4ACHA

Gsk3b in complex with inhibitor
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
350
structure length
350
Chain Sequence
SKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords GLYCOGEN SYNTHASE KINASE-3 BETA
publication title Discovery of novel potent and highly selective glycogen synthase kinase-3 beta (GSK3 beta ) inhibitors for Alzheimer's disease: design, synthesis, and characterization of pyrazines.
pubmed doi rcsb
source organism Homo sapiens
total genus 95
structure length 350
sequence length 350
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2011-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4achA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4achA01
5HCYA 4EK5A 1GJOA 1ZYDA 3NUPA 4H36A 3NUXA 4A9YA 3A7HA 2J0MB 5FBOA 4XV9A 2ITNA 1QPJA 4FR4A 3QTWA 5C9CA 4HVSA 1YDRE 4M67A 2ERKA 1H01A 3AC3A 3ZLSA 3OVVA 4ANBA 2CKQA 2A4LA 3QUDA 3V5WA 2FB8A 2UW6A 2VX1A 4E4LA 4EWHA 4IAIA 4P4CA 3MJ2A 3R7UA 2VTOA 4IM3A 3WE8A 4V04A 3WILA 5HLNA 1W84A 3FYKX 4RVTA 5CQWA 1JNKA 3NS9A 5I0BA 1TQMA 3FBVA 2YACA 3G51A 5CF8A 3DPKA 3R71A 4BCGA 4E6QA 3UC4A 5IDPA 3DY7A 5CZHA 2I0YA 4FBXA 5DG5A 4BTKA 3ZRKA 4MVFA 5IG1A 4BWKA 5E8YA 3SD0A 2EXCX 3ZZWA 1V0BA 5IA1A 3NIZA 1SM2A 5CXZA 3ORPA 4GK2A 4UMTA 4ZMFA 4F0FA 1UA2A 4E4XA 4GFOA 3MTFA 3EB0A 2UVYA 3HGKA 5IDNA 3C1XA 3MA3A 4LGGA 3AC4A 3NPCA 3O17A 3R9HA 4ALVA 5GZ8A 2G2HA 3QLGA 1WBTA 2RG6A 4X2JA 5CF6A 1IASA 3KF4A 1U5RA 3QD0A 2V22A 4UX9A 4IW0A 5M4IA 2XBJA 3TZ8A 4NM0A 4RA4A 2C0OA 4IFGA 3FPMA 5L4QA 4CCUA 4LUDA 1T45A 4O91A 2ITTA 3GC0A 4MQ2A 3WBLA 4TL0A 4FNXA 4O7WA 4BDHA 2I1MA 4MNEA 4Y46A 3HV6A 4GS6A 4MBIA 3LHJA 2F7ZE 3VS5A 4D4YA 2C69A 5HIBA 3UQCA 4QQTA 5HVKA 5C8KA 3DXQA 2Y9QA 4I5CA 5L2QA 3C9WA 4NKAA 2XJ0A 3OCGA 5EYDA 4JI9A 4YZCA 3UODA 5L2TA 4O7SA 3PXFA 3W2OA 5FXRA 2OH0E 3DAEA 2C6LA 3HX4A 3QCSA 3KXMA 3QHRA 2J0KA 2GS2A 2YITA 3POOA 3NDMA 5K4IA 4YTHA 2PMOX 3ORTA 4FT9A 2YWVA 1JBPE 4FZ6A 5AP6A 3ZMMA 2WGJA 4DEGA 4K9YA 3OWKA 4G9RA 4LYNA 4O7LA 2BZKB 5IKWA 3G6HA 3I5ZA 4AGWA 4B0GA 4RFMA 4KKGA 3UZPA 1ZXEA 5AUWA 3KB7A 1WAKA 3ZBFA 2WTWA 2R7IA 4FSMA 3F82A 2PVFA 3DXNA 5KX8A 4JIAA 4NH1A 3MSSA 4X0MA 2J4ZA 3TTJA 1UNLA 3DA6A 2Y4IC 2ERZE 4C3PA 5I9YA 4NL0A 4UMUA 2VWWA 2CSNA 5HOAA 4J96A 2QLQA 3TZ7A 3FMEA 4XEYA 3FAAA 5AAFA 3OZ6A 4LOPA 1FINA 4XX9A 3M42A 3LMIA 2IVVA 3F3WA 2B9IA 4PPAA 5K4JA 5JRQA 5E1EA 4WNOA 5FD2A 4Z3VA 1YOMA 2C3LA 2YIQA 5AR2A 1H1QA 1MRUA 1ZLTA 4GV1A 3Q9WA 2Z7QA 3LFEA 4TYHB 2R3RA 5IF1A 4EK8A 3BI6A 3RAWA 4IVAA 3PJ3A 3DCVA 3TJCA 3UOKA 3WF5A 4C4EA 4YLJA 1L3RE 5FLFA 2GNLA 3FJQE 4QYFA 4BHZA 2OKRA 2YFXA 2YISA 5HBEA 4C3FA 5JK3A 4FKOA 1F0QA 3KULA 4L67A 1PXOA 4FV1A 4J7BA 2GNIA 4PL5A 3G2FA 2JKQA 2YAAA 2PMIA 3Q4TA 2RFSA 4QP1A 3TNWA 5IQGA 4II5A 4G16A 4QQ5A 5TF9A 3UO6A 2I40A 3EKKA 4PV0A 3PIZA 3V8WA 4L43A 1Q41A 1OB3A 5CI6A 2GHLA 3FMNA 3VS7A 2ONLC 1DI8A 5AR3A 3WI6A 4FA2A 1Y6AA 4GKIA 5BX0A 4PDYA 3RCDA 1PMVA 4FT0A 3DBDA 3QC9A 3NVMB 3DTWA 4C35A 4OUCA 2E9OA 2W7XA 3D7TA 1J7UA 3EFJA 4FIEA 2OSCA 3AD6A 5AP4A 1GIJA 2EU9A 4OTPA 3IW4A 4IX5A 5KBQA 4JX3A 3O8UA 4YU2A 4MD8E 3FQSA 3GC7A 2OG8A 3FSFA 4J8NA 5J7HA 3OUNB 4ORKA 3EQGA 1GAGA 3ETAA 3MH2A 3MY5A 1KE6A 5HI2A 5A14A 4RJ3A 2ZOQA 2YJSA 1ZWSA 3PIXA 3FI8A 3PJ8A 4EH4A 4I1ZA 2XUUA 3AT3A 1Y8GA 4OBOA 5CAPA 5IZFA 1TQIA 3VBYA 1YRPA 4L53A 4RIYA 5KZIA 2OJJA 5GZ9A 4IB1A 4AQCA 4KAOA 3LFBA 4R78A 2PPQA 4DFUA 4UY9A 3KK8A 4BYJA 1OPLA 2R2PA 1WBOA 4DG3E 4LV5A 2KULA 5FXQA 4DEDA 2J51A 5IMEA 3QL8A 4HGSA 3BELA 4CG9A 3PG3A 4DCEA 4IAFA 3AD5A 4XHKB 3D4QA 5ETFA 3ORKA 2JAMA 2XBAA 4EHEA 5J95A 2ACXA 3BHUA 3CPBA 5BYLA 2QKWB 4F99A 5LWNA 1REKA 4M15A 3TEIA 4EONA 5FDPA 5B2MA 4BBFA 4RQVA 4O0RA 3FMJA 3U51A 4D2RA 3PIYA 3IS5A 4XYFA 5AR8A 2XK3A 1UV5A 2XNMA 4KRDA 5A4LA 1JPAA 2FVDA 2P2HA 2ZV2A 4FTNA 2JFMA 4F70A 2JD5A 4FK6A 4FTIA 4AW5A 4KBAA 2X2LA 3H9FA 2R9SA 4RSSA 5HU9A 5LVNA 3COMA 5LMKA 3FQEA 5CZIA 3SX9A 4B6LA 4GT5A 4WUAA 4IZ5A 3R9RA 3PZEA 3PG1A 4JRNA 4LI5A 5E90A 5LMBA 4FSZA 2F7XE 4JOAA 3QX4A 2XIYA 1RW8A 4LL5A 1B38A 2YLEA 2UW9A 3GU6A 3ELJA 2V62A 3LCDA 4UBAA 2CKOA 4HW7A 3AC1A 5AAGA 1JSTA 5AAEA 5CAOA 3VUHA 3B2WA 4UXQA 4S32A 4DAWA 3JVRA 3ORXA 4XG8A 2PUUA 4NM7A 2J7TA 4D2VA 4OT5A 4DINA 5L2SA 3BHYA 3MH0A 2VGOA 1STCE 5CSWA 5ANGA 3PVUA 2OIQA 4M13A 4MXXA 4NIFA 4ZTQA 2YM8A 3G9LX 1QCFA 1XJDA 3C4WA 3L9PA 3GGFA 3IONA 5AV2A 3LQ8A 4BIEA 2ZV8A 2P4IA 3EZVA 5A46A 3BE9A 2IZUA 2OF2A 2J50A 5IH6A 3F3VA 4U0IA 5K0XA 4TKSA 4IDTA 4EC9A 1PMNA 2VZ6A 1Q97A 2G15A 4MTAA 3UP2A 4BY9E 4AZTA 3ROCA 1Q8UA 2VWZA 3CKWA 3ZEWA 2VO3A 4RVMA 3ACKA 4X2NA 3A7JA 5E9EA 5LARA 5AADA 3QCYA 4MXYA 3DBQA 3E3BX 3ODYX 3W2SA 3TXOA 5CALA 4CFXA 3OCTA 3S4QA 5AR4A 4C7TA 2R3IA 5AX9A 4FKTA 4L6QA 5DT3A 2DWBA 4ZSLA 1LP4A 4D2PA 2CLXA 1U4DA 3HUCA 4RPVA 4IVDA 4CV8A 4AOTA 4X3FA 3EN4A 4DG2E 5LVMA 5HIDA 2RKUA 2E9UA 4XG6A 4HCVA 4BDFA 3Q4ZA 5EM5A 3LAUA 4RJ8A 4ZY5A 3KC3A 4CGAA 2XB7A 3V5LA 5CSXA 5H3QA 1OL5A 4FTJA 3R9NA 2JEDA 4LGHA 1YWNA 2IO6A 3DJ5A 3U54A 4ZZNA 2I6LA 4PQNA 3A60A 4OTWA 3UZTA 3MY1A 2GHGA 4JJRA 5KBRA 2FGIA 3E64A 5ANDA 5HGIA 3VBVA 3SGCA 4GVAA 3RPRA 2C3KA 1PF8A 3R6XA 5JRSA 2R0IA 3ULIA 4DLJA 1XO2B 