3Q4ZA

Structure of unphosphorylated pak1 kinase domain
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
296
structure length
282
Chain Sequence
EEILEKLRIIVSVGDPKFEKIGQGASGTVYTAMDQEVAIRQMNLKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALEFLHSNQVIHRNIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNGTPELQNPEKLSAIFRDFLNRCLEMDVEKRGSAKELIQHQFLKIAKPLSSLTPLIAAAKEATKNNHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into the autoactivation mechanism of p21-activated protein kinase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Serine/threonine-protein kinase PAK 1
total genus 90
structure length 282
sequence length 296
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2010-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3q4zA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3q4zA01
3DKCA 4WBBB 3UQFA 2OFVA 3QBNA 1REKA 4BHZA 3E88A 3R30A 2GQGA 2C5NA 2XMYA 2YITA 4HYIA 4ZK5A 3FXZA 3Q9WA 4IJPA 4U6RA 3F5XA 4L3LA 3RCDA 2FSTX 3DK3A 4APCA 4M0YA 3I81A 3WIGA 4AOTA 3QD3A 4C0TA 4FSUA 4ITHA 4RG0A 1PMUA 4BF2A 4EOIA 4RJ6A 3GQIA 4ZSLA 3B2WA 4XUFA 1ZY4A 4DITA 4WNMA 4P5ZA 2CNVA 2WOTA 4HGSA 2J0LA 3VBTA 3BCEA 1O6LA 4ZLYA 2XA4A 2UZLA 2I0YA 3KF4A 4A07A 3FSKA 4IWPA 3ANRA 1ZY5A 4LUEA 3UG1A 3VUGA 3GC8A 2X9FA 2EB3A 2YCSA 3ETAA 3Q9XA 2RIOA 2A2AA 2VO7A 3ORTA 1R0EA 3QZIA 4GEOA 4NL0A 3BELA 1S9JA 2BZHB 2PVYA 4IVAA 1BI7A 2IN6A 3QYWA 2O63A 4C3FA 3K5UA 4NM7A 4WSYA 3ZRLA 3M1SA 5JMSA 4U81A 4DFBA 3UC4A 5E8XA 4A9TA 1CSNA 3LE6A 5CAUA 4EJ7A 1KOAA 4RJ7A 5DWRA 1SVGA 4RFYA 3W1FA 2J0JA 2R3PA 1SZMA 3HZTA 1T46A 4RZWA 3SW4A 4F9YA 4W8DA 5C4KA 4W4VA 1U5QA 4FKOA 3BBTB 4HNFA 5HTBA 4WRSA 2PMIA 1A06A 3SG9A 3FMJA 2C69A 3UDBA 4L3JA 2X6EA 5C1QB 3NIZA 4CKJA 5HE2A 3ZUUA 3QRIA 3BBWA 3SC1A 4JDJA 4K9YA 4U42A 4X3FC 3L9LA 4OTIA 4YTCA 4NKSA 1ZYCA 5HX8A 3G9NA 3FKLA 4BTFA 3O7LD 2W5HA 3RZFA 4NH1A 4GIHA 3U87A 5IUGA 2HXLA 5JT2A 4O7LA 3BX5A 3SD0A 3UOLA 3JY9A 3MH1A 2EUFB 4ZSEA 4GKHA 4U0IA 2P0CA 3C51A 3WBLA 4MCVA 3RJCA 4WUNA 3LQ5A 1BYGA 3O23A 3PWDA 2WO6A 2E9NA 1JOWB 3MJ2A 5TOZA 1MUOA 1H26A 4E5AX 5JK3A 3LJ1A 5HOAA 2YIXA 3EN5A 5CNNA 3MH3A 3VUIA 4YU2A 5K4IA 1O6KA 4LMUA 4J53A 2R3NA 3R83A 4ALUA 2EXCX 1IR3A 4TPTA 5A4CA 3QWKA 3T9TA 2WB8A 1V0BA 2ONLA 4FV1A 3ZU7A 1JQHA 4ORKA 4Y95A 2X1NA 3SGCA 3L1SA 4I6HA 5DNRA 1OZ1A 2XK3A 3OXTA 4J99A 5C26A 1ZZ2A 3BLHA 3R7GA 5HTCA 5H9BA 2QKWB 4FIGA 5JH6A 4M8TA 3OTUA 1M2RA 4O7RA 4IM0A 2X7FA 4DINA 4CT2A 4XG2A 5AV4A 1H24A 4V0GA 2EXEA 4GV1A 4J96A 4C2VA 2PZ5A 3HV3A 3BHUA 4PTEA 3BWFA 3C4ZA 4XLVA 5CF8A 2QOIA 3LOKA 1XH9A 4NM3A 1XH6A 4DFNA 2PVJA 2ZAZA 4P4CA 4PWNA 4GL9A 4J7BA 4XV9A 4UN0C 5DN3A 5LXMA 1F5QA 1WCCA 3CQEA 3MY5A 4X2GA 3W8QA 4C7TA 3K54A 2XRWA 2F57A 2ZM1A 2IVUA 2C47A 3QTIA 2G1TA 4EH6A 4Y46A 4YNEA 3Q52A 3QTQA 5FM2A 5IA3A 3F66A 2R3MA 1V0PA 4FG8A 5IH6A 4JBPA 3D0EA 3KY2A 4FE2A 2IZSA 3F3UA 4C36A 2X2LA 3KMMA 3WZJA 4O0YA 3ZOSA 3QQJA 3KRRA 4HYUA 3KEXA 1JSUA 3T3VA 3LCSA 2YM3A 4D2RA 5KBRA 3SG8A 2IW6A 3R9HA 5IQCA 3QLGA 1UA2A 4Z7GA 4OTFA 4F9AA 5HE0A 2DS1A 4EQMA 4XG7A 4FSRA 2VD5A 4DBXA 3FLSA 3PRFA 1FVRA 1ZMUA 4H36A 1JLUE 4JDKA 4QPAA 5EW9A 4ALVA 4ENYA 1YRPA 4BGQA 1RQQA 1MRVA 4E20A 5DG5A 4IVDA 2WAJA 3UIBA 1LUFA 2R3KA 2Q0NA 5JFWA 2YIRA 4FC0A 4FBXA 1NXKA 4IWDA 4DF3A 2Y8OA 4YC3A 3UMXA 2PZRA 4O38A 1SVEA 4PX6A 1UKIA 1H00A 3FI3A 4ZZNA 3TIZA 2WIPA 4Z9LA 1W84A 4BCQA 4FEQA 3E92A 4C4GA 1LPUA 2VTSA 5AUUA 5L2SA 5KNJA 2CKQA 4O82A 3ZM9A 4D9TA 4UWYA 4FT3A 1W83A 4R3RA 5EK7A 4DFUA 2HYYA 4F64A 5KKRC 4MD8E 3KKVA 4QYFA 2ZMCA 5FBNC 3FYJX 4TWCA 4GFMA 5IA4A 4YUQA 2XYUA 4IE9A 4X6RA 1B39A 2NNWB 2UW4A 2RG6A 4B8LA 4NK9A 3G2FA 4FNZA 5DEWA 5CVFA 3W2QA 3RI1A 2GU8A 3FKNA 4F9CA 4KSPA 4M66A 2XM8A 5AP1A 3U54A 3VUDA 3PPZA 3V3VA 2F7ZE 1Q61A 5CEOA 3NW7A 4QMZA 4ZSAA 4EKKA 1A9UA 4XBUA 2CNUA 2F2CB 5FP5A 4FR4A 5J9ZA 3CKXA 1UNLA 4ZZMA 5K9IA 4BC6A 3QTUA 2IPXA 4FTOA 3PVUA 4XV1A 3HA6A 4BI1A 4HJOA 4YURA 2YIYA 3NUPA 4ACCA 2IO6A 5HD7A 2JFMA 2BIYA 4FV0A 5CF6A 4B8MA 4YNOA 3IDBA 4RBLA 4AGWA 2GFSA 1E9HA 2C68A 2IZUA 4FSZA 2WTDA 3G90X 3C4EA 1WBPA 3AC4A 3LIJA 4X7QA 2OI4X 4R7HA 4TL0A 2HW7A 1LR4A 2QONA 5T6KA 3DY7A 3OC1A 5ETIA 4NJ3A 4TY1A 2A27A 1PW2A 2ITVA 3TNIA 4ACDA 4UMRA 3N4UA 4QTDA 4WNPA 1NW1A 5H2UA 3FPQA 4TYHB 4DEEA 1IAJA 4FTQA 5JEBA 2VAGA 4BGGA 4DEBA 5FLFA 4GJ3A 1XH5A 4RLLA 4FT0A 4NWMA 5HEZA 4O6EA 2W1HA 4I23A 4L68A 4BHNA 5LOHA 3PXQA 1BUHA 4UZHA 3S3IA 3S95A 4FV9A 3F5GA 1XWSA 2E2BA 5CALA 5AP6A 5EQYA 2WTKC 5L2WA 2OXDA 4WD5A 4IM2A 4V0GB 2UZUE 4M15A 5JZNA 4CMOA 4BWXA 2VWBA 3OOMA 4O7VA 2QKRA 4FKUA 4EOJA 5HG9A 5L3AA 2CKPA 2P3GX 4C35A 3IKAA 2IVSA 3JY0A 2PUPA 4C8BA 3AC2A 1M2QA 5C27A 3DS6A 4RA5A 4ASEA 5KKRB 2J9MA 1ZOEA 1ERKA 4UZDA 4Y72A 4EH8A 1PYEA 5EYKA 3TEIA 1R39A 2J0IA 5CT7A 4I92A 3OUNB 1ATPE 3DDPA 1CKJA 4KINA 4PDPA 5AR4A 3CTQA 3R8PA 4UV0A 2WELA 3GOPA 4FYOA 5ETAA 4IQ6A 1KOBA 4G9CA 3DDQA 5CQWA 2PE0A 5FM3A 2XIXA 1MRYA 3OWPA 2X0GA 1M17A 1XHAA 3LFQA 1OUYA 2XUUA 3W2PA 4WNKA 3N51A 5KMLA 3QHWA 4D4VA 4IJ9A 4MD7E 3S1HA 2PMLX 2QR8A 4JBVA 4NYEA 4IIRA 3QC9A 4R5YA 2Y9QA 4UWBA 1H28A 2BPMA 5GIPE 3H4JA 4CKIA 1GZNA 3I0QA 3GVUA 5I9XA 4YJTA 2BZJA 4AXAA 3TDWA 4I0TA 1YDTE 