LGGA 4GG7A 4RIYA 2IG7A 1GIHA 4GH2A 2OKRA 4FI1A 2DQ7X 2RG6A 3A7HA 5EYCA 4FOCA 3FXZA 3ZEWA 3HVCA 2OH0E 3TTIA 4FEVA 2WMVA 3EKNA 3QZGA 4H1JA 3BLQA 4FE2A 3LJ2A 5A4LA 3E88A 5AUZA 2VAGA 1ZAOA 3AMAA 3LCOA 4LL5A 3DAKA 4YC8A 3G6GA 4ZZMA 1HOWA 4MQ2A 1B38A 3OCSA 2XYUA 4IDVA 4LV8A 5IF1A 4N0SA 2O63A 4G3EA 2C6OA 4QYHA 4DCAA 2QR7A 4FV3A 5HNBA 4NIFB 5G1XA 4F64A 2JBPA 3VS5A 2IVVA 3QD3A 5C4LA 4GW8A 2YIWA 2VWVA 3NYXA 5L2IA 2O65A 5FUTA 5AR3A 3DJ6A 3ZRMA 2W1DA 2F2UA 2YCQA 4F0IA 2J90A 4QQCA 3MY5A 3L8SA 3NCGA 4IAZA 4KSQA 4HGLA 3EZVA 3LHJA 4C4HA 5ETAA 3RWPA 1WBWA 4A9SA 2XK3A 1REKA 3MA3A 4FTMA 5EW9A 1PJKA 3LJ1A 5K5NA 1YOJA 4JQEA 3F66A 3H9OA 3FKLA 4IMYA 1OUYA 4JX3A 2R3MA 5EW3A 5TKDA 4XX9A 3IPHA 4FV0A 3DGKA 1WBSA 5ANEA 4H39A 4RX8A 3A4OX 2SRCA 4BWKA 4G9RA 3RM6A 2B1PA 2BKKA 1LUFA 4JOAA 4QYFA 5EHYA 4X3FB 5EFQA 3UE4A 4APPA 2QONA 2F7ZE 4BDKA 4KIQA 5DLSA 5J5SA 2R3PA 4MF0A 4GK4A 4D5KA 4NZWB 4FSUA 4GU6A 5ANDA 4CZYB 3HEGA 2QR8A 2UZTA 4FG8A 2P0CA 2BCJA 3KN6A 4I4EA 4BDJA 3POZA 4FTAA 1YXXA 5BMMA 5HQ0A 4RJ5A 3HV7A 3HKOA 4BBEA 1P4OA 3IO7A 3BYVA 3EFKA 2Q0BA 3MFTA 3EWHA 3LFBA 4JDIA 4UZHA 3VQHA 4HGSA 3ENMA 1H1RA 4C38A 4GU9A 4MK0A 2YACA 1R78A 3LFAA 2WELA 4QTEA 2X6DA 3LOKA 3Q6WA 4NK9A 3W2PA 2QVSE 3GVUA 1ZLTA 4IQ6A 5K4IA 2PUPA 2BZHB 2QQ7A 3RNIA 4EL9A 4FVPA 3O7LB 5EQEA 1QL6A 3QKKA 5E8YA 3ZH8A 1U54A 5FRIA 3DCVA 3Q3BA 4GVJA 4EOIA 1JVPP 4FKIA 2OK1A 3PE1A 3MJ2A 4OTDA 4XP0A 4XP3A 2XRWA 5LJJA 4RRVA 2G2IA 5JMSA 1UU8A 4Z7HA 4ITIA 4FG9A 4IAIA 3L9MA 5DRDA 5EI2A 2C6IA 2BZJA 1WAKA 4MXZA 3QTWA 4Y5HA 4X0MA 2PVKA 3VJOA 3DZQA 2VTHA 4TXCA 4RIYB 3UPXA 1XJDA 4O0TA 4G31A 4BHZA 3F88A 4HCVA 4ARKA 4AZFA 2DYLA 4I5HA 4DG2E 4DH3A 3R8UA 3HV6A 5HGIA 3JVSA 2YWVA 4ANBA 1OIYA 4JIAA 1Y6BA 3BHVA 3FMJA 4FIFA 4FX3A 2OF2A 4TNBA 4LOOA 4XG4A 5C8NA 2NP8A 3ORZA 4LUEA 2GU8A 4FGBA 4E73A 4BL1A 2C5XA 3ZXZA 3ZDUA 2ZJWA 3RALA 5AP5A 5CAVA 3NW5A 4TYJA 2WMRA 2JKMA 4IM3A 4WSYA 5AAFA 4UMPA 2PVLA 3BHYA 1FGIA 4FK6A 3EQFA 3MPTA 4FKOA 3OXZA 3RKBA 3FLSA 2HXQA 3FXXA 4APCA 5HO7A 4TW9A 3DT1A 1ZARA 4X21A 3GC9A 4O0VA 2XNEA 4FIIA 2PZPA 3D4QA 5JEBA 3NIEA 4BCJA 5IA1A 5IA5A 4RWIA 4L45A 3RPRA 2BHHA 5JQ5A 5KKRC 4RSSA 1IA8A 1Q5KA 4U8ZA 5L6WL 4YBJA 2HWPA 3F9NA 3I7BA 3DLZA 2ERZE 4FVQA 4Y8DA 1GAGA 4ZJVA 2WMAA 3W33A 3UOJA 5D11A 3NRMA 5H2UA 3ZS5A 2BIKB 4FT7A 3LFFA 5HBJA 1JWHA 4QPSA 3QKMA 4O2ZA 5DPVA 1NVQA 3DK6A 5IQCA 3FZ1A 4AFJA 1R3CA 1UU3A 