4G2FA 4ZTNA 2X0GA 4MKCA 3QKLA 2WQEA 1DI9A 4PTEA 3OWLA 4HGEA 3VAPA 1WBVA 2X2MA 2B52A 3U9CA 4V05A 4MWIA 4QP6A 2EXEA 1Y6BA 1M14A 5BUEA 3LE6A 4I0TA 3BYVA 3FI4A 4LRKA 2C5VA 4S30A 3QU0A 5FG8A 5G1XA 4AT5A 1SMHA 2QC6A 4R6VA 2O65A 2BROA 2YHVA 4QP4A 2X1NA 2ZDUA 4NWMA 3LXKA 1VYZA 4AT4A 4BFMA 4X6QC 4BDBA 2X2KA 5D41A 4FT5A 4DT8A 2F2CB 4CXAA 3EQFA 3P5KA 4C02A 4EKKA 3ACJA 3Q9ZA 5IQIA 2PE2A 3WYYA 5HG5A 5E8SA 2QURA 2XNEA 1Q4LA 4HPTE 2H9VA 3HMOA 3O23A 4E6AA 4FSNA 4QNAA 3VN9A 4FIJA 3NNVA 4WBBB 4I21A 5AP7A 3IECA 5AP5A 3TN8A 4DH7A 4QMZA 4EQMA 3F2RA 4PL3A 4LUEA 3UVPA 5M56A 4U3ZA 4BCNA 2B9HA 3I1AA 4CD0A 4DITA 3BLQA 4O0SA 5EYKA 5E8ZA 2HOGA 5D1JA 5IH4A 5TE0A 1JVPP 1WBWA 4F6UA 4QMYA 3S00A 2VU3A 3VULA 4C59A 4FNYA 4CFNA 3A61A 2GS6A 4TZRA 2R3LA 3NNXA 3U4UA 2JKKA 2QLUA 3H9OA 1XH4A 4OTIA 3R9OA 3MH3A 4TYIA 2I0VA 4FKRA 1YXUA 4YHTA 4IQ6A 5CU2A 3D5XA 2HELA 4FICA 4OTDA 4JRVA 4WRGA 2WIHA 4TYEA 3N4TA 4FZFB 1MUOA 3MS9A 2VTNA 4D2WA 5IQCA 1EH4A 4CKJA 2R3JA 5HE3A 4QP7A 3ZHPC 4Y8DA 4RLLA 5AIKA 4DH5A 4NUSA 4BDEA 4EJNA 1ZOGA 4BDGA 3R1YA 4FTAA 4FSQA 4WO5A 3UYTA 3MH1A 5CU4A 4NJ3A 4F9WA 2Q0NA 3TNQB 4U42A 3W2CA 5DE2A 2Y6MA 3UOLA 1CM8A 3S0OA 2W9ZB 3HMIA 4IJPA 3ROYA 3VC4A 5HNIX 5M53A 4ASEA 4G3FA 1BI8A 3O8TA 4EYJA 3U6HA 3OY1A 5I9VA 4BCHA 3TV7A 5L8LA 1GY3A 1FVVA 2VO0A 3OWPA 1P2AA 2WKMA 3D7TB 3OW4A 4BKYA 4JXFA 1YI3A 4AA4A 2BHEA 2WTVA 4JVGA 3BU6A 3TL8A 4F9BA 2R3KA 1FQ1B 3IGGA 4LGDA 2ITOA 3RM6A 3DK7A 3KCFA 4CYIA 2QQ7A 4N70A 2IWIA 2YDIA 2PMNX 2JC6A 2QNJA 5DFPA 3ZFXA 4F1OA 2EVAA 5KUPA 4GMYA 4DCAA 3BGPA 2DUVA 3HNGA 3QUEA 4I6QA 2XK7A 4R3PA 4U9AA 4ZSAA 4QTBA 5IQEA 5AUTA 2BDWA 3VBTA 1B6CB 1OIUA 1R0EA 3UMWA 1AD5A 4PL4A 1YDSE 4IAKA 4CQEA 3FZPA 2R3QA 4WKQA 4DH3A 2J0JA 3E87A 3M11A 4W4WA 4BCOA 3IKAA 2WEIA 4M69B 3RKBA 3WZDA 5HVYA 3HEGA 3OCSA 3RMFA 3OXIA 4I93A 4OTGA 4YSJA 4W9WA 2QU5A 4BF2A 4FX3A 2R3FA 3DJ7A 3C5IA 2PZ5A 4IM0A 4X7QA 3D2KA 1UWJA 4W4VA 4QYGA 3MVLA 4L44A 3HA6A 2OO8X 4O1PA 3L8PA 5BMMA 5CEPA 2ZB0A 3BEAA 1SZMA 2QO2A 3EKNA 5IEVA 4BL1A 3RVGA 4ZEGA 3AOXA 4JQ7A 4JT3A 3TKIA 1WVWA 1GZ8A 1YI6A 3FHRA 3Q96A 3UIMA 2R3GA 4NCTA 4DGNA 4EZ7A 5CASA 4M14A 1PMUA 3WYXA 2XKCA 4KB8A 4B9DA 3UTOA 2GQRA 4GYGA 3FSKA 4OT6A 5FUTA 3OFMA 1OKYA 2CHLA 4FTLA 1ZZLA 5EM7A 4RX7A 4FEXA 4BICA 3RHKA 3HP2A 2W1HA 5L6PA 2WMWA 3W55A 2W4OA 3GU7A 4H3PA 4YJQA 3SVVA 3P7BA 4BZOA 2WTDA 4G5PA 4QNYA 3BU3A 4C58A 3VO3A 3OF0A 4QYHA 4CKRA 4Q9SA 5DGZA 2UZWE 4GT3A 3S3IA 5M4CA 1E1XA 5AP0A 3CTQA 2JIIA 3PWYA 5DRBA 4YZMA 5E8TA 1IG1A 1P4FA 3H4JA 5LVOA 2AUHA 1OECA 1NW1A 5FEDA 2XCKA 4AGUA 3FDNA 4ANMA 3MVHA 4O96A 4K18A 3KN6A 5IA4A 2Z60A 2YIYA 2Y8OA 3DK6A 4CTCA 5JFVA 4NIFB 1WMKA 1OL2A 4FG7A 1PJKA 4H1JA 2WMVA 3FMDA 3ZXTA 1ZYLA 1Q61A 4E1ZA 1XWSA 3VVHA 2FSMX 3KXNA 2PZYA 5F4NA 5ITAA 2V55A 3KMUA 4UWYA 5HCZA 3H30A 3ZO2A 3F9NA 4QMLA 4EH7A 3KCKA 4WOVA 2BAJA 4XLVA 4ALUA 1Q8YA 3OT3A 3ZDIA 4KD1A 5DI1A 2CGXA 4QMTA 3VS4A 1KV2A 2CNQA 1ZMWA 5FP5A 2BKZA 3OD6X 3F5XA 4PNIA 3TUDA 3QTQA 4BI2A 4C61A 4QTEA 5A4TA 3VUKA 4DH8A 3QRKA 4WT6A 1XBCA 5GIOE 3LJ1A 3GFEA 3I0QA 5AM6A 5DVRA 4X3FB 3RAHA 5EW8A 4IAYA 3GEQA 3QD3A 5DEWA 3F5PA 4OGRA 3PFQA 2CMWA 3VJOA 4XRLA 1P14A 3GU4A 4ITIA 3QXPA 5CXHA 4U3YA 5E8UA 1GNGA 4PTCA 3FY0A 1A06A 3EL8A 4F1MA 4D1XA 4GKHA 4TYGA 3VUIA 4CFVA 4E3CA 1AQ1A 2XYNA 2QG7A 4HYIA 1H27A 3Q53A 4NFNA 3ZSHA 4L01A 3SAYA 3E8NA 3V5PA 5ETCA 4I23A 5I9UA 3TKHA 4X2KA 1RQQA 3IW5A 4UZHA 2QO9A 3H9RA 3ZEPA 1R3CA 2I0HA 4WIHA 2EXMA 4XRJA 3P79A 4IADA 4O22A 4ENYA 4UEUA 3O2MA 4NTTA 4WNMA 3BGQA 1I44A 5K3YA 4AUAA 5AFVA 5TOZA 2HK5A 4E5BA 4FEWA 4NJDA 4O7ZA 4FKUA 4UYAA 3BV2A 4TWPA 2B9FA 1G5SA 4YNEA 1QMZA 4G34A 4O2PA 2X6DA 3R02A 4QRCA 3RGFA 3TWJA 3ZUVA 3V6SA 1W82A 5EHYA 3ATTA 4DTKA 3COIA 3RWPA 2OZAB 2YCRA 3FKNA 3MIAA 4JBQA 5HD7A 4C4JA 1JSVA 4GUEA 2XCHA 3EQIA 3DQXA 5A4CA 3G33A 1NY3A 5ETIA 4TWNA 3CLYA 4RC2A 4QMUA 2G1TA 3PXQA 1J1BA 3FL5A 2OH4A 3IO7A 3EN5A 3AC5A 2O8YA 4GK4A 5FM2A 2X39A 2WEVA 1FPUA 3Q60A 1BMKA 4HYHA 2HXQA 2GQGA 4Z55A 5EKNA 2VWIA 2UW4A 4H39A 4JL9A 4FV0A 2UW7A 3Q6WA 5LMKC 3PJCA 4U45A 4L3JA 2QOKA 2IW8A 4YJOA 4D28A 1ZMUA 3AGMA 2BR1A 4EH6A 1IAHA 5C01A 3AGLA 4FG9A 3DGKA 4L3LA 3SG9A 1OIQA 2R5TA 5DR6A 1ZOEA 4ALWA 1CDKA 4MF1A 4M68A 3FZ1A 3GQIA 3HVCA 4AWIA 4NTSA 4RJ4A 3Q32A 4BHNA 4RMZA 4U41A 3HDNA 1O6LA 4Y5HA 1BYGA 3OROA 5FTQA 2X8IA 2IW9A 1OMWA 2GNGA 4IM2A 5J9LA 1YQJA 5JZJA 5FBNC 5A6NA 4GFMA 5CF5A 1O6KA 3T3UA 4PX6A 3GCUA 4PUZA 1I09A 2UZEA 3FLNC 4P90A 2QOQA 2X8EA 1H1SA 3CD3A 5AIRA 4FK3A 5LJJA 4A9UA 3SA0A 3R7YA 3C7QA 3V04A 5FTGA 2UZBA 2DYLA 4AW0A 1H08A 4JAIA 3OCBA 3HRFA 2WQNA 2JKMA 3ZUTA 1FBNA 4MHAA 1PRYA 4YURA 2C5OA 3BCEA 2WTIA 3QWJA 4CV9A 2JIUA 4FVQA 3ZXZA 5DLSA 4B8LA 3WF8A 3VF9A 4C2WA 4AGCA 2XK8A 3FEGA 3JY0A 2PUIA 4NU1A 5LVLA 5C4LA 2IW6A 5BVKA 2Z02A 4X3FC 3OT8A 4J98A 2LGCA 4ITHA 1V0PA 2YM7A 3GP0A 5F94A 1SNXA 3R22A 3E62A 4HZSA 4BKJA 1OGUA 3FMKA 4EOLA 4O0WA 5AJQA 4USFA 4FSRA 1YOLA 5HBHA 4LG4A 2JDVA 3OBJA 4IIRA 2UW8A 4QYEA 4IAAA 1YW2A 3LFFA 4MF0A 4D5HA 3ZC6A 5AUUA 4FKGA 4RRVA 5DIAA 1H28A 4FTUA 2QHMA 1PKDA 3QTZA 4N0SA 3P0MA 3EFLA 4YC6A 4RJ6A 3ZLWA 2PHKA 4IC7A 3GFWA 3R2YA 3KEXA 3QQHA 4R7BA 2VRXA 1H1RA 4CMOA 