1BMKA 3HECA 3ALOA 3D5WA 4RIWA 3U4UA 4BI0A 3V04A 2QG5A 2FA2A 5E8WA 3COIA 1PXPA 4EWHA 4IAKA 4JI9A 3WZDA 3MIAA 4F1MA 3ZFXA 3HMOA 3VUMA 3E5AA 1OIRA 1UU8A 3CP9A 4Y5HA 4ZTNA 2C5VA 4XMOA 1URWA 5BMSA 4FL3A 3BWJA 3F82A 3AXWA 4PDOA 3A4OX 2PTKA 3VBVA 3D15A 4L44A 4WIHA 1H8FA 3C0GA 4DYMA 4EOSA 3R7VA 3HUCA 4RC2A 4USEA 3ROYA 3CXWA 1PHKA 3FUPA 4DG0E 5HG5A 5IA0A 5EOLA 4MXOA 2FVDA 2XZSA 1OPKA 2ZV7A 4QPMA 3Q4CA 1W82A 3NUUA 3VS6A 4AE9A 3AGMA 2XK4A 4TYGA 4XHKB 5I3OA 5J79A 2I7QA 3CPBA 5FEQA 2WTVA 2VWZA 2YACA 4DFLA 3FMLA 3VO3A 3WZEA 3GC9A 4BICA 3Q5IA 4TNDA 4ANNA 3W32A 3KL8A 3JYAA 2OH0E 3BE2A 4YJOA 2Y6OA 4ZTRA 3SKCA 4EWQA 3BI6A 3GCUA 5H8GA 4AFEA 4QP4A 2R3GA 2UZEA 3KN5A 4GT4A 5CENA 4L53A 3GENA 2PMNX 2B52A 4QMXA 4E7WA 4F4PA 3RWQA 3LMIA 3NS9A 4M67A 4TRLA 4XH6A 2YM7A 4EJNA 3EL7A 1SNUA 2WTJA 4JL9A 4LYNA 1TQPA 2CDZA 3AMBA 5HG8A 4KWPA 3MESA 3DV3A 4D28A 3KXMA 5KZ0A 3RCJA 1YXVA 5J5SA 2YZAA 1IA8A 5M4FA 5CZHA 1PXNA 4E3CA 3OW3A 2C3IB 2P2IA 3LM5A 5J95A 3WYXA 3ZS5A 5IF1A 3VJOA 3CC6A 3QHRA 1WBVA 3EQGA 3FQHA 1Z5MA 3ENMA 2C5XA 5EI6A 3UO6A 4MWHA 3FLNC 2REIA 3NCZA 3QUEA 4CTBA 3B8RA 3VS0A 4J8NA 2B0QA 4M84A 4A7CA 4MXAA 2PL0A 2QOFA 2PVFA 1OITA 3GFEA 2XIZA 5AUXA 3U51A 2FSLX 1MQBA 2J5FA 1Q97A 1WVXA 4D0WA 4A4XA 5CAPA 1Q8UA 2HELA 5CLPA 3PRIA 4AW2A 4ASXA 3FYKX 3TV6A 5GINE 3POOA 4C58A 2R3OA 4MX9A 4N0SA 2VTHA 3C0IA 3F3TA 3I79A 3V5PA 5IMEA 5LCJA 3Q60A 2C6MA 5HO8A 3ODYX 4GMYA 1YVJA 5CY3A 2I0EA 2PVNA 4IZYA 4KB8A 4O81A 3NX8A 1KE6A 5C8KA 3UZRA 3PFQA 3GU6A 3RZBA 5ANEA 1CDKA 4RFZA 3RPOA 3HLLA 4QMNA 4RIXA 4EH2A 4GH2A 3F2NA 3EZRA 1WBTA 4YJPA 4E1ZA 2W06A 3ZXTA 5BX0A 2W5AA 5DHJA 1M7QA 3ORKA 5B7VA 4IANA 2PYWA 3AG9A 5DBXA 4IMYA 4H39A 3PJCA 3TIYA 3T9IA 1XO2B 3DKGA 3A99A 4FT9A 1G5SA 5AEPA 4QYEA 2VWYA 4PP7A 2JEDA 2PZYA 3VC4A 2UZVA 3UPZA 3OF0A 3MW1A 5ANGA 3R1NA 1L8TA 3W55A 4O0VA 3UVRA 4O6LA 4I6FA 2XF0A 3FI4A 4L3PA 4EYJA 3QRJA 4DGNA 2PZIA 4QMMA 5LMAA 3ACJA 4KIQA 3AC8A 2LAVA 2XK8A 1GAGA 2EU9A 3EFLA 4E5BA 4RX5A 3DB8A 3MYGA 3PJ1A 4BTKA 3PA5A 4QD6A 4W8EA 4EONA 4JR3A 3UOHA 3OFMA 4MK0A 4LUDA 3P7BA 1VEBA 3IONA 1ZWSA 2VTOA 2O8YA 3R7YA 5AM7A 3V5JA 4FVRA 3F88A 2CMWA 4E6DA 5CU0A 2XP2A 2V55A 2RL5A 5D1JA 5AM6A 1PY5A 1VJYA 2VWIA 1LEZA 5HBHA 1QMZA 4FT7A 1YHWA 5EM7A 4F99A 3E8EA 4PP9A 4QP8A 1KE8A 1MQ4A 3JS2A 4FEWA 5F20A 2YAAA 1NVQA 1J1CA 2BDJA 3CEKA 3JR1A 2R2PA 3EN9A 3ZLYA 4M14A 3QXPA 4Q9SA 4ASDA 1STCE 1P2AA 4RWIA 3UVQA 1GNGA 2QOKA 3FZSA 4OTGA 3SOCA 4QYHA 5C03A 3ZZEA 1CM8A 2A0CX 1PKGA 5GIOE 5FQDC 3OS3A 4BKZA 5M4UA 3ZLXA 2VZ6A 4BCGA 4BCFA 3QKKA 4JS8A 4DHFA 5JFSA 5K4JA 4FTNA 3UZTA 2YERA 3DLZA 2GS2A 2Z7QA 2W1CA 3VQHA 1G8SA 1YI4A 3BHHA 3Q9YA 1Y91A 3MIYA 3R22A 4FMQA 4LGDA 4RMZA 2IVVA 4O0RA 3MWUA 5AUZA 5KMIA 2YWPA 4P90A 3HYHA 4O86A 1RE8A 4OUCA 4FIFA 1Q99A 4DE4A 5KO1A 3KCFA 4YGAA 2XVDA 1VR2A 3JPVA 5E8SA 4IZ7A 3HRCA 3PDTA 2WU7A 5E9EA 5D7VA 4D5HA 5FEDA 2C1BA 4ID7A 4DLIA 4OGRA 4ALWA 3FLWA 1VZOA 5E8ZA 2Y4IC 4O7NA 4YTHA 3NSZA 4QMVA 3KVWA 1U46A 3I5NA 4FKIA 2R3JA 3EN4A 3PVWA 3MGYA 5AIKA 3BRBA 5DVRA 3SW7A 2O0UA 4Y83A 5HKMA 3TZ8A 2BAQA 3NNWA 4MXZA 4XLIA 4G9RA 5CF4A 4M68A 4RIOA 2IVTA 4IWQA 3QUPA 5IQBA 2GHGA 3NUAA 5JQ5A 2OO8X 3ORPA 1JNKA 4RQKA 5CU3A 1PMNA 3REPA 4YSJA 4P7EA 4AW5A 2VO0A 2R3FA 4D4SA 2C6IA 5AMNA 3AOXA 4YLLA 3TG1A 2VU3A 1R3CA 1H07A 2RFNA 2WMAA 5ACBC 4C4HA 3KF7A 1LP4A 3WE8A 5AA9A 4ZZOA 4MXYA 3D5UA 2UZOA 4QQJA 4IX5A 3EN7A 2CLQA 4JXFA 4MD9E 2UW0A 4QQCA 4QYGA 5H8EA 3SHEA 4CCBA 4EZ7A 2NRYA 1UV5A 5EOBA 4FSMA 1YHSA 3N4VA 3GCQA 4MF1A 5GZAA 4RVMA 2XK9A 2C4GA 1JVPP 5D10A 4AS0A 2X8DA 4DA5A 5B2KA 4FNWA 1HCKA 2UW9A 3W33A 2IW8A 1OKYA 5HHWA 5HO6A 2PUIA 4FZ7A 3VW8A 4RSSA 2V22A 3COMA 4TWOA 4ERWA 5KMOA 2B9IA 4H05A 3AMAA 5J7HA 4M7IA 4DLJA 2NO3A 1YXSA 5I0BA 2YCQA 3TI1A 1T45A 4L01A 3B2TA 2R64A 1OPLA 3SRVB 3VIDA 1UU3A 3EQPA 5DT4A 5ACKA 4E8AA 1BLXA 2IWIA 3W2OA 4X21A 5EM6A 4U3YA 4W9XA 2I1MA 3SXRA 3VUHA 3QLFA 1DM2A 3E8CA 2GFCA 4O2PA 2HIWA 5A4TA 4XG6A 3GCPA 2PVHA 1KV2A 3R6XA 4PNIA 5J87A 3NPCA 4AZWA 4ZOGA 3UZPA 5M56A 3GEQA 1OL2A 4XP2A 3A8WA 4FSTA 4NIFA 3UC3A 3G0EA 3E63A 3HEGA 4B9DA 5GJGA 3KQ7A 3KULB 3BIZA 2QLQA 5AUVA 2CCHA 4LOOA 3LPBA 1B6CB 3C4XA 4UMQA 4A06A 3CS9A 2EB2A 1M7NA 2PU8A 3QZFA 3V01A 2ONLC 3WILA 3P0MA 2QHNA 5CASA 4EOOA 1PYXA 4ZY5A 5L6OA 3P5KA 4AT4A 3LVPA 5CTPA 4MXCA 1PXIA 5AIRA 1H27A 3NW5A 4L42A 5K0KA 4DGGA 4ZS4A 4LMNA 4DGMA 5JGDA 4DH5A 4G6LA 3DBFA 5TE0A 3AD4A 4LFIA 4LGGA 5F4NA 2ITZA 4JQ7A 3RAWA 4ZLZA 2G2FA 4XG3A 1SYKA 3BQCA 5HCZA 4BCIA 5LMKC 4BDCA 3L8VA 4AG8A 4I24A 4E4MA 2P33A 1CKPA 3FLYA 3TUCA 3Q5ZA 1Z9XA 1S9IA 4QMUA 4GT5A 4FZAB 3TWJA 2WQBA 4K77A 3Q4ZA 1A48A 5K5XA 3DBCA 5CWZA 3RM7A 2EWAA 4U43A 2WEVA 3I6UA 4I0SA 5FGKA 5LVPA 2VTLA 4GW8A 3HMIA 1XKKA 2C3LA 3ULZA 1OIQA 4OAVB 3LJ2A 4G2FA 2RFSA 3LXLA 4YBJA 1KWPA 4PNKA 3TN8A 1V0OA 3POZA 1KV1A 2B9HA 5IMXA 3ZRKA 4AOIA 4QT1A 3PA3A 3O0GA 3OTVA 4O0TA 4WRGA 2FB8A 4X2FA 3ZC6A 4U9AA 4R5SA 4BN1A 4F6SA 3AT3A 3IW6A 5FP6A 2HENA 3R1YA 2C3KA 2HXQA 2OSCA 1IRKA 3UYSA 4IAYA 5FTQA 4KKEA 2BILB 3OZ6A 2GNFA 3Q6WA 4IB3A 3TKUA 3TKIA 4Z7HA 2B4SB 4EK5A 3TTIA 2GHLA 4KS7A 5IG1A 4YC8A 4N6YA 1R78A 2LGCA 4G5JA 2QO7A 4MKCA 2GMXA 3BU3A 2PVKA 3EKKA 3GUBA 