3I60A 2WEVA 4U45A 3ZUUA 1UWHA 2YM7A 4ANNA 1BL7A 3HV3A 4ZTHA 3UIXA 4CYIA 5JFVA 2EXEA 3BX5A 4O91A 2JIVA 2W5HA 3R01A 5LCJA 3LXLA 3V3VA 3QRIA 3QALE 2PVJA 1NA7A 2C5YA 1JNKA 2EB2A 3KA0A 3A7GA 4KAOA 4ZSJA 3T9IA 4FV2A 3D7ZA 4E8AA 5E8TA 4FT5A 2BZIB 4F6WA 4F9AA 4IVBA 4TL0A 3PA5A 4E26A 4YMJA 2WTCA 2CLQA 3G0FA 4EZ7A 3RMFA 5CT0A 4DN5A 3QCSA 3S00A 4NL0A 2BFXA 4HVSA 5CANA 4ZLYA 2OXDA 2XB7A 1PMNA 3ULZA 3UO4A 5HU3A 2XMYA 4WUAA 2OW3A 2R3NA 4IEBA 2VO3A 4YSMA 4AA5A 3N4VA 3GNIB 4JIKA 4LOPA 1PW2A 4W4YA 2W1IA 5LOHA 5HG7A 1BUHA 4IBMA 1W82A 2J4ZA 5CU2A 5L3AA 3PJ1A 3LM5A 5IQAA 2W05A 5E7RA 3P7CA 2X0GA 4FYOA 1CMKE 2VTIA 4DYMA 2WQMA 4EOQA 1YWRA 3BYSA 1H0VA 2XEYA 2UW0A 4EH4A 4XLIA 2CKEA 4OR5A 4XHKB 4ZY4A 5FGKA 4HPTE 4QMPA 5K3YA 5CQUA 4RJ3A 2BUJA 3R9NA 3UO6A 3UP2A 4IAKA 4AT3A 5D12A 4RWLA 2QOOA 3MPMA 4R5SA 3C5IA 3C4WA 4PRJA 4W8DA 3KRXA 3ACKA 4K2RA 1MRUA 2WGJA 4I0RA 3LFSA 3BHHA 2H6DA 4PX6A 4EOOA 1SVGA 3PZEA 4BDEA 5HD4A 4MNEA 4OAUC 3VS1A 3R71A 2ZOQA 3QF9A 4BFMA 3SG8A 4RA4A 5DR6A 3ZONA 4IJ9A 4R1VA 3TJCA 4IVDA 3GB2A 2GQGA 4J96A 4I6HA 3FQEA 2G2FA 5M08A 4O83A 4ZMEA 4L52A 3LLAA 2ZV8A 4JXFA 3P5KA 4QMWA 3IW5A 4O6LA 1KE8A 4TYGA 1T46A 2VTNA 4RIWA 1UU7A 2X81A 3A4PA 4FIEA 4FV5A 1KE6A 5JGAA 3MY0A 4ZOGA 3DJ5A 3W2CA 3F6XA 4FNZA 3VN9A 4B9DA 3V5LA 1CKPA 4R3RA 4AZSA 4E5WA 4EH2A 5JFWA 4Z7GA 4EHGA 3M1SA 3TN8A 4CG9A 4BDFA 3TG1A 4CCUA 3F3UA 2ETKA 4RLKA 4YO6A 5HHWA 3QTZA 4KNBA 5I0BA 3V8SA 1UWJA 3C0IA 3R0TA 4MVFA 3VAPA 3NNVA 3VUTA 5KMNA 4ZTQA 4H3QA 3G9LX 5LQFA 2GHLA 3CXWA 3VUHA 4CFVA 4AACA 5IZFA 3PDTA 2XIXA 4MXCA 1SM2A 5DMZA 2ZV9A 1XR1A 3OWJA 3NCZA 2EXCX 2OU7A 4Z9LA 5EW8A 3LFCA 3NUAA 4TNDA 5CEMA 2X6EA 2GNGA 2IWIA 3CD3A 3BU3A 1JPAA 3CBLA 2B9JA 3R7UA 1UU9A 1WZYA 3FPMA 4AG8A 2XJ0A 4FC0A 4Y95A 3EYGA 3ODZX 5ICPA 2YA9A 3B2TA 4K77A 5EOBA 3VUDA 4YSJA 3AD5A 1P2AA 2Y6OA 5DT3A 3U6HA 4FNYA 4H3BA 1M17A 4YC6A 2V5QA 2GQSA 4B4LA 2RFEA 5CXZA 3FZOA 4QP2A 4B6LA 5GZAA 5HVJA 4BC6A 5HIEA 4ALVA 5CVGA 4IAYA 3UTOA 4FTKA 4BYJA 4BHNA 5HX8A 1OECA 2Y7JA 3E3PA 3EHAA 3DBCA 3NUSA 4C0TA 4TN6A 1OIRA 3BYUA 4O0SA 1YOMA 1DAWA 2ZMDA 3LW0A 5I9VA 4DFXE 3EMGA 2JDTA 2QLUA 3BGPA 3DJ7A 4RQKA 3V51A 3W18A 4DH8A 4FTIA 2PMIA 3ITZA 3LFDA 3MS9A 3GQIA 1A9UA 3BWJA 4EEVA 4H3PA 3VBTA 4U7ZA 2GNHA 3GOPA 4BCPA 1E1XA 4YTCA 4R7HA 3DAJA 1JOWB 1YQJA 2IO6A 5L2QA 4J71A 4CFXA 2VUWA 1JAMA 3VF9A 4HVHA 5E1SA 3COMA 1VYWA 3IOPA 3C4CA 4JBQA 