5CT7A 4MXOA 4EHGA 4EOMA 3EN7A 4D55A 3LJ2A 5JH6A 3RPSA 2WELA 5LCJA 2WO6A 2YIXA 3KVXA 1UU9A 1PYEA 3QRUA 5EM8A 1Q8WA 1QPCA 4P5ZA 4PP9A 3VW8A 5ANOA 1E1VA 3PLSA 1MQ4A 5KE0A 2VX0A 3S2PA 2OGVA 2UZTA 4JBVA 4DEIA 4JS8A 4DG0E 3V8TA 4O2ZA 4X2GA 1PXPA 4GFGA 3GNIB 4E4MA 1PXMA 3RPVA 5E92A 2OLCA 4FV2A 2HY81 2BZIB 4AFEA 4HVHA 2NPQA 2PVMA 3FZRA 1NVQA 2CN8A 2F2UA 4FKQA 4GK3A 5AX3A 1OVEA 3FWQA 3SHEA 5AWMA 3UE4A 1OUKA 2IZTA 3TNPC 2RFNA 4HGLA 4DFZE 2YAKA 2CCHA 2A1AB 3Q5IA 4UN0C 2P3GX 1M17A 5FEEA 1QL6A 4FEQA 2VTTA 1CKJA 2XNOA 4LQMA 4Y83A 4QP3A 3CQWA 5HQ0A 3Q9YA 5C03A 4O1OA 5EDRA 5CAUA 3FI3A 4HCTA 2WQMA 2ITPA 3CC6A 4I41A 2G9XA 3JS2A 4TRLA 4IMYA 4GG7A 4R5SA 4AZWA 3PJ2A 4O7RA 3DB6A 2AC5A 1SYKA 3C0HA 4M0YA 1H0VA 4R3RA 4YP8A 3BBTB 1FVTA 4AACA 1GIIA 4LMNA 5JGBA 4I5MA 2C6DA 2VV9A 3MB6A 4NM5A 4CZUA 5CAVA 5K5NA 3G5DA 3R9DA 3JR1A 4WG3A 1QPDA 2RGPA 4B4LA 3R1QA 4UMQA 3HECA 3UVRA 3A99A 3FLQA 2REIA 3CIKA 3L8VA 3L8SA 3LOKA 4QOXA 4FTKA 1YKRA 5EYCA 3VS1A 2X8DA 4DN5A 3LMHA 4EQUA 5L3AA 4RZWA 5L2WA 4U97A 1KUTA 1YXXA 4Q2AA 2R3OA 2PE1A 4UMPA 3V01A 3L9LA 3BHHA 4USDA 3Q52A 4L52A 3UOHA 4F0GA 3DV3A 4FV3A 5CT0A 3FLZA 2W4KA 3RPOA 2JITA 4G3GA 4J1RA 3S1HA 5IA3A 4C4GA 2E9VA 5E8VA 3SRVA 4JDIA 2C6EA 3ORIA 4D9UA 3VHEA 4X3JA 2ITUA 1OPKA 4W4XA 3UMXA 4EOKA 1OL6A 1PXKA 2W9FB 3NW5A 3EN9A 4EWQA 3Q6UA 1IA8A 3A8XA 2V7OA 1J1CA 3KXXA 4E6CA 2WZJA 3PRFA 3QCXA 3QKKA 4AZVA 5F95A 4RIXB 3GUBA 4YNOA 2BKKA 3E88A 4YSMA 3KF7A 2Z2WA 3DU8A 2PVJA 2O5KA 5TO8A 2H8HA 3DXPA 4AZFA 3II5A 3I4BA 2ZJWA 5HICA 1M7QA 1OM1A 3D14A 4BDIA 1Q8TA 3ZZEA 3VUGA 4CQGA 3DJ6A 4YZ9A 1M52A 2P55A 4FYOA 4JR7A 4L3PA 5GJGA 5I3RA 4RVKA 1BI7A 3C50A 3P7CA 4FNWA 2WFYA 3RI1A 4LRMA 2C6MA 4HVIA 5HIEA 3VF8A 3RZBA 1H24A 3CXWA 5D9HA 5JQ8A 1UKIA 2OK1A 4M8TA 2JBPA 1YWVA 3BYSA 4J53A 4NSTA 4HGTA 3DZOA 4M69A 4DBNA 3WIGA 4F9YA 1Q62A 3BYMA 3VJNA 4OAVB 3BEGA 1PY5A 4A07A 3L8XA 5BQ0A 2XA4A 3H0ZA 4FIFA 2YEXA 4FZDB 5F1ZA 4ASZA 2IPXA 3NIEA 4ZTLA 2CPKE 2XEYA 4MK0A 3QF9A 4NCTC 5BYZA 5JGAA 4MH7A 4ACMA 2GTNA 4MD7E 4TTHB 4E73A 3NUUA 5KZ0A 2YM6A 4F9AA 4DT9A 3PWDA 4IANA 3C4FA 2J5EA 4FG8A 3DKFA 1WBSA 4M12A 3F3UA 4D2SA 1XH9A 4ZTMA 2F7EE 4M7IA 2BMCA 1DAWA 3BZ3A 4DTAA 4E7WA 5EQYA 2G2FA 3KRWA 4FIGA 4ZXTA 5C26A 5I9XA 3CJGA 3OHTA 4WA9A 4WNPA 5J79A 4PWNA 3AG9A 3PPKA 4AGDA 2ITZA 1YHWA 4CT2A 2FO0A 4Q5EA 4RJ5A 4A9SA 4OBPA 1VZOA 4QMXA 1NVSA 3GI3A 3E3PA 5DT4A 3M2WA 3ID6C 3TV4A 3MPAA 4AA5A 5JFWA 3I6UA 5FGKA 4DH1A 1F5QA 3CGFA 5EKOA 5M57A 3TACA 3MFUA 4EH5A 4LM5A 4IWDA 4JQEA 1LEWA 3SOAA 5I9WA 1W98A 2YIRA 4FSTA 4JNWA 3PDTA 3ZH8A 3R1SA 4BCJA 2FUMA 4DFYA 2F49A 3N51A 4PP7A 4EUUA 5BUJA 5HVJA 5HZNA 3VHKA 2BFXA 3DT1A 4DBXA 4ZOGA 3E5AA 4B8MA 3VS3A 4L8MA 2YZLA 4TYJA 4E5WA 3GVUA 2NO3A 3IGOA 5EOBA 4I4FA 4ZSJA 4EI4A 3RM7A 2QOLA 3FC2A 3NUSA 1BLXA 1TVOA 2XIRA 4A4XA 2O63A 1OL7A 2YA9A 4BDCA 2NNWB 4NW6A 3ZM4A 5M55A 2VO7A 2ITWA 4O0XA 3QZHA 4YJSA 3HAMA 3NMUF 4EOQA 5AV3A 1FGKA 2QOCA 5ANJA 4O7YA 4I6HA 2YDJA 5HO7A 1CSNA 3E8CA 4KSPA 3UIBA 3RHXA 4AU8A 2VTPA 3FZSA 3U4WA 4YJVA 3OC1A 4K77A 1CTPE 5GNKA 2BUJA 3DB8A 4NFMA 4F1TA 3O50A 2VTQA 2G2IA 1Q8ZA 5EW3A 3ZRMA 4AN9A 4Z16A 5L2IA 3TT0A 2IVTA 2J2IB 4FOCA 3I81A 4EK6A 3RINA 4EOJA 4F4PA 5M07A 2FSOX 3BLRA 4BIDA 1YVJA 3NW6A 2WQOA 4IVBA 3LLAA 4YHJA 5GIPE 3ITZA 3FMHA 3QC4A 3QD4A 5AEPA 2QOOA 2ITYA 3Q4UA 4G6NA 5A9UA 5IQFA 4R1VA 5DYJA 3O71A 1FMKA 5I9ZA 3G6GA 5KKRB 5H8GA 3QZIA 3GU8A 3FXZA 1UVRA 4FTTA 4C36A 2ZM4A 3R7VA 1XR1A 3VRYA 3ZLYA 4YO4A 5JFSA 2ETKA 3MJ1A 2R3PA 3NR9A 3MY0A 4FTQA 4YC8A 2W06A 4R5YA 3LIJA 1A9UA 4RWLA 4C4IA 3D5WA 3TZ9A 3GB2A 2WQBA 3EQCA 4M97A 5J1WA 3GT8A 1U5QA 2IVSA 5BVWA 3KRRA 1CKPA 1UWHA 1OUYA 2OI4X 5C1QB 5LXMA 3JUHA 5AUYA 2ZAZA 4IWOA 5DHJA 4V01A 4D1SA 5CEMA 3R7EA 4DGGA 4TY1A 1K2PA 4M3QA 3RZFA 3UGCA 3F69A 2XKFA 4P2KA 3UG2A 5EQEA 3PA5A 4EEVA 2GU8A 4MEDA 4U81A 4E8AA 3FZOA 5J9YA 4XG4A 4ZZOA 2HW6A 3IW8A 3MFTA 3ZSGA 1Q5KA 4YR8A 1TQPA 2R64A 2WAJA 3D5VA 3G9NA 3PTGA 3HMNA 3ZBXA 3MW1A 3DFCB 4AG8A 5HBJA 2HCKA 4IE9A 1SVHA 3UIXA 4K2RA 3SW4A 1H1PA 3COKA 2R3HA 3KMMA 2QONA 4QMMA 4LRJA 4U5JA 5DNRA 4FC0A 2BHHA 4H3QA 1SVEA 3FLSA 5ANKA 4RX9A 2W1DA 2QR7A 5CQUA 3BIZA 2OZAA 4PNKA 4YUQA 3LXNA 3OUKA 3D0EA 5J7BA 2ETMA 3COHA 4XCUA 5IQHA 4YHFA 5GJFA 2X4ZA 4YJPA 5CTPA 2FYSA 1ZY5A 5CVFA 4I92A 4RWIA 4Y95A 4ZSEA 4C2VA 4O7NA 4QPAA 4FZ7A 4DLIA 4KUJA 3RWQA 2CLQA 2WMUA 4DFXE 5LCKA 2WOTA 3DAJA 5B0XA 5IEYA 4S34A 4DGLC 4HJOA 3V8SA 3QTSA 4XG2A 2XM9A 2JGZA 3GC9A 1M7NA 2RFEA 3OXTA 3MN3A 2YJRA 3HV3A 3DKOA 3QKMA 4KBCA 2C6KA 5K9IA 5TR6A 1H00A 3UNKA 4FE2A 4XG7A 4PRJA 4ENXA 3NNUA 3C13A 5CU3A 2XEZA 2XZSA 4ACHA 1S9JA 3SW7A 5M08A 4O38A 5HLPA 2UZOA 2PZIA 2VD5A 1FOTA 1WZYA 4XV1A 4G5JA 5HG9A 3TUBA 5E4HA 3WZJA 3A8WA 4JQ8A 4XLIA 4ZTRA 4ZIMA 3AXWA 4KKEA 2ZM3A 3RPYA 5BPYA 4AS0A 1JQHA 3LFCA 3PP1A 4QO9A 4HYSA 4OTHA 3ENHA 4E5AX 3BLHA 2NRYA 3SRVB 4RT7A 3ANQA 3BYUA 4D0WA 3TI1A 2WMQA 2QVSE 3P1AA 4QTAA 3D7ZA 3NRMA 3PXKA 4KINA 4C57A 3C0IA 3BBWA 3UNJA 4BGQA 4CYJA 2PUPA 3RJCA 4RLKA 3KRLA 2GTMA 2B7AA 4X2FA 3I60A 4CCBA 4W9XA 2OIDA 3KXZA 4C62A 3E8DA 2UV2A 3CE3A 4AAAA 4UMRA 4EHZA 5ACBC 3ZU7A 4CZYB 3MPMA 4GVJA 4MD9E 2ZV9A 3HYHA 3G0EA 