3Q4ZA

Structure of unphosphorylated pak1 kinase domain
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
296
structure length
282
Chain Sequence
EEILEKLRIIVSVGDPKFEKIGQGASGTVYTAMDQEVAIRQMNLKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALEFLHSNQVIHRNIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNGTPELQNPEKLSAIFRDFLNRCLEMDVEKRGSAKELIQHQFLKIAKPLSSLTPLIAAAKEATKNNHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Serine/threonine-protein kinase PAK 1
publication title Structural insights into the autoactivation mechanism of p21-activated protein kinase
pubmed doi rcsb
source organism Homo sapiens
total genus 90
structure length 282
sequence length 296
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2010-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3q4zA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3q4zA01
4EH2A 3JR1A 5M4IA 5HCXA 2XKDA 3UC3A 3VS3A 3M2WA 4FEVA 2FUMA 1CKPA 5E8ZA 5A4QA 1IEPA 2UW9A 5EW9A 3D9VA 4A9UA 5A4TA 3T9TA 5IQDA 1F5QA 5IQAA 4F64A 2WNTA 4R3PA 2YCSA 4AN2A 4PL3A 5KHWA 3ZRLA 3PVWA 3ZUTA 4D58A 4LGGA 3AMBA 5E4HA 3R28A 3IKAA 3VF8A 3T3UA 4IX5A 4XS2A 2OF4A 4N6ZA 5A54A 2KTYA 4NFMA 2F4JA 4KKEA 2W4JA 1YOJA 2PUNA 3WYXA 2W5BA 5JFXA 3NUYA 2AUHA 4E4NA 5A9UA 1YWRA 1NA7A 3HV4A 3EFKA 5FEDA 2RIOA 2YCFA 2ZAZA 4M0YA 1J1BA 4XOZA 4BL1A 3GC8A 4BCNA 3MB7A 4XP3A 3BX5A 4ALVA 3D2KA 4I5PA 1Q8TA 4TWPA 5AAEA 4BN1A 1V0PA 5M51A 2ZVAA 3I60A 2OJJA 4BCMA 1H24A 5HBHA 3EZRA 4BC6A 1XO2B 4E7WA 5K4IA 4HCTA 3W2RA 2YN8A 3QXOA 4FKPA 2YM4A 5F4NA 5J7HA 2CHLA 3ZONA 2C30A 4AGUA 3C4WA 4RFMA 2X2MA 4TYGA 1O6LA 3A4PA 3WOWA 4MHAA 4KRDA 4BTJA 4JQ7A 4QP3A 1PF8A 2XKCA 3C4CA 2JIVA 5L2WA 1M7NA 2QHMA 2WU6A 4OGRA 4V0GA 4O21A 4DLJA 2XIRA 3ZU7A 2WMUA 3QD4A 2R3KA 4RIWA 2J2IB 4TY1A 4U97A 4NUSA 2E9OA 2RG6A 3R00A 5IU2A 4C4JA 2DYLA 3NW7A 4HNIA 2EUFB 4YHFA 3V8SA 4DN5A 4IWPA 4BCIA 3RMFA 2Y9QA 4QMWA 5E7RA 3D83A 2FGIA 4EOKA 2WHBA 5DMZA 5F94A 5M09A 2YM5A 3KXZA 4QMPA 1Q97A 4O0UA 3EQBA 3EHAA 1Z9XA 4W8DA 3U55A 2OJIA 1PW2A 3EFWA 4M69B 3W32A 5AA9A 4GG5A 4CFNA 3DLZA 3LFCA 2ZJWA 3LQ3A 3ZUVA 4QYGA 3WF7A 5AAFA 2VTMA 4H36A 5A4EA 4PF4A 4ZZOA 3DU8A 2CKQA 2C3KA 2WQMA 5IEYA 4U7ZA 4FTJA 2FSLX 3CCNA 5EM7A 3OXTA 3I4BA 1WBTA 3DFAA 3F7WA 4BCQA 1R39A 5AM6A 3UO4A 5JGAA 1W83A 2B9IA 3O71A 4DFYA 2OZAA 4CG8A 3NCGA 3TWJA 2GFSA 4FL3A 1PYEA 2O3PA 3TXOA 5K5XA 2W9FB 1KUTA 3KMUA 1PHKA 4MF0A 3RWQA 5DOSA 4TTHB 3MB6A 3DK3A 4H58A 4O7RA 4Q9ZA 4BGQA 3G9LX 4QD6A 3ZH8A 3A62A 3W8LA 5ETCA 4AA0A 2X7FA 2JKKA 3JY9A 1ZZ2A 5HX8A 2QOCA 3E8CA 4F0GA 3U4WA 2GNFA 2OF2A 2I7QA 3FXWA 5IQBA 4M67A 2B54A 4XH6A 3PP0A 3R8PA 4E6CA 1YDRE 1SNXA 1G3NA 3G33A 3DBFA 1XBBA 4M13A 3F66A 2Z02A 2XVDA 1PMUA 3V51A 2GS6A 3UIXA 5M44A 1U4DA 3K3IA 4IACA 4K1BA 2PVFA 1IA9A 3JVSA 1QMZA 2YZAA 4IZ5A 1W0XC 4WBOA 3PIZA 2P4IA 3BYSA 3DBEA 2CCHA 4R8QA 3WIKA 4HVDA 2GNGA 3COMA 3QC4A 3QRUA 4RJ8A 4TNDA 3SOCA 5DVRA 1YXSA 4QMLA 3R7YA 3F7ZA 3DLSA 3R73A 1IRKA 3H0ZA 4HGSA 1LEZA 5DR9A 2J0MB 3R9HA 3R1SA 3LCDA 4BI1A 3ZFXA 2CGXA 3RI1A 3LXNA 4O0TA 5DRDA 5BX0A 3LE6A 4I0TA 2IVVA 3JUHA 5CF5A 4EL9A 1JLUE 1HOWA 1ZOGA 2QC6A 2GNHA 5JSMA 2B9FA 5IQIA 4EI4A 1UNGA 4M14A 4TZRA 4FT3A 3KRJA 4LMNA 4QMSA 5AR3A 5IEVA 2EVAA 2GFCA 1BI7A 4X2FA 2ETMA 1DAYA 1QPDA 2CGVA 2IZTA 4IAKA 2WMXA 4YZBA 4BCJA 2UZDA 1BX6A 4PQNA 1AQ1A 4II5A 3GU5A 2W96B 3O17A 4YJUA 5TOZA 4MTAA 4BF2A 1NVRA 5K5NA 1W8CA 3LQ5A 1Y8GA 4EORA 3D0EA 2BRHA 4QPMA 5CTPA 3HVCA 3UVPA 3A7FA 3F82A 1PMNA 4L67A 5CU6A 4AACA 3GT8A 2ITOA 3HEGA 1B38A 4UMPA 5IPJA 3LFNA 1OBGA 4G6NA 2R3MA 3BI6A 2C69A 3HLLA 4JT3A 4ZTLA 4QMQA 2OU7A 1GZNA 4BTFA 2UZNA 3FI8A 1KE9A 3G5DA 3FLSA 4OTDA 3W2SA 4BYJA 2Z7RA 1JAMA 1WBNA 5HBJA 2CN5A 5AWMA 4IH8A 2C6LA 5AADA 3AMYA 2CCIA 4KNBA 3AD4A 4MBJA 5TF9A 4BDCA 3U51A 4USFA 4IB0A 4GW8A 5J79A 3F2RA 3VS7A 2VX3A 3ATTA 4EK4A 2W5HA 3DKGA 4UY9A 5LVOA 3IW6A 4R6VA 4CMUA 4MH7A 3TNHA 3DKCA 4K6ZA 3TKIA 3TUDA 2VO6A 4YLJA 5E8XA 3FL5A 4IX3A 3ET7A 5CSVA 5AP5A 5BNJA 1TQPA 3ZO2A 3P08A 2FO0A 4U41A 5J5SA 5DEYA 2VTHA 4GFMA 1GNGA 1OVEA 3UG1A 4F9WA 4IE9A 2JDVA 3U6IA 3N9XA 4U42A 2XRWA 2C6IA 3BRBA 3LJ1A 3FI4A 5E8TA 4AGDA 4F6SA 3DJ7A 1JKLA 5T3QA 3VS6A 1UU9A 2OXDA 3V5PA 4BDGA 3LVPA 4ACHA 2HYYA 5HCYA 5JN2A 3LJ2A 4GJ3A 2ZDTA 1OL7A 3I6WA 4GK2A 4M12A 4W4YA 3LM0A 5C9CA 3ZEPA 4DGNA 3ZFMA 4DH5A 4M84A 3QRTA 2WMVA 3DBQA 3R7GA 3VUIA 1NT2A 1Q3DA 4XX9A 4P4CA 5LVNA 1DM2A 4G3CA 3PG3A 4KD1A 2CLQA 3VS2A 3ZS5A 2EWAA 4D9TA 1H1QA 1M7QA 1UWHA 3BQCA 3WARA 3M1SA 4OAVB 3KA0A 4QMYA 1T46A 5HOAA 2CNUA 5IA4A 3ODYX 4QMUA 3C4XA 2XNPA 4GCJA 3D14A 4NW6A 3ZLYA 4FR4A 2X0GA 5FEEA 3GUBA 4PP7A 4HVHA 3SG8A 4E4XA 3FLNC 2J0LA 1YWNA 1ZY5A 3UIBA 4DTAA 3K5VA 2GNIA 4GMYA 3Q2JA 5DG5A 5C4LA 1Z57A 4GRBA 4RT7A 4DA5A 3HMOA 4CRSA 3R2BA 3GC9A 4XG7A 3WZKA 1M52A 4LV5A 2IG7A 2G2IA 3LFSA 4OTFA 2CN8A 3Q9WA 3OS3A 3U54A 4O7YA 2Y7JA 4MWHA 2R3FA 3BU6A 4NH1A 3BCEA 4FEQA 3QQUA 2BKZA 2HY0A 4ZLYA 4Y85A 2UW0A 4JQEA 4RZVA 3MA6A 5DFPA 4AS0A 2W06A 2PL0A 3ITZA 4DEBA 3NDMA 3LXPA 4HW7A 4C35A 5K9IA 2J90A 