3AMYA 3VS0A 4P4CA 3SHEA 3D2IA 4GK2A 4MKCA 4BCGA 4ACMA 4FKSA 4BCNA 3KN5A 2ZM4A 3EN6A 3NSZA 2ZB0A 3S2PA 5EYKA 2CGWA 3LCKA 3BEAA 3PJ2A 2J5EA 3RINA 2R3FA 3DFAA 2UZWE 4EKKA 3AGLA 4HZSA 3OEFX 5M53A 2PZIA 1NVRA 2CCIA 3Q4UA 4RC2A 4Y46A 2PVRA 3TUCA 1QPCA 2HW6A 4MBLA 1H01A 4A9UA 4HYHA 3SQQA 3KXXA 3MB6A 3R9HA 3WBLA 5KMJA 3VUMA 1RJBA 3BYMA 3KC3A 4GVAA 4PMSA 3OY3A 4YJQA 4EOPA 1URWA 5LVMA 4ERWA 3Q53A 4FKLA 3LFEA 4WA9A 5HESA 4V0GA 3TV7A 5FQDC 1YXTA 3ZLSA 4AA0A 3IS5A 1K9AA 4FOBA 4MD7E 4E6DA 5HCZA 3C51A 4XG3A 4BCFA 3K5UA 5LWMA 1OI9A 2PUNA 3P0MA 2YDIA 3MWUA 3LMGA
chains in the Genus database with same CATH superfamily
1OL2A 3ORMA 3R7GA 4WNMA 5DRBA 4QMQA 4ZZOA 1M7QA 1RE8A 1OMWA 2WFYA 4DBNA 1MRYA 2X4FA 4EC8A 3A7JA 4PPCA 1V0BA 2YJRA 4FKQA 2HZ4A 2BILB 2E9OA 5M06A 4U40A 4YBKA 5D9HA 3CY2A 4FIGA 5DH3A 5F4NA 3T9TA 2C3KA 1KE5A 4BIBA 4D1XA 4C2WA 4ZSAA 3U8WA 5AUUA 5CEKA 4FK3A 3EQPA 4RIWB 4XS2A 5GINE 1ZRZA 2YDJA 4BRXA 2C5NA 4QDEA 3KIOC 4PNKA 2OBJA 1H28A 5E91A 4JJRA 4EJ7A 5AP1A 2XKCA 4IZYA 4UWYA 3UC4A 3EL7A 3MH0A 3PG1A 4XV3A 2OLCA 5GJFA 3ANRA 3D14A 4PV0A 3G5DA 1PKDA 2LAVA 4M0YA 4AF3A 1SVEA 4CG8A 2C6TA 4FT0A 2VO7A 2OFVA 1VJYA 5A4QA 4A07A 3D5XA 4B0GA 3CKWA 5I4NA 1OKYA 2VX1A 4F9YA 4ZXTA 2VX3A 2XNNA 5HVKA 5JSMA 4C4FA 4O7TA 3JXWA 3LJ0A 5IA4A 2J50A 3PXQA 4QPMA 4FSMA 2REIA 3AMBA 4L3JA 1I09A 5TO8A 4F99A 3E64A 3KXZA 4L9IA 3LIJA 3U4WA 4F08A 3RPYA 3W32A 3SGCA 4L53A 3KMMA 4FYNA 3VS2A 1Q8WA 2UW7A 1R1WA 3C0GA 3HX4A 4EHEA 2ZFYA 4BN1A 5HE0A 4O96A 3C4XA 5BUJA 2BDWA 1WVXA 1YI4A 3CP9A 3IW8A 3NMUF 1PHKA 4UMTA 3UPZA 3OBJA 1TQIA 1FVRA 4L42A 4RIOA 3UDBA 2VWZA 1OKWA 4BWXA 3FKNA 3QA0A 2G1TA 4XLVA 3DQWA 3Q52A 5BVEA 3S4QA 5F9EA 5JRQA 4DTBA 3T3VA 4O86A 1GZKA 4DEEA 3PVWA 4AFEA 4JLCA 3ZSIA 4M13A 5ANKA 4JBVA 4AZWA 3UZRA 2J7TA 2JFMA 2WMQA 3BCEA 3MVJA 4XOYA 4X2FA 4DG3E 2JIUA 4EOSA 2YM8A 2YCSA 4X3FC 4G5PA 3CGOA 5DR9A 3COHA 3VS7A 3WF5A 3LCSA 2X0OA 4Z55A 1OBGA 4CYJA 5IH5A 2QO7A 2ZVAA 3NEWA 2WTVA 4ZK5A 2G2HA 4ACCA 3EN5A 5FDXA 4HNIA 5A46A 1DI8A 5CF6A 3ZOSA 4GKIA 1KOBA 3GQLA 4R7BA 2FB8A 4NM5A 4CFNA 4IM0A 3MVHA 5KE0A 4ERKA 3QTQA 2ONLA 4M8TA 3EN7A 4WO5A 3QFVA 5AX9A 2XK7A 4K18A 5KZ0A 2P2IA 3HV4A 3UODA 3ZHPC 2CNUA 3BL9A 4BB4A 4G9CA 3L9PA 1OZ1A 1H08A 2JAVA 4S2ZA 4WG4A 3G6HA 1PMUA 4A9RA 3U6IA 3M2WA 1KOAA 4DE4A 1O6KA 3HAVA 2EB3A 4QMUA 5FEDA 4QEBA 4IB5A 4OW8A 1P14A 3WARA 5HVYA 4PTCA 4RG0A 5D7VA 2HELA 