4QPMA 3VBXA 4HVDA 3OY3A 3R8ZA 4CG8A 4K6ZA 1OKVA 4ANOA 4YJUA 1O9UA 3HV5A 5AA9A 5HO8A 4CMUA 4USEA 3KFAA 2C30A 2GNJA 2ITQA 2BDFA 4GRBA 3ZOSA 2W5AA 4CMTA 4UB7A 5BVDA 2FSLX 4NKSA 3WARA 4ASDA 1JLUE 4TPTA 3LFDA 3WE4A 1H8FA 2IZRA 5DH3A 5KKRC 2IVUA 3IDPA 3UJGA 5KCVA 3ET7A 4BCMA 3DZQA 3Q2JA 4A7CA 3QQUA 5KMIA 3SC1A 4FGBA 4FUXA 5L8JA 3FYJX 4BCPA 4ZLYA 4BN1A 3KVWA 3B2TA 3W1FA 3D94A 1REJA 3I6WA 4XOZA 1DAYA 2YN8A 3W10A 3UIUA 4BCIA 4WG4A 2OU7A 2PSQA 4JDHA 3ZS5A 4N57A 3CTHA 4BI0A 5HKMA 3OP5A 3DQWA 4IBMA 4YJRA 5LWMA 2EB3A 2O3PA 3ZCLA 2HENA 5DEYA 1LPUA 3QTIA 4XP0A 2UZVA 3PE1A 3DTCA 4O86A 3W2RA 3D5UA 3FMLA 2C1BA 2XF0A 3AD4A 3LCOA 3MFSA 3UC3A 4F0IA 3WF6A 5CF4A 5M44A 3H0YA 4D4VA 4HNFA 2QOHA 3R0TA 4LV8A 4PTGA 3BHTA 2R3NA 2A2AA 4K0YA 4F65A 3A62A 2C0IA 3O7LD 4FODA 5I3OA 4O27B 3TTIA 3ZFMA 4HZRA 1XH8A 4IJ9A 1JOWB 3OWJA 4KIPA 4RIOA 3W33A 4C37A 4ZAUA 1OBDA 3UQFA 4J8MA 3BE2A 4ANLA 1SVGA 2WMTA 5HE0A 3U55A 5IQDA 2W99B 4PF4A 4X21A 5HG7A 2H34A 2PVKA 3GBZA 4B7TA 5I4NA 3RK9A 3V5JA 3BKBA 3W2PA 3PXYA 4BDKA 4AOJA 3UYSA 3AT4A 2WB8A 4Z9LA 4BBMA 3DDQA 2RIOA 3U9NA 4CRLA 2OFVA 3EQDA 2GFSA 2OXDA 3Q4CA 1PXIA 3QAME 4K11A 4ZSGA 2EWAA 1J91A 4RVLA 1OL1A 4RA5A 3UPXA 4F6SA 1XH7A 4S33A 3UQGA 4F63A 3Q2MA 5CU0A 2XKEA 4ASXA 5JQ5A 2PE0A 5ACKA 2OF4A 4G9CA 4JR3A 2A0CX 5CEOA 4DFBA 3LXLA 4ITJA 4EUTA 2YCSA 4XV2A 5ANEA 1WFCA 5FRIA 2G01A 4L42A 1ZY4A 1W0XC 4QP9A 1OITA 4JG7A 5CY3A 3OOMA 2OJIA 5IQBA 4FTOA 3RTPA 2Z7SA 4OAUC 4AX8A 3K5UA 1H0WA 2OIBA 4L7FA 3ORZA 5KMOA 5DN3A 3K3JA 2J5FA 4AA0A 5KMMA 2CKPA 4FGRA 4I6FA 2WHBA 2ZM1A 4AT3A 2PUNA 4A4OA 4ACDA 3DKCA 4R7IA 3UOJA 2O2UA 3D9VA 3R8LA 1J7LA 4O83A 5HE1A 3GCVA 2BRNA 2Y7JA 4PDOA 2VTRA 3NSZA 3LZBA 2VNYA 5DBXA 5BYYA 1GZNA 5LMAA 3SDJA 4B99A 5EG3A 3GXLA 4FIIA 2VGPA 3EQPA 3R8MA 3T8OA 3P7AA 4NW5A 2UW5A 4ONAA 5A4QA 3O51A 1GZOA 2PTKA 5AUVA 4AFJA 4S31A 3NGAA 2W1IA 1Z9XA 4N4SA 1Q24A 4RFYA 4YPSA 3CJFA 3K5VA 4BRXA 1U59A 3KKVA 3OMVA 4YJTA 5FEQA 1PKGA 2YZAA 2UZUE 3QUPA 4E93A 4RIXA 1XH6A 3QCQA 1PW2A 4YC3A 3AMAA 3NWWA 2Q0BA 3I5NA 2OICA 3KMWA 5HHWA 4XBRA 4GU9A 4BKZA 2PU8A 5ANIA 4ZS0A 2J9MA 5B2KA 4BGHA 3HDMA 4UYNA 2A27A 3WF7A 4EH2A 3ULZA 4HCUA 3NNWA 1QPEA 4MYGA 4U43A 4UWCA 4XH6A 4BBEA 4BWPA 1GIHA 4BTMA 3BWJA 3R2BA 3IG7A 3GOKA 4IX3A 3VUMA 4IX4A 2QU6A 3ZO3A 3ENMA 5AMNA 3LM0A 4FSWA 4F08A 4IH8A 4ZY4A 5CAQA 4O84A 1PXJA 2UW3A 5HE2A 1WBPA 1YXTA 4OBQA 3F2NA 4G3CA 4QQCA 2GNFA 4BR3A 4WBOA 5EH0A 4A9RA 1DS5A 2GS7A 4IHPA 4YBKA 1KSWA 5T6KA 2GDOA 2WMSA 4KRCA 2IG7A 4FKJA 4LOOA 2WU7A 4ZY6A 2CGUA 2E2BA 3ZO1A 3BU5A 5HTIA 2VTLA 2BTRA 1IEPA 1BKXA 5C8MA 3VUDA 1JKLA 4Z7GA 5CWZA 5JSMA 2CNVA 2VWXA 2Z8CA 1H1WA 5K5XA 2ITXA 2I0EA 5EI2A 3KN5A 4TXCA 5JMSA 1MRVA 4D4RA 3QYWA 5HNBA 3ZSIA 3RALA 3PE2A 3P4KA 2ITVA 5JFXA 4FIHA 3I7CA 4AE9A 2IZSA 3PVBA 3LM5A 3AC2A 5CSVA 3C4ZA 4WSQA 4U79A 5C4KA 3VIDA 1M2PA 3HMMA 4XG3A 2OZOA 3F2AA 1JAMA 2QODA 3DBCA 3QD2B 4PDSA 1JKSA 4AE6A 3KREA 1VEBA 1K9AA 3MA6A 3LW0A 3G15A 2XNBA 4FF8A 3DLSA 4U7ZA 4PMTA 3ZM9A 2Q83A 3PA3A 3N9XA 3MPTA 5AV1A 2HWPA 3RAIA 4FV5A 3VQUA 4H58A 2J0LA 2WTCA 3LCKA 3RNYA 1XBBA 4EZ5A 3ATSA 4G3DA 5EI6A 3SXFA 3FUPA 3HL7A 3H10A 5CNOA 2O0UA 3CP9A 5FQDC 3KXGA 1OZ1A 1V0OA 4EZ3A 3R83A 4QMPA 2GCDA 5EM6A 3VRZA 2HXLA 2OW3A 3NUNA 4FOBA 3FXWA 5CU6A 2JDTA 2V0DA 4FKVA 5J8IA 3L1SA 4PMPA 2QI8A 3R28A 3L9NA 3NVKI 3QQKA 4D5KA 2W5BA 3PY0A 3VQHA 5KHXA 4QMNA 3UZRA 1ZYCA 4FV8A 2C6IA 4FV4A 4EORA 4YPDA 2EB2A 4CEGA 3NZ0A 4RC3A 4DA5A 1Q3WA 3IW6A 5IA0A 3B8RA 2LAVA 4RFZA 3RCJA 2C3JA 2BILB 1M2QA 2BTSA 3V6RA 5IA2A 3R21A 4FV9A 4KIOA 4AZEA 5HTBA 2YIWA 1OPJA 4YTIA 4JX7A 3SG8A 1H07A 1UU3A 3D83A 4H1MA 2V5QA 3VBQA 5J5TA 3FHIA 4EHVA 3QQJA 4MX9A 3CS9A 4EOPA 4EBVA 1K3AA 4LMUA 2B4SB 3UO4A 3T3VA 3K54A 1H26A 4IC8A 5ICPA 2J6MA 2W0JA 1U46A 3KGAA 1KWPA 5TT7A 3I79A 3T9IA 4GL9A 4EH9A 5JZNA 3EYHA 3FKLA 5IUIA 4IWQA 5CX9A 2C5NA 2XM8A 5C8NA 4IDVA 5HLWA 1URCA 2XNNA 5JT2A 1OI9A 3PP0A 2W5HA 2PMLX 4FTCA 4BCKA 4APCA 5AP2A 4XS2A 4EL9A 5JGDA 2C5XA 4G3EA 4F64A 4YMJA 5KMJA 2ZMDA 1W83A 4K33A 4ID7A 3B8QA 4Y72A 1LR4A 3NYXA 2XRWA 3L9MA 3REPA 4FEUA 3FZTA 4QMSA 2W17A 5EW9A 3NYVA 3CSVA 3FLWA 3VNTA 3TDVA 1Q99A 4UALA 5CYIA 3VS0A 4J99A 4R7HA 2X9FA 4G6OA 3E7OA 1YOJA 4JBPA 4O0UA 5H8BA 3PUPA 5HG8A 4XUFA 2WMBA 3I7BA 1V1KA 4TW9A 5KHWA 2JAVA 4FL2A 3QGYA 3C4XA 3TNHA 4FT3A 5IUGA 4EBWA 1WCCA 2Y4PA 3OW3A 3QTRA 3QTXA 3QXOA 3A7GA 4IAZA 3SV0A 4DHFA 4DEEA 4GT4A 5CEIA 3HRCA 4DYMA 3JY9A 3FQHA 3K3IA 5BUIA 3BHVA 3V5TA 3QQGA 3AC8A 5C27A 1R1WA 1Y91A 1JSUA 3V5QA 4GU6A 3EQBA 4JBOA 3U6JA 4KA3A 1RE8A 2VWUA 2YLFA 5CLPA 4RC4A 3NCGA 4PPCA 4CNHA 1GZKA 1YXVA 2XNGA 4C4FA 3ORMA 4QQJA 2ZVAA 5LOHA 4EC8A 3HKOA 3QHWA 5IMXA 2VO6A 3IDBA 2HZ4A 2PK9A 1R39A 4BDJA 3NYNA 3T9TA 1MP8A 4RG0A 4W8DA 4FNZA 2GHMA 5A6OA 2X9EA 3OEFX 4FVRA 4OTRA 4YZNA 1J7IA 2X6EA 2W1FA 3IK3A 3PA4A 5IU2A 2DS1A 2JBOA 2WTJA 3E63A 4YLKA 3IOPA 1NT2A 4I20A 3MFRA 4I5PA 4BI1A 4E20A 2XMYA 2BCJA 1APME 2BZHB 5AV0A 4RBLA 4CFWA 4FUYA 4K1BA 4A4LA 3OBGA 4BZDA 2W05A 3PXZA 1Y57A 5IUHA 4C33A 2HAKA 3LLTA 3KQ7A 5IH5A 1P5EA 4GW8A 1U54A 4X6RA 2RF9A 3FC1X 4EH3A 1OIRA 3R1NA 3LVPA 4BTJA 4WD5A 1YXSA 4ACGA 3NUAA 2WXVA 2XS0A 4QD6A 