3U9CA 1WVYA 2XNGA 5ANJA 3ZBXA 3JVRA 4BDKA 3O2MA 3CE3A 5A54A 4BYIA 4GRBA 2QOCA 2E9UA 3VBYA 5A4EA 3F3WA 3FMHA 3KFAA 5JGBA 4ZTSA 4USDA 1YKRA 4RRVA 3CTJA 5HNGA 4F09A 4QTEA 3PXYA 3O7LB 2UZTA 3GC7A 4HVGA 1DS5A 2V62A 3VWAA 5DA3A 4IDTA 1LEWA 1GZKA 4ANOA 2ITOA 3R2YA 4FVQA 4S30A 4FSYA 4EK8A 4C4EA 3GU7A 3VF9A 4QP7A 4KAOA 1YOJA 4IHPA 2GNGA 4B4LA 4KUJA 2OGVA 3ZO3A 4BRXA 4E6CA 4LL5A 1XQZA 4AA0A 3LFFA 2WNTA 3CPCA 1O6YA 5AA8A 3EQCA 4BWPA 3N9XA 3U6JA 2Q0BA 3OROA 5I4NA 2UUEA 3I7CA 4P2KA 4XP0A 3F69A 3P7AA 3UNZA 3PTGA 3QALE 4M12A 2VX3A 3A4PA 3VUTA 4BDBA 1OKZA 1J7UA 4R78A 3ZC5A 3KGAA 5JRSA 2FGIA 3ATTA 2WGJA 4XV3A 2F9GA 1PMVA 3PLAE 4RLKA 1HOWA 3FZRA 2VTRA 3G33A 3LFEA 3DTWA 2CN8A 4GG7A 4E26A 5IEYA 3QA0A 5M4IA 5IA5A 4NSTA 4EBWA 5DIAA 4HPUE 5IUIA 3ZEPA 2ERZE 4FIHA 5BMMA 4IZAA 3QD2B 4FZ6A 4DFZE 5ITAA 5CXHA 5G6VA 4L00A 4C59A 1RW8A 3LKMA 3HV7A 4Y8DA 1BKXA 3UIMA 4JLCA 3ORZA 4P5QA 5IPJA 2PVLA 4GS6A 3ZMMA 2H96A 4CLIA 2W1ZA 1Q8TA 4UXLA 5ETCA 3VS4A 3R71A 4BKJA 5CU6A 1W0XC 4JVGA 3TZMA 3WF9A 3ZFMA 2YAKA 3BLRA 3F3ZA 2F2UA 2VGPA 1DAYA 1PXOA 4OTDA 5GZ9A 3RK5A 5ICPA 5IZFA 2BHHA 4K1BA 4AN3A 1OL5A 4F6WA 4ZIMA 4UBAA 3FV8A 3P86A 4QYYA 4MNEA 4RFMA 4JR7A 4RZVA 4FKTA 4H58A 3CIKA 3R9DA 3VS1A 4EQCA 4O7WA 3QGWA 3MA6A 5DE2A 3GXLA 2GTMA 1PKDA 2GPHA 4KSQA 4CSVA 3QD4A 3QGYA 5HICA 5DMZA 5IQHA 4OT6A 4F7NA 4CLJA 4UWCA 5AUWA 5G1XA 1TQIA 3P7CA 3SOAA 2PZPA 1UKHA 3MJ1A 1GJOA 2BVAA 5KX8A 3Q3BA 2WQNA 1ND4A 2JDOA 4FIIA 3QUDA 5CEKA 4YJSA 1CKIA 4GT3A 4TWPA 2ZV8A 4G6OA 4EOQA 3IW8A 5IH4A 2C6DA 2UV2A 3DNEA 4TYJA 5T68A 1RJBA 3OWKA 4BCHA 2IJMA 2JDVA 3KK8A 3OBGA 4J1RA 4LL0A 2I0HA 2XYNA 4YPSA 2BRHA 2WMXA 4IADA 2CPKE 5EI2A 4FTLA 3WF5A 4A4LA 2NP8A 4CEGA 2XCKA 4UMUA 3F2AA 2FSOX 3O17A 3U4WA 4CKRA 3D7ZA 3LJ0A 4D9UA 1K3AA 1TQMA 3CCNA 4KA3A 5HVKA 3FMMA 3KCKA 2B9JA 4FVPA 3DGKA 4TYEA 1ZZLA 3NYNA 5LWNA 5DT0A 5IQFA 1H1PA 3KXHA 1V1KA 4EH3A 4U41A 4JIAA 3W2RA 3RPSA 2I6LA 2YJSA 3QC4A 4J95A 1PXLA 3CTHA 3GGFA 3MVMA 1YWVA 5LARA 3VHKA 5KMJA 2UZDA 2OWBA 4D2PA 1J1BA 2XB7A 5LMBA 4R3CA 3VNTA 4BCKA 5M06A 3SXSA 4IAIA 4C4IA 3V51A 3BQRA 4ZTMA 3ZLWA 4ZSJA 1H1SA 5FBOA 4R77A 1I09A 1MRUA 3FWQA 4IVBA 4JRNA 4KIOA 2RGPA 3H9OA 5EM5A 5AV0A 3ZM4A 2P2HA 5EDQA 2WFYA 5IDNA 4GG5A 3OMVA 4LOPA 5BQ0A 3R04A 3IG7A 3O8UA 3E8DA 3TACA 3TNPC 4DTBA 4K0YA 4CD0A 2JC6A 3WE4A 4FYNA 1BX6A 3EL8A 3E3PA 5AP4A 4D4YA 4HGEA 3IGOA 1Q3DA 4I0RA 5EW3A 1Z57A 2PK9A 4H3QA 4Q9ZA 4YTIA 4AE6A 3BYSA 5BYLA 5EKOA 5M08A 2Z7RA 4CFMA 4F1TA 4EH9A 3ZFYA 3MFSA 3W2CA 4CFVA 2GTNA 5DEYA 2C6TA 1ZAOA 3P1AA 5C8MA 3QWJA 4Y73A 1XBCA 2O3PA 4CMUA 4K6ZA 4BCJA 2WQOA 1H1RA 4FG7A 4UB7A 3VS5A 5FTGA 3OG7A 4FG9A 1PXJA 2C6OA 5JKGA 3FDNA 5EQEA 3IOPA 5EYDA 3FLZA 3IGGA 3JXWA 3R7OA 3ZXZA 4F7JA 5AFVA 4BL1A 3HX4A 4QNYA 3UPXA 3OOGA 3VJNA 1JKTA 1DI9A 5D9HA 1YI6A 4YZBA 4DH8A 5HU3A 4O96A 4WO5A 3RKBA 2R0IA 3PZEA 2UVZA 3HMPA 4IC8A 5HE1A 4D4RA 4KD1A 3SA0A 2H6DA 2CCIA 4RGJA 5C9CA 4AX8A 5C8NA 3KB7A 3ODZX 5AP0A 4AACA 5HQ0A 4AN2A 5DFPA 5M51A 2XNMA 3MY0A 5HLNA 3FI2A 3NEWA 2YM4A 4BCMA 4IDVA 4I6QA 4YJQA 5KE0A 3DAKA 3CGOA 1SNXA 3GFWA 3LHJA 4FKVA 2WXVA 4OTWA 5BYZA 4UYAA 3V5LA 1G8AA 5IQDA 5E91A 1OGUA 3L8XA 1YXUA 2G01A 3I1AA 4XRJA 3R7EA 5HD4A 3A2CA 3IK3A 4HYSA 2OZAB 1Q4LA 2R7IA 1YXTA 4R8QA 4B6LA 5JFXA 3HVCA 4WG3A 4YLJA 4MH7A 4OBOA 4ZXTA 4BZNA 4MBLA 4IAZA 4PRJA 2YA9A 1FPUA 3DOGA 4CQGA 5DRBA 1OB3A 4PUZA 2GCDA 2W1FA 3OCBA 3QQUA 4BCPA 5KCVA 3HV4A 5LVMA 3PYYA 1PXKA 5CI7A 4BDFA 1FOTA 1OVEA 3LLTA 3MPAA 3EQFA 1VYWA 3UP7A 1WBOA 5EM8A 3QTXA 2WMSA 3ZH8A 3LMGA 4UYNA 5K5NA 4BR3A 3A60A 4XP3A 4QMOA 3PJ8A 4NTSA 5ETFA 2CLXA 2YLFA 4QMTA 2JBOA 2PPQA 2HK5A 4KBKA 3PJ2A 3VBWA 3O71A 4XG8A 4IXPA 4HGTA 4PTGA 5DGZA 3GP0A 3VUKA 3MH0A 4XCUA 4YLKA 4D1XA 5HIEA 3S2PA 2YEXA 3S0OA 2KTYA 5D11A 2WMBA 4H3BA 3NYOA 4GUBA 4NCTA 4MF0A 5BVNA 2PMOX 2UW3A 1OIYA 3MDYA 5CEPA 3FAAA 3PG1A 1JBPE 4CT1A 1UU7A 1G3NA 3QCSA 1R0PA 4D0XA 3EYGA 4DC2A 3KREA 3OUKA 3Q4UA 1NY3A 3DNDA 4S31A 3WOWA 4E4LA 4BCOA 2WU6A 3HL7A 5CSHA 4JAIA 2WMTA 3U6HA 4KIPA 4HCTA 1H1QA 2CGWA 1OL6A 3MA3A 2X8IA 3NDMA 2BRMA 3OCSA 4UMTA 3UGCA 4A9SA 4FKGA 4RC3A 3NYVA 4DTKA 3ZONA 4G34A 4D2VA 1B38A 3PLSA 4F65A 3DLSA 3OVVA 4Y5QA 4C3PA 5CEMA 2C6KA 4Z3VA 4EOPA 2OICA 3ATSA 5DH3A 1KUTA 1JSTA 3ELJA 3EKNA 2JFLA 2WPAA 2XBAA 1REJA 2B54A 4YO6A 2W05A 5HCXA 4ZJVA 5EDRA 4YR8A 5L2TA 4BKYA 3GBZA 3FZOA 5F9EA 3FHIA 1GIHA 4NT4A 4YZCA 1JKSA 2V5QA 3U55A 4AWIA 3LQ8A 4KKGA 4ZTQA 3DKFA 4JDHA 2G2HA 4KRCA 2ZV2A 2W1IA 3K3IA 3W2SA 4FKLA 3HDNA 1YHVA 3PA4A 4MHAA 5E8UA 5A6NA 2Z02A 4HPTE 5I9VA 3OY3A 1SM2A 2QO2A 5KMMA 3R8VA 4EK4A 2UZNA 4O1PA 3DZOA 3I4BA 1XH4A 4TWNA 2WIHA 5EYCA 3RM6A 4E4XA 1H25A 2PSQA 3LFCA 3PUPA 2JKOA 2OBJA 3EQHA 3LFNA 3QTSA 4BBMA 5BPYA 3HDMA 2ZM4A 3ULIA 3V5TA 3ORNA 4GJ2A 5H8BA 2HWPA 2QD9A 3BGQA 4MVFA 2ZB1A 4AZTA 4CV8A 2YN8A 1Y57A 3OWJA 2QG7A 3PSBA 3G6GA 5CS6A 3NR9A 2ZVAA 3D7TA 5JRQA 2JDRA 3EYHA 4FOCA 5HLPA 3EQBA 4JQEA 4U44A 3E8NA 4JX7A 4TN6A 3D14A 4D1ZA 2X4ZA 2OJFE 3SAYA 3FZPA 4X2NA 2EVAA 1EH4A 4FI1A 2QI8A 2ZOQA 3PIYA 3TZ9A 2HWOA 2ZB0A 4PPBA 3TZ7A 3F2RA 2ESMA 4O7TA 1DAWA 1Y6BA 2WTCA 3G15A 2X7GA 3TCPA 4EOKA 3FSFA 4HW7A 4X3FB 3BHVA 4JX3A 5EW8A 2VUWA 4CQEA 