2VGOA 4FV6A 4Y72A 4YTIA 4XJ0A 4OTPA 4AE6A 5AA9A 1KUTA 4XRLA 4U80A 4RZVA 3TNPC 5B0XA 1ZYLA 2OJIA 5FP6A 5J7HA 2W4JA 3ORTA 3LE6A 3T8OA 3QUDA 3KEXA 4MQ1A 3NNUA 4QMMA 2QOCA 2WNTA 4C33A 3ZBFA 3GCUA 1SNUA 5M07A 4KWPA 1GIJA 4IVCA 4RIXA 3VUKA 4BDAA 4Q5EA 3O8UA 3E62A 3BE2A 5L8JA 2VTSA 2B0QA 3AC4A 2CCHA 3I6WA 4BDGA 2F57A 3KRWA 3TNIA 4DF3A 5EKNA 5LMKA 3R00A 4O4EA 4B8MA 1I44A 3QCQA 4IANA 3Q2JA 2WTWA 3QC4A 1REJA 5H8EA 2GHMA 4LFIA 2QOFA 2V7OA 3DLSA 5KMIA 5L2SA 3SG9A 2WD1A 3LPBA 3RZFA 3ENHA 3PPJA 3ML1A 2H9VA 4LDTA 1WBVA 3AQVA 4JS8A 4U81A 3O8PA 3A61A 4R6VA 4WSQA 2W9ZB 1RQQA 3QTRA 2WZJA 3Q2MA 3ZC5A 2R3OA 4O21A 2UW5A 3KK9A 2WMSA 4MX9A 5AP3A 3UIBA 3ZRLA 4DFZE 1IAJA 3U55A 1UNHA 3CLYA 3KFAA 4CEGA 3QRJA 2X8EA 5HI2A 1H1PA 1WMKA 1YKRA 2HYYA 4YZBA 4LGDA 5E92A 4HW7A 4KIOA 3UYTA 3PE2A 2E2BA 5CT7A 3Q4TA 1TQPA 4PQNA 4YZCA 2CGUA 3O7LD 4D2RA 4DLJA 4YC3A 3CCNA 3W0SA 2EWAA 2UV2A 4MXOA 5FTQA 3WOWA 4E1ZA 3NVKI 1JKSA 2CDZA 2Z7SA 3DBEA 3Q9XA 2XNGA 4C35A 3P86A 3FI8A 5LVOA 3HA8A 4E5BA 5HBEA 3HDMA 2XARA 3U9NA 4O84A 3R02A 2C6KA 1QCFA 5HO6A 4YPDA 3D83A 2UZBA 4DT8A 4PDOA 3EFJA 1OIQA 5DHJA 2W96B 3ZMMA 4K11A 4CQEA 3UNJA 2UW9A 2GTNA 2PMNX 4FRFA 5DNRA 3C5UA 2EU9A 4MD8E 2QLQA 3AT2A 2OZOA 2X0QA 1XH9A 1JKTA 2WOTA 3MY1A 4JL9A 2DS1A 2ITZA 2P55A 3RGFA 1NW1A 5ETCA 2A19B 2AC5A 3PLSA 2PUIA 4ZP5A 2QD9A 4LUDA 4G3DA 2PVMA 5LARA 4HVIA 1ZYJA 5I9WA 4PTEA 3CJFA 2UW4A 4QTAA 2O64A 4DH5A 2KULA 5J7BA 3RP9A 5KHWA 4FTLA 4KBAA 4NW6A 3NLBA 4Y73A 4YJVA 2JC6A 4DH1A 2X2LA 2C0IA 3LVPA 2YFXA 2NNWB 4WNPA 2WMUA 3DDQA 3R8LA 5E90A 4ZZNA 4V01A 5AWMA 1J3HA 2WMWA 5CZIA 3R21A 5JFXA 4K8AA 4M69A 3S95A 2HOGA 2QHNA 3FDNA 1IA9A 3AGMA 1WVWA 2YWPA 5KMMA 1ZWSA 2UW8A 5CWZA 3DAEA 2PULA 4A06A 4OTQA 3MIAA 1DAYA 3G15A 5BVDA 4NCTA 2XIRA 3KF7A 4I94A 2J6MA 5CNOA 3C7QA 5BNJA 4I1ZA 3VO3A 3R8PA 3ZFYA 4DGMA 2YEXA 4YLJA 2FVDA 3CR0A 3DQXA 3QTSA 3TYKA 4U42A 3WIGA 4DHJA 4TKSA 4ZJJA 3KXNA 4NUSA 1XHAA 4AXDA 4Y5QA 5FTGA 4F6UA 3VRYA 4EZ5A 2VD5A 3G33A 4R3PA 5IH6A 2PE1A 2XP2A 1XBAA 3FZTA 2B53A 4S34A 2Z7LA 3R7VA 3UDZA 5IQHA 4BGQA 4UN0C 3O5AA 3GENA 4XYFA 5H8BA 3REPA 4FG7A 3SC1A 3AC8A 3W8QA 5AR5A 2WEIA 1R0EA 4CT1A 5JGBA 3UDTA 1PXOA 5HE1A 3ZO3A 3UOKA 4IX5A 4YZ9A 3TXOA 1ST4A 4FSTA 4QMNA 3WZKA 5HORA 5DA3A 1ZY5A 2BRHA 3GU8A 2RIOA 3F3TA 3SOAA 2WTIA 3ZU7A 1GNGA 3GC7A 5EOLA 2P2HA 3R7OA 1CKJA 3P1AA 1JSUA 2QO9A 2CN5A 2W1FA 4XMOA 2YISA 3EIDA 