2W1ZA 1KOAA 4JAJA 1KV1A 3E7VA 2PVHA 4DEHA 4ZJJA 4U8ZA 2P2IA 3P08A 2WU6A 3F5UA 1ERKA 2JFLA 4KABA 3OTVA 4G17A 2XIXA 3CQEA 3DBEA 4YTCA 4HVGA 2YABA 1PHKA 2RG5A 4ZTHA 3RK5A 3EQRA 5EOLA 2VN9A 4QP2A 3R8UA 4AP7A 2BZJA 2QHNA 4ERWA 3GCSA 3K2LA 5M06A 4DEBA 4E6DA 4XNEA 1TKIA 2BRGA 2OWBA 3PZHA 1ZOHA 5M51A 3HA8A 3N4VA 3FV8A 2XYUA 3SOCA 2RSVA 4P5QA 3F3ZA 4CLJA 1G8AA 2I7QA 3OEZA 2EUFB 1ND4A 5H9BA 4FZAB 4RZVA 5CNNA 2B55A 3LPBA 4EH8A 1H25A 5CSHA 4M84A 3WF9A 4C8BA 4E26A 2X7OA 5BNJA 3DNDA 5AA8A 5E7RA 3Q04A 4RJ7A 4RIWA 1ZAOA 1URWA 5ETAA 5T68A 4TWCA 3M1SA 4TNBA 1RJBA 2UUEA 5LVPA 1OKZA 3W2QA 2GMXA 3GQLA 2VTJA 3QRJA 4O82A 2XK9A 3MVJA 4BIBA 2XVDA 1FVRA 5CENA 4ARKA 4W8EA 2ETRA 1F3MC 3OOGA 3W32A 4DF3A 4DGMA 1OKWA 5HO6A 3QTUA 4BC6A 1JKKA 4CRSA 5B7VA 3EFWA 2WIPA 4KIQA 4M66A 2ZB1A 4WSYA 1ZYJA 4BVUA 4EK4A 2E9PA 2WTKB 3EOCA 3QWKA 2QCSA 3CTJA 4FKIA 2XJ2A 4L46A 4C38A 2ZDTA 3O0GA 3IW7A 5EYMA 5DMZA 4R8QA 3H3CA 4CVAA 2X4FA 3PSDA 1XHAA 3EYGA 4S2ZA 1XBAA 3TNIA 5KNJA 4ZLOA 3ALNA 4GIHA 3MWUA 3SQQA 3TIYA 4XJ0A 4GCJA 3ANRA 3ERKA 4YZBA 2CJMA 3GOPA 2BRBA 5I5ZA 3LKMA 4OW8A 5AUZA 3JXWA 3MIYA 3U6IA 1R0PA 5M4FA 3VS2A 1WVXA 2QD9A 4XP3A 4TN6A 4MAOA 4GG5A 4Z7HA 3ORNA 5B2LA 3E92A 3R7GA 5F9EA 4U80A 2UZLA 3LJ0A 3PLAE 3ORLA 2FH9A 3MTLA 2VAGA 4FMQA 2BALA 2B53A 2OXXA 4QYYA 4O0TA 2CGVA 4FSYA 3S95A 4H05A 2JKOA 4MBJA 5HNGA 4PPBA 1ZZ2A 2UW0A 3ZRLA 1VJYA 4J97A 4KIKB 4YZDA 1L8TA 3Q3BA 3TG1A 2CGWA 1BUHA 4L7SA 3BPRA 3LFAA 3TM0A 4I3ZA 2KTYA 2WPAA 3G90X 2GSFA 1G3NA 3MGYA 3QZGA 5FDXA 1DM2A 4R3CA 2SRCA 2V7AA 2AYPA 3FMMA 5A3XA 3C5UA 4J71A 4D58A 3MYGA 1AGWA 3KRXA 3NUYA 5E91A 2H6DA 3NEWA 4NK9A 3BQRA 3SKCA 4DGOA 4ZJIA 4Q9ZA 5GINE 3QZFA 2C6OA 2FA2A 4G31A 4GYIA 4IZ7A 3R63A 4BGGA 3FY2A 3GENA 3KL8A 2Y0AA 3R01A 4L9IA 5BMSA 3AQVA 4LL0A 4AXAA 2C68A 5KMNA 3I0OA 4TWOA 4EYMA 3KY2A 4ZZMA 3NW7A 5KMLA 5HU3A 5TKDA 3CCNA 4EKLA 3FL4A 4MBLA 5J87A 3SXRA 4C0TA 4CKIA 4QMQA 1YDTE 4V0GA 4DFNA 1IR3A 3QA8A 1S9IA 2QOBA 1BX6A 3EN6A 4GEOA 2DQ7X 2XKDA 3A4PA 5DT0A 5KMKA 1MQBA 4LOQA 2PYWA 2W1CA 1IRKA 1YWRA 1VYWA 2C4GA 2FSTX 3QQLA 4CSVA 5A4EA 5IQAA 4FKLA 4J95A 3QQFA 4ANSA 4RQKA 4D1ZA 5HX6A 3E8EA 4MNEB 2JDOA 3QX2A 3VBWA 3PY1A 3W16A 4KKHA 1KE5A 3QLFA 1WVYA 3SLSA 1PMEA 3W18A 2Z7RA 4I0SA 4IACA 4F09A 3LFNA 4ERKA 4CLIA 2VWBA 2XIZA 3Q5ZA 1RDQE 2PL0A 3PXRA 3TUCA 3F3TA 4ANQA 3UO5A 2CN5A 3HRBA 2BAQA 3DFAA 3MDYA 3GCQA 4I6BA 4OTFA 4MXZA 3ZC5A 2YM3A 3ZTXA 3W8LA 4GUBA 2ESMA 4Q5HA 1W8CA 5AM7A 3WZUA 4GSBA 3P23A 3C51A 2OXYA 3EMGA 4D2TA 2UVZA 5BVNA 3F61A 4PDPA 1X8BA 4MWHA 1LUFA 2PY3A 2WTKC 2X81A 3C0GA 3AMBA 4I22A 4LFIA 3CBLA 3PJ1A 5AP1A 2R3MA 4IVCA 2X7FA 3LMGA 4N6ZA 5FTOA 3FPQA 1CKIA 2YCQA 3EL7A 4BZNA 4CFFA 5CSPA 1P4OA 3TZMA 2O64A 1KE7A 3UBDA 2Y6OA 3F5GA 4JLCA 4EQCA 4YJNA 1NVRA 3BWFA 4F7LA 3NX8A 2ZV7A 4UV0A 4WG5A 3F66A 4BDAA 3PYYA 3G0FA 3PRIA 2F57A 3OTUA 2W4JA 2VTIA 3CD8A 4FKPA 4IX6A 3ALOA 5CEQA 3F7ZA 1OBGA 4W4YA 4RX8A 4ANNA 5HTCA 3CQUA 5CEKA 4A06A 4DEAA 3UNZA 3FKOA 4L45A 5BVFA 4KBKA 4NM3A 4CFMA 3ZYAA 3R8VA 1U54B 3BX5A 3DDPA 4Y5QA 5L6OA 4NYEA 1JKTA 3CGOA 3TV6A 2XP2A 4U40A 3UDBA 3WIKA 4AZSA 1WBNA 3PVWA 4M0ZA 3QALE 4PMMA 4WUNA 4C3RA 4BCQA 4OR5A 3NAYA 3MB7A 3CPCA 4MCVA 4FV7A 4CZTA 1VR2A 4FTMA 4OLIA 4IB3A 5GJDA 2A19B 2C1AA 5IA5A 2GQSA 3OXZA 2WNTA 3R7OA 2OFUA 4WHZA 5CI7A 3JYAA 2W96B 3DBFA 3D15A 4GH2A 3KULB 3EIDA 3NAXA 2C0TA 2B9JA 5HCXA 5D7AA 2IJMA 3MVMA 3HLLA 3C4EA 5EDPA 3WZKA 3RAKA 3MESA 1YHSA 3VW6A 2BRMA 2XJ1A 4KNBA 4C34A 4I24A 2VTAA 2QG5A 3MI9A 5DOSA 4F7NA 5L6WL 4MXAA 4E4NA 3F88A 2HIWA 3HZTA 2BRHA 3TJDA 4JDKA 4KWPA 4JG6A 3WOWA 3V51A 2VTHA 2XNPA 2UVXA 2WMRA 3A7FA 3D2IA 3PVGA 4HNIA 2B1PA 4F7SA 3TIZA 3QGWA 5IEXA 2NRUA 4GIIA 3DLZA 2B54A 2ONLA 5FP6A 3ZO4A 3LCTA 2J90A 3V3VA 3A4OX 3SXSA 2GFCA 3R8PA 1BL6A 2HW7A 3EJ1A 5H8EA 4RIWB 2JIVA 3O8PA 4UXLA 2YCFA 4IWPA 1HCLA 2WD1A 2P33A 4IEBA 4IB5A 2HWOA 1PYXA 3KXHA 4O6EA 4RIYB 2CDZA 3QFVA 3AT2A 1FMOE 1T46A 1UKHA 3R30A 2WMAA 4K8AA 3C4CA 4YLLA 4YBJA 4BB4A 2JLDA 2JDSA 5BVOA 1BL7A 5EHLA 4FL1A 3CY2A 3IDCA 3LCSA 3EFKA 2VUWA 4WRSA 3KRJA 3KA0A 3R73A 3CR0A 2YM5A 4O21A 2PVNA 2OJGA 4HOKA 3P86A 1XH5A 3BRBA 3EZRA 4G6LA 5DA3A 4YO6A 3O7LB 4F6WA 2VNWA 5M4UA 1OIYA 4HPUE 1PXLA 1PXNA 3KU2A 2PWLA 2VTSA 1IA9A 3GC8A 4FVPA 1KE8A 4O7VA 3W8QA 4NT4A 4BCFA 2QR8A 3HP5A 3NYOA 3F7WA 5AR5A 2NP8A 5DWRA 4P7EA 5FXSA 3THBA 2VWYA 3DK3A 5CS6A 3P78A 5EDQA 4O7TA 2Z7LA 2PVYA 4G1WA 4PMSA 3U8WA 2CNUA 3GCPA 5EK7A 4ZTSA 4AF3A 2PVLA 2VTMA 5CANA 5EQPA 4AW2A 2XK4A 4FKWA 5DPVA 4KS8A 4U44A 2C6TA 3POZA 4UWBA 3BGZA 1KOBA 1UNGA 5EI8A 2C3IB 1Z5MA 4NZWB 2BPMA 5FWKK 2C47A 4RWKA 4L00A 1A48A 4FI1A 3WZEA 4KSQA 5KO1A 5E8XA 2RL5A 5G6VA 4F9CA 2QO7A 2QOFA 4A9TA 3HAVA 4D0XA 3O96A 1J3HA 3UG1A 3N4UA 5JEBA 1ZYSA 3FLYA 1IAJA 3P9JA 3R7IA 5CVGA 2GPHA 5AV4A 4DC2A 4QPSA 1HCKA 1MRYA 5HEZA 5DRDA 4QMOA 4ZP5A 4APPA 1ATPE 4DFLA 3KK9A 4MNFA 3AMYA 2B0QA 3DOGA 1YI4A 3IOKA 2GNHA 4BWXA 1ZRZA 4D4SA 2W1GA 2BIYA 2F4JA 3PPZA 4YGAA 3RK7A 4YTFA 4QT1A 2XH5A 2XRUA 1UU8A 4TT7A 3RBWA 5J9ZA 3LXPA 4FV6A 4QMWA 3CEKA 4PY1A 5HX8A 3JVSA 2QOIA 1Z57A 4U6RA 4AN2A 1JWHA 3PSBA 4XG9A 4EJ7A 2YWPA 4BTFA 4FKSA 4J52A 2CCIA 4FTRA 4EOIA 1XQZA 