3MY0A 3MVHA 4YSMA 2PYWA 5CAVA 1YOMA 4I22A 3POOA 2NO3A 2XK3A 3DDPA 1WFCA 2Y6MA 4ZTNA 3GCVA 4A7CA 5AEPA 1YRPA 4Y72A 3FHIA 5IQHA 2R7IA 4G2FA 4FT7A 4ITJA 5K0KA 2C5VA 3KEXA 1G8SA 4E1ZA 4FTUA 3EQGA 4AW1A 5IH6A 3RNIA 4ZSEA 4FTRA 4ZY6A 2BDJA 1A9UA 1MRVA 3Q4ZA 4W4VA 4YC6A 3E63A 5FP5A 3QALE 2QOBA 4TWNA 1W98A 3F2NA 3NUPA 3I5NA 1Q61A 3H9RA 3Q6UA 2ZM3A 1H1RA 2BILB 5CEQA 2W9ZB 1UU8A 3OXZA 3L1SA 3WYYA 1BI8A 4NEUA 2W4KA 2OH0E 2WFYA 4KABA 2VTRA 2CSNA 4AT4A 4XP2A 5HTIA 3KULA 4CLJA 2F7EE 2YA9A 4GS6A 3Q2MA 4JBQA 4M3QA 3QA8A 3DGKA 2E9PA 3LMIA 2R0UA 3C0HA 2I0YA 4RZWA 1JKSA 3A7IA 4FVQA 4HJOA 3HV3A 2A0CX 1VZOA 3EQRA 2XK6A 4YHJA 3R9OA 4A4LA 4LI5A 5CAPA 1HCLA 4F7SA 4J71A 2J5FA 4PDPA 2C3IB 3IW7A 3VN9A 2EXEA 3KGAA 4M8TA 5IH4A 2C6KA 1JQHA 4YU2A 5CEKA 3UG2A 1WMKA 4N70A 4BCOA 4YLKA 3FEGA 4ZMEA 3KY2A 3SD0A 3ZXZA 3AT4A 3RGFA 3QTQA 3W2PA 3P7AA 1YKRA 3VWAA 3DXNA 4PV0A 3PXYA 4NZWB 2PVYA 5A3XA 4UWYA 3AMAA 4UX9A 4WD5A 4XJ0A 3QZIA 2XNEA 5H2UA 4CRLA 2JDSA 2WTCA 5E9EA 3OUNB 2GPHA 3FZRA 3C1XA 4FKJA 2WMQA 4S30A 3HRFA 2JBPA 4GKHA 5E92A 3BPRA 3PWDA 4USEA 3ZDIA 4M7IA 2C0OA 4IJ9A 4BCFA 3TUCA 1DI9A 4FIHA 3NS9A 3EYHA 4CYIA 4BDKA 2UV2A 4RFZA 4O7NA 3I7BA 4GG7A 1RE8A 1TVOA 4GK4A 4K0YA 5A6OA 3HDNA 4WIHA 4ANBA 1PMEA 5CEOA 4PMMA 3W2QA 3UQFA 4AZFA 4C4HA 5FXRA 2YCRA 2YDJA 3K5UA 2PMOX 3FPQA 2OSCA 2YFXA 4FKUA 4KRCA 3HMIA 4F63A 1UNLA 2DS1A 5DPVA 1Q41A 4CZUA 1BMKA 4FMQA 2NRUA 3SV0A 2VWZA 2W1EA 4GT3A 2A1AB 3BIZA 5DE2A 3RAIA 2YWPA 3M11A 3RVGA 4FA2A 3RZFA 2GHLA 3D4QA 4HYIA 3R04A 4HVGA 3R01A 3FMEA 1PKDA 1P5EA 1BLXA 2C68A 3NIEA 3C5IA 3TI1A 3S2PA 3UPXA 5HX6A 2W4OA 3UNZA 4RX7A 2HENA 4BDJA 5C8NA 4AGWA 4QMMA 3V5QA 3MTFA 3RJCA 2WTJA 5LMKA 4E73A 4D2PA 4G3FA 4EC9A 1FGIA 3E3PA 2WKMA 4AW0A 3HMNA 5J95A 4FE2A 2PK9A 5GZ8A 3VS0A 4S31A 4O6EA 3NSZA 2CJMA 4IX4A 4JOAA 4RRVA 4YJQA 3OT3A 4MNEB 4D2VA 5HD4A 3SGCA 4NIFB 4RIYA 4ASDA 1JNKA 1LEWA 2RKUA 4DH7A 3PXKA 4QYYA 3D5VA 1CSNA 5CT0A 4ACGA 2XCKA 4MD9E 2VWBA 3N4VA 5CAOA 5EYCA 2AC5A 2WMTA 5CZHA 2R5TA 1I44A 4IVAA 3KN5A 4IAAA 4WBBB 5HE0A 3UQCA 4O7ZA 3GGFA 1J7IA 4X0MA 4Y5HA 5CANA 4R7IA 4PDYA 4IB1A 3OWLA 4CGAA 1W84A 4QP9A 3FQSA 3EN7A 5D7VA 3ZDUA 5CVHA 5LJJA 4LYNA 3C4FA 3AXWA 2OJ9A 2QVSE 3PPJA 4K18A 5HESA 5L8LA 1OIRA 2WTKC 1VR2A 2PUPA 5E8WA 4EUTA 3REPA 5A4CA 5CT7A 3LCSA 4GFOA 3OCBA 4FTKA 3PVBA 5C8MA 3Q4TA 4MCVA 2HXQA 2WIHA 4N0SA 5A46A 2NNWB 3V6SA 2BHEA 4XLIA 3FI3A 4G34A 3I79A 3HGKA 3RCJA 4FSTA 3RAKA 2G01A 4C36A 4YZCA 5EHLA 4KIQA 4I94A 4ITIA 1YOLA 4ACDA 3BBWA 1OITA 4ERWA 4MX9A 3GENA 4DGLC 3VHKA 3IPHA 1IAHA 1CKIA 4OTHA 3F61A 4A4OA 4YZNA 1ZYJA 1U5QA 3E3BX 3QQHA 2YIXA 3CLYA 4BI0A 3D5UA 4FTNA 3LMHA 5IG1A 3MVLA 3UYSA 4EQMA 4JAJA 3W8QA 1XBAA 4EEVA 4JDJA 2J5EA 4RA5A 4BKZA 2XNBA 3IW5A 3QKLA 4HCUA 4D2SA 5IF1A 1QPCA 3MV5A 2QG7A 5ACBC 2XJ0A 1UWJA 4FSZA 3BV2A 4YTFA 3FQEA 4CKRA 2OH4A 5EOLA 2IVUA 2KULA 3E5AA 2Z7QA 3QX2A 3HUCA 3V04A 5EI2A 3WZJA 1GIHA 4NYEA 4C62A 4D2WA 2C6TA 5LMKC 4IQ6A 2C0TA 3L9NA 3TNPC 3G6HA 4UXQA 3AC3A 4P5ZA 4XG2A 3UZRA 3IG7A 2YM8A 3BYOA 3Q4UA 2LAVA 4ENXA 5KHXA 4FTOA 4EBWA 3CY2A 2X4FA 4J98A 5L2IA 4O0YA 4OT5A 1QL6A 5FWKK 4DT8A 4BCGA 3E7OA 1LUFA 2QLUA 4IWQA 4CD0A 2QKWB 4YMJA 3WF6A 2QD9A 3HL7A 4AQCA 2I6LA 4ZSAA 1YHWA 1XH4A 3HUBA 2PVKA 4GIIA 4YTHA 5KMIA 2W5AA 5J9LA 4O81A 3EFJA 3OOMA 4CXAA 3EN9A 4C4FA 3CIKA 3Q5ZA 3FBVA 4PUZA 3FJQE 2QU5A 2Z7LA 3MSSA 3VC4A 4DEEA 4Z16A 2O8YA 3DKOA 3LM5A 4EHVA 3VULA 2WQBA 3OTVA 5ANEA 4EC8A 1SZMA 3NZ0A 3QU0A 1Q4LA 5D11A 1KE5A 2W17A 4J7BA 4U8ZA 4GEOA 2YIYA 3VS4A 4NWMA 4DE4A 4IVCA 2XM9A 3W55A 3ZEWA 4JVGA 3DKFA 3RWPA 5HO6A 4YZDA 2VO0A 3VUKA 3ENHA 5J5TA 3KC3A 4B6LA 5FDPA 3FWQA 3MH2A 4ANOA 4LV8A 5HIDA 4ASXA 5HNBA 4E4MA 3CXWA 4F6UA 1STCE 2C1BA 1JVPP 3FZTA 5KUPA 4F9BA 3GQLA 4X2KA 3LFAA 2ETKA 3FHRA 3OROA 2R3GA 2Y6OA 4OLIA 3C0GA 3LIJA 1UV5A 2F57A 4I6QA 4LRJA 3CQWA 3O50A 4BIEA 3BE9A 4X21A 5HE2A 1H28A 5D10A 2BCJA 4ASZA 3VIDA 1NVSA 2P0CA 3VBXA 3C9WA 3FZPA 5M08A 2CKEA 2Y4PA 5EI8A 4DH1A 3COKA 5H9BA 3AC4A 3OOGA 2NRYA 4AA4A 5M07A 5LWMA 1OL5A 2XNGA 4G5JA 4FEXA 4MNFA 3PG1A 5C4KA 2OGVA 3U6HA 3CY3A 4RFYA 3R9NA 2ETRA 3C7QA 4KSQA 4Q9SA 3EN4A 3H0YA 4RBLA 3UZPA 3PJ2A 4D55A 1KOBA 5D1JA 3VAPA 4E93A 3DAEA 3FSKA 4WNOA 4G5PA 1YDTE 4JX7A 4FV2A 3RK9A 1Y57A 4F9CA 2VTNA 4O7TA 3TEIA 4L9IA 5K3YA 2OFVA 4PL5A 4Q2AA 1YQJA 2YHVA 3UVQA 4DFZE 4YR8A 1H26A 4DT9A 4RC3A 1S9JA 3POZA 4TYHA 3U8WA 2HW7A 4AA5A 1S9IA 4BDAA 4X7QA 5M4CA 3IGGA 5L4QA 4MYGA 2WGJA 2VNWA 4LL5A 2JKOA 3VVHA 2IWIA 1Z5MA 4FUYA 4AZSA 3FLQA 5JEBA 4YNEA 2C3JA 3PIXA 4G9RA 4V0GB 3ZCLA 4U5JA 1GIIA 3NUUA 4XUFA 2CLXA 5IUHA 1SVEA 3EN6A 4KBCA 5KMLA 3UOJA 3FMJA 5IUIA 1IR3A 3RZBA 2BFXA 3QYWA 5CNNA 1Q99A 2ZDUA 4EOSA 1GZOA 5AX9A 4AXAA 4BWXA 4F7NA 4PNIA 5BUEA 3P4KA 3RPSA 3SC1A 3FZSA 2I40A 3R8LA 2WQEA 3RHKA 2X1NA 3UBDA 3IQ7A 4NT4A 4PPAA 3IONA 3KKVA 5HCZA 3L9MA 2HK5A 3H10A 3PY3A 2WELA 4FKOA 2VO7A 3UTOA 5HLWA 4KKGA 5DBXA 3NW5A 4C7TA 3I0QA 4LFIA 4G17A 4K9YA 5G1XA 2FSTX 3ZHPC 2BUJA 4BDDA 1WVYA 1ZYSA 5AUVA 4BWKA 4ALUA 4JG8A 4O0XA 4ACMA 3UNKA 1JPAA 2OBJA 