3OY1A 4BBEA 2PE1A 1FQ1B 4FSWA 3JUHA 4IW0A 4AZSA 4IFGA 3LCOA 4D55A 5AP5A 3G6HA 3NUXA 4S2ZA 3VAPA 2UW8A 2OXYA 4FTUA 2BRNA 3ZEWA 4F63A 2IZRA 3DK7A 3DCVA 4L67A 1ZOGA 2PY3A 4GCJA 3EFWA 4X2KA 4D2TA 2ZDTA 3UIXA 1ZYLA 3GI3A 2JDSA 3KA0A 3DTCA 4GIIA 3NYXA 3FMNA 4BI2A 5M09A 4O83A 3DB6A 4IC7A 4FV5A 3UBDA 3HAMA 4U80A 3BV3A 4BDHA 4L7SA 2VO3A 3ITZA 4QQTA 3MI9A 3W18A 4AU8A 4YMJA 2OJ9A 3V8WA 5HX6A 4V04A 1K9AA 2ITNA 1WVWA 3TDVA 4FOBA 4Z16A 4FV4A 3Q04A 1E1XA 5TKDA 4BB4A 4USFA 2OW3A 1YWRA 2O5KA 4TNBA 5CI6A 5EHOA 2YM8A 4BZDA 5J9LA 3BV2A 3CBLA 4ITJA 1ZARA 4EHGA 3KMWA 5JZJA 2YDJA 3F5UA 4MQ1A 3S4QA 2WQMA 1O9UA 4O0SA 4XJ0A 2A19B 4J98A 4O21A 4EKLA 3FEGA 2R4BA 4ACGA 4I21A 4C61A 4RWLA 3K2LA 5ANIA 4PV0A 1KE9A 2OG8A 5CVGA 4C34A 2IG7A 2BMCA 3FE3A 4FV3A 1MP8A 4QO9A 3TXOA 4FL1A 3DJ6A 3V5QA 3DKOA 2R3RA 3U6IA 1FBNA 4QRCA 4PTCA 2C0TA 4BYJA 4AZVA 5FXRA 4QP9A 5L2QA 4ZY6A 2CHLA 1NVSA 3RPYA 3OD6X 1ZMWA 4YHJA 4AOJA 1U54B 5JQ8A 1FGIA 3OT8A 3L9NA 1J7LA 3MSSA 4YPDA 1KSWA 5GJFA 3O8PA 5H3QA 3T8OA 3ZSGA 3ZSIA 2VWVA 3HKOA 4YZNA 5AR5A 4G17A 4E93A 2QVSE 4WBOA 2WMQA 4FTKA 4FV6A 1PXMA 1YXXA 4HOKA 4FGRA 2JKKA 4FEXA 1P5EA 5AR8A 3LQ3A 5EH0A 3OW4A 5HVYA 3DXPA 4O0WA 1QPJA 3LXKA 4XNEA 2VWXA 5AR7A 5A46A 3NCGA 3OHTA 2OLCA 3QQGA 2AUHA 3ORMA 3IO7A 5IU2A 4N70A 5ANOA 1I44A 2F49A 4G5PA 3EQRA 4FTRA 2BALA 4KABA 3VHEA 2JDTA 1OKWA 3C0HA 2GQSA 3IS5A 3AD5A 3T3UA 4ONAA 2UVYA 3CJGA 4IM3A 4AAAA 4AW1A 5B2MA 5E1SA 3UJGA 4PY1A 2IZTA 3NZ0A 2GNIA 4TZRA 5HO7A 4YHTA 2JKMA 3FL5A 3ZBFA 2JIUA 3OXZA 3E7VA 1JAMA 2UZWE 2VTIA 4U97A 3QFVA 1P4OA 3RPVA 2W5BA 4AGCA 4EQUA 2HCKA 4L6QA 5TT7A 3V8TA 1VYZA 1Q24A 5FWKK 5CXZA 4FK6A 2WTIA 2YM6A 2OJJA 3HGKA 3PXRA 3MFTA 4G3CA 4JQ8A 1H08A 2E9OA 2VV9A 4O2ZA 4V01A 4X2JA 3UYTA 3ZUVA 2CJMA 4PL4A 4CGAA 4HCUA 5CQUA 4OTRA 4I93A 4U8ZA 3RHXA 3I60A 5E8VA 4LV5A 3ZUTA 5M4CA 3NMUF 4G3EA 5FEEA 2XIYA 1JPAA 5EHLA 3QL8A 4CMTA 3E64A 4PDYA 2XKFA 2BKZA 1HCLA 1WMKA 2OH4A 2ZJWA 2OZAA 4U45A 4WG5A 5LVNA 3LXPA 4Q2AA 4M0ZA 5EI8A 4CZYB 4DBNA 1YDRE 2QQ7A 4IB5A 4DEDA 4JRVA 1W7HA 4ANQA 4EC9A 2R7BA 3ET7A 2WHBA 3BKBA 1JKKA 3FL4A 3LXNA 4YSMA 5I9UA 4Y85A 4DFXE 5DYJA 4DT9A 2WKMA 4RPVA 4ASZA 2OF4A 3FLQA 2Y4IB 1AQ1A 5BNJA 3LFBA 4MNFA 3LZBA 4RJ4A 3SV0A 1QPEA 2R3IA 4MXXA 2C6EA 3R7UA 3THBA 2G2IA 4DEGA 2OIBA 3EQIA 3FPMA 3TNQB 2X39A 3BGPA 4R6VA 4DN5A 4PDSA 2GHMA 3K3JA 3LLAA 4CNHA 4FNYA 4ZJIA 1FINA 4GK4A 5IKWA 4HGLA 5HI2A 5BVOA 4NJDA 3RMFA 3BHTA 1ZRZA 1J3HA 3GB2A 4HZSA 5CEQA 3WIKA 1TKIA 5JFVA 3D94A 2KULA 3H10A 5FXSA 4GKIA 4B0GA 5AP2A 5IQGA 4O0UA 2B9FA 1UWHA 3PY0A 3GNIB 3QXOA 4X3FA 3S00A 4W4XA 4AZEA 2PWLA 3CY2A 3QD0A 5C01A 5EG3A 4GVAA 4FKWA 4HCVA 3A8XA 1WBSA 2JBPA 3DPKA 2ZM3A 4TXCA 1NA7A 3K5VA 2UW7A 3PE2A 3PG3A 3ERKA 3V5WA 4EHEA 4YC6A 5EHYA 1L3RE 3PP0A 4C2WA 1UNGA 3C5UA 5AWMA 3VRZA 3R9RA 2BAJA 3KU2A 4I94A 1XJDA 3EHAA 2F7XE 3W8LA 3ROCA 3DAEA 3C13A 4XG9A 4CV9A 2VNYA 4RJ3A 4C62A 1XR1A 4J52A 2YCFA 3NNVA 3R01A 5AX9A 4TKSA 4DH1A 2QOBA 1QPCA 5DR9A 5TF9A 2Z7SA 3QTRA 3LAUA 5ANKA 3KULA 4F1OA 2BRGA 4PMSA 1Q8WA 3EWHA 3P78A 4KKHA 4BDJA 3M42A 3A7GA 4FTAA 3QX2A 2JAMA 3TUBA 5LVLA 5HG7A 4RJ8A 2B55A 5KBQA 4C38A 4RX7A 2W4OA 4W4YA 3KXZA 4CG8A 3UMWA 4GYGA 3ORXA 4OAUC 2W1DA 3VS3A 2OIQA 2QOLA 2XEZA 4RJ5A 2CGVA 4EK6A 3NVKI 5HU9A 4QQ5A 4BDAA 3CQWA 5HESA 3QRKA 2C0IA 1DI8A 1ZYJA 4U3ZA 3LFDA 4FKSA 3QTZA 2O65A 3KRXA 2ZV9A 3CQUA 4WKQA 3ENHA 2J7TA 4ACMA 5BUEA 4WA9A 4PF4A 1IA9A 2YABA 4G6NA 3RTPA 5AADA 4WHZA 2UW5A 5IUHA 4CVAA 2Z7LA 1H4LA 4D5KA 3QU0A 4U40A 3FXWA 2QR7A 4RQVA 4G3DA 2XJ2A 4QMYA 4ACHA 4X6QC 2E9VA 5LWMA 3UNJA 4WG4A 3MH2A 5CSPA 3IDCA 3GU8A 5M53A 2V7OA 4YHFA 5KMKA 4I6BA 1Q8ZA 1OIUA 2BFYA 3QQFA 2XBJA 3C1XA 4M69B 4BFMA 3ZTXA 4CXAA 3COHA 4RT7A 2X9EA 2VNWA 2BRBA 3DA6A 3ID6C 4AA4A 3BU6A 4C33A 3KVXA 3HRBA 4U5JA 2ITWA 2YIWA 2QLUA 3D4QA 4IB1A 3NLBA 4NKAA 5AJQA 3FMEA 4CG9A 3R73A 4BDEA 4AGDA 3C9WA 2PVMA 3VW6A 2B53A 4O22A 3Q6UA 2PVRA 2A1AB 3HAVA 4O27B 3V8SA 4YBKA 3VS7A 2BKKA 3AC5A 4FKQA 5CU4A 2YJRA 2I0VA 4TYIA 4ZS0A 2BZIB 4ZTHA 1YWNA 4BVUA 4U79A 4LRMA 1APME 3F7ZA 1YI3A 4EOMA 1FVVA 5IEXA 5DT3A 4I20A 3E3BX 3BYUA 3NW6A 2HZIA 4EUTA 2C1AA 2C3JA 5AP7A 4BDDA 3QQHA 1XH7A 2JKQA 3MTLA 4QMWA 4FL2A 2OJIA 4FSQA 5J9YA 2W9ZB 3UO4A 4AQCA 2ACXA 3QQKA 2HZ4A 2XRUA 3KRWA 2R9SA 4IVCA 3TTJA 3QRTA 4FTJA 3P23A 2QU6A 4LM5A 3LM0A 4R3PA 5I3RA 3BEAA 2OF2A 4H1JA 4LV8A 3BGZA 4MAOA 4XBRA 5F94A 3D9VA 5AV1A 2V7AA 3TJDA 4II5A 2W17A 4J71A 3I7BA 5CSVA 4CRSA 4AZFA 5HNBA 5JN2A 3R1SA 4L46A 3TT0A 4OW8A 2GSFA 3UODA 1BI8A 1PMEA 4XOZA 1U59A 4QP1A 4EZ5A 4IBMA 4M3QA 4FTIA 1CMKE 2XEYA 2OKRA 4IWOA 4KNBA 4HYHA 3PSCA 3SX9A 5IDPA 3FZ1A 4QTBA 1P14A 3KXNA 4L7FA 2XNBA 5IISA 4CYJA 4TTHB 1OMWA 1X8BA 2XJ0A 3TV4A 4DGOA 3ANQA 1QCFA 4I3ZA 4NW6A 3TV7A 3BLQA 5CAVA 4AA5A 3R8LA 4B99A 2J0MB 2H34A 3NRMA 2W4JA 2X2MA 1NVRA 5HBJA 2OZOA 3F3VA 3HP5A 1WFCA 1Q62A 2XNEA 4PMMA 3F6XA 4S32A 3H0ZA 4XYFA 3PXFA 4S33A 3ZLSA 3FI8A 3FC1X 1URCA 2ETRA 3O50A 5E8TA 5IA1A 3DU8A 3TKHA 3WYYA 4IACA 3QCXA 3RHKA 4BZOA 4ANSA 3W16A 2XNNA 2ITPA 4EC8A 5M57A 5F1ZA 4M69A 1OUKA 4C57A 3C50A 2QOHA 4V05A 5EQPA 5J8IA 3OEFX 1IAHA 3WZUA 4L52A 3R02A 2ZMDA 2WMVA 1JKLA 4IFCA 2BAKA 3F9NA 4WOVA 