4GJ3A 2BDJA 3UPZA 3HMPA 1G8SA 4DTBA 2OBJA 4I5HA 2R0UA 4RGJA 2PULA 3EHAA 3Q9XA 1M2RA 3PSCA 4TYHA 2XIKA 4IB0A 2YDKA 2HZ0A 4TNDA 1H4LA 3LFSA 4AOIA 4EK3A 5J5SA 2E9NA 4AN3A 4D9TA 4O0YA 4WNKA 2BAKA 5DR2A 5E1SA 5T3QA 3QA0A 5HORA 3LQ3A 1Y8YA 4V0GB 4KS7A 3BQCA 5GHVA 4IZAA 4UZDA 3IQ7A 3CY3A 2W1EA 5H2UA 5EHOA 4EOSA 4BYIA 4FYNA 4I4EA 3BYOA 1XKKA 2JDRA 3FXXA 5BVEA 2BFYA 1NA7A 2R7BA 2XK6A 2QKRA 4MXCA 1UU7A 5K0KA 5E8WA 5HD4A 5F20A 3ZUUA 1B39A 4ZJVA 4XP2A 1NXKA 3RP9A 4O0VA 2BIKB 4N6YA 5IISA 2VWVA 1UNHA 3QYZA 5AUXA 3R04A 2ZYBA 3UVQA 3MV5A 3NCZA 4Y73A 5D10A 3ODZX 4QTCA 4XV3A 4OTQA 3TCPA 2YERA 3GU5A 3HV4A 4XOYA 2H96A 3U87A 4I94A 4CFUA 1HOWA 4FEVA 2VX3A 2YM4A 4RWJA 4QTDA 4RX5A 4FSUA 3OG7A 3IPHA 2ZMCA 2PZRA 3QBNA 3A7IA 4JIKA 4XBUA 2R4BA 4ACCA 4C4HA 3ZFYA 3PPJA 1YHVA 4JG8A 2OJ9A 3FE3A 3E93A 3DNEA 1ZMVA 4EOOA 3BV3A 4ZLZA 1E9HA 5CVHA 3QRTA 4Y85A 3HUBA 4O81A 3QRIA 5JKGA 2IN6A 1O6YA 2UZNA 3DAKA 2X7GA 3R00A 4GJ2A 4L68A 3A2CA 3TKUA 3VUTA 4DE4A 3DS6A 4IFCA 4NEUA 3MBLA 4AW1A 3RNIA 4F7JA 4FL3A 2J0IA 2PZPA 2RFDA 1R78A 3VWAA 5IPJA 2P0CA 3ZONA 3DKGA 4H3BA 5D12A 2WMXA 5AP3A 3TDWA 1GOLA 2HZNA 4R1YA 4ZS4A 1SNUA 5JN2A 2C5YA 4IZYA 4JDJA 5D11A 2HYYA 4MQ1A 3ZLXA 3ZDUA 4FT7A 3EH9A 1FGIA 4I0RA 4R77A 2HY0A 3JPVA 3LQ5A 4QMVA 5M09A 3PY3A 3LFQA 3NLBA 3EWHA 5GZAA 5L8KA 4ZK5A 2OJFE 1KE9A 4CT1A 2Y4IB 5A54A 5HESA 5J1VA 4HYUA 5D7VA 5DR9A 3VS6A 1W7HA 1Q3DA 4O6LA 4BDDA 2AC3A 4CTBA 3CKXA 2PVRA 3F6XA 2UZDA 2CKEA 3OS3A 2F9GA 5AR7A 3EQHA 5FM3A 2HZIA 4QP8A 5LQFA 3HV7A 4XMOA 2WOUA 4ZMEA 3FI2A 1CMKE 1LEZA 2BVAA 3UP7A 4KIKA 5EFQA 1ZARA 4IXPA
chains in the Genus database with same CATH superfamily
5HCYA 4EK5A 1GJOA 1ZYDA 3NUPA 4H36A 3NUXA 4A9YA 3A7HA 2J0MB 5FBOA 4XV9A 2ITNA 1QPJA 4FR4A 3QTWA 5C9CA 4HVSA 1YDRE 4M67A 2ERKA 1H01A 3AC3A 3ZLSA 3OVVA 4ANBA 2CKQA 2A4LA 3QUDA 3V5WA 2FB8A 2UW6A 2VX1A 4E4LA 4EWHA 4IAIA 4P4CA 3MJ2A 3R7UA 2VTOA 4IM3A 3WE8A 4V04A 3WILA 5HLNA 1W84A 3FYKX 4RVTA 5CQWA 1JNKA 3NS9A 5I0BA 1TQMA 3FBVA 2YACA 3G51A 5CF8A 3DPKA 3R71A 4BCGA 4E6QA 3UC4A 5IDPA 3DY7A 5CZHA 2I0YA 4FBXA 5DG5A 4BTKA 3ZRKA 4MVFA 5IG1A 4BWKA 5E8YA 3SD0A 2EXCX 3ZZWA 3UDZA 1V0BA 5IA1A 3NIZA 1SM2A 5CXZA 3ORPA 4GK2A 4UMTA 4ZMFA 4F0FA 1UA2A 4E4XA 4GFOA 3MTFA 3EB0A 2UVYA 3HGKA 5IDNA 3C1XA 3PUFC 3MA3A 4LGGA 3AC4A 3NPCA 3O17A 3R9HA 4ALVA 5GZ8A 2G2HA 3QLGA 1WBTA 2RG6A 4X2JA 5CF6A 1IASA 3KF4A 1U5RA 3QD0A 2V22A 4UX9A 4IW0A 5M4IA 2XBJA 3TZ8A 4NM0A 4RA4A 2C0OA 4IFGA 3FPMA 5L4QA 4CCUA 4LUDA 1T45A 4O91A 2ITTA 3GC0A 4MQ2A 3WBLA 4TL0A 4FNXA 4O7WA 4BDHA 2I1MA 4MNEA 4Y46A 3HV6A 4GS6A 4MBIA 3LHJA 2F7ZE 3VS5A 4D4YA 2C69A 5HIBA 3UQCA 4QQTA 5HVKA 5C8KA 3DXQA 2Y9QA 4I5CA 3BL9A 5L2QA 3C9WA 4NKAA 2XJ0A 3OCGA 5EYDA 4JI9A 4YZCA 3UODA 5L2TA 4O7SA 3PXFA 3W2OA 5FXRA 2OH0E 3DAEA 2C6LA 3HX4A 3QCSA 3KXMA 3QHRA 2J0KA 2GS2A 2YITA 3POOA 3NDMA 5K4IA 3W0QA 4YTHA 2PMOX 3ORTA 4FT9A 2YWVA 1JBPE 4FZ6A 5AP6A 3ZMMA 2WGJA 4DEGA 4K9YA 3OWKA 4G9RA 4LYNA 4O7LA 2BZKB 5IKWA 3G6HA 3I5ZA 4AGWA 4B0GA 4RFMA 4KKGA 3UZPA 1ZXEA 5AUWA 3KB7A 1WAKA 3ZBFA 2WTWA 2R7IA 4FSMA 3F82A 2PVFA 3DXNA 5KX8A 4JIAA 4NH1A 3MSSA 4X0MA 2J4ZA 3TTJA 1UNLA 3DA6A 2Y4IC 2ERZE 4C3PA 5I9YA 4NL0A 4UMUA 2VWWA 2CSNA 5HOAA 4J96A 2QLQA 3TZ7A 3FMEA 4XEYA 3FAAA 5AAFA 3OZ6A 4LOPA 1FINA 4XX9A 3M42A 3LMIA 2IVVA 3F3WA 2B9IA 4PPAA 5K4JA 5JRQA 5E1EA 4WNOA 5FD2A 4Z3VA 1YOMA 2C3LA 2YIQA 5AR2A 1H1QA 1MRUA 1ZLTA 4GV1A 3Q9WA 2Z7QA 3LFEA 4TYHB 2R3RA 5IF1A 4EK8A 3BI6A 3RAWA 4IVAA 3PJ3A 3DCVA 3TJCA 3UOKA 3WF5A 4C4EA 4YLJA 1L3RE 5FLFA 2GNLA 3FJQE 4QYFA 4BHZA 2OKRA 2YFXA 2YISA 5HBEA 4C3FA 5JK3A 4FKOA 1F0QA 3KULA 4L67A 1PXOA 4FV1A 4J7BA 2GNIA 4PL5A 3G2FA 2JKQA 2YAAA 2PMIA 3Q4TA 2RFSA 4QP1A 3TNWA 5IQGA 4II5A 4G16A 4QQ5A 5TF9A 3UO6A 2I40A 3EKKA 4PV0A 3PIZA 3V8WA 4L43A 1Q41A 1OB3A 5CI6A 2GHLA 3FMNA 3VS7A 2ONLC 1DI8A 5AR3A 3WI6A 4FA2A 1Y6AA 4GKIA 5BX0A 4PDYA 3RCDA 1PMVA 4FT0A 3DBDA 3QC9A 3NVMB 3DTWA 4C35A 4OUCA 2E9OA 2W7XA 3D7TA 1J7UA 3EFJA 4FIEA 2OSCA 3AD6A 5AP4A 1GIJA 2EU9A 4OTPA 3IW4A 4IX5A 5KBQA 4JX3A 3O8UA 4YU2A 4MD8E 3FQSA 3GC7A 2OG8A 3FSFA 4J8NA 5J7HA 3OUNB 4ORKA 3EQGA 1GAGA 3ETAA 3MH2A 4DHIB 3MY5A 1KE6A 5HI2A 5A14A 4RJ3A 2ZOQA 2YJSA 1ZWSA 3PIXA 3FI8A 3PJ8A 4EH4A 4I1ZA 2XUUA 3AT3A 1Y8GA 4OBOA 5CAPA 5IZFA 1TQIA 3VBYA 1YRPA 4L53A 4RIYA 5KZIA 2OJJA 5GZ9A 4IB1A 4AQCA 4KAOA 3LFBA 4R78A 2PPQA 4DFUA 4UY9A 3KK8A 4BYJA 1OPLA 2R2PA 1WBOA 4DG3E 4LV5A 2KULA 5FXQA 4DEDA 2J51A 5IMEA 3QL8A 4HGSA 3BELA 4CG9A 3PG3A 4DCEA 4IAFA 3AD5A 4XHKB 3D4QA 5ETFA 3ORKA 2JAMA 2XBAA 4EHEA 5J95A 2ACXA 3BHUA 3CPBA 5BYLA 2QKWB 4F99A 5LWNA 1REKA 4M15A 3TEIA 4EONA 5FDPA 5B2MA 4BBFA 4RQVA 4O0RA 3FMJA 3U51A 4D2RA 3PIYA 3IS5A 4XYFA 5AR8A 2XK3A 1UV5A 2XNMA 4KRDA 5A4LA 1JPAA 2FVDA 2P2HA 2ZV2A 4FTNA 2JFMA 4F70A 4MUQA 2JD5A 4FK6A 4FTIA 4AW5A 4KBAA 2X2LA 3H9FA 2R9SA 4RSSA 5HU9A 5LVNA 3COMA 5LMKA 3FQEA 5CZIA 3SX9A 4B6LA 4GT5A 4WUAA 4IZ5A 3R9RA 3PZEA 3PG1A 4JRNA 4LI5A 5E90A 5LMBA 4FSZA 2F7XE 4JOAA 3QX4A 2XIYA 1RW8A 4LL5A 1B38A 2YLEA 2UW9A 3GU6A 3ELJA 2V62A 3LCDA 4UBAA 2CKOA 4HW7A 3AC1A 5AAGA 1JSTA 4O4EA 5AAEA 5CAOA 3VUHA 3B2WA 4UXQA 4S32A 4DAWA 3JVRA 3ORXA 4XG8A 2PUUA 