1OKYA 3ZBXA 4C61A 4QP6A 2OZAB 2AYPA 1SVGA 3UC4A 2YZLA 3LPBA 5GINE 3GVUA 1OL2A 2ITQA 3MI9A 2WOUA 3PSBA 2ESMA 4PP9A 5AR4A 2HZ4A 2VWVA 5L6PA 3RM6A 3NUXA 3NVMB 1IG1A 1PXOA 4BKJA 4RWJA 2V55A 1ZXEA 2JAMA 4C02A 1UA2A 1ZAOA 2QONA 3PY1A 4C3FA 5L8JA 3TCPA 4C57A 4IM2A 1ZZLA 3FMKA 5CWZA 3ZO3A 3Q60A 3P7BA 4A07A 3NYOA 4I0RA 1Q8YA 3RHXA 3F9NA 2QOKA 2VTLA 2PSQA 4CFUA 3SDJA 5CAUA 3GEQA 5HG5A 4H3PA 4R77A 3C0IA 5HD7A 4TRLA 4ANSA 4NL0A 2VGOA 3TDVA 3R02A 4FVRA 3AT3A 4Z9LA 4ZTMA 2ZMDA 4BDIA 3N51A 5B2LA 5EOBA 2UW3A 3UMWA 3FSFA 2HY81 4DCEA 5KBQA 3VRZA 4EHZA 4FL1A 2QO7A 3R8ZA 4FZ7A 2BRMA 3RM7A 5CSHA 3AC8A 4HZSA 2ITPA 3ACJA 3CS9A 2WXVA 4ZJIA 3UVRA 4FV6A 3PA4A 4R1YA 2PVLA 5IA1A 3TV7A 3DNDA 3R7UA 2BZHB 2OFUA 3EIDA 4I1ZA 5BVKA 3RKBA 2XKEA 4IANA 4JXFA 4ANLA 2ERKA 5HI2A 4L53A 3CGOA 2QI8A 2BRBA 4EONA 3PXFA 3EN5A 3BZ3A 1NY3A 3NYVA 4DEDA 4ZLOA 2PWLA 5KZ0A 4U0IA 3ID6C 1YI3A 5AJQA 5JZNA 3VBVA 3GB2A 3GCPA 3MPAA 4XLVA 4MXYA 5F1ZA 4D1XA 5JK3A 4L3PA 3VBYA 3UOKA 3KRXA 1A06A 3MWUA 3QUDA 3G0EA 2GQGA 3DV3A 4GT5A 4LQMA 2IPXA 4DTBA 5LXMA 4FSUA 3ZYAA 4BBFA 3TJDA 4BZDA 4KKHA 5CF6A 4GSBA 4MXOA 4P7EA 4D4VA 4ZAUA 3QUPA 5CASA 3EOCA 5J7BA 4FGBA 3PA5A 2IVTA 5CI6A 1YDSE 2A19B 5TKDA 1PKGA 1I09A 4C8BA 2HXLA 4ZJJA 3ZZEA 3IOPA 4KWPA 5IQEA 3MH1A 3QRIA 2XNNA 3BLQA 3O2MA 5HORA 2FA2A 2C6EA 2YWVA 3TV6A 4JJRA 1ZYLA 3V6RA 2PHKA 5C8KA 4RLKA 4EZ7A 1IASA 4ORKA 4M69A 4L42A 4RJ4A 5H3QA 5FUTA 2VN9A 3KK9A 4J52A 3F3UA 2R3HA 5DI1A 4XOYA 4JDIA 4USDA 2YAAA 4WG5A 1YI6A 3MESA 2V7AA 1YXTA 3BEGA 3NRMA 3MTLA 3BHTA 3AQVA 4YBKA 3FMMA 5B2KA 4ZTRA 2Y4IC 5TE0A 5J9YA 3FY0A 4NU1A 4TYEA 4FZAB 2NPQA 5EI6A 4AZEA 1F3MC 3U9CA 4ZTQA 4L43A 1JKTA 2B7AA 4MXZA 4HNFA 3EFLA 3GOPA 4XG4A 3A61A 3II5A 3ORXA 4WHZA 4HGEA 3AGLA 4G3EA 1GZ8A 2WOTA 4MK0A 4X2JA 4EOLA 4NK9A 3UOLA 4L7FA 3Q5IA 3RPRA 4MD7E 5LVPA 3IW8A 1KV2A 2QQ7A 4FIIA 3DTCA 1NVQA 4MEDA 3Q04A 4IAZA 4C38A 1K3AA 4AOTA 5GNKA 3F5PA 4MQ2A 4GL9A 4DBNA 1MP8A 3CD3A 4QPAA 3B8RA 4JIKA 3R0TA 4IAFA 4U44A 1OBDA 1K2PA 1X8BA 3A7HA 2PUUA 3LMGA 4R78A 5JQ8A 4RVTA 4A9YA 3SVVA 2Z60A 1ZMWA 2PVJA 2X9FA 4GVAA 3GCUA 4QMXA 4QTDA 4TYIA 3ZBFA 3A7GA 5DRBA 4PPCA 3BE2A 4NTSA 2O63A 1FBNA 2XNOA 3HA8A 3OCTA 3CQUA 4UYAA 1YHVA 2FSOX 3HRCA 4J96A 4IHPA 4O96A 3BYVA 5IA0A 1FMKA 5EM8A 4EHGA 3BKBA 4P2KA 2YLFA 3CQEA 3GCSA 2VTOA 3FL4A 2XIKA 4P90A 4FEUA 3V5LA 2WTDA 4YO4A 3TZ7A 5HKMA 3DOGA 3OMVA 3GCQA 4GV1A 1OL1A 4IM3A 5C03A 4E8AA 1FVVA 2QOOA 3A4OX 3ZM4A 1BL7A 3R71A 3L8XA 4RVKA 3E93A 3ZSIA 1B39A 2YABA 1Y6AA 2R3JA 3PJ1A 1WAKA 4XG8A 3R63A 1FINA 1XQZA 2P2HA 1H1WA 2YM3A 5KZIA 4FKTA 4RJ7A 2I1MA 3NYNA 2I0VA 4AT5A 4Y95A 1H1PA 3I81A 4UMRA 5EYDA 2ITVA 1Q24A 3E87A 4AZWA 3N4UA 4MBLA 3FKLA 2ITYA 2REIA 4YTCA 2GHMA 1YI4A 2J0IA 4H1MA 3UIMA 2WMBA 4RJ5A 3SAYA 4QTEA 2OIQA 4QMTA 5CY3A 3JPVA 3ANRA 4EH5A 2CGUA 2XYUA 3L9LA 4L52A 3VF9A 4HYSA 1U54A 5HO7A 5KKRC 3KULB 5DH3A 4DG2E 5CSXA 5HVKA 4HZRA 3R83A 4QOXA 3HV6A 1GAGA 3PE2A 2OW3A 2WMWA 3H30A 4FNYA 4FV0A 4M66A 5DWRA 4BI2A 3F5GA 3GU8A 5HLPA 2BDWA 2QNJA 1JBPE 2J0KA 3O0GA 4FZDB 4G16A 5FG8A 3QD3A 4CCUA 1JSUA 3BELA 3NNWA 2PVNA 4R5SA 2F7XE 2R3RA 3O7LD 4DINA 4D1SA 2X8IA 3K2LA 3KF7A 4KSPA 4RIXA 3RK7A 3WF8A 2UVZA 3GOKA 3PJCA 3MPMA 3VUDA 4G6OA 3MY5A 3OCSA 4DEIA 3WF5A 4FKSA 4YHTA 3Q9XA 3FLWA 3R21A 4DGGA 4FTLA 5IDPA 3QAME 3PSCA 4MVFA 3A7JA 3KU2A 3QZHA 2WU7A 4CKIA 4NFNA 4FV8A 2HOGA 3F5UA 4F6WA 4JG6A 3HAMA 3KXGA 4BKYA 4YNOA 1OKVA 2QO2A 2WTKB 4LL0A 3L8VA 4QQ5A 3SRVA 5EKNA 1ZRZA 2EXCX 3FUPA 3QTZA 5GZ9A 1K9AA 1QPEA 2Y8OA 3NNUA 4PMTA 2OJFE 2W1ZA 4OAUC 4ZMFA 4KS8A 4KAOA 2OXXA 3QTXA 4DH3A 4AUAA 2XMYA 5LWNA 3ULZA 4IM0A 4ONAA 4YZ9A 3R7IA 5I9WA 2BZJA 4HPTE 3PYYA 5A14A 1GOLA 2WTWA 3P23A 5M55A 2E9UA 4KIPA 3RK5A 4O0RA 4FC0A 3F3TA 4IEBA 2ZV8A 3EMGA 4YJOA 5F20A 2QG5A 4M97A 2H8HA 4IVDA 4X6RA 3UJGA 2ITNA 3KK8A 5CX9A 4GUBA 2G9XA 4OTIA 2ONLA 3S3IA 4D9UA 4BGHA 1RDQE 3P9JA 4C4GA 3KXHA 3EKNA 5AA8A 5FGKA 4IW0A 4BRXA 1OIUA 2OWBA 3QQLA 4QYHA 5LVLA 4BCKA 3C50A 4J99A 5H8EA 5M56A 3FMNA 2ACXA 2B1PA 5FLFA 3R8UA 4FICA 2QO9A 3PPKA 5IISA 4MXCA 5D12A 4AN3A 5L6OA 3Q52A 3E64A 5TO8A 4EYMA 4U40A 5K4JA 4FG9A 2PZIA 2QOFA 2GQSA 4FIEA 3MYGA 3FY2A 3O51A 4W9WA 4W9XA 4KBKA 4HOKA 1MRYA 3OFMA 1H1SA 2X7GA 4PTEA 4F1MA 2PY3A 3BHYA 4QP4A 5AM7A 2UZOA 3TNQB 3FKOA 2GNJA 4CFVA 1PXLA 4WUAA 4F9AA 4U45A 4L01A 4AFJA 3O8TA 5IMXA 3D5XA 3UMXA 1YXVA 3BLRA 3PVGA 2CDZA 5KMOA 2XM8A 4QYEA 4C37A 4FT0A 5B7VA 2FH9A 4M15A 4BDHA 4YP8A 3MFUA 4C2VA 1XH9A 5AV1A 2IVSA 3R9DA 4TW9A 3W33A 3OD6X 4EQCA 4F08A 2JIIA 1W7HA 3UYTA 3Q32A 4R1VA 2GNLA 4TYJA 5EH0A 3BYMA 4DH8A 4LUDA 4CSVA 5ETAA 3SQQA 4I4EA 4RX9A 1KE7A 5AP1A 2BIKB 2HAKA 3HECA 3DS6A 3MH3A 4FKRA 4TPTA 5CXZA 3U87A 4BBEA 4FUXA 3NUNA 4WA9A 3E8NA 3CJFA 4CMOA 4D2RA 5KNJA 5T68A 4CEGA 4DAWA 4L6QA 3PJ8A 4RX5A 5CSWA 3VBWA 2BZKB 1CM8A 2FSMX 5CYIA 1PXMA 4ZJVA 5EQEA 5BVFA 4BICA 1OMWA 3ROYA 5I9YA 2R2PA 1XH8A 3DJ6A 2UZEA 2WMAA 4I21A 4WNMA 1PMVA 4FKGA 4C33A 2E9NA 2HCKA 4C4EA 3DY7A 2CMWA 3EQHA 3PUPA 4FSQA 2UUEA 2XJ1A 4D2TA 4R3RA 4PY1A 2V5QA 1OB3A 1XKKA 1OIQA 