3R00A 4EEVA 4M97A 2RKUA 2J4ZA 2YDKA 4GK2A 4FV2A 4ANMA 5L8KA 2JITA 3FHRA 3NIEA 3DFAA 2FH9A 4UY9A 4OBPA 1IG1A 4ITIA 5FTOA 3B8QA 2JLDA 4D1SA 4HVHA 5HNIX 3CKWA 3I5ZA 4ERKA 5DR2A 3Q4TA 1UU9A 3HP2A 3LCTA 4X0MA 4AFJA 5HLWA 4FEVA 3VBXA 5T3QA 3HV6A 4O91A 3P08A 2OIDA 4CTCA 3QQLA 5GJDA 1AGWA 3R2BA 4FV8A 4O1OA 2PUNA 2CSNA 3VF8A 1K2PA 5IA2A 3AMYA 3C4WA 1OL7A 4PMTA 4FX3A 4NZWB 4I5HA 3ACKA 2W7XA 4FF8A 3EMGA 3LMHA 5FDPA 4I1ZA 4NU1A 4Q5HA 2XKDA 4EHVA 4FKRA 4JNWA 4FIEA 3MS9A 2ITTA 2BCJA 4UMPA 2BZKB 3KRJA 4OTQA 4KS8A 3MB7A 5BVKA 3HV5A 3WARA 4BCNA 5L6WL 3C4CA 3TNHA 5HE3A 3R7IA 4K11A 2YFXA 4YZ9A 4YZDA 2YM5A 5AX3A 3DK6A 3EZVA 4QP3A 2WZJA 3N4TA 3WI6A 5BVFA 2YCRA 2H8HA 3D83A 3KRLA 2J0KA 3QYZA 2PULA 5HORA 2WEIA 3L9PA 3UO5A 5E7RA 3QAME 3PY1A 4R1YA 1UVRA 2XK6A 4OR5A 3L8PA 5KHWA 2YHVA 4G1WA 2B7AA 3VBQA 4CCUA 2CGUA 4LG4A 4YO4A 5HCYA 2O2UA 3D5XA 3VS2A 2ITYA 4NCTC 3II5A 4X3JA 5A6OA 4BTMA 2AC5A 2E9PA 4JIKA 5JSMA 4FODA 3ZHPC 3Q32A 5AAEA 3GCVA 3TJCA 2ETKA 3ZCLA 2X81A 3NNUA 4I4FA 2X4FA 4GK3A 3RVGA 4EHZA 3OXIA 4C4FA 1H0WA 4F0IA 5HIBA 2YLEA 5KUPA 5B0XA 3MV5A 3LCDA 3VQUA 5L8LA 4NTTA 2Z8CA 3OBJA 4PL5A 5CU2A 2CN5A 4QOXA 1ZLTA 4BGHA 2YWVA 4NM0A 2J51A 3H30A 2UW6A 3CY3A 4CYIA 3NNXA 3IW7A 3LFAA 4G16A 4ZMEA 5ANDA 3ALNA 2BDFA 2Y7JA 4IX6A 3RINA 2R3QA 4HNIA 2R3LA 4JG8A 2JIIA 3IOKA 3LFSA 1IASA 2RF9A 5E4HA 3C5IA 4RWKA 2ZDUA 2XH5A 2RFDA 4F7LA 1YQJA 4HVIA 4FV7A 5LQFA 5AAGA 5FXQA 3UVPA 3A7FA 5CANA 4YZMA 1YDSE 4MYGA 4S34A 2ITQA 1GY3A 5EFQA 3I0OA 3H3CA 4ZY4A 2ETMA 3V6RA 1ZOHA 4IEBA 3V6SA 2HZ0A 1Q41A 4RC4A 2O64A 5LVOA 3O96A 3C7QA 4KIKA 3QKMA 2PE2A 4RIWB 3RP9A 3G0FA 3HMNA 4L45A 4FICA 5LMKA 3VULA 2CKOA 3MB6A 3ZDIA 3F7WA 3PZHA 1WAKA 5L8JA 3BU5A 4A9RA 4EL9A 4EBVA 3DJ5A 4JBOA 3A61A 4ZEGA 4KRDA 4L8MA 3FKOA 4J8MA 4XOYA 3RAIA 3G5DA 4A9UA 5GZ8A 3IW5A 1FMKA 4O0XA 3WF6A 3AGLA 1H1WA 3HA8A 4QP6A 5FRIA 4NEUA 4LRKA 2GQRA 3E7OA 3VN9A 2WMRA 2NPQA 2ERKA 4FZDB 3UNKA 3UG2A 5EYMA 2GDOA 3RALA 3D7TB 4RIYA 3PJ3A 4RVTA 3QA8A 4JG7A 4Q5EA 2QU5A 4YJUA 5HGIA 3R8ZA 1Q3WA 3A7HA 3FJQE 3BYOA 5AV3A 1SMHA 1QL6A 5HBEA 3HUBA 4DH3A 4I5CA 2A4LA 4IB0A 4EUUA 3L8SA 2FSMX 4C37A 2HOGA 2XJ1A 3Q2JA 1OL1A 5DI1A 1GIIA 1OI9A 3ZDUA 5L6PA 1M52A 5LJJA 3ZRMA 1E1VA 4CFFA 4E4NA 3ZZWA 4G31A 4H1MA 4OBQA 3R9OA 2F7EE 4F70A 3E62A 4JAJA 5F95A 3RNYA 2B1PA 3AD6A 3AT4A 4MNEB 4AP7A 4W9WA 3QZHA 3R0TA 4EOLA 3LW0A 4JJRA 1J91A 1YOMA 3P4KA 4BWKA 5C4LA 3BZ3A 3C4FA 3COKA 2W4KA 3M2WA 4FEUA 5HTIA 5GNKA 3PPJA 3D5VA 3QZGA 4I22A 5FDXA 4O7YA 2WTKB 3DXNA 4TYHA 2YZLA 3H9RA 2C0OA 4CFNA 5BYYA 3SDJA 2GNHA 3CD3A 4GSBA 4QTAA 4DG3E 3OCGA 3TM0A 4Z55A 3OP5A 1SVHA 3MVLA 4IAFA 3OCTA 4UEUA 4F08A 2DQ7X 4OLIA 4EYMA 5I9ZA 5E92A 4L43A 3NAXA 4IX4A 5CNOA 3KK9A 5IH5A 1UNHA 4ENXA 4F9WA 3UIUA 2ITUA 5K0XA 3A7IA 3PSDA 1WZYA 2VN9A 1F3MC 2VTAA 2YIQA 2OU7A 3FZTA 3DAJA 4BIDA 4CZUA 4R1VA 1OKVA 5J5TA 3HMMA 4OT5A 4EH4A 2X2KA 3KXXA 3ZO2A 4GYIA 3UTOA 4GFOA 3Q96A 2I40A 1WBWA 2WQEA 3PXKA 5KZIA 3CGFA 3DZQA 5AR3A 2HW6A 4BIBA 2BIKB 4OTHA 2XM9A 1OPJA 1WBNA 4MBJA 5D12A 3FMKA 4QPSA 3RNIA 4EK3A 3UE4A 3NUSA 5GHVA 2H9VA 4ZJJA 4QTCA 1J7IA 2R5TA 2C30A 4MQ2A 4F0FA 4HZRA 4R7IA 1NT2A 5AAFA 3RK9A 3R8UA 1ZYSA 2XCHA 2BFXA 5IQIA 3H9FA 3MPMA 3ZO4A 2PUUA 3UQCA 5CSWA 1OECA 2JGZA 3NWWA 3WF7A 4UX9A 2QC6A 2R3HA 1YOLA 4O7SA 4I5MA 1W8CA 4OTPA 2ITXA 2VGOA 1CTPE 3AC3A 3PIXA 4FZFB 3MTFA 4A9YA 2W0JA 3MN3A 4JDIA 4JBQA 4MEDA 4BTJA 3PY3A 2VO6A 4RVLA 3PWYA 1GIJA 5AR2A 3IQ7A 2AC3A 3OT3A 1GOLA 2W1EA 5EDPA 3SXFA 3RWPA 4F6UA 3CSVA 4LGHA 1TVOA 2W1GA 4IH8A 5CYIA 3FY0A 3DBDA 3R21A 3QCYA 3EN6A 2QOOA 2VWWA 5E8YA 4KIKB 4DFYA 5A4LA 4IAAA 3ZYAA 3FBVA 2QNJA 5DR6A 5CX9A 2CKEA 3BE9A 3FMDA 1GZOA 5A3XA 4XS2A 4EORA 5I9WA 1P4FA 1Y8GA 3R63A 5D41A 4KBAA 4BY9E 4I41A 3LCKA 5IQAA 1KE5A 5E90A 2VWUA 5J7BA 1BL6A 4IZ5A 1H0VA 1ZMVA 2Y6MA 3DFCB 4ARKA 4EZ3A 4JOAA 3ORIA 5CSXA 2J2IB 2RSVA 3EB0A 2XKCA 3NUNA 3EH9A 4K18A 3CLYA 3O51A 3OWLA 4FGBA 4FUYA 4NM5A 4HVDA 2VX0A 2QHMA 4QP2A 3MY1A 4D58A 4AUAA 2QO9A 3IPHA 4WT6A 3QTWA 2CGXA 4GUEA 4YJRA 5CZIA 5CF5A 2YISA 2P4IA 4GU9A 4PPAA 5FD2A 4CFXA 4D2WA 5M07A 2RG5A 3Q9ZA 2VX1A 3MVHA 2FUMA 3R1QA 3SRVA 1QPDA 4PMPA 1AD5A 4ZSGA 3MFRA 2YDIA 1U4DA 4FNXA 3TNWA 3R28A 1U5RA 1ZXEA 4EI4A 5M44A 4U7ZA 3ZSHA 4PL3A 5AUTA 3DQWA 1F0QA 4BBFA 4FKPA 2XKEA 4XG4A 5FG8A 4B7TA 5AUYA 3AQVA 2QODA 1FMOE 4AT5A 5EKNA 5KHXA 2BUJA 5I5ZA 3PVGA 3DBQA 3UP2A 4LOQA 4F0GA 4NUSA 3TL8A 4MWIA 3BYVA 4NFMA 2FO0A 2EXMA 5L4QA 2RFEA 3PIZA 4FIJA 2FYSA 3UOKA 1GZ8A 4L9IA 4FA2A 4GU6A 4YJVA 2VTPA 5CVHA 5K3YA 4DT8A 5DPVA 5CEIA 3F5PA 3EQDA 1Y6AA 3MVJA 2W9FB 5A4QA 4NFNA 4DCEA 2XNPA 3MBLA 4TW9A 3UQGA 5DRDA 5BVDA 2G9XA 5I9YA 1R1WA 2XNOA 4A4OA 3FY2A 1XBAA 4O84A 4RX8A 4QMQA 2HY0A 3P79A 4ANLA 4CRLA 4TT7A 4YJNA 2WOUA 3G51A 1Q8YA 4YP8A 3EJ1A 3PVBA 4RIXB 4C02A 2VTMA 3QKLA 3WZKA 3NGAA 4CFUA 2PHKA 3BEGA 4I4EA 2BDWA 5M55A 4QMLA 1Q5KA 1PRYA 2W96B 3F61A 4NIFB 2DUVA 2X6DA 4RWJA 4RVKA 5J1WA 4AW0A 2DWBA 3SLSA 4FK3A 4N6ZA 3VRYA 2X8EA 4EH7A 2HY81 2VRXA 3NUYA 4PQNA 2BTRA 4C3RA 4EH5A 4KBCA 3RPRA 4AN9A 1ZYDA 2C6LA 5E1EA 4C4JA 4ZMFA 2J90A 4F9BA 4K8AA 3IECA 2Y4PA 3MPTA 4FTCA 4G3GA 2Z2WA 4ZAUA 3R9NA 1Y8YA 2WD1A 5CAQA 4JT3A 4K2RA 