4FKRA 1PXLA 4J95A 4X2JA 3UQFA 2V7AA 4LI5A 4QQTA 3QTIA 4W4VA 3RTPA 4QTBA 4D9UA 3PA3A 3ZBXA 5T6KA 3RM7A 4FTCA 4G6OA 3F5PA 4EI4A 2ITVA 3FZPA 4I6BA 3WILA 2XANA 3LXPA 3OTUA 1YXUA 5DT4A 3VQUA 3JR1A 4YJRA 4U3YA 4L3PA 2XKEA 1RDQE 4O82A 2PMOX 2HIWA 3LQ8A 2YN8A 2GHGA 4DFBA 1YOLA 2F4JA 3LAUA 3Q6UA 4EH5A 2YAAA 5HLPA 3FBVA 4F7JA 2B9HA 3AC1A 3P78A 4C4GA 3MH1A 3GOKA 3RK7A 2JKKA 5HICA 2XF0A 1CM8A 1E1VA 2Z7RA 3PXRA 4F78A 2XM9A 5HO8A 2ZV2A 3KVWA 4C36A 3OT3A 5E9EA 5ANOA 3VBQA 4E4LA 3MBLA 2IEWA 1M52A 4TWPA 4MH7A 4EH9A 4RQVA 3FHIA 4F9BA 1LEZA 4RJ4A 5E8XA 4UXLA 2ITQA 3JVRA 2R5TA 1ERKA 4CMTA 4GL9A 3ZEPA 4O7ZA 2OGVA 2F9GA 3JUHA 2ZM3A 1V0PA 2XM8A 2QC6A 4RLLA 3SOCA 2C1AA 3ULIA 1QMZA 1MUOA 2I0HA 3KB7A 2YM5A 3NUXA 3SLSA 2O3PA 1KV1A 1HCLA 3UC3A 4H05A 4ASZA 4FV1A 4O7RA 4KSPA 4CV9A 2A4LA 4O0RA 2XK9A 4WOVA 4JX7A 1XH4A 4RVTA 4FV9A 4BKYA 5DG5A 4EH8A 2XA4A 5AUVA 4ZLZA 3PVGA 4TY1A 2FSLX 2JBOA 3LCTA 4A9TA 4YR8A 4ZS4A 2R2PA 5IQGA 4F4PA 5BUEA 4FNWA 3Q5IA 3PA4A 3LQ5A 3O17A 3ZYAA 2IPXA 3FMDA 4YLLA 1G8SA 3RPOA 4I6FA 2UW3A 4C8BA 3I4BA 1PMVA 1W7HA 4QOXA 5HCYA 5CALA 1JSVA 3GBZA 5EK7A 4IAFA 3UIMA 4C4JA 4EBWA 3D7TB 5CXHA 5AR7A 3LCDA 4RPVA 4FV8A 1H1QA 3DKOA 3GFEA 3KGAA 2EVAA 4IX3A 1AQ1A 4CKIA 3SW7A 3TUBA 4CT2A 2A1AB 3W2RA 3ORIA 5B2LA 2QG5A 5TE0A 2ZB1A 4BBMA 4YJSA 3HMOA 2IN6A 3RJCA 1ZOHA 2GS6A 3CQWA 3SVVA 3E5AA 5FXQA 4CNHA 5BUIA 3P4KA 4RFMA 3SA0A 1KWPA 3BGQA 3CIKA 3CPBA 1IG1A 5FEEA 1CSNA 1Z57A 3E8CA 4I24A 3RK5A 3ZRKA 3RCDA 1KE9A 4KS7A 3HL7A 2UVXA 3VW6A 3I79A 1ZMUA 3A7IA 2NO3A 2XIZA 4FKPA 4RT7A 5GJDA 2JD5A 3VVHA 5BYZA 2BPMA 2CPKE 3UNZA 3VUIA 4YNEA 5CAPA 3OF0A 1O6LA 3WZEA 4ZSEA 1UNLA 3F5GA 1YWVA 4N6YA 2IZUA 3AC3A 2IZSA 4KA3A 4BZOA 4MBIA 4UALA 4EHZA 2J0KA 3IDPA 3P7AA 3D15A 2ZDUA 3V6RA 3HRBA 2PY3A 1ZMVA 4ASXA 2ZAZA 1FINA 2XK4A 3IOKA 3FMLA 1X8BA 2X9EA 2OXXA 3PY3A 1XWSA 4FGRA 3KY2A 1JQHA 2ITNA 4QMSA 4ENXA 1W2CA 5CI7A 4YNOA 5CTPA 3KCKA 3HRFA 3MSSA 5AV2A 4EBVA 4BCMA 3QLFA 3QD2B 3A2CA 3R7EA 3AT4A 5IMEA 5C26A 3I1AA 5GNKA 4IWOA 3FL5A 4O38A 3VW8A 3DKCA 4IIRA 2PVFA 3FC2A 2VN9A 3V5QA 4DLIA 5CEPA 3PVBA 4I5MA 3F3WA 4AGUA 4CVAA 5A54A 4ZSLA 3L8VA 2W06A 3COIA 2W5BA 3MH3A 1J7IA 2Y0AA 4CSVA 2FGIA 4PTGA 4F1MA 1G5SA 3UZPA 4F1TA 4YUQA 5C27A 1R39A 2A0CX 2PZRA 3GCVA 4WRGA 4XP2A 4AT5A 4W8EA 5EM6A 4ACHA 2CKOA 2Y4IB 3QBNA 3QCYA 4LOQA 4GYIA 4Q2AA 5C8MA 1ND4A 1W83A 4CFUA 2I40A 4JDKA 4PDPA 4J98A 2PVYA 