4NM7A 2J7TA 4D2VA 4OT5A 4DINA 5L2SA 3BHYA 3MH0A 2VGOA 1STCE 5CSWA 5ANGA 3PVUA 2OIQA 4M13A 4MXXA 4NIFA 4ZTQA 2YM8A 3G9LX 1QCFA 1XJDA 3C4WA 3L9PA 3GGFA 3IONA 5AV2A 3LQ8A 4BIEA 2ZV8A 2P4IA 3EZVA 5A46A 3BE9A 2IZUA 2OF2A 2J50A 5IH6A 3F3VA 4U0IA 5K0XA 4TKSA 4IDTA 4EC9A 1PMNA 2VZ6A 1Q97A 2G15A 4MTAA 3UP2A 4BY9E 4AZTA 3ROCA 1Q8UA 2VWZA 3CKWA 3ZEWA 2VO3A 4RVMA 3ACKA 4X2NA 3A7JA 5E9EA 5LARA 5AADA 3QCYA 4MXYA 3DBQA 3E3BX 3ODYX 3W2SA 3TXOA 5CALA 4CFXA 3OCTA 3S4QA 5AR4A 4C7TA 2R3IA 5AX9A 4FKTA 4L6QA 5DT3A 2DWBA 4ZSLA 1LP4A 4D2PA 2CLXA 1U4DA 3HUCA 4RPVA 4IVDA 4CV8A 4AOTA 4X3FA 3EN4A 4DG2E 4DHJA 5LVMA 5HIDA 2RKUA 2E9UA 3W0RA 4XG6A 4HCVA 4BDFA 3Q4ZA 5EM5A 3LAUA 4RJ8A 4ZY5A 3KC3A 4CGAA 3W0PA 2XB7A 3V5LA 5CSXA 5H3QA 1OL5A 4FTJA 3R9NA 2JEDA 4LGHA 1YWNA 2IO6A 3DJ5A 3U54A 4ZZNA 2I6LA 4PQNA 1G8KA 3A60A 4OTWA 3UZTA 3MY1A 2GHGA 4JJRA 5KBRA 2FGIA 3E64A 5ANDA 5HGIA 3VBVA 3SGCA 4GVAA 3RPRA 2C3KA 1PF8A 3R6XA 5JRSA 2R0IA 3ULIA 4DLJA 1XO2B 4G2FA 4ZTNA 2X0GA 4MKCA 3QKLA 2WQEA 1DI9A 4PTEA 3OWLA 4HGEA 3VAPA 1WBVA 2X2MA 2B52A 3U9CA 4V05A 4MWIA 4QP6A 2EXEA 1Y6BA 1M14A 5BUEA 3LE6A 4I0TA 3BYVA 3FI4A 4LRKA 2C5VA 4S30A 3QU0A 5FG8A 5G1XA 4AT5A 1SMHA 2QC6A 4R6VA 2O65A 2BROA 2YHVA 4QP4A 2X1NA 2ZDUA 4NWMA 3LXKA 1VYZA 4AT4A 4BFMA 4X6QC 4BDBA 2X2KA 5D41A 4FT5A 4DT8A 2F2CB 4CXAA 3EQFA 3P5KA 4C02A 4EKKA 3ACJA 3Q9ZA 5IQIA 3W0NA 2PE2A 3WYYA 5HG5A 5E8SA 2QURA 2XNEA 1Q4LA 4F78A 4HPTE 2H9VA 3HMOA 3O23A 4E6AA 4FSNA 4QNAA 3VN9A 4FIJA 3NNVA 4WBBB 4I21A 5AP7A 3IECA 5AP5A 3TN8A 4DH7A 4QMZA 4EQMA 3F2RA 4PL3A 4LUEA 3UVPA 5M56A 4U3ZA 4BCNA 2B9HA 3I1AA 4CD0A 4DITA 3BLQA 4O0SA 5EYKA 5E8ZA 2HOGA 5D1JA 5IH4A 5TE0A 1JVPP 1WBWA 4F6UA 4QMYA 3S00A 2VU3A 3VULA 4C59A 4FNYA 4CFNA 3A61A 2GS6A 4TZRA 2R3LA 3NNXA 3U4UA 2JKKA 2QLUA 3H9OA 1XH4A 4OTIA 3R9OA 3MH3A 4TYIA 2I0VA 4FKRA 1YXUA 4YHTA 4IQ6A 5CU2A 3D5XA 2HELA 4FICA 4OTDA 4JRVA 4WRGA 2WIHA 4TYEA 3N4TA 4FZFB 1MUOA 3MS9A 2VTNA 4D2WA 5IQCA 1EH4A 4CKJA 2R3JA 5HE3A 4QP7A 3ZHPC 4Y8DA 4RLLA 5AIKA 4DH5A 4NUSA 4BDEA 4EJNA 1ZOGA 4BDGA 3R1YA 4FTAA 4FSQA 4WO5A 3UYTA 3MH1A 5CU4A 4NJ3A 4F9WA 2Q0NA 3TNQB 4U42A 3W2CA 5DE2A 2Y6MA 3UOLA 1CM8A 3S0OA 2W9ZB 3HMIA 4IJPA 3ROYA 3VC4A 5HNIX 5M53A 4ASEA 4G3FA 3BL7A 1BI8A 3O8TA 4EYJA 3U6HA 3OY1A 5I9VA 4BCHA 3TV7A 5L8LA 1GY3A 1FVVA 2VO0A 3OWPA 1P2AA 2WKMA 3D7TB 3OW4A 4BKYA 4JXFA 1YI3A 4AA4A 2BHEA 2WTVA 4JVGA 3BU6A 4AXEA 3TL8A 4F9BA 2R3KA 1FQ1B 3IGGA 4LGDA 2ITOA 3RM6A 3DK7A 3KCFA 4CYIA 2QQ7A 4N70A 2IWIA 2YDIA 2PMNX 2JC6A 2QNJA 5DFPA 3ZFXA 4F1OA 2EVAA 5KUPA 4GMYA 4DCAA 3BGPA 2DUVA 3HNGA 3QUEA 4I6QA 2XK7A 4R3PA 4U9AA 4ZSAA 4QTBA 5IQEA 5AUTA 2BDWA 3VBTA 1B6CB 1OIUA 1R0EA 3UMWA 1AD5A 4PL4A 1YDSE 4IAKA 4CQEA 3FZPA 2R3QA 2A98A 4WKQA 4DH3A 2XALA 2J0JA 3E87A 3M11A 4W4WA 4BCOA 3IKAA 2WEIA 4M69B 3RKBA 3WZDA 5HVYA 3HEGA 3OCSA 3RMFA 3OXIA 4I93A 4OTGA 4YSJA 4W9WA 2QU5A 4BF2A 4FX3A 2R3FA 3DJ7A 3C5IA 2PZ5A 4IM0A 4X7QA 3D2KA 1UWJA 4W4VA 4QYGA 3MVLA 4L44A 3HA6A 2OO8X 4O1PA 3L8PA 5BMMA 5CEPA 2ZB0A 3BEAA 1SZMA 2QO2A 3EKNA 5IEVA 4BL1A 3RVGA 4ZEGA 3AOXA 4JQ7A 4JT3A 3TKIA 1WVWA 1GZ8A 1YI6A 3FHRA 3Q96A 3UIMA 2R3GA 4NCTA 4DGNA 4EZ7A 5CASA 4M14A 1PMUA 3WYXA 2XKCA 4KB8A 4B9DA 3UTOA 4O4DA 2GQRA 4GYGA 3FSKA 4OT6A 5FUTA 3OFMA 1OKYA 2CHLA 4FTLA 1ZZLA 5EM7A 4RX7A 4FEXA 4BICA 3RHKA 3HP2A 2W1HA 5L6PA 2WMWA 3W55A 2W4OA 3GU7A 4H3PA 4YJQA 3SVVA 3P7BA 4BZOA 2WTDA 4G5PA 4QNYA 3BU3A 4C58A 1ST4A 3VO3A 3OF0A 4QYHA 4CKRA 4Q9SA 5DGZA 2UZWE 4GT3A 3S3IA 5M4CA 1E1XA 5AP0A 3CTQA 2JIIA 3PWYA 5DRBA 4YZMA 5E8TA 1IG1A 1P4FA 3H4JA 5LVOA 2AUHA 1OECA 1NW1A 5FEDA 2XCKA 4AGUA 3FDNA 4ANMA 3MVHA 4O96A 4K18A 3KN6A 5IA4A 2Z60A 2YIYA 2Y8OA 3DK6A 4CTCA 5JFVA 4NIFB 1WMKA 1OL2A 4FG7A 1PJKA 4H1JA 2WMVA 3FMDA 3ZXTA 1ZYLA 1Q61A 4E1ZA 1XWSA 3VVHA 2FSMX 3KXNA 2PZYA 5F4NA 5ITAA 2V55A 3KMUA 4UWYA 5HCZA 3H30A 3ZO2A 4AAYA 3F9NA 4QMLA 4EH7A 3KCKA 4WOVA 2BAJA 4XLVA 4ALUA 1Q8YA 3OT3A 3ZDIA 4KD1A 5DI1A 2CGXA 4QMTA 3VS4A 1KV2A 2CNQA 1ZMWA 5FP5A 2BKZA 3OD6X 3F5XA 4PNIA 3TUDA 3QTQA 4BI2A 4C61A 4QTEA 5A4TA 3VUKA 4DH8A 3QRKA 4WT6A 1XBCA 5GIOE 3LJ1A 3GFEA 3I0QA 5AM6A 5DVRA 4X3FB 3RAHA 5EW8A 4IAYA 3GEQA 3QD3A 5DEWA 3F5PA 4OGRA 3PFQA 4AXCA 2CMWA 3VJOA 4XRLA 1P14A 3GU4A 4ITIA 3QXPA 5CXHA 4U3YA 5E8UA 1GNGA 4PTCA 3FY0A 1A06A 3EL8A 4F1MA 4D1XA 4GKHA 4TYGA 3VUIA 4CFVA 4E3CA 1AQ1A 2XYNA 2QG7A 4HYIA 1H27A 3Q53A 4NFNA 5BV3A 3ZSHA 4L01A 3SAYA 3E8NA 3V5PA 5ETCA 4I23A 5I9UA 3TKHA 4X2KA 1RQQA 3IW5A 4UZHA 2QO9A 3H9RA 3ZEPA 1R3CA 2I0HA 4WIHA 2EXMA 4XRJA 3P79A 4IADA 4O22A 4ENYA 4UEUA 3O2MA 4NTTA 4WNMA 3BGQA 1I44A 5K3YA 4AUAA 5AFVA 5TOZA 2HK5A 4E5BA 4FEWA 4NJDA 4O7ZA 4FKUA 4UYAA 3VONA 3BV2A 1XMLA 4TWPA 2B9FA 1G5SA 4YNEA 1QMZA 4G34A 4O2PA 2X6DA 3R02A 4QRCA 3RGFA 3TWJA 3ZUVA 3V6SA 1W82A 5EHYA 3ATTA 4DTKA 3COIA 3RWPA 2OZAB 2YCRA 3FKNA 3MIAA 4JBQA 5HD7A 4C4JA 1JSVA 4GUEA 2XCHA 3EQIA 3DQXA 5A4CA 3G33A 1NY3A 5ETIA 4TWNA 3CLYA 4RC2A 4QMUA 2G1TA 3PXQA 1J1BA 3FL5A 2OH4A 3IO7A 3EN5A 3AC5A 2O8YA 4GK4A 5FM2A 2X39A 2WEVA 1FPUA 3Q60A 1BMKA 4HYHA 2HXQA 2GQGA 4Z55A 5EKNA 2VWIA 2UW4A 4H39A 4JL9A 4FV0A 2UW7A 3Q6WA 5LMKC 3PJCA 4U45A 4L3JA 2QOKA 2IW8A 4YJOA 