4QMPA 1M14A 2Z60A 3AT2A 3HNGA 3Q2MA 4RA4A 5TO8A 4ZLOA 4DCAA 2HAKA 1YW2A 2G15A 3BYMA 3CD8A 3GU4A 3QRUA 3D2IA 3OEZA 5A14A 5HZNA 5HVJA 3WF8A 2OK1A 3GCSA 2R0UA 4AGUA 2XS0A 1XBBA 2BROA 2J5EA 2OXXA 3Q53A 4FTTA 2IW9A 5J1VA 1KE7A 3H0YA 1W98A 4XRLA 5D7AA 2VTTA 3MFUA 5FUTA 2VTNA 3RK7A 3BPRA 2VTQA 3P9JA 5JGAA 3I6WA 4N57A 3KN6A 3NAYA 3QF9A 2OFUA 4LQMA 4RX9A 3NVMB 5TR6A 1H01A 4K33A 2AYPA 3GQLA 4ZP5A 4J97A 3FXXA 4M13A 1XH8A 3DJ7A 3HRFA 4RIYB 5DLSA 3SVVA 3G9LX 4XEYA 1M2PA 4D2SA 5IQEA 4FUXA 3RAKA 5L2IA 2UZBA 5AV2A 3CJFA 4HVSA 2ZYBA 2CNQA 1IEPA 3PE1A 4DTAA 3A7JA 4DEIA 4GFGA 2JAVA 3DBEA 4UALA 5IEVA 1UWJA 2UVXA 2DYLA 1BL7A 4ANBA 2Q83A 2GNJA 2J6MA 2XK7A 3L9MA 2GNLA 4I5PA 1FGKA 4QNAA 1JWHA 2Y0AA 4FT5A 2BR1A 4DEHA 2BTSA 1U54A 4CFWA 3DQXA 1OM1A 5A9UA 4N4SA 2XIKA 2F4JA 5LCKA 3GU5A 3M11A 4FSNA 3EFJA 4LRJA 2BHEA 3AC1A 3O8TA 3RGFA 3BHYA 3PP1A 4XV2A 4R7BA 3FQEA 4JG6A 4F7SA 3D2KA 2WMWA 4DEAA 1OBGA 3RBWA 4AF3A 3KXGA 2JD5A 3KMUA 2GS6A 4DH7A 4W4WA 2J50A 3PPKA 3GOKA 2P55A 3QX4A 5BVEA 4G3FA 4QMSA 2WTWA 4YTFA 3UOJA 2JIVA 2VTJA 4WUAA 5BVWA 3RAHA 4DG2E 1RDQE 4E6AA 3U9NA 2NRUA 5HIDA 4O7ZA 4LI5A 3EFKA 5KMNA 4ZTLA 3E87A 2WMUA 2OJGA 4PPCA 4XX9A 4AT3A 4H3PA 4NW5A 3EOCA 4E6QA 1PF8A 2XIRA 4WNOA 3FQSA 3DT1A 4BDGA 4CZTA 4DAWA 5B2LA 1FVTA 3ZO1A 4BDIA 3VVHA 3CR0A 2V0DA 2C5OA 4DGLC 3R8MA 4MBIA 3DXQA 4E5WA 2W99B 3SQQA 4FTMA 3E93A 2QOQA 2SRCA 3GT8A 1PJKA 5CT0A 4BIEA 2HZNA 1OBDA 3GC0A 2GS7A 2QCSA 3EIDA 2X7OA 3IW4A 4UXQA 4FKJA 3TUDA 3A62A 3W10A 4GVJA 4IX3A 3KC3A 3PXZA 3IDPA 5AP3A 4APPA 3ORLA 4MTAA 5BUIA 3JVSA 3FC2A 4WSQA 3U8WA 3QCQA 5DOSA 4E73A 2QURA 5CAOA 2C5YA 5BUJA 1JSVA
chains in the Genus database with same CATH superfamily
3DKCA 4WBBB 3UQFA 2OFVA 3QBNA 1REKA 4BHZA 3E88A 3R30A 2GQGA 2C5NA 2XMYA 2YITA 4HYIA 4ZK5A 3FXZA 3Q9WA 4IJPA 4U6RA 3F5XA 4L3LA 3RCDA 2FSTX 3DK3A 4O4DA 4APCA 4M0YA 3I81A 3WIGA 4AOTA 3QD3A 4C0TA 4FSUA 4ITHA 4RG0A 1PMUA 4BF2A 4EOIA 4RJ6A 3GQIA 4ZSLA 3B2WA 4XUFA 1ZY4A 4DITA 4WNMA 4P5ZA 2CNVA 2WOTA 4HGSA 2J0LA 3VBTA 3BCEA 1O6LA 4ZLYA 2XA4A 2UZLA 2I0YA 3KF4A 4A07A 3FSKA 4IWPA 3ANRA 1ZY5A 4LUEA 3UG1A 3VUGA 3GC8A 2X9FA 2EB3A 2YCSA 3ETAA 3Q9XA 2RIOA 2A2AA 2VO7A 3ORTA 1R0EA 3QZIA 4GEOA 4NL0A 3BELA 1S9JA 2BZHB 2PVYA 4IVAA 1BI7A 2IN6A 3QYWA 2O63A 4C3FA 3K5UA 4NM7A 4WSYA 3ZRLA 3M1SA 5JMSA 4U81A 4DFBA 3UC4A 5E8XA 4A9TA 1CSNA 3LE6A 5CAUA 2NYAA 4EJ7A 1KOAA 4RJ7A 5DWRA 1SVGA 4RFYA 3W1FA 2J0JA 2R3PA 1SZMA 3HZTA 1T46A 4RZWA 3SW4A 4F9YA 4W8DA 5C4KA 4W4VA 1U5QA 4FKOA 3BBTB 4HNFA 5HTBA 4WRSA 2PMIA 3W0MA 1A06A 4FRFA 3SG9A 3FMJA 2C69A 3UDBA 4L3JA 2X6EA 5C1QB 3NIZA 4CKJA 5HE2A 3ZUUA 3QRIA 3NFGB 3BBWA 3SC1A 4JDJA 4K9YA 4U42A 4X3FC 3L9LA 4OTIA 4YTCA 4NKSA 1ZYCA 5HX8A 3G9NA 3FKLA 4BTFA 3O7LD 2W5HA 3RZFA 4NH1A 4GIHA 3U87A 5IUGA 2HXLA 5JT2A 4O7LA 3BX5A 3SD0A 3UOLA 3JY9A 3MH1A 2EUFB 4ZSEA 4GKHA 4U0IA 2P0CA 3C51A 3WBLA 4MCVA 3RJCA 4WUNA 3LQ5A 1BYGA 3O23A 3PWDA 2WO6A 2E9NA 1JOWB 3MJ2A 5TOZA 1MUOA 1H26A 4E5AX 5JK3A 3LJ1A 5HOAA 2YIXA 3EN5A 5CNNA 3MH3A 3VUIA 4YU2A 5K4IA 1O6KA 4LMUA 4J53A 2R3NA 3R83A 4ALUA 2EXCX 1IR3A 4TPTA 5A4CA 3QWKA 3T9TA 2WB8A 1V0BA 2ONLA 4FV1A 3ZU7A 1JQHA 4ORKA 4Y95A 2X1NA 3SGCA 3L1SA 4I6HA 5DNRA 1OZ1A 2XK3A 3OXTA 4J99A 5C26A 1ZZ2A 3BLHA 3R7GA 5HTCA 3W0OA 5H9BA 2QKWB 4FIGA 5JH6A 4M8TA 1TFFA 3OTUA 1W2DA 1M2RA 4O7RA 4IM0A 2X7FA 4DINA 4CT2A 4XG2A 5AV4A 1H24A 4V0GA 4DHZA 2EXEA 4GV1A 4J96A 4C2VA 2PZ5A 3HV3A 3BHUA 4PTEA 3BWFA 3C4ZA 4XLVA 3BL7A 5CF8A 2QOIA 3LOKA 1XH9A 4NM3A 1XH6A 4DFNA 2PVJA 2ZAZA 4P4CA 4PWNA 4GL9A 4J7BA 4XV9A 4UN0C 5DN3A 5LXMA 1F5QA 1WCCA 3CQEA 3MY5A 4X2GA 3W8QA 4C7TA 3K54A 2XRWA 2F57A 2ZM1A 2IVUA 2C47A 3QTIA 2G1TA 4EH6A 4Y46A 4YNEA 3Q52A 3QTQA 5FM2A 5IA3A 3F66A 2R3MA 1V0PA 4FG8A 5IH6A 4JBPA 3D0EA 3KY2A 4FE2A 2IZSA 3F3UA 4C36A 2X2LA 3KMMA 3WZJA 4O0YA 3ZOSA 3QQJA 3KRRA 4HYUA 3KEXA 1JSUA 3T3VA 3LCSA 2YM3A 4D2RA 5KBRA 4BJJA 3SG8A 2IW6A 3R9HA 5IQCA 3QLGA 1UA2A 4Z7GA 4OTFA 4F9AA 5HE0A 2DS1A 4EQMA 4XG7A 4FSRA 2VD5A 3VONA 4DBXA 3FLSA 3PRFA 1FVRA 1ZMUA 4H36A 1JLUE 4JDKA 4QPAA 5EW9A 4ALVA 4ENYA 1YRPA 4BGQA 1RQQA 1MRVA 4E20A 5DG5A 4IVDA 2WAJA 3UIBA 1LUFA 2R3KA 2Q0NA 5JFWA 2YIRA 4FC0A 4FBXA 1NXKA 4IWDA 4DF3A 2Y8OA 4YC3A 3UMXA 2PZRA 4O38A 1SVEA 4PX6A 1UKIA 1H00A 3FI3A 4ZZNA 3TIZA 2WIPA 4Z9LA 1W84A 4BCQA 4FEQA 3E92A 4C4GA 1LPUA 2VTSA 5AUUA 5L2SA 5KNJA 2CKQA 4O82A 3ZM9A 4D9TA 4UWYA 4FT3A 1W83A 4R3RA 5EK7A 4DFUA 2HYYA 4F64A 5KKRC 4MD8E 3KKVA 4QYFA 2ZMCA 2XAOA 5FBNC 3FYJX 4TWCA 4GFMA 5IA4A 4YUQA 2XYUA 4IE9A 4X6RA 1B39A 2NNWB 2UW4A 2RG6A 4B8LA 4NK9A 3G2FA 4FNZA 5DEWA 5CVFA 3W2QA 3RI1A 2GU8A 3FKNA 4F9CA 4KSPA 4M66A 2XM8A 5AP1A 3U54A 3VUDA 3PPZA 3V3VA 2F7ZE 1Q61A 5CEOA 3NW7A 4QMZA 4ZSAA 4EKKA 1A9UA 4XBUA 2CNUA 2F2CB 5FP5A 4FR4A 5J9ZA 3CKXA 1UNLA 4ZZMA 5K9IA 4BC6A 3QTUA 2IPXA 4FTOA 3PVUA 4XV1A 3HA6A 4BI1A 4HJOA 4YURA 2YIYA 3NUPA 4ACCA 2IO6A 5HD7A 2JFMA 2BIYA 4FV0A 5CF6A 4B8MA 4YNOA 3IDBA 4RBLA 4AGWA 2GFSA 1E9HA 2C68A 2IZUA 4FSZA 2WTDA 3G90X 3C4EA 1WBPA 3AC4A 3LIJA 4X7QA 2OI4X 4R7HA 4TL0A 3UDTA 2HW7A 1LR4A 2QONA 5T6KA 3DY7A 3OC1A 5ETIA 4NJ3A 4TY1A 2A27A 1PW2A 2ITVA 3TNIA 4ACDA 4UMRA 3N4UA 4QTDA 4WNPA 1NW1A 5H2UA 