2J4ZA 4KIKB 4FKWA 4CKJA 3S95A 4K11A 5HG9A 4FV9A 3VO3A 3QTWA 4ASEA 4EHEA 2RL5A 4EJNA 4UEUA 2CKPA 3NWWA 3LZBA 3S4QA 5AR7A 3UE4A 4F09A 1OUYA 2BMCA 4NM0A 3OF0A 4FKVA 4RPVA 2H96A 2GTMA 2ONLC 3CJGA 4U6RA 3QLFA 4F70A 1OUKA 3ULIA 4G1WA 1XH6A 3WBLA 3LFBA 4CCBA 1XJDA 2WMRA 1FGKA 3R9RA 2W1CA 4L3JA 3GFEA 5FM2A 3ATSA 1WBWA 3QWKA 2VX1A 4G31A 5DYJA 4V05A 3KXNA 4RWIA 5EQYA 4E6AA 5C1QB 3EL7A 4BY9E 4ZOGA 3FV8A 3GNIB 4OTRA 2VWWA 5CENA 2XKFA 3ZXTA 3EQDA 5H8GA 3TKHA 1ZWSA 4LGDA 3DBCA 5BYYA 3BGQA 1J91A 4HYHA 4S33A 3QA0A 5AV2A 5FXQA 4ZS4A 3ZUUA 3AOXA 1KE8A 1GJOA 2VNYA 1U5RA 3HRBA 3RAWA 2HZIA 3KL8A 1UNHA 4I0SA 1YVJA 2UVXA 2P3GX 4K77A 5E8SA 3BGPA 4G3DA 3MH0A 3OT8A 2GQRA 1BUHA 4NM3A 2OKRA 4GYGA 4JR7A 5CF4A 4XMOA 3P78A 5CXHA 5FTQA 4BHNA 3CGFA 5AP4A 2BPMA 3H9FA 4IX6A 4RJ6A 1G5SA 3NGAA 3GU4A 3HKOA 3P5KA 3E7VA 4D0XA 4BZNA 5IQFA 3W2CA 3FYKX 3COIA 2QODA 3MFTA 4F0FA 3PXZA 3FPMA 3KF4A 3KXXA 2RSVA 1SYKA 1R1WA 5M06A 3SA0A 3SOAA 3PY0A 2HZNA 4IWOA 3QTIA 4E20A 3FZ1A 3GU6A 2OI4X 5HNGA 5I0BA 4HPUE 4PWNA 3KCFA 1Q8ZA 5AUYA 4MD8E 1V1KA 2Z7SA 1SM2A 2VTQA 3HP5A 3MFRA 1RW8A 4J8NA 4O0WA 3W18A 4CLIA 4EZ3A 4ZLZA 4UXLA 3JS2A 4R7HA 4A4XA 4RC2A 4WG3A 5I9ZA 5IQCA 3OWPA 3U9NA 4FYNA 4CTBA 4RGJA 2ITTA 4L45A 4F65A 3V8WA 3FMDA 2VZ6A 1E1VA 4IFCA 3QKMA 2QOLA 2UW4A 4FKLA 3QKKA 2JGZA 4QTAA 2C5XA 2GTNA 4FNXA 4D4SA 4F99A 3HMMA 4EK8A 2OXYA 4CG9A 2R0IA 1OPJA 4IB3A 3ODZX 4LOPA 5GJDA 3HYHA 4QMOA 2OLCA 3UIUA 3ORTA 4WUNA 5EQPA 1QPJA 3IW4A 3QC9A 1OECA 1REKA 3FYJX 2QCSA 5FXSA 5LQFA 4LRMA 4FBXA 4YTIA 2YEXA 3JY0A 4O27B 3V3VA 2UZLA 3A2CA 3QGWA 5A6NA 5L8KA 2PVHA 2BIYA 4AZTA 1XH5A 3FLYA 5BMMA 4WOVA 1P4OA 4E26A 1O9UA 3TG1A 5KMMA 4FV4A 3S1HA 2JAVA 3OEFX 2WQOA 3SHEA 3TZ9A 5I9VA 2QKRA 4HGLA 5EM5A 4F7JA 1H08A 3VJOA 2VAGA 5D41A 1M17A 2V62A 2X7OA 4EZ5A 3LFFA 1L3RE 2EXMA 4J95A 3NCZA 4BDBA 3QFVA 3VQHA 3V01A 4KUJA 4O83A 3T9IA 3AT2A 2XBAA 4X6QC 4AU8A 1UKIA 2JIUA 4LUEA 3NLBA 4FIJA 1R78A 2AC3A 3D2IA 3LXKA 4LG4A 3W16A 2Q83A 4EK6A 3KMWA 4JBPA 1BKXA 3UQGA 2IZUA 3WE8A 5HQ0A 2R3QA 4C2WA 3I5ZA 4JR3A 5DR2A 1ND4A 2ZM4A 4K33A 5LVMA 1O6KA 4CFWA 1VEBA 2BFYA 1WZYA 3G6GA 5DIAA 4EOQA 3MFSA 3OWJA 1XHAA 4HVSA 2XB7A 4QQJA 2C0IA 1H25A 3PA3A 3DDQA 2DWBA 5JT2A 2W7XA 3WILA 3KRWA 3BWFA 3DPKA 4GUEA 3I6UA 5HTBA 2O0UA 2ZV2A 5E91A 2XUUA 2V0DA 4TYHB 5BVOA 3EJ1A 5HLNA 1Q8WA 3DQWA 4FI1A 4WNKA 4EOIA 2Z2WA 3IDCA 2JFMA 5EW8A 1WBSA 4GH2A 5BUJA 3VUMA 1FQ1B 3E62A 3RPYA 2RGPA 2H34A 3P86A 4L44A 1ZMVA 4PL4A 4C34A 3UZTA 4EOJA 4BYIA 3DZQA 2XH5A 4YSJA 4PTGA 4Z7HA 2GHGA 4YJSA 5I4NA 3E8EA 1W82A 2XA4A 3PE1A 3UDBA 2HZ0A 3GBZA 4B99A 5KO1A 4YBJA 4DFBA 3BGZA 4Q5EA 4H3QA 2A4LA 3OTUA 5CEPA 2J6MA 4DG0E 1AD5A 5ANOA 4LM5A 3G9NA 2VV9A 1OKZA 2F7ZE 3ORPA 1BYGA 4TN6A 1R3CA 3JXWA 3O7LB 4OBPA 2C5OA 4FTQA 2BR1A 5BYLA 2G1TA 2W1DA 4J8MA 3EKKA 3EL8A 5T6KA 3QD0A 4L00A 4EH3A 3C5UA 3THBA 4EQUA 5DT3A 4EUUA 2OK1A 3PWYA 1CMKE 3RPVA 2X4ZA 4W8EA 1PXIA 4AP7A 4I93A 3OW4A 4O38A 1DI8A 3MBLA 3E8DA 3QTRA 4X3JA 4E6QA 5IMEA 4TT7A 4FV7A 5CI7A 4CMTA 2J0JA 3GU7A 1OKWA 4O7LA 4FOCA 2RFSA 5GIPE 4EWHA 3QZFA 4I5MA 5JFSA 2RF9A 2QU6A 1SVHA 3MGYA 2QOQA 3DXQA 4XYFA 1PXJA 4I6FA 3VW8A 3CBLA 5E8VA 5K0XA 4Y83A 2XBJA 4G3GA 5J1WA 4U80A 3ZZWA 4EK5A 3Q96A 4FNWA 4RIWB 5B2MA 4PMSA 3CPBA 4OW8A 4WNPA 2Q0BA 2WPAA 3H4JA 3OBJA 3OVVA 3PP1A 4I23A 3KB7A 4RIOA 2IJMA 3DQXA 4UV0A 5EK7A 4ZSJA 2X8DA 4X2GA 3R1NA 2PULA 1E9HA 3BBTB 1Y8YA 3ZM9A 4QP7A 4ZS0A 3V5JA 2F2CB 3V5WA 4D28A 3A60A 2X8EA 4I92A 4BDEA 3CPCA 4H39A 2Y4IB 4XBRA 3W2OA 2YACA 3QL8A 3BEAA 4I4FA 1VYZA 3MA3A 4PDSA 3HNGA 4PX6A 2UW7A 4ZZMA 4N6YA 4RVLA 5ITAA 3OP5A 1U59A 3HV7A 5CVFA 4Y8DA 3ZLWA 2YDIA 4FVPA 5DGZA 3VS1A 4AG8A 5HTCA 3FE3A 4DTKA 5I9XA 5HVYA 2ZB1A 2WZJA 3DBDA 4AZVA 2CGWA 4CFXA 1PXPA 5GJGA 3D7TA 5AR8A 4U43A 3O23A 4AE6A 1B6CB 4CZYB 5E8UA 3DJ5A 4C0TA 3OHTA 2DQ7X 5CVGA 5HU9A 4L68A 3ORNA 4EBVA 2YJSA 2HW6A 4FZFB 3P0MA 3V5TA 3TZMA 5AIRA 4CVAA 3RALA 1ZYDA 1Q62A 2X9EA 5KCVA 4L46A 2VX0A 4Y73A 5FP6A 5LMAA 4CQGA 4ZZNA 2W99B 3R22A 3NIZA 3O8PA 4W4XA 3E92A 1GY3A 2VRXA 3PLAE 3I0OA 4U79A 4H1JA 2DUVA 4F1TA 4IAYA 2C6DA 4X3FA 5HHWA 2IZSA 5JH6A 2B53A 2YIWA 3SXFA 2XRUA 2PMNX 2ITWA 3OC1A 4OTWA 4WO5A 4S32A 5AV3A 3WZDA 2BAQA 3NNVA 4YJPA 5FD2A 5HZNA 4BDFA 2UZWE 4CV9A 3F3ZA 1OPLA 1KWPA 2H6DA 1KV1A 4O0VA 2SRCA 2WEIA 5ANKA 5JQ5A 2BKKA 2XEZA 2LGCA 1FPUA 3KVWA 2HIWA 2X2KA 2ZOQA 4I20A 4XV2A 5HNIX 2FB8A 3PSDA 4BTMA 2VWYA 5AX3A 3QHRA 2VTJA 4DEHA 4ZSLA 3S0OA 2NP8A 5DEWA 5AUUA 3IECA 5J87A 5AIKA 2R7BA 5LOHA 4YGAA 3GP0A 4G9CA 4AW2A 3QLGA 4BBMA 3EB0A 1DAWA 2PZPA 3EZVA 2PU8A 3KCKA 4DC2A 4RWLA 3TACA 1J3HA 5ANIA 2O64A 5ANJA 3R1YA 4MXXA 2V22A 3TJCA 4WSYA 4AX8A 3H3CA 3L8PA 3LFDA 4Y5QA 2PMLX 4ZIMA 3SG9A 4D4YA 3TTJA 1FOTA 2HWOA 2CNQA 4LRKA 4QP2A 4I5CA 3ORIA 3PLSA 1M14A 3IGOA 4HGTA 5EDRA 4DFNA 5KKRB 4A06A 3A99A 4RWKA 3U6JA 4DCAA 2IW8A 4C59A 3AD6A 3F3VA 5DHJA 5EYMA 5CAQA 4JLCA 3OXIA 3WIGA 5IUGA 3FZOA 3K3JA 5I3OA 4ZY5A 5ANGA 3ORLA 3SX9A 4QT1A 5G6VA 3KXMA 4FL2A 2GS7A 5E8YA 3TNIA 3VNTA 4MBIA 2F49A 4XCUA 3C4EA 3TDWA 2C5YA 4TWOA 