2YIQA 4USFA 3W55A 3ODYX 3EN4A 5LMAA 4O0UA 4FTUA 3GCPA 4O1PA 3C50A 4LV5A 1FMKA 4MXAA 2XAOA 4PL3A 3JY9A 2C69A 1OKZA 4R3CA 2P4IA 4YO4A 1PXIA 2C0TA 3NYNA 4E20A 3O23A 4P7EA 4NTSA 3QRTA 5AAGA 2HXLA 4L00A 3N4TA 2VTPA 2VX0A 4NEUA 3WZJA 3CGFA 4RJ6A 4R7IA 3DXPA 2PU8A 4QT1A 2ITOA 4W9WA 5AIKA 4AZVA 4OAVB 4CV8A 4X6RA 4LYNA 3DBDA 5IA0A 3TNQB 3V01A 5JT2A 4P90A 2ZM1A 2WQEA 3FI3A 4IWQA 2WTKB 3Q9WA 4B7TA 1XQZA 1U54B 3SAYA 5CASA 5JZNA 4TTHB 4JR3A 2V22A 4G3GA 4M84A 3ZO4A 3F2AA 3UJGA 3W1FA 4NW5A 3A8WA 1ST0A 4MUQA 4EWHA 4F70A 3QD4A 4MNFA 4U79A 5FXSA 2I7QA 4FBXA 2RKUA 3EOCA 4RJ7A 4EWQA 1UV5A 3QA8A 3CTJA 1J1CA 3EQBA 2X7FA 4FKJA 4QO9A 4A4XA 5AIRA 4FZAB 1YXVA 5HLNA 1H26A 5FM2A 2YZLA 4DHZA 1W2FA 2R3RA 3K3IA 4IW0A 5CSHA 3GU5A 4NH1A 3ZZEA 2XALA 2XKDA 4O0WA 4IH8A 2R3LA 5IUIA 3MTFA 5H8GA 4IVAA 4UYAA 4JVGA 1PXNA 1W98A 5F20A 5HE2A 4AGDA 3S1HA 4KRDA 4BR3A 5IQFA 2CGXA 5AV4A 3FYJX 2F2CB 5M4IA 4DGNA 2XNPA 3O71A 3OT8A 5L8LA 2JEDA 3QUEA 3UVPA 4AE9A 4MXXA 1Q8UA 4IM2A 3QHRA 3VRZA 2XEZA 4BKJA 3QAME 1WBOA 3F5UA 4PWNA 2BFYA 4X3JA 5J9ZA 4P5ZA 4YLKA 4E7WA 1BKXA 1OL1A 2OO8X 1ZMWA 4V05A 4QDVA 4D5HA 4D2WA 5LCKA 3ET7A 3OHTA 4LL0A 1EH4A 2X4ZA 4JR7A 4HVDA 5LXMA 1NXKA 3FLYA 1V0OA 4NM0A 3LMHA 3EJ1A 3IONA 2ITXA 3MYGA 2B9IA 3UQCA 2X2KA 1R0PA 2WTDA 3NUYA 5CSPA 4AXCA 1Y8YA 4N70A 5I9YA 2O5KA 4YJPA 5E1EA 4CD0A 4A7CA 5EYDA 1FVTA 4FTQA 4D2PA 2ITTA 5EM7A 3IW4A 2XCKA 4E6QA 2ETRA 4JNWA 2VO0A 4LMNA 4XEYA 4E93A 4FT3A 2HCKA 4BIDA 2PZYA 3FZRA 1H24A 5CSVA 3UQGA 1PXJA 2WQOA 4YJOA 4JDJA 5DI1A 1Q62A 4L8MA 4QP8A 5HG5A 1W0XC 4BCHA 5A9UA 2A98A 4ZY5A 1OIUA 3OWLA 3VIDA 3S0OA 3ACJA 3KU2A 2X7GA 4FIJA 1XH7A 2ITWA 3GUBA 5B2MA 3PSDA 3E3BX 3FI2A 3LXKA 4PF4A 1M7NA 4D9TA 3LKMA 5DEYA 4C62A 5JRSA 2OICA 4KKHA 5BVKA 3WZDA 3OFMA 4H58A 4WBOA 5HIBA 4IB1A 2VWYA 3R9DA 4QYEA 5HCXA 5GZ8A 4JG7A 3OUKA 4AS0A 4UZDA 5CEQA 4MHAA 5KO1A 4BJJB 5M09A 1RW8A 5A6NA 4O7WA 3VF8A 1Q8YA 2GNIA 4XNEA 3HAMA 2W1HA 4JBOA 2C3JA 3R22A 4CCBA 5HLWA 2H8HA 4GIHA 1FBNA 2Z02A 4USEA 3OCGA 4BI0A 4CMUA 3VBYA 3VBXA 4AW0A 2JGZA 4UMUA 4Q9ZA 4M12A 4RX5A 4F7LA 4JT3A 3ZM4A 3FMNA 4BCKA 5AP0A 2P33A 2R9SA 3TL8A 1XMLA 3R2BA 3WI6A 2ONLC 3IK3A 2J0JA 2VNYA 4XRJA 1PRYA 2F49A 5I5ZA 4R78A 2VTTA 2XZSA 1W8CA 4ASEA 3DK3A 1S9IA 2PHKA 3CEKA 4O7SA 3FYKX 3D0EA 4YGAA 4D1SA 2ITPA 1PYEA 2ETMA 5HKMA 1YI6A 1APME 1Z5MA 2OSCA 4F0GA 1UVRA 3ZTXA 2BTRA 2B55A 2W17A 4KBCA 3UOLA 4CLJA 