4D28A 1ZMUA 3AGMA 2BR1A 4EH6A 1IAHA 5C01A 3AGLA 4FG9A 3DGKA 1ST0A 4L3LA 3SG9A 1OIQA 2R5TA 5DR6A 1ZOEA 4ALWA 1CDKA 4MF1A 4M68A 3FZ1A 3GQIA 3HVCA 4AWIA 4NTSA 4RJ4A 3Q32A 4BHNA 4RMZA 4U41A 3HDNA 1O6LA 4Y5HA 1BYGA 3OROA 5FTQA 2X8IA 2IW9A 1OMWA 2GNGA 4IM2A 5J9LA 1YQJA 5JZJA 5FBNC 5A6NA 2ZFYA 4GFMA 5CF5A 1O6KA 3T3UA 4PX6A 3GCUA 4PUZA 1I09A 2UZEA 3FLNC 4P90A 2QOQA 2X8EA 1H1SA 3CD3A 5AIRA 4FK3A 5LJJA 4A9UA 3SA0A 3R7YA 3C7QA 3V04A 5FTGA 2UZBA 2DYLA 4AW0A 1H08A 4JAIA 3OCBA 3HRFA 2WQNA 2JKMA 3ZUTA 1FBNA 4MHAA 1PRYA 4YURA 2C5OA 3BCEA 2WTIA 3QWJA 4CV9A 2JIUA 4FVQA 3ZXZA 5DLSA 4B8LA 3WF8A 3VF9A 4C2WA 4AGCA 2XK8A 3FEGA 3JY0A 2PUIA 4NU1A 5LVLA 5C4LA 2IW6A 5BVKA 2X0PA 2Z02A 4X3FC 3OT8A 4J98A 2LGCA 4ITHA 1V0PA 2YM7A 3GP0A 5F94A 1SNXA 3R22A 3KIOC 3E62A 3W0OA 4HZSA 4BKJA 1OGUA 3FMKA 4EOLA 4O0WA 5AJQA 4USFA 4FSRA 4JMQA 1YOLA 5HBHA 4LG4A 2JDVA 3OBJA 4IIRA 2UW8A 4QYEA 4IAAA 1YW2A 3LFFA 4MF0A 4D5HA 3ZC6A 5AUUA 4FKGA 4RRVA 5DIAA 1H28A 4FTUA 2QHMA 1PKDA 3QTZA 4N0SA 3P0MA 3EFLA 4YC6A 4RJ6A 3ZLWA 3UDTA 2PHKA 4IC7A 3GFWA 3NFFB 3R2YA 3KEXA 3QQHA 4R7BA 2VRXA 1H1RA 4CMOA 5CT7A 4MXOA 4EHGA 4EOMA 3NFGB 4I6LA 3EN7A 4D55A 4DHZA 3LJ2A 5JH6A 3RPSA 2WELA 5LCJA 2WO6A 2YIXA 3KVXA 1UU9A 1PYEA 3QRUA 5EM8A 1Q8WA 1QPCA 4P5ZA 4PP9A 3VW8A 5ANOA 1E1VA 3PLSA 1MQ4A 5KE0A 2VX0A 3S2PA 2OGVA 2UZTA 4JBVA 4DEIA 4JS8A 4DG0E 3V8TA 4O2ZA 4X2GA 1PXPA 4GFGA 3GNIB 4E4MA 1PXMA 3RPVA 5E92A 2OLCA 4FV2A 2HY81 2BZIB 4AFEA 4HVHA 2NPQA 2PVMA 3FZRA 1NVQA 2CN8A 2F2UA 4FKQA 4GK3A 5AX3A 1OVEA 3FWQA 3SHEA 5AWMA 3UE4A 1OUKA 2IZTA 3TNPC 2RFNA 4FRFA 4HGLA 4DFZE 2YAKA 2CCHA 2A1AB 3Q5IA 4UN0C 2P3GX 1M17A 5FEEA 1QL6A 4FEQA 2VTTA 1CKJA 2XNOA 4LQMA 4Y83A 4QP3A 3CQWA 5HQ0A 3Q9YA 5C03A 4O1OA 5EDRA 5CAUA 3FI3A 4HCTA 2WQMA 2ITPA 3CC6A 4I41A 2G9XA 3JS2A 4TRLA 4IMYA 4GG7A 4R5SA 4AZWA 3PJ2A 4O7RA 3DB6A 2AC5A 1SYKA 3C0HA 4M0YA 1H0VA 4R3RA 4YP8A 3BBTB 1FVTA 4AACA 1GIIA 4LMNA 5JGBA 4I5MA 2C6DA 2VV9A 3MB6A 4NM5A 4CZUA 5CAVA 5K5NA 3G5DA 3R9DA 3JR1A 4WG3A 1QPDA 2RGPA 4B4LA 3R1QA 4UMQA 3HECA 3UVRA 3A99A 3FLQA 2REIA 3CIKA 3L8VA 3L8SA 3LOKA 4QOXA 4FTKA 1YKRA 5EYCA 3VS1A 2X8DA 4DN5A 3LMHA 4BJJA 4EQUA 5L3AA 4RZWA 5L2WA 4U97A 1KUTA 1YXXA 4Q2AA 2R3OA 2PE1A 4UMPA 3V01A 3L9LA 3BHHA 4USDA 3Q52A 4L52A 3UOHA 4F0GA 3DV3A 4FV3A 5CT0A 3FLZA 2W4KA 3RPOA 2JITA 4G3GA 4J1RA 3S1HA 5IA3A 4C4GA 2E9VA 5E8VA 3SRVA 4JDIA 2C6EA 3ORIA 4D9UA 3VHEA 4X3JA 2ITUA 1OPKA 4W4XA 3UMXA 4EOKA 1OL6A 1PXKA 2W9FB 3NW5A 3EN9A 4EWQA 3Q6UA 1IA8A 3A8XA 2V7OA 1J1CA 3KXXA 4E6CA 2WZJA 3PRFA 3QCXA 3QKKA 4AZVA 5F95A 4RIXB 3GUBA 4YNOA 2BKKA 3E88A 4YSMA 3KF7A 1XMMA 2Z2WA 3DU8A 2PVJA 2O5KA 5TO8A 2H8HA 3DXPA 4AZFA 3II5A 3I4BA 2ZJWA 5HICA 1M7QA 1OM1A 3D14A 1TFFA 4BDIA 1Q8TA 3ZZEA 3VUGA 4CQGA 3DJ6A 4YZ9A 1M52A 2P55A 4FYOA 4JR7A 4L3PA 5GJGA 5I3RA 4RVKA 1BI7A 3C50A 3P7CA 4FNWA 2WFYA 3RI1A 4LRMA 2C6MA 4HVIA 5HIEA 3VF8A 3RZBA 1H24A 3CXWA 5D9HA 5JQ8A 1UKIA 2OK1A 4M8TA 2JBPA 1YWVA 3BYSA 4J53A 4NSTA 4HGTA 3DZOA 4M69A 4DBNA 3WIGA 4F9YA 1Q62A 3BYMA 3VJNA 4OAVB 3BEGA 1PY5A 4A07A 3L8XA 5BQ0A 2XA4A 3H0ZA 4FIFA 2YEXA 4FZDB 5F1ZA 4ASZA 2IPXA 3NIEA 4ZTLA 2CPKE 2XEYA 4MK0A 3QF9A 4NCTC 5BYZA 5JGAA 4MH7A 4ACMA 2GTNA 4MD7E 4TTHB 4E73A 3NUUA 5KZ0A 2YM6A 4F9AA 4DT9A 3PWDA 4IANA 3C4FA 2J5EA 4FG8A 3DKFA 1WBSA 4M12A 3F3UA 4D2SA 1XH9A 4ZTMA 2F7EE 4M7IA 2BMCA 1DAWA 3BZ3A 4DTAA 4E7WA 5EQYA 2G2FA 3KRWA 4FIGA 4ZXTA 5C26A 5I9XA 3CJGA 3OHTA 4WA9A 4WNPA 5J79A 4PWNA 3AG9A 3PPKA 4AGDA 2ITZA 1YHWA 4CT2A 2FO0A 4Q5EA 4RJ5A 4A9SA 4OBPA 1VZOA 4QMXA 1NVSA 3GI3A 3E3PA 5DT4A 3M2WA 3ID6C 3TV4A 3MPAA 4AA5A 5JFWA 3I6UA 2X0QA 5FGKA 4DH1A 1F5QA 3CGFA 5EKOA 5M57A 3TACA 3MFUA 4EH5A 1TZDA 4LM5A 4IWDA 4JQEA 1LEWA 3SOAA 5I9WA 1W98A 2YIRA 4FSTA 4JNWA 3PDTA 3ZH8A 3R1SA 4BCJA 2FUMA 4DFYA 2F49A 3N51A 4PP7A 4EUUA 5BUJA 5HVJA 5HZNA 3VHKA 2BFXA 3DT1A 4DBXA 4ZOGA 3E5AA 4B8MA 3VS3A 4L8MA 2YZLA 4TYJA 4E5WA 3GVUA 1VLRA 2NO3A 3IGOA 5EOBA 4I4FA 4ZSJA 4EI4A 3RM7A 2QOLA 3FC2A 3NUSA 1BLXA 1TVOA 2XIRA 4A4XA 2O63A 1OL7A 2YA9A 4BDCA 2NNWB 4NW6A 3ZM4A 5M55A 2VO7A 2ITWA 4O0XA 3QZHA 4YJSA 3HAMA 3NMUF 4EOQA 5AV3A 1FGKA 2QOCA 5ANJA 4O7YA 4I6HA 2YDJA 5HO7A 1CSNA 3E8CA 4KSPA 3UIBA 3RHXA 4AU8A 2VTPA 3FZSA 3U4WA 4YJVA 3OC1A 4K77A 1CTPE 5GNKA 2BUJA 3DB8A 4NFMA 4F1TA 3O50A 2VTQA 2G2IA 1Q8ZA 5EW3A 3ZRMA 4AN9A 4Z16A 5L2IA 3TT0A 2IVTA 2J2IB 4FOCA 3I81A 4EK6A 3RINA 4EOJA 4F4PA 5M07A 2FSOX 3BLRA 4BIDA 1YVJA 3NW6A 2WQOA 4IVBA 3LLAA 4YHJA 5GIPE 3ITZA 3FMHA 3QC4A 3QD4A 5AEPA 2QOOA 2ITYA 3Q4UA 4G6NA 5A9UA 5IQFA 4R1VA 5DYJA 3O71A 1FMKA 5I9ZA 3G6GA 5KKRB 5H8GA 3QZIA 3GU8A 3FXZA 1UVRA 4FTTA 4C36A 2ZM4A 3R7VA 1XR1A 3VRYA 3ZLYA 4YO4A 5JFSA 2ETKA 3MJ1A 2R3PA 3NR9A 3MY0A 4FTQA 4YC8A 2W06A 4R5YA 3LIJA 1A9UA 4RWLA 4C4IA 3D5WA 3TZ9A 3GB2A 2WQBA 3EQCA 4M97A 5J1WA 3GT8A 1U5QA 2IVSA 5BVWA 3KRRA 1CKPA 1UWHA 1OUYA 2OI4X 5C1QB 5LXMA 3JUHA 5AUYA 2ZAZA 4IWOA 5DHJA 4V01A 4D1SA 5CEMA 3R7EA 4DGGA 4TY1A 1K2PA 4M3QA 3RZFA 3UGCA 3F69A 2XKFA 4P2KA 3UG2A 5EQEA 3PA5A 4EEVA 2GU8A 4MEDA 4U81A 4E8AA 3FZOA 5J9YA 4XG4A 4ZZOA 2HW6A 3IW8A 3MFTA 3ZSGA 1Q5KA 4YR8A 1TQPA 2R64A 2WAJA 3D5VA 3G9NA 3PTGA 3HMNA 3ZBXA 3MW1A