3U4UA 1E1XA 2PVMA 4EOMA 3P7CA 3F6XA 2ITXA 3M42A 5EDQA 2OICA 3MY1A 5KE0A 1M2RA 2ZB0A 4GJ2A 4JAIA 4XRLA 3TZ8A 3WE4A 4EH6A 1FVRA 3LLAA 4KS7A 4C3RA 4J53A 4Z3VA 4BR3A 2P2IA 2R3PA 4O0SA 4OBOA 4RSSA 5AP2A 5AUZA 5J1VA 1JSVA 2C4GA 5HGIA 5CU2A 4A9TA 3JVRA 1XR1A 3V8TA 1Q5KA 1OI9A 3MW1A 4GKIA 3CEKA 2OZOA 2XS0A 4AAAA 4B7TA 4MAOA 1JOWB 4QTBA 4UZDA 4I24A 4LOOA 5L6WL 5C26A 4JRNA 5IQGA 1PY5A 4CFFA 2XIXA 4NM7A 4QO9A 4FG8A 3FI2A 4GU9A 4X3FC 4O1PA 5GZAA 3OZ6A 4IBMA 4XRJA 4F9YA 4QYFA 3EQIA 5A4LA 2IN6A 2R3OA 3ACKA 3O96A 5HICA 4BCPA 5KX8A 3UODA 4MQ1A 5CU4A 1URCA 5HIEA 4PDOA 5HIBA 5DNRA 5AMNA 4DBXA 3MVMA 4NM5A 4TWCA 4BIBA 5HG8A 3ZO1A 5BYZA 2XIYA 4XG3A 3QZGA 4FTIA 4FTCA 5AR5A 3TKUA 4CT2A 1OM1A 2VU3A 3LQ8A 1CDKA 2RG5A 3ALOA 3ZTXA 4YPDA 5EDPA 3QTSA 1RQQA 2PE0A 3C13A 5L2SA 5CS6A 4I41A 3R8MA 1Q3WA 3FC1X 4O82A 3EYGA 3BHUA 2BTSA 2C1AA 3LLTA 1J1CA 2GSFA 2QHNA 5C01A 4DG3E 4R7BA 4TNBA 4JIAA 3UO6A 2XZSA 2W1HA 4LGHA 1PXKA 2WMSA 2W1IA 4IDTA 1NXKA 1YHSA 3Q53A 3G0FA 4RC4A 3SW4A 2YIQA 4ENYA 4IB5A 4YC8A 3QGYA 3CC6A 4NTTA 5HU3A 3DB6A 3RNYA 4FT9A 3IOKA 4IC8A 1U54B 4O22A 3G51A 5ETIA 1Q8UA 5AAGA 4DFXE 3LAUA 3HV5A 4JG7A 2XP2A 3LKMA 1IA8A 3MN3A 4TXCA 3T3VA 5HE1A 3BHHA 1MQ4A 4XG9A 3BV3A 1OZ1A 4O86A 3GFWA 2QR7A 4DGOA 3H9OA 2GMXA 2JD5A 4BGGA 4UMQA 4WKQA 4E5AX 1A48A 1XWSA 3QQGA 4H3BA 4JI9A 5IA5A 3WF9A 2QOIA 1XBCA 4FTMA 4UALA 5AV0A 4EKLA 3IO7A 4OUCA 4L3LA 5CQWA 5FTGA 4O7SA 4RIXB 2OIBA 1P4FA 2Q0NA 4ID7A 4YO6A 5AP6A 3TNWA 4CNHA 5TT7A 1CTPE 3GC0A 3PFQA 1MUOA 1WVWA 1H4LA 4FEWA 5DN3A 3JYAA 2EU9A 3RTPA 5DT4A 1UU7A 3NW6A 4IWDA 4YLLA 2O2UA 3IDPA 4QNAA 4N57A 4O6LA 1Y6BA 2W0JA 5J8IA 4CYJA 5JGDA 1KOAA 4YC3A 3SRVB 4EH7A 2PPQA 4OR5A 2UZVA 3ETAA 4B4LA 3QXPA 4QNYA 4RMZA 3UGCA 4FZ6A 2BAKA 4IC7A 1DS5A 4C3PA 2X6DA 4FSNA 1ZOHA 4FTTA 5JFWA 5CF8A 1ATPE 1PYXA 1F0QA 4PMPA 4U3YA 5BVDA 1TQMA 2OO8X 2UW6A 3LCOA 4AGCA 4ALWA 2CKOA 1ERKA 3ZFYA 2XYNA 3TL8A 4CZTA 4HVIA 3W10A 3ZRMA 3SKCA 2R3LA 3DT1A 3FMLA 4UB7A 4W4WA 3AG9A 3L9PA 5DLSA 3ZOSA 3ZRKA 3HMPA 5IDNA 2XIZA 4QPSA 3L8SA 5IZFA 2WB8A 4WRSA 2RFEA 4JL9A 5CNOA 1BL6A 4FIFA 2RFDA 4O7WA 4GFGA 2YERA 5CEIA 4F7LA 1G8AA 4BVUA 1REJA 4IAIA 2OIDA 4D1ZA 4KIOA 4RA4A 3MDYA 3RINA 3TV4A 4U9AA 4Z7GA 2BVAA 3KREA 5GHVA 3G2FA 3NUSA 3RBWA 3NPCA 4YZMA 1QCFA 2PZ5A 5I9UA 5E90A 3HZTA 2WTIA 4CT1A 2UZTA 3AC2A 4AW5A 3F88A 5BPYA 5KMNA 4V01A 3R1QA 4EYJA 4KB8A 3HX4A 2BRGA 1JSTA 4ZK5A 2QURA 3QCSA 2VWUA 2XEYA 4K8AA 2BROA 4NW5A 4DLIA 3DZOA 5HG7A 3ZC6A 2WIPA 3KRLA 4UMTA 2FVDA 5BQ0A 3RCDA 4EH4A 5EFQA 4CQEA 3QBNA 2JKMA 3DK7A 3QWJA 4JBVA 2J51A 3KRRA 3SXRA 4UZHA 5JMSA 4ANMA 2OG8A 3D7ZA 3ZC5A 3CTQA 4D5KA 4FNZA 3TIZA 1R0PA 4EWQA 4XV1A 4QMNA 2J9MA 5JKGA 2ZM1A 3CE3A 5DA3A 4FTAA 2JKQA 4XV9A 4FSMA 2G2FA 2I0HA 2V7OA 3FXZA 4C58A 5AFVA 2B9JA 4GU6A 2BRNA 4IIRA 3R7VA 1JWHA 1ZOEA 2F9GA 2WD1A 2UZBA 4U81A 4FGRA 2VO3A 3HAVA 3VBTA 3OEZA 4IDVA 5AR2A 1VYWA 4GVJA 2UVYA 4TKSA 4D5HA 3R6XA 2XJ2A 4XHKB 5JRSA 2X81A 3D94A 3TT0A 5CLPA 4EOPA 1OPKA 2BAJA 4ZP5A 3ZLXA 3I7CA 4M68A 4H05A 4NJ3A 1PJKA 5HVJA 3D15A 2JDRA 4WRGA 3PTGA 4Q5HA 4EOOA 2VTIA 3CKXA 3HP2A 3LHJA 3R7EA 2RFNA 4FODA 2B52A 3QCYA 2YAKA 4GT4A 4ANNA 3B2TA 1V0OA 3MJ1A 2IO6A 4FX3A 1UVRA 2B9HA 1LR4A 4IZ7A 3FXXA 3KMMA 4ANQA 3EWHA 1H01A 4AT3A 4BZOA 2YCQA 4B8MA 5ANDA 3CD8A 4NKSA 3R2YA 4LMUA 1IAJA 4FV5A 2WO6A 1NW1A 2IW6A 2X6EA 2VTAA 4RIYB 5H8BA 3NX8A 4M0ZA 4ERKA 4GIHA 3CTHA 2E2BA 3QHWA 4IJPA 2VUWA 1LP4A 2PMIA 3D5WA 3DAKA 4FSWA 4JBOA 4JNWA 4WT6A 3PVUA 4MKCA 3GXLA 4ZSGA 3FQHA 4JX3A 4QQTA 3NEWA 4HYUA 5B0XA 5FBNC 5D7AA 5D9HA 3G15A 2Y0AA 2C6OA 2C5NA 2J50A 2GU8A 3GQIA 5LMBA 4DYMA 2GDOA 3EQFA 1APME 3CP9A 1ZYCA 3F2AA 2ZV7A 3ZMMA 4U3ZA 1P2AA 4YJNA 1TQIA 1M2PA 2JC6A 2VWIA 3OWKA 2IW9A 4AF3A 4IZYA 4IVBA 2QR8A 4DITA 3ZSHA 5DT0A 4GK3A 4ACCA 2PUIA 1YW2A 4DFUA 3ZSGA 2W1FA 2A2AA 1OIYA 3NUAA 3AD5A 2R64A 2ERZE 3UO5A 3VHEA 4X2NA 5KMJA 5LARA 3ORMA 1YXUA 1UKHA 1WBPA 1ZARA 2YIRA 1H00A 2BDFA 3QUEA 5E1EA 1J7LA 3OUKA 1YXXA 3IS5A 1J7UA 1VJYA 4F0IA 2HWPA 4AE9A 2PZRA 2C3LA 3F5XA 4E4LA 4RQKA 3R30A 3Q9YA 4S34A 1O6YA 3PJ3A 3N4TA 2EB3A 4ITHA 4NJDA 3VUHA 4KA3A 1WBOA 5M57A 2ITUA 4FV1A 4YJRA 4R3CA 5M4FA 2YJRA 2YLEA 3O8UA 1JKKA 4BB4A 2R9SA 3SW7A 3MIAA 2IZRA 1TKIA 3ALNA 1KE6A 2WTVA 5CALA 3AC5A 5IKWA 3PDTA 3A8XA 3ZLSA 3PXQA 3P79A 2R3IA 2W1GA 3KVXA 4FK6A 4EH9A 2C6MA 4BWPA 4LOQA 2GS2A 2B55A 2CPKE 3KN6A 4S2ZA 4AOJA 1H0WA 5BMSA 3LW0A 3QCXA 4YPSA 4OTQA 2H9VA 3EQPA 3FMHA 1URWA 3BWJA 5JRQA 3EQCA 4AOIA 1AGWA 3C4ZA 4NKAA 5GJFA 3Q6WA 3OY1A 2XCHA 4O1OA 4QP1A 4UWCA 4AWIA 4CV8A 2E9VA 2VWXA 1V0BA 3I1AA 3QQKA 3BU3A 5LCKA 1H0VA 4D0WA 5CEMA 3BLHA 3OBGA 4F4PA 2JBOA 1L8TA 2W05A 3PPZA 4FG7A 4I6HA 4DEAA 4JS8A 3QQJA 5IEXA 4BHZA 3QQFA 3NMUF 2YITA 4K2RA 4HCVA 3LJ0A 3BQRA 4APCA 4IMYA 4O84A 3QRJA 3PZHA 2BZIB 4I3ZA 4O2PA 3CKWA 4MWIA 4XP0A 5AUXA 3R7OA 3VW6A 5I5ZA 2G2HA 3DK6A 1FMOE 4EKKA 2ZYBA 4EK3A 4C4IA 5KBRA 4A9RA 2XK7A 4FSRA 3NYXA 3T8OA 3TUBA 4QQCA 1KSWA 3VJNA 2VGPA 3ROCA 4B0GA 2P55A 2YISA 3P1AA 3QYZA 4JRVA 4PTCA 4WSQA 2JITA 5EW3A 3UP2A 3VUGA 4AFEA 