3FPQA 4TYHB 4DEEA 1IAJA 4FTQA 5JEBA 2VAGA 4BGGA 4DEBA 5FLFA 4GJ3A 1XH5A 4RLLA 4FT0A 4NWMA 5HEZA 4O6EA 2W1HA 4I23A 4L68A 4BHNA 5LOHA 3PXQA 1BUHA 4UZHA 3S3IA 3S95A 4FV9A 3F5GA 1XWSA 2E2BA 5CALA 5AP6A 5EQYA 2WTKC 5L2WA 2OXDA 4WD5A 4IM2A 4V0GB 2UZUE 4M15A 5JZNA 4CMOA 4BWXA 2VWBA 3OOMA 4O7VA 2QKRA 4FKUA 4EOJA 5HG9A 5L3AA 2CKPA 2P3GX 4C35A 4I6LA 3IKAA 2IVSA 3JY0A 2PUPA 4C8BA 3AC2A 1M2QA 5C27A 3DS6A 4RA5A 4ASEA 5KKRB 2J9MA 1ZOEA 1ERKA 4UZDA 4Y72A 4EH8A 1PYEA 5EYKA 3TEIA 1R39A 2J0IA 5CT7A 4I92A 3OUNB 1ATPE 3DDPA 1CKJA 4KINA 4PDPA 5AR4A 3CTQA 3R8PA 4UV0A 2WELA 3GOPA 4FYOA 5ETAA 4IQ6A 1KOBA 4G9CA 3DDQA 5CQWA 2PE0A 5FM3A 2XIXA 1MRYA 3OWPA 2X0GA 1M17A 1XHAA 3LFQA 1OUYA 2XUUA 3W2PA 4WNKA 3N51A 5KMLA 3QHWA 4D4VA 4IJ9A 4MD7E 3S1HA 2PMLX 2QR8A 4JBVA 4NYEA 4IIRA 3QC9A 4R5YA 2Y9QA 4UWBA 1H28A 2BPMA 5GIPE 3H4JA 4CKIA 1GZNA 3I0QA 3GVUA 5I9XA 4YJTA 2BZJA 4AXAA 3TDWA 4I0TA 1YDTE 1BMKA 3HECA 3ALOA 3D5WA 4RIWA 3U4UA 4BI0A 3V04A 2QG5A 2FA2A 5E8WA 3COIA 1PXPA 4EWHA 4IAKA 4JI9A 3WZDA 3MIAA 4F1MA 3ZFXA 3HMOA 3VUMA 3E5AA 1OIRA 1UU8A 3CP9A 4Y5HA 4ZTNA 2C5VA 4XMOA 1URWA 5BMSA 4FL3A 3BWJA 3F82A 3AXWA 4PDOA 3A4OX 2PTKA 3VBVA 3D15A 4L44A 4WIHA 1H8FA 3C0GA 4DYMA 4EOSA 3R7VA 3HUCA 4RC2A 4USEA 3ROYA 3CXWA 1PHKA 3FUPA 4DG0E 5HG5A 5IA0A 5EOLA 4LV7A 4MXOA 2FVDA 2XZSA 1OPKA 2ZV7A 4QPMA 3Q4CA 1W82A 3NUUA 3VS6A 4AE9A 3AGMA 2XK4A 4TYGA 4XHKB 5I3OA 5J79A 2I7QA 3CPBA 5FEQA 2WTVA 2VWZA 2YACA 4DFLA 3FMLA 3VO3A 3WZEA 3GC9A 4BICA 3Q5IA 4TNDA 4ANNA 3W32A 3KL8A 3JYAA 2OH0E 3BE2A 4YJOA 2Y6OA 4ZTRA 3SKCA 4EWQA 3BI6A 3GCUA 5H8GA 4AFEA 4AAYA 4QP4A 2R3GA 2UZEA 3KN5A 4GT4A 5CENA 4L53A 3GENA 2PMNX 2B52A 4QMXA 4E7WA 4F4PA 3RWQA 3LMIA 3NS9A 4M67A 4TRLA 4XH6A 2YM7A 4EJNA 3EL7A 1SNUA 2WTJA 4JL9A 4LYNA 1TQPA 2CDZA 3AMBA 5HG8A 4KWPA 3MESA 4JMQA 3DV3A 4D28A 3KXMA 5KZ0A 3RCJA 1YXVA 5J5SA 2YZAA 1IA8A 5M4FA 5CZHA 1PXNA 4AXDA 4E3CA 3OW3A 2C3IB 2P2IA 3LM5A 5J95A 3WYXA 3ZS5A 5IF1A 3VJOA 3CC6A 3QHRA 1WBVA 3EQGA 3FQHA 1Z5MA 3ENMA 2C5XA 5EI6A 3UO6A 4MWHA 3FLNC 2REIA 3NCZA 3QUEA 4CTBA 3B8RA 3VS0A 4J8NA 3PFYA 2B0QA 4M84A 4A7CA 4MXAA 2PL0A 2QOFA 2PVFA 1OITA 3GFEA 2XIZA 5AUXA 3U51A 2FSLX 1MQBA 2J5FA 1Q97A 1WVXA 4D0WA 4A4XA 5CAPA 1Q8UA 2HELA 5CLPA 3PRIA 4AW2A 4ASXA 3FYKX 3TV6A 5GINE 3POOA 4C58A 2R3OA 4MX9A 4N0SA 2VTHA 3C0IA 3F3TA 3I79A 3V5PA 5IMEA 5LCJA 3Q60A 2C6MA 5HO8A 3ODYX 4GMYA 1YVJA 5CY3A 2I0EA 2PVNA 4IZYA 4KB8A 4O81A 3NX8A 1KE6A 5C8KA 3UZRA 3PFQA 3GU6A 3RZBA 5ANEA 1CDKA 4RFZA 3RPOA 3HLLA 4QMNA 4RIXA 4EH2A 4GH2A 3F2NA 3EZRA 1WBTA 4YJPA 4E1ZA 2W06A 3ZXTA 5BX0A 2W5AA 5DHJA 1M7QA 3ORKA 5B7VA 4IANA 2PYWA 3AG9A 5DBXA 4IMYA 4H39A 3PJCA 3TIYA 3T9IA 1XO2B 3DKGA 3A99A 4FT9A 1G5SA 5AEPA 4QYEA 2VWYA 4PP7A 2JEDA 2PZYA 3VC4A 2UZVA 3UPZA 3OF0A 3MW1A 5ANGA 3R1NA 1L8TA 3W55A 4O0VA 3UVRA 4O6LA 4I6FA 2XF0A 3FI4A 4L3PA 4EYJA 3QRJA 4DGNA 2PZIA 4QMMA 5LMAA 3ACJA 4KIQA 3AC8A 2LAVA 2XK8A 1GAGA 2EU9A 3EFLA 4E5BA 4RX5A 3DB8A 3MYGA 3PJ1A 4BTKA 3PA5A 4QD6A 4W8EA 4EONA 4JR3A 3UOHA 3OFMA 4MK0A 4LUDA 3P7BA 1VEBA 3IONA 1ZWSA 2VTOA 2O8YA 3R7YA 5AM7A 3V5JA 4FVRA 3F88A 2CMWA 4E6DA 5CU0A 2XP2A 2V55A 2RL5A 5D1JA 5AM6A 1PY5A 1VJYA 2VWIA 1LEZA 5HBHA 1QMZA 4FT7A 1YHWA 5EM7A 4F99A 3E8EA 4PP9A 4QP8A 1KE8A 1MQ4A 3JS2A 4FEWA 5F20A 2YAAA 1NVQA 1J1CA 4DHIB 2BDJA 3CEKA 3JR1A 2R2PA 3EN9A 3ZLYA 4M14A 3QXPA 4Q9SA 4ASDA 1STCE 1P2AA 4RWIA 3UVQA 1GNGA 2QOKA 3FZSA 4OTGA 3SOCA 4QYHA 5C03A 3ZZEA 1CM8A 2A0CX 1PKGA 5GIOE 5FQDC 3OS3A 4BKZA 5M4UA 3ZLXA 2VZ6A 4BCGA 4BCFA 3QKKA 4JS8A 4DHFA 5JFSA 5K4JA 4FTNA 3UZTA 3O5AA 2YERA 1G8KA 3DLZA 2GS2A 2Z7QA 2W1CA 3VQHA 1G8SA 1YI4A 3BHHA 3Q9YA 1Y91A 3MIYA 3R22A 4FMQA 4LGDA 4RMZA 2IVVA 4O0RA 3MWUA 5AUZA 5KMIA 2YWPA 4P90A 3HYHA 4O86A 1RE8A 4OUCA 4FIFA 1Q99A 4DE4A 5KO1A 3KCFA 4YGAA 2XVDA 1VR2A 3JPVA 5E8SA 4IZ7A 3HRCA 3PDTA 2WU7A 5E9EA 5D7VA 4D5HA 5FEDA 2C1BA 4ID7A 4DLIA 4OGRA 4ALWA 3FLWA 1VZOA 5E8ZA 2Y4IC 4O7NA 4YTHA 3NSZA 4QMVA 3KVWA 1U46A 3I5NA 4FKIA 2R3JA 3EN4A 3PVWA 3MGYA 5AIKA 3BRBA 5DVRA 3SW7A 2O0UA 4Y83A 5HKMA 3TZ8A 2BAQA 3NNWA 4MXZA 4XLIA 4G9RA 5CF4A 4M68A 4RIOA 2IVTA 4IWQA 3QUPA 5IQBA 2GHGA 3NUAA 5JQ5A 2OO8X 3ORPA 1JNKA 4RQKA 5CU3A 1PMNA 3REPA 4YSJA 4P7EA 4AW5A 2VO0A 2R3FA 4D4SA 2C6IA 5AMNA 3AOXA 4YLLA 3TG1A 2VU3A 1R3CA 1H07A 2RFNA 2WMAA 5ACBC 4C4HA 3KF7A 1LP4A 3WE8A 5AA9A 4ZZOA 4MXYA 3D5UA 2UZOA 4QQJA 4IX5A 3EN7A 2CLQA 4JXFA 4MD9E 2UW0A 4QQCA 4QYGA 5H8EA 3SHEA 4CCBA 4EZ7A 2NRYA 1UV5A 5EOBA 4FSMA 1YHSA 4BJJB 3N4VA 3GCQA 4MF1A 5GZAA 4RVMA 2XK9A 2C4GA 1JVPP 5D10A 4AS0A 2X8DA 4DA5A 5B2KA 4FNWA 1HCKA 2UW9A 3W33A 2IW8A 1OKYA 5HHWA 5HO6A 2PUIA 4FZ7A 3VW8A 4RSSA 2V22A 3COMA 4TWOA 4ERWA 5KMOA 2B9IA 4H05A 3AMAA 5J7HA 4M7IA 4DLJA 2NO3A 1YXSA 5I0BA 2YCQA 3TI1A 1T45A 4L01A 3B2TA 2R64A 1OPLA 3SRVB 3VIDA 1UU3A 3EQPA 5DT4A 5ACKA 4E8AA 1BLXA 2IWIA 3W2OA 4X21A 5EM6A 4U3YA 4W9XA 2I1MA 3SXRA 3VUHA 3QLFA 1DM2A 3E8CA 2GFCA 4O2PA 2HIWA 5A4TA 4XG6A 3GCPA 2PVHA 1KV2A 3R6XA 4PNIA 5J87A 3NPCA 4AZWA 4ZOGA 3UZPA 5M56A 3GEQA 1OL2A 4XP2A 3A8WA 4FSTA 4NIFA 3UC3A 3G0EA 3E63A 3HEGA 4B9DA 5GJGA 3KQ7A 3KULB 3BIZA 2QLQA 5AUVA 2CCHA 4LOOA 3TMOA 3LPBA 1B6CB 3C4XA 4UMQA 4A06A 3CS9A 