5FG8A 1VLRA 4FKGA 3A60A 1YVJA 3DOGA 4KUJA 5FBOA 2X7OA 2W5AA 2BALA 2R0IA 3DV3A 4FV7A 4BTJA 5J1VA 1GY3A 4P2KA 1W84A 4G5JA 4C34A 4MNEB 2J9MA 4JRVA 3R7IA 4YTFA 1OL7A 1G8KA 3U54A 3ZFXA 1NVSA 4S32A 5J87A 4L43A 1WBTA 2FUMA 3KRJA 3NNWA 4G3FA 4F6SA 2VTQA 4RC4A 1DI9A 4ZS0A 2QG7A 2VTJA 4PL5A 3QYZA 3RHKA 3FQSA 3LMIA 2EXMA 2UZDA 3Q9ZA 3MESA 3FAAA 3IECA 2A2AA 1OPLA 3HUBA 3SXFA 4DEAA 3QRUA 5FDPA 5L2TA 1MP8A 3JPVA 3VHEA 4X2GA 1G8AA 1H4LA 4LRJA 3MFUA 3L9NA 4DEDA 4FL2A 5BVWA 4BDDA 4K1BA 4QP1A 5DBXA 4EONA 3ORXA 4CXAA 3EQGA 4F65A 1YXSA 3GU6A 4M3QA 2AC3A 3HYHA 2Z60A 4GJ3A 4ZTMA 4ENYA 2QO2A 3GU4A 3QWKA 4HJOA 1LPUA 4ZIMA 1A06A 3FI4A 3PRIA 4RA5A 1JKLA 2YIXA 4GMYA 3CQEA 3GGFA 2CN8A 3NNXA 5CEOA 1SMHA 3SV0A 2CHLA 3CS9A 4HYUA 4DGLC 4QRCA 3SRVA 3KRRA 3EN9A 3IDBA 4PY1A 1TFFA 2V55A 1OM1A 3NW6A 5GIOE 2FSMX 3ORLA 4U0IA 4L68A 2QOIA 3THBA 4ZMFA 5IH4A 5I9XA 3QZIA 4I6LA 2VWIA 3DY7A 4GJ2A 2X39A 1KSWA 4I5PA 4YPSA 3T3UA 3QQLA 4U9AA 3SXSA 5LVPA 3MB7A 4M68A 4BF2A 3TT0A 3E7OA 3VULA 4CQGA 4GIIA 2CJMA 4C3PA 5D41A 4L7FA 3WE8A 3FL4A 2QCSA 3H9RA 4ITHA 4KIPA 3OG7A 2YLEA 5K4JA 3C1XA 4RZWA 4D4VA 4QMXA 4FZDB 3I0OA 2QU6A 5EI8A 5TT7A 4FKVA 4O4BB 3RBWA 3QRKA 2XCHA 4CLIA 3OP5A 3PSBA 4K6ZA 4BYIA 1VEBA 2WMXA 3GCQA 4GYGA 3POOA 4L01A 3TI1A 4IFCA 4E6CA 5C8KA 1Q4LA 4O6EA 2E9VA 3BE9A 4EHVA 4EORA 5KMOA 3B8QA 2J2IB 3IKAA 1ZYCA 3FY2A 4ACGA 3NAYA 1BI8A 4A4LA 4BZDA 4DT9A 2F7XE 1XH6A 3HMNA 5EKOA 3II5A 3QC9A 3RAIA 4AGCA 3PYYA 4EOKA 2C5VA 2W1CA 3K5VA 4MTAA 2QOBA 2FYSA 2UZEA 2VTMA 5H3QA 4AQKA 4L44A 4TZRA 3AD6A 2J0MB 1XMMA 2C3LA 4TYHA 3DB6A 3C4ZA 5GHVA 2B7AA 2Z8CA 3NS9A 1YHWA 5AX3A 3AKJA 5KZIA 4JI9A 3RCJA 5LMKC 4MWHA 4FIHA 4V0GB 4OTFA 4KINA 4RGJA 3LZBA 5D10A 2PE2A 4AZTA 4FUYA 5AV1A 3MFSA 4FSNA 4OBPA 4NKAA 2RSVA 5DIAA 2JDVA 2R0UA 3IGOA 5AUWA 2VTAA 1Q24A 5EDQA 3WF7A 5AFVA 4EH7A 3P79A 4ZTRA 1URCA 3RAKA 5J9YA 3QQUA 3R1SA 5AP6A 3QZHA 3IQ7A 4ALUA 4NU1A 1BLXA 4FSRA 4QYGA 3W2QA 5AUXA 1Q97A 5IDPA 3TEIA 4D4SA 2OIDA 2JDRA 3I7CA 5DEWA 4FZ6A 4QQJA 3PJ8A 3CJGA 5FEQA 5A4TA 4IE9A 3PZHA 4QMTA 4FV4A 5EG3A 5I9ZA 2BRNA 4GFOA 2OWBA 3R8MA 3G9NA 1L8TA 4AN9A 2C4GA 2W9FB 1YHVA 3CD8A 4FSYA 2BZKB 1FGKA 1U59A 1SYKA 1STCE 4HCUA 5IQIA 2W0JA 4WRSA 4WG3A 3MVLA 4LG4A 4I41A 2XS0A 5CI6A 4WT6A 5EHLA 4YURA 3F61A 4GSBA 4HZRA 4M0ZA 4RMZA 1IEPA 3TZ8A 4M66A 5JK3A 4PMPA 4GG5A 1SZMA 4DFYA 1A48A 4I23A 1OL6A 3VHKA 3BQRA 4AT4A 2E9PA 