3MJ2A 1UU3A 4V04A 1SNUA 1WBVA 3NR9A 3NNXA 5EHOA 3FAAA 4IFGA 5AP3A 5L2QA 5JZJA 5LCJA 5M53A 2JFLA 1ZMUA 4ZTSA 3C51A 3VRYA 3LFEA 2PZYA 2VD5A 5IA2A 1WCCA 3UNJA 1PXNA 4DGMA 1T45A 4O2ZA 4Y46A 4P5QA 4KIKA 4NSTA 3IK3A 2BTRA 3PZEA 4FKIA 3SLSA 5ICPA 5AP0A 3SXSA 5CZIA 3FKNA 4MNEA 3RPOA 3MIYA 4NCTA 3ENMA 5IH5A 3WI6A 4IXPA 4NIFA 2PTKA 5CU0A 3PXRA 2HELA 3B2WA 4WG4A 2BALA 2JLDA 2VTTA 4XV3A 4B9DA 3CR0A 3ZO4A 4E3CA 2QLQA 4KINA 3OG7A 3ERKA 3KQ7A 3LFQA 4BTKA 1U46A 2J7TA 3OY3A 5HBEA 2GCDA 4I6BA 4E5WA 2A27A 2OJGA 5BVEA 3QD2B 3GI3A 1MRUA 4RG0A 4FK3A 2X39A 2R3NA 3COHA 5FEQA 2YDKA 5M4UA 5L2TA 4B8LA 3B8QA 2ITZA 3LXLA 4PNKA 4RX8A 5EG3A 4MF1A 4OT6A 3WZEA 4A9SA 3VBQA 4QMVA 3DCVA 3BU5A 5ETFA 4DEGA 3EH9A 4JDHA 4QRCA 2X2LA 5EYKA 3WZUA 2UW5A 3UP7A 4CFMA 4UN0C 4L7SA 5BUIA 3DTWA 4DFLA 5EKOA 3DXPA 3FC2A 2B4SB 2EB2A 4QTCA 1H27A 4XNEA 5BVNA 5L3AA 5TR6A 2I0EA 4XBUA 5HE3A 2ZMCA 4FSYA 3HA6A 2VTSA 4DHFA 5ACKA 4XEYA 1YWVA 4EJ7A 3ELJA 2O65A 2XK9A 2ZV9A 3LCTA 4APPA 5JFVA 1OGUA 1R0EA 2WEVA 4PPBA 2JDTA 4AN9A 2UZUE 3KFAA 4FF8A 4OTGA 2PVRA 3PIYA 4OBQA 5E1SA 3PRIA 1PRYA 3MPTA 4GYIA 4JDKA 4ZY4A 3VS5A 3CTJA 3NVKI 2P33A 3OCGA 5EHYA 3DAJA 1CKJA 1GZKA 3A8WA 3BYUA 3LCKA 4QMZA 5FM3A 3F69A 5FBOA 5FQDC 2BHHA 2QOHA 3G90X 4BIDA 5AUTA 2YM6A 4L8MA 5J9ZA 2XK8A 4YJVA 5JGBA 4J1RA 2WAJA 3RAHA 1P14A 3BHVA 4FYOA 4FOBA 1OL6A 4OTPA 3PRFA 5FRIA 5F9EA 4Z55A 4F1OA 4JQ8A 5HEZA 3UPZA 3AGMA 4YURA 3OW3A 5I3RA 1H8FA 3TTIA 3VUTA 1WVXA 2G15A 4KBAA 4RLLA 5IA3A 5EM6A 2C47A 3ORZA 3TM0A 5AP7A 5FTOA 3QX4A 2PE2A 4DF3A 4PRJA 3TN8A 1XH7A 3FDNA 1ZLTA 3K54A 4J97A 4NCTC 5HO8A 5AV4A 4YJTA 1ZY4A 5CU3A 3AC1A 2CNVA 1H07A 2WQNA 5F95A 3F3WA 4CTCA 4BCHA 4ZTHA 1FVTA 3LOKA 4E6DA 4I5HA 3Q4CA 3DB8A 2XF0A 3QCQA 4IZAA 4FIGA 3QRKA 2UW8A 4RVMA 3IDBA 3NAYA 4UWBA 4N4SA 4IADA 3VQUA 5DR6A 4UMUA 2PE1A 4FT5A 3UOHA 3ANQA 5FDXA 1HCKA 3MS9A 4FV3A 4R5YA 4EH8A 3CSVA 5CQUA 5KMKA 2O5KA 2R4BA 4ZXTA 4ARKA 3D7TB 4MXAA 3ORKA 3RP9A 4E5BA 3S00A 3DFCB 4ZEGA 3W1FA 4BFMA 4D4RA 1LPUA 2XK4A 4FKQA 5CSPA 3NAXA 2JEDA 3DA6A 2YM7A 5GIOE 4QP8A 4RJ3A 2VTPA 5BVWA 4YUQA 5C27A 3QTUA 3GC7A 2JDOA 1EH4A 5AUWA 1RJBA 1M2QA 2F2UA 2XNMA 1Y91A 2Z8CA 1SMHA 3E88A 4UYNA 4TL0A 2B0QA 3HDMA 3R8VA 2FYSA 4O91A 3DNEA 3TIYA 3MVJA 3QF9A 3Q3BA 4X3FB 1GIJA 3Q9ZA 4O7VA 4RQVA 4XG6A 1MQBA 4G6LA 4UBAA 3FLZA
chains in the Genus database with same CATH superfamily
4EH2A 3JR1A 5M4IA 5HCXA 2XKDA 3UC3A 3VS3A 3M2WA 4FEVA 2FUMA 1CKPA 5E8ZA 4O4CA 5A4QA 1IEPA 2UW9A 5EW9A 3D9VA 4A9UA 5A4TA 3T9TA 5IQDA 1F5QA 5IQAA 3O5AA 4F64A 2WNTA 4R3PA 2YCSA 4AN2A 4PL3A 5KHWA 3ZRLA 3PVWA 3ZUTA 4D58A 4LGGA 3AMBA 5E4HA 3R28A 3IKAA 3VF8A 3T3UA 4IX5A 4XS2A 2OF4A 4N6ZA 5A54A 2KTYA 4NFMA 2F4JA 4KKEA 2XANA 2W4JA 1YOJA 2PUNA 3WYXA 2W5BA 5JFXA 3NUYA 2AUHA 4E4NA 5A9UA 1YWRA 1NA7A 3HV4A 3EFKA 5FEDA 2RIOA 2YCFA 2ZAZA 4M0YA 1J1BA 4XOZA 4BL1A 3GC8A 4BCNA 3MB7A 4XP3A 3BX5A 4ALVA 3D2KA 4I5PA 1Q8TA 4TWPA 5AAEA 4BN1A 1V0PA 5M51A 2ZVAA 3I60A 2OJJA 4BCMA 1H24A 5HBHA 3VONA 3EZRA 4BC6A 1XO2B 4E7WA 4BJJA 5K4IA 4HCTA 3W2RA 2YN8A 3QXOA 4FKPA 2YM4A 5F4NA 5J7HA 2CHLA 3ZONA 2C30A 4AGUA 3C4WA 4RFMA 2X2MA 4TYGA 1O6LA 3A4PA 3WOWA 4MHAA 4KRDA 4BTJA 4JQ7A 4QP3A 1PF8A 2XKCA 3C4CA 2JIVA 5L2WA 1M7NA 2QHMA 2WU6A 4OGRA 4V0GA 4O21A 4DLJA 2XIRA 3ZU7A 2WMUA 3QD4A 2R3KA 4RIWA 2J2IB 4TY1A 4U97A 4NUSA 2E9OA 2RG6A 3R00A 5IU2A 4C4JA 2DYLA 3NW7A 4HNIA 2EUFB 4YHFA 3V8SA 4DN5A 4IWPA 4BCIA 3RMFA 2Y9QA 4QMWA 5E7RA 3D83A 2FGIA 4EOKA 2WHBA 5DMZA 5F94A 5M09A 2YM5A 3KXZA 4QMPA 1Q97A 4O0UA 3EQBA 3EHAA 1Z9XA 4W8DA 3U55A 2OJIA 1PW2A 3EFWA 4M69B 3W32A 5AA9A 4GG5A 4CFNA 3DLZA 3LFCA 3BLAA 2ZJWA 3LQ3A 3ZUVA 4QYGA 3WF7A 5AAFA 2VTMA 4H36A 5A4EA 4PF4A 4ZZOA 3DU8A 2CKQA 2C3KA 2WQMA 5IEYA 4U7ZA 4FTJA 2FSLX 3CCNA 5EM7A 3OXTA 3I4BA 1WBTA 3DFAA 3F7WA 4BCQA 1R39A 5AM6A 3UO4A 5JGAA 1W83A 2B9IA 3O71A 4DFYA 2OZAA 4CG8A 3NCGA 3TWJA 2GFSA 4FL3A 1PYEA 2O3PA 3TXOA 5K5XA 2W9FB 1KUTA 3KMUA 1PHKA 4MF0A 3RWQA 5DOSA 4TTHB 3MB6A 3DK3A 4H58A 4O7RA 4Q9ZA 4BGQA 3G9LX 4QD6A 3ZH8A 3A62A 3W8LA 5ETCA 4AA0A 2X7FA 4AQKA 2JKKA 3JY9A 1ZZ2A 5HX8A 2QOCA 3E8CA 4F0GA 3U4WA 2GNFA 2OF2A 2I7QA 3FXWA 5IQBA 4M67A 2B54A 4XH6A 3PP0A 3R8PA 4E6CA 1YDRE 1SNXA 1G3NA 3G33A 3DBFA 1XBBA 4M13A 3F66A 2Z02A 2XVDA 1PMUA 3V51A 2GS6A 3UIXA 5M44A 1U4DA 3K3IA 4IACA 4K1BA 2PVFA 1IA9A 3JVSA 1QMZA 2YZAA 4IZ5A 1W0XC 4WBOA 3PIZA 2P4IA 3BYSA 3DBEA 2CCHA 4R8QA 3WIKA 4HVDA 2GNGA 3COMA 3QC4A 3QRUA 4RJ8A 4TNDA 3SOCA 5DVRA 1YXSA 4QMLA 3R7YA 3F7ZA 3DLSA 3R73A 1IRKA 3H0ZA 4HGSA 1LEZA 5DR9A 2J0MB 3R9HA 3R1SA 3LCDA 4BI1A 1ST4A 3ZFXA 2CGXA 3RI1A 3LXNA 4O0TA 5DRDA 5BX0A 3LE6A 4I0TA 2IVVA 3JUHA 5CF5A 4EL9A 1JLUE 1HOWA 1ZOGA 2QC6A 2GNHA 5JSMA 2B9FA 5IQIA 4EI4A 1UNGA 4M14A 4TZRA 2X0QA 3KRJA 4FT3A 4LMNA 4QMSA 5AR3A 5IEVA 2EVAA 2GFCA 1BI7A 4X2FA 2ETMA 1DAYA 1QPDA 2CGVA 2IZTA 4IAKA 2WMXA 4YZBA 4BCJA 2UZDA 1BX6A 4PQNA 1AQ1A 4II5A 3GU5A 2W96B 3O17A 4YJUA 5TOZA 4MTAA 4BF2A 1NVRA 5K5NA 1W8CA 3LQ5A 1Y8GA 4EORA 3D0EA 2BRHA 4QPMA 5CTPA 3HVCA 3AKKA 3UVPA 3A7FA 3F82A 1PMNA 4L67A 