2EB2A 1M7NA 2PU8A 3QZFA 3V01A 2ONLC 3WILA 3P0MA 2QHNA 5CASA 4EOOA 1PYXA 4ZY5A 5L6OA 3P5KA 4AT4A 3LVPA 5CTPA 4MXCA 1PXIA 5AIRA 1H27A 3NW5A 4L42A 5K0KA 4DGGA 4ZS4A 4LMNA 4DGMA 5JGDA 4DH5A 4G6LA 3DBFA 5TE0A 3AD4A 4LFIA 4LGGA 5F4NA 2ITZA 4JQ7A 3RAWA 4ZLZA 2G2FA 4XG3A 1SYKA 3BQCA 5HCZA 4BCIA 5LMKC 4BDCA 3L8VA 4AG8A 4I24A 4E4MA 2P33A 1CKPA 3FLYA 3TUCA 3Q5ZA 1Z9XA 1S9IA 4QMUA 4GT5A 4AXFA 4FZAB 3TWJA 2WQBA 4K77A 3Q4ZA 1A48A 4AXCA 5K5XA 3DBCA 5CWZA 3RM7A 2EWAA 4U43A 2WEVA 3I6UA 4I0SA 5FGKA 5LVPA 2VTLA 4GW8A 3HMIA 1XKKA 2C3LA 3ULZA 1OIQA 4OAVB 3LJ2A 4G2FA 2RFSA 3LXLA 4YBJA 1KWPA 4PNKA 3TN8A 1V0OA 3POZA 1KV1A 2B9HA 5IMXA 3ZRKA 4AOIA 4QT1A 3PA3A 3O0GA 3OTVA 4O0TA 4WRGA 2FB8A 4X2FA 3ZC6A 4U9AA 4R5SA 4BN1A 4F6SA 3AT3A 3IW6A 5FP6A 2HENA 3R1YA 2C3KA 2HXQA 2OSCA 1IRKA 3UYSA 4IAYA 5FTQA 4KKEA 2BILB 3OZ6A 2GNFA 3Q6WA 4IB3A 3TKUA 3TKIA 4Z7HA 2B4SB 4EK5A 3TTIA 2GHLA 4KS7A 5IG1A 4YC8A 4N6YA 1R78A 2LGCA 4G5JA 2QO7A 4MKCA 2GMXA 3BU3A 2PVKA 3EKKA 3GUBA 3U9CA 1WVYA 2XNGA 5ANJA 3ZBXA 3JVRA 4BDKA 3O2MA 3CE3A 5A54A 1OGYA 4BYIA 4GRBA 2QOCA 2E9UA 3VBYA 5A4EA 3F3WA 3FMHA 3KFAA 5JGBA 4ZTSA 4USDA 1YKRA 4RRVA 3CTJA 5HNGA 4F09A 4QTEA 3PXYA 3O7LB 2UZTA 3GC7A 4HVGA 1DS5A 2V62A 3VWAA 5DA3A 4IDTA 1LEWA 1GZKA 4ANOA 2ITOA 3R2YA 4FVQA 4S30A 4FSYA 4EK8A 4C4EA 3GU7A 3VF9A 4QP7A 4KAOA 1YOJA 4IHPA 2GNGA 4B4LA 4KUJA 2OGVA 3ZO3A 4BRXA 4E6CA 4LL5A 1XQZA 4AA0A 3LFFA 2WNTA 3CPCA 1O6YA 5AA8A 3EQCA 4BWPA 3N9XA 3U6JA 2Q0BA 3OROA 5I4NA 2UUEA 3I7CA 4P2KA 4XP0A 3F69A 3P7AA 3UNZA 3PTGA 3QALE 4M12A 2VX3A 3A4PA 3VUTA 4BDBA 1OKZA 1J7UA 4R78A 3ZC5A 3KGAA 5JRSA 2FGIA 3ATTA 2WGJA 4XV3A 2F9GA 1PMVA 3PLAE 4RLKA 1HOWA 3FZRA 2VTRA 3G33A 3LFEA 3DTWA 2CN8A 4GG7A 4E26A 5IEYA 3QA0A 5M4IA 5IA5A 4NSTA 4EBWA 5DIAA 4HPUE 5IUIA 3ZEPA 2ERZE 4FIHA 5BMMA 4IZAA 3QD2B 4FZ6A 4DFZE 5ITAA 5CXHA 5G6VA 4L00A 4C59A 1RW8A 3LKMA 3HV7A 4Y8DA 1BKXA 3UIMA 4JLCA 3ORZA 4P5QA 5IPJA 2PVLA 4GS6A 3ZMMA 2H96A 4CLIA 2W1ZA 1Q8TA 4UXLA 5ETCA 3VS4A 3R71A 4BKJA 5CU6A 1W0XC 4JVGA 3TZMA 3WF9A 3ZFMA 2YAKA 3BLRA 3F3ZA 2F2UA 2VGPA 1DAYA 1PXOA 4OTDA 5GZ9A 3RK5A 5ICPA 5IZFA 2BHHA 4K1BA 4AN3A 1OL5A 4F6WA 4ZIMA 4UBAA 3FV8A 3P86A 4QYYA 4MNEA 4RFMA 4JR7A 4RZVA 2IEWA 4FKTA 4H58A 3CIKA 3R9DA 3VS1A 4EQCA 4O7WA 3QGWA 3MA6A 5DE2A 3GXLA 2GTMA 1PKDA 2GPHA 4KSQA 4CSVA 3QD4A 3QGYA 5HICA 5DMZA 5IQHA 4OT6A 4F7NA 4CLJA 4UWCA 5AUWA 5G1XA 1TQIA 3P7CA 3SOAA 2PZPA 1UKHA 3MJ1A 1GJOA 2BVAA 5KX8A 3Q3BA 2WQNA 1ND4A 2JDOA 4FIIA 3QUDA 5CEKA 4YJSA 1CKIA 4GT3A 4TWPA 2ZV8A 4G6OA 4EOQA 3IW8A 5IH4A 2C6DA 1TZDA 2UV2A 3DNEA 4TYJA 5T68A 1RJBA 3OWKA 4BCHA 2IJMA 2JDVA 3KK8A 3OBGA 4J1RA 4LL0A 2I0HA 2XYNA 4YPSA 2BRHA 2WMXA 4IADA 2CPKE 5EI2A 4FTLA 3WF5A 4A4LA 2NP8A 4CEGA 2XCKA 4UMUA 3F2AA 2FSOX 3O17A 3U4WA 4CKRA 3D7ZA 3LJ0A 4D9UA 1K3AA 1TQMA 3CCNA 4KA3A 5HVKA 3FMMA 3KCKA 2B9JA 4FVPA 3DGKA 4TYEA 1ZZLA 3NYNA 5LWNA 5DT0A 5IQFA 1H1PA 3KXHA 1V1KA 4EH3A 4U41A 4JIAA 3W2RA 3RPSA 2I6LA 2YJSA 3QC4A 4J95A 1PXLA 3CTHA 3GGFA 3MVMA 1YWVA 5LARA 3VHKA 5KMJA 2UZDA 2OWBA 4D2PA 1J1BA 2XB7A 5LMBA 4R3CA 3VNTA 4BCKA 5M06A 3SXSA 4IAIA 4C4IA 3V51A 3BQRA 4ZTMA 3ZLWA 4ZSJA 1H1SA 5FBOA 4R77A 1I09A 1MRUA 3FWQA 4IVBA 4JRNA 4KIOA 2RGPA 3H9OA 5EM5A 5AV0A 3ZM4A 2P2HA 5EDQA 2WFYA 5IDNA 4GG5A 3OMVA 4LOPA 5BQ0A 1VLRA 3R04A 3IG7A 3O8UA 3E8DA 3TACA 3TNPC 3W0QA 4DTBA 4K0YA 4CD0A 2JC6A 4O4FA 4FYNA 3WE4A 1BX6A 3EL8A 3E3PA 5AP4A 4D4YA 4HGEA 3IGOA 1Q3DA 4I0RA 5EW3A 1Z57A 2PK9A 4H3QA 4Q9ZA 4YTIA 4AE6A 3BYSA 5BYLA 5EKOA 5M08A 2Z7RA 4CFMA 4F1TA 4EH9A 3AKLA 3ZFYA 3MFSA 3W2CA 4CFVA 2GTNA 5DEYA 2C6TA 1ZAOA 3P1AA 5C8MA 3QWJA 4Y73A 1XBCA 2O3PA 4CMUA 4K6ZA 4BCJA 2WQOA 1H1RA 4FG7A 4UB7A 3VS5A 5FTGA 3OG7A 4FG9A 1PXJA 2C6OA 5JKGA 3FDNA 5EQEA 3IOPA 5EYDA 3FLZA 3IGGA 3JXWA 3R7OA 3ZXZA 4F7JA 5AFVA 4BL1A 3HX4A 4QNYA 3UPXA 3OOGA 3VJNA 1JKTA 1DI9A 5D9HA 1YI6A 4YZBA 4DH8A 5HU3A 4O96A 4WO5A 3RKBA 2R0IA 3PZEA 2UVZA 3HMPA 4IC8A 5HE1A 4D4RA 4KD1A 3SA0A 2H6DA 2CCIA 4RGJA 5C9CA 4AX8A 5C8NA 3KB7A 3ODZX 5AP0A 4AACA 5HQ0A 4AN2A 5DFPA 5M51A 2XNMA 3MY0A 5HLNA 3FI2A 3NEWA 2YM4A 4BCMA 4IDVA 4I6QA 4YJQA 5KE0A 3DAKA 3CGOA 1SNXA 3GFWA 3LHJA 4FKVA 2WXVA 4OTWA 5BYZA 4UYAA 3V5LA 1G8AA 3KIOC 5IQDA 5E91A 1OGUA 3L8XA 1YXUA 2G01A 3I1AA 4XRJA 3R7EA 5HD4A 3A2CA 3IK3A 4HYSA 2OZAB 1Q4LA 2R7IA 1YXTA 4R8QA 4B6LA 5JFXA 3HVCA 4WG3A 4YLJA 4MH7A 4OBOA 4ZXTA 4BZNA 4MBLA 4IAZA 4PRJA 2YA9A 1FPUA 3DOGA 4CQGA 5DRBA 1OB3A 4PUZA 2GCDA 2W1FA 3OCBA 3QQUA 4BCPA 5KCVA 3HV4A 5LVMA 3PYYA 1PXKA 5CI7A 4BDFA 1FOTA 1OVEA 3LLTA 3MPAA 3EQFA 1VYWA 2X0PA 3UP7A 1WBOA 5EM8A 3QTXA 2WMSA 3ZH8A 3LMGA 4UYNA 5K5NA 4BR3A 3A60A 4XP3A 4QMOA 3PJ8A 4NTSA 5ETFA 2CLXA 2YLFA 4QMTA 2JBOA 2PPQA 2HK5A 4KBKA 3PJ2A 3VBWA 3O71A 4XG8A 4IXPA 4HGTA 4PTGA 5DGZA 3GP0A 3VUKA 3PUFC 3MH0A 4XCUA 4YLKA 4D1XA 5HIEA 3S2PA 2YEXA 3S0OA 2KTYA 5D11A 2WMBA 4H3BA 3NYOA 4GUBA 4NCTA 4MF0A 5BVNA 2PMOX 2UW3A 1OIYA 3MDYA 5CEPA 3FAAA 3PG1A 1JBPE 4CT1A 1UU7A 1G3NA 3QCSA 1R0PA 4D0XA 3EYGA 4DC2A 3KREA 3OUKA 4F78A 3Q4UA 1NY3A 3DNDA 4S31A 3WOWA 4E4LA 4BCOA 2WU6A 3HL7A 5CSHA 4JAIA 2WMTA 3U6HA 4KIPA 4HCTA 1H1QA 2CGWA 1OL6A 3MA3A 2X8IA 3NDMA 2BRMA 3OCSA 4UMTA 3UGCA 4A9SA