3PPZA 3GC8A 2XK6A 1GZ8A 3F3ZA 3GT8A 3R1YA 2C47A 4C3FA 4F1OA 2I0VA 2JDOA 1IASA 4PPAA 2XKFA 1J7LA 4UV0A 2HWOA 4NIFA 2WMBA 4R1YA 3SRVB 3PVUA 2X0PA 1ZXEA 1Q8TA 4PNIA 5EQYA 2H96A 1OBDA 3PFQA 2HZNA 4CRLA 4OGRA 3AKLA 4MWIA 3GFWA 2UUEA 3HMMA 3E8DA 4M97A 3ZLYA 3L9LA 5BVOA 4PL4A 1OUKA 5KUPA 3ZFMA 5J95A 5AR4A 4IZ7A 2GPHA 4PMMA 3VJNA 1YWNA 1OGUA 4UXQA 3ANQA 3A8XA 1GOLA 1VZOA 2HW7A 5AUYA 3OCBA 1JBPE 3BHUA 3HV5A 3FXWA 1XH8A 5AP7A 3HGKA 2Y4IC 2WU6A 4E3CA 3UZTA 3H30A 4EK8A 4RC3A 3KL8A 2HENA 4DC2A 3UOHA 4UYNA 5TF9A 4XH6A 4FEWA 2BAKA 1XO2B 4N4SA 2NRYA 1IAHA 4R77A 3HP5A 3ZDIA 5FP5A 3L8PA 4RX7A 5L6OA 4FL3A 2XIYA 2C6EA 3TDWA 3SDJA 3OWKA 4O22A 4EUUA 3KMUA 4IX6A 3FEGA 3D5UA 2OXYA 3ORKA 4X3FA 5AM6A 4C3RA 5IA3A 4AQCA 4YTHA 4OTWA 3A99A 1PKGA 4MCVA 2ESMA 3OCTA 2Y9QA 3DTWA 4DFNA 3TDVA 4F09A 2OI4X 3K2LA 3DS6A 3O2MA 3U9CA 4X2NA 4ANMA 2R7IA 1Q8ZA 3KMWA 3L8XA 4NKSA 5CU6A 2C6LA 1YHSA 2G15A 5IUGA 3Q4CA 3UBDA 1H00A 4H1MA 2IW9A 3EZRA 1LEWA 5CZHA 3PXZA 5CENA 2WTKC 4BDIA 5KNJA 4ID7A 4YHJA 2CGVA 4DH7A 3KK8A 4XG6A 1TQMA 3FPQA 3ZO2A 4AP7A 2Q83A 2PL0A 3QZFA 4A4OA 4QMLA 5EQPA 3BRBA 5CF8A 1F0QA 1PMEA 2GCDA 4WNKA 5AMNA 3LM0A 4GEOA 3FSKA 4MBJA 5AP2A 4C2VA 5HTIA 1BL6A 3VS3A 3NUNA 3Q96A 1UNGA 4AN2A 3DFCB 3P9JA 4IWDA 3ZUTA 2OZAA 4CTBA 2UZNA 3C13A 2IVUA 4G34A 4RVLA 1WBPA 4O7YA 4U41A 5EM8A 3MVMA 1Q99A 4RIXB 3V5TA 1B39A 2RF9A 2G9XA 2WIPA 4QYYA 3EQIA 4NFMA 3SXRA 3OWPA 2A27A 3U87A 4AWIA 4EK5A 1TKIA 2GFSA 2X8DA 1YDRE 4C4IA 2PWLA 3ORPA 4ALWA 3WIKA 3DXNA 3EH9A 4AW5A 2VU3A 3H3CA 3B8RA 2B54A 4EQMA 2XBJA 4YJTA 3CPCA 3D2KA 3QL8A 5E8VA 1UKIA 3OROA 5ETFA 3VUGA 1B6CB 3ZC6A 3RNYA 4OT5A 3QGYA 5HU9A 3GC0A 2R7BA 3JYAA 2CKPA 3CKXA 4BY9E 3EB0A 4TPTA 3L1SA 1ZOGA 2UVZA 2BAQA 3NGAA 3G90X 4FL1A 4JRNA 4UMQA 4GK3A 3MPAA 4FODA 2WKMA 4AAAA 4W4WA 1ZOEA 2JAMA 3FUPA 3TZMA 1H25A 3V8WA 1BMKA 4X6QC 4PDYA 2W1ZA 4OBOA 4BTKA 1JKKA 5K0XA 2QHMA 1H27A 2YDKA 2PVHA 2YIYA 4U44A 5BX0A 3FY0A 5JQ8A 4ZTNA 3ZSHA 3JY0A 1PYXA 1DM2A 4XG9A 5CAOA 1T45A 3W0OA 4CKRA 1OB3A 4II5A 2BRGA 3IW6A 3E8NA 1ATPE 3D5VA 4TYIA 3LXNA 4JAJA 1CKIA 3V04A 3F5XA 3R7YA 4F0FA 2JLDA 4CFMA 3FC1X 3LFQA 1K3AA 4FR4A 1XBBA 4DTKA 2PTKA 3QQHA 3QU0A 3RPVA 1F3MC 2GS7A 1XBCA 1ZY4A 5HG9A 4AUAA 4BTMA 4FTRA 4KBKA 2G01A 2R3HA 4KD1A 4EQCA 5CLPA 5JGDA 5E4HA 3TV4A 2R3KA 2ZMCA 3UVRA 4EOJA 5B7VA 3O8TA 2YIRA 3BPRA 5DN3A 5JKGA 5LMBA 4ZTSA 5AADA 4OBQA 5EM5A 4CZTA 4XV2A