5CU6A 4AACA 3GT8A 2ITOA 3HEGA 1B38A 4UMPA 5IPJA 3LFNA 1OBGA 3AKLA 4G6NA 2R3MA 3BI6A 2C69A 3HLLA 4JT3A 4ZTLA 4QMQA 2OU7A 1GZNA 4BTFA 2UZNA 3FI8A 1KE9A 3G5DA 3FLSA 3W0SA 4OTDA 3W2SA 4BYJA 2Z7RA 1JAMA 1WBNA 5HBJA 2CN5A 5AWMA 4IH8A 2C6LA 5AADA 3AMYA 2CCIA 4KNBA 3AD4A 4MBJA 5TF9A 4BDCA 3U51A 4USFA 4IB0A 4GW8A 5J79A 3F2RA 3VS7A 2VX3A 3ATTA 4EK4A 2W5HA 3DKGA 4UY9A 5LVOA 3IW6A 4R6VA 4CMUA 4MH7A 3TNHA 3DKCA 4K6ZA 3TKIA 3TUDA 2VO6A 4YLJA 5E8XA 3FL5A 4IX3A 3ET7A 5CSVA 5AP5A 5BNJA 1TQPA 3ZO2A 3P08A 2FO0A 4U41A 5J5SA 5DEYA 2VTHA 4GFMA 1GNGA 1OVEA 3UG1A 4F9WA 4IE9A 2JDVA 3U6IA 3N9XA 4U42A 2XRWA 2C6IA 3BRBA 3LJ1A 3FI4A 5E8TA 4AGDA 4F6SA 3DJ7A 1JKLA 5T3QA 3VS6A 1UU9A 2OXDA 3V5PA 4BDGA 3LVPA 4ACHA 2HYYA 5HCYA 5JN2A 3LJ2A 4GJ3A 2ZDTA 1OL7A 3I6WA 4GK2A 4M12A 4W4YA 3LM0A 5C9CA 3ZEPA 4DGNA 3ZFMA 4DH5A 4M84A 3QRTA 2WMVA 3DBQA 3R7GA 3VUIA 1NT2A 1Q3DA 4XX9A 4P4CA 5LVNA 1DM2A 4G3CA 3PG3A 4KD1A 2CLQA 3VS2A 3ZS5A 2EWAA 4D9TA 1H1QA 1M7QA 1UWHA 3BQCA 3WARA 3M1SA 2NYAA 4OAVB 3KA0A 4QMYA 1T46A 5HOAA 2CNUA 5IA4A 3ODYX 4QMUA 3C4XA 2XNPA 4GCJA 3D14A 4NW6A 3ZLYA 4FR4A 2X0GA 5FEEA 3GUBA 4PP7A 2XARA 4HVHA 3SG8A 4E4XA 3FLNC 2J0LA 1YWNA 1ZY5A 3UIBA 4DTAA 3K5VA 2GNIA 4GMYA 3Q2JA 5DG5A 5C4LA 1Z57A 4GRBA 4RT7A 4DA5A 3HMOA 4CRSA 3R2BA 3GC9A 4XG7A 3WZKA 1M52A 4LV5A 2IG7A 2G2IA 3LFSA 4OTFA 2CN8A 3Q9WA 3OS3A 3U54A 4O7YA 2Y7JA 4MWHA 2R3FA 3BU6A 4NH1A 3BCEA 4FEQA 3QQUA 2BKZA 2HY0A 4ZLYA 4Y85A 2UW0A 4JQEA 4RZVA 3MA6A 5DFPA 4AS0A 2W06A 2PL0A 3ITZA 4DEBA 3NDMA 3LXPA 4HW7A 4C35A 5K9IA 2J90A 3MY0A 3MVHA 4YSMA 2PYWA 5CAVA 1YOMA 4I22A 3POOA 2NO3A 2XK3A 3DDPA 1WFCA 2Y6MA 4ZTNA 3GCVA 4A7CA 5AEPA 1YRPA 4Y72A 3FHIA 5IQHA 2R7IA 4G2FA 4FT7A 4ITJA 5K0KA 2C5VA 3KEXA 1G8SA 4E1ZA 4FTUA 3EQGA 4AW1A 5IH6A 3RNIA 4ZSEA 4FTRA 4ZY6A 2BDJA 1A9UA 1MRVA 3Q4ZA 4W4VA 4YC6A 3E63A 5FP5A 3QALE 2QOBA 4TWNA 1W98A 3F2NA 3NUPA 3I5NA 1Q61A 3H9RA 3Q6UA 2ZM3A 1H1RA 2BILB 5CEQA 2W9ZB 1UU8A 3OXZA 3L1SA 3WYYA 1BI8A 4NEUA 2W4KA 2OH0E 2WFYA 4KABA 2VTRA 2CSNA 4AT4A 4XP2A 5HTIA 3KULA 4CLJA 2F7EE 2YA9A 4GS6A 3Q2MA 4JBQA 4M3QA 3QA8A 3DGKA 2E9PA 3LMIA 2R0UA 3C0HA 2I0YA 4RZWA 1JKSA 3A7IA 4FVQA 4HJOA 3HV3A 2A0CX 1VZOA 3EQRA 2XK6A 4YHJA 3R9OA 4A4LA 4LI5A 5CAPA 1HCLA 4F7SA 4J71A 2J5FA 4PDPA 2C3IB 3IW7A 3VN9A 2EXEA 3KGAA 4M8TA 5IH4A 2C6KA 1JQHA 4YU2A 5CEKA 3UG2A 1WMKA 4N70A 4BCOA 4YLKA 3FEGA 4ZMEA 3KY2A 3SD0A 3ZXZA 3AT4A 3RGFA 3QTQA 3W2PA 3P7AA 1YKRA 3VWAA 3DXNA 4PV0A 3PXYA 4NZWB 3P5JC 2PVYA 5A3XA 2XAOA 4UWYA 3AMAA 4UX9A 4WD5A 4XJ0A 3QZIA 2XNEA 5H2UA 4CRLA 2JDSA 2WTCA 5E9EA 3OUNB 2GPHA 3FZRA 3C1XA 4FKJA 2WMQA 4S30A 3HRFA 2JBPA 4GKHA 5E92A 3BPRA 3PWDA 4USEA 3ZDIA 4M7IA 2C0OA 4IJ9A 4BCFA 3TUCA 1DI9A 4FIHA 3NS9A 3EYHA 4CYIA 4BDKA 1W2CA 2UV2A 4RFZA 4O7NA 3I7BA 4GG7A 1RE8A 1TVOA 4GK4A 4K0YA 5A6OA 3HDNA 4WIHA 4ANBA 1PMEA 5CEOA 4PMMA 3W2QA 3UQFA 4AZFA 1W2FA 4C4HA 5FXRA 2YCRA 2YDJA 3K5UA 2PMOX 3FPQA 2OSCA 2YFXA 4FKUA 4KRCA 3HMIA 4F63A 1UNLA 2DS1A 5DPVA 1Q41A 4CZUA 1BMKA 4FMQA 2NRUA 3SV0A 2VWZA 2W1EA 4GT3A 2A1AB 3BIZA 5DE2A 4DDGA 3RAIA 2YWPA 3M11A 3RVGA 4FA2A 3RZFA 2GHLA 3D4QA 4HYIA 3R04A 4HVGA 3R01A 3FMEA 1PKDA 1P5EA 1BLXA 2C68A 3NIEA 3BL9A 3C5IA 3TI1A 3S2PA 3UPXA 5HX6A 2W4OA 3UNZA 4RX7A 2HENA 4BDJA 5C8NA 4LDTA 4AGWA 4QMMA 3V5QA 3MTFA 3RJCA 2WTJA 5LMKA 4I6LA 4E73A 4D2PA 4G3FA 4EC9A 1FGIA 3E3PA 2WKMA 4AW0A 3HMNA 5J95A 4FE2A 2PK9A 5GZ8A 3VS0A 4S31A 4O6EA 3NSZA 2CJMA 4IX4A 4JOAA 4RRVA 4YJQA 3OT3A 4MNEB 4D2VA 5HD4A 3SGCA 4NIFB 4RIYA 4ASDA 1JNKA 1LEWA 2RKUA 4DH7A 3PXKA 4QYYA 3D5VA 1CSNA 5CT0A 4ACGA 2XCKA 4MD9E 2VWBA 3N4VA 5CAOA 5EYCA 2AC5A 2WMTA 5CZHA 2R5TA 1I44A 4IVAA 3KN5A 4IAAA 4WBBB 5HE0A 3UQCA 4O7ZA 3GGFA 1J7IA 4X0MA 4Y5HA 5CANA 4R7IA 4PDYA 4IB1A 3OWLA 4CGAA 1W84A 4QP9A 3FQSA 3EN7A 5D7VA 3ZDUA 5CVHA 5LJJA 4LYNA 3C4FA 3AXWA 2OJ9A 2QVSE 3PPJA 4K18A 5HESA 5L8LA 5BV3A 1OIRA 2WTKC 1VR2A 2PUPA 5E8WA 4EUTA 3REPA 5A4CA 5CT7A 3LCSA 4GFOA 3W0PA 3OCBA 4FTKA 3PVBA 5C8MA 3Q4TA 4MCVA 2HXQA 2WIHA 4N0SA 5A46A 2NNWB 3V6SA 2BHEA 4XLIA 3FI3A 4G34A 3I79A 3HGKA 3RCJA 4FSTA 3RAKA 2G01A 4C36A 4YZCA 5EHLA 4KIQA 4I94A 4ITIA 1YOLA 4ACDA 3BBWA 1OITA 4ERWA 4MX9A 3GENA 4DGLC 3VHKA 3IPHA 1IAHA 1CKIA 4OTHA 3F61A 4A4OA 4YZNA 1ZYJA 1U5QA 3E3BX 3QQHA 2YIXA 3CLYA 4BI0A 3D5UA 4FTNA 3LMHA 5IG1A 3MVLA 3UYSA 4EQMA 4JAJA 3W8QA 1XBAA 4EEVA 4JDJA 2J5EA 4RA5A 4BKZA 2XNBA 3IW5A 3QKLA 4HCUA 4D2SA 5IF1A 1QPCA 3MV5A 4O4BB 5ACBC 2XJ0A 1UWJA 4FSZA 2QG7A 3BV2A 2A98A 4YTFA 3FQEA 4CKRA 2OH4A 5EOLA 2IVUA 2KULA 3E5AA 2Z7QA 3QX2A 3HUCA 3V04A 5EI2A 3WZJA 1GIHA 4NYEA 4C62A 4D2WA 1XMMA 2C6TA 5LMKC 4IQ6A 2C0TA 3L9NA 3TNPC 3G6HA 4UXQA 3AC3A 4P5ZA 4XG2A 3UZRA 3IG7A 2YM8A 3BYOA 3Q4UA 2LAVA 4ENXA 5KHXA 4FTOA 4EBWA 3CY2A 2X4FA 4J98A 5L2IA 4O0YA 4OT5A 1QL6A 5FWKK 4DT8A 4DHJA 4BCGA 3E7OA 1LUFA 2QLUA 4IWQA 4CD0A 2QKWB 4YMJA 3WF6A 2QD9A 3HL7A 4AQCA 2I6LA 4ZSAA 1YHWA 1XH4A 3HUBA 2PVKA 4GIIA 4YTHA 5KMIA 2W5AA 5J9LA 4O81A 3EFJA 3OOMA 4CXAA 3EN9A 4C4FA 3CIKA 3Q5ZA 3FBVA 4PUZA 3FJQE 2QU5A 2Z7LA 3MSSA 3VC4A 4DEEA 4Z16A 2O8YA 3DKOA 3LM5A 4EHVA 3VULA 2WQBA 3OTVA 5ANEA 4EC8A 1SZMA 3NZ0A 3QU0A 1Q4LA 5D11A 1KE5A 2W17A 4J7BA 4U8ZA 4GEOA 2YIYA 3VS4A 4NWMA 4DE4A 4IVCA 2XM9A 3W55A 3ZEWA 4JVGA 3DKFA 3RWPA 5HO6A 4YZDA 2VO0A 3VUKA 3ENHA 5J5TA 3KC3A 4B6LA 5FDPA 3FWQA 3MH2A 4ANOA 4LV8A 5HIDA 4ASXA 5HNBA 4E4MA 3CXWA 4F6UA 1STCE 2C1BA 1JVPP 3FZTA 5KUPA 4F9BA 3TMOA 3GQLA 4X2KA 3LFAA 2ETKA 3FHRA 3OROA 2R3GA 2Y6OA 1XMLA 4OLIA 3C0GA 3LIJA 1UV5A 2F57A 4I6QA 4LRJA 3CQWA 3O50A 4BIEA 3BE9A 4X21A 5HE2A 1H28A 5D10A 2BCJA 4ASZA 3VIDA 1NVSA 2P0CA 3VBXA 3C9WA 3FZPA 5M08A 2CKEA 2Y4PA 5EI8A 4DH1A 3COKA 5H9BA 3AC4A 3OOGA 2NRYA 4AA4A 5M07A 5LWMA 1OL5A 2XNGA 4G5JA 4FEXA 4MNFA 3PG1A 5C4KA 2OGVA 3U6HA 3CY3A 4RFYA 3R9NA 3W0QA 2ETRA 3C7QA 4KSQA 4Q9SA 3EN4A 3H0YA 4RBLA 3UZPA 3PJ2A 4D55A 1KOBA 5D1JA 3VAPA 4E93A 3DAEA 3FSKA 4WNOA 4G5PA 1YDTE 4JX7A 4FV2A 4AXEA 3RK9A 1Y57A 4F9CA 2VTNA 4O7TA 3TEIA 4L9IA 5K3YA 2OFVA 4PL5A 4Q2AA 1YQJA 2YHVA 3UVQA 4DFZE 4YR8A 1H26A 4DT9A 4RC3A 1S9JA 3POZA 4TYHA 3U8WA 2HW7A 4AA5A 1S9IA 4BDAA 4X7QA 5M4CA 3IGGA 5L4QA 4MYGA 2WGJA 2VNWA 4LL5A 2JKOA 3VVHA 2IWIA 1Z5MA 4FUYA 4AZSA 3FLQA 5JEBA 4YNEA 2C3JA 3PIXA 4G9RA 4V0GB 3ZCLA 4U5JA 1GIIA 3NUUA 4XUFA 2CLXA 5IUHA 1SVEA 3EN6A 4KBCA 5KMLA 3UOJA 3FMJA 5IUIA 1IR3A 3RZBA 2BFXA 3QYWA 5CNNA 1Q99A 2ZDUA 4EOSA 1GZOA 5AX9A 4AXAA 4BWXA 4F7NA 4PNIA 5BUEA 3P4KA 3RPSA 2ZFYA 3SC1A 3FZSA 2I40A 3R8LA 2WQEA 3RHKA 2X1NA 3UBDA 3IQ7A 4NT4A 4PPAA 3IONA 3KKVA 5HCZA 3L9MA 2HK5A 3H10A 3PY3A 2WELA 4FKOA 2VO7A 4O4EA 3UTOA 5HLWA 4KKGA 5DBXA 3NW5A 4C7TA 3I0QA 4LFIA 4G17A 4K9YA 5G1XA 3BL7A 2FSTX 3ZHPC 2BUJA 4BDDA 1WVYA 1ZYSA 5AUVA 4BWKA 4ALUA 4JG8A 4O0XA 4ACMA 4UV0A 1JPAA 2OBJA 3UNKA 1OKYA 3ZBXA 4C61A 4QP6A 2OZAB 2AYPA 1SVGA 3UC4A 2YZLA 3LPBA 5GINE 2IEWA 3GVUA 1OL2A 2ITQA 3MI9A 2WOUA 3PSBA 2ESMA 4PP9A 5AR4A 2HZ4A 2VWVA 5L6PA 3RM6A 3NUXA 3NVMB 1IG1A 1PXOA 3UDZA 4BKJA 4RWJA 2V55A 1ZXEA 2JAMA 4C02A 1UA2A 1ZAOA 2QONA 3PY1A 4C3FA 5L8JA 3TCPA 4C57A 4IM2A 1ZZLA 3FMKA 5CWZA 3ZO3A 3Q60A 3P7BA 4A07A 3NYOA 4I0RA 1Q8YA 3RHXA 3F9NA 2QOKA 2VTLA 2PSQA 4CFUA 3SDJA 5CAUA 3GEQA 5HG5A 4H3PA 4R77A 3C0IA 5HD7A 4TRLA 4ANSA 4NL0A 2VGOA 3TDVA 3R02A 4FVRA 3AT3A 4Z9LA 4ZTMA 2ZMDA 4BDIA 3N51A 5B2LA 5EOBA 2UW3A 3UMWA 3FSFA 2HY81 4DCEA 5KBQA 3VRZA 4EHZA 4FL1A 2QO7A 3R8ZA 4FZ7A 2BRMA 3RM7A 5CSHA 3AC8A 4HZSA 3W0MA 2ITPA 3ACJA 3CS9A 2WXVA 4ZJIA 3UVRA 4FV6A 3PA4A 4R1YA 2PVLA 5IA1A 3TV7A 3DNDA 3R7UA 2BZHB 2OFUA 3EIDA 4I1ZA 5BVKA 3RKBA 2XKEA 4IANA 4JXFA 1OGYA 4ANLA 2ERKA 5HI2A 4L53A 3CGOA 2QI8A 2BRBA 4EONA 3PXFA 3EN5A 3BZ3A 1NY3A 3NYVA 4DEDA 4ZLOA 2PWLA 5KZ0A 4U0IA 3ID6C 1YI3A 5AJQA 4FRFA 5JZNA 3GB2A 3GCPA 3MPAA 4XLVA 4MXYA 5F1ZA 3VBVA 4D1XA 5JK3A 4L3PA 3VBYA 3UOKA 3KRXA 1A06A 3MWUA 3QUDA 3G0EA 2GQGA 3DV3A 4GT5A 4LQMA 2IPXA 4DTBA 5LXMA 4FSUA 3ZYAA 4BBFA 3TJDA 4BZDA 2X0PA 4KKHA 5CF6A 4GSBA 4MXOA 4P7EA 4D4VA 4ZAUA 3QUPA 5CASA 3EOCA 5J7BA 4FGBA 3PA5A 2IVTA 5CI6A 1YDSE 2A19B 5TKDA 1PKGA 1I09A 4C8BA 2HXLA 4ZJJA 3ZZEA 3IOPA 4KWPA 5IQEA 3MH1A 3QRIA 2XNNA 3BLQA 3O2MA 5HORA 2FA2A 2C6EA 2YWVA 3TV6A 4JJRA 1ZYLA 3V6RA 2PHKA 5C8KA 2AEGA 4RLKA 3TYKA 4EZ7A 1IASA 4ORKA 4M69A 4L42A 4RJ4A 5H3QA 5FUTA 2VN9A 3KK9A 4J52A 3F3UA 2R3HA 5DI1A 4XOYA 2XAMA 4JDIA 4USDA 2YAAA 4WG5A 1YI6A 3MESA 2V7AA 1YXTA 3BEGA 3NRMA 3MTLA 3BHTA 3AQVA 4YBKA 3FMMA 5B2KA 4ZTRA 2Y4IC 5TE0A 5J9YA 3FY0A 4NU1A 4TYEA 4FZAB 2NPQA 5EI6A 4AZEA 1F3MC 3U9CA 4ZTQA 4L43A 1JKTA 2B7AA 4MXZA 4HNFA 3EFLA 3GOPA 4XG4A 3A61A 3II5A 3ORXA 4WHZA 4HGEA 3AGLA 4G3EA 3PUFC 1GZ8A 2WOTA 4MK0A 4X2JA 4EOLA 4NK9A 3UOLA 4L7FA 3Q5IA 3RPRA 4MD7E 5LVPA 3IW8A 1KV2A 2QQ7A 4FIIA 3DTCA 1NVQA 4MEDA 3Q04A 4IAZA 4C38A 1K3AA 4AOTA 5GNKA 3F5PA 4MQ2A 4GL9A 4DBNA 1MP8A 3CD3A 4QPAA 3B8RA 4JIKA 3R0TA 4IAFA 4U44A 1OBDA 1K2PA 1X8BA 3A7HA 2PUUA 3LMGA 4R78A 5JQ8A 4RVTA 4A9YA 3SVVA 2Z60A 1ZMWA 2PVJA 2X9FA 4GVAA 3GCUA 4QMXA 4QTDA 4TYIA 3ZBFA 3A7GA 5DRBA 4PPCA 3BE2A 4NTSA 2O63A 1FBNA 2XNOA 3HA8A 3OCTA 3CQUA 4UYAA 1YHVA 2FSOX 3HRCA 4J96A 4IHPA 4O96A 3BYVA 5IA0A 1FMKA 5EM8A 4EHGA 3BKBA 4P2KA 4AXCA 2YLFA 3CQEA 3GCSA 2VTOA 3FL4A 2XIKA 4P90A 4FEUA 3V5LA 2WTDA 4YO4A 3TZ7A 5HKMA 3DOGA 3OMVA 3GCQA 4GV1A 1OL1A 4IM3A 5C03A 4E8AA 1FVVA 2QOOA 3A4OX 3ZM4A 1BL7A 3R71A 3L8XA 4RVKA 1W2DA 3E93A 3ZSIA 1B39A 2YABA 1Y6AA 2R3JA 3PJ1A 1WAKA 4XG8A 3R63A 1FINA 1XQZA 2P2HA 4FJVA 1H1WA 2YM3A 5KZIA 3W0RA 4FKTA 4RJ7A 2I1MA 3NYNA 2I0VA 4AT5A 4Y95A 1H1PA 3I81A 4UMRA 5EYDA 2ITVA 1Q24A 3E87A 4AZWA 3N4UA 4MBLA 3FKLA 2ITYA 2REIA 4YTCA 2GHMA 1YI4A 2J0IA 4H1MA 3UIMA 2WMBA 4RJ5A 3SAYA 4QTEA 2OIQA 4QMTA 5CY3A 3JPVA 3ANRA 4EH5A 2CGUA 2XYUA 3L9LA 4L52A 3VF9A 4HYSA 1U54A 5HO7A 5KKRC 3KULB 5DH3A 4DG2E 5CSXA 5HVKA 4HZRA 3R83A 4QOXA 3HV6A 1GAGA 3PE2A 2OW3A 2WMWA 3H30A 4FNYA 4FV0A 4M66A 5DWRA 4BI2A 3F5GA 3GU8A 5HLPA 2BDWA 2QNJA 1JBPE 2J0KA 3O0GA 4FZDB 4G16A 5FG8A 3QD3A 4CCUA 1JSUA 3BELA 3NNWA 2PVNA 4R5SA 2F7XE 2R3RA 3O7LD 4DINA 4D1SA 2X8IA 3K2LA 3KF7A 4KSPA 4RIXA 3RK7A 3WF8A 2UVZA 3GOKA 3PJCA 3MPMA 3VUDA 4G6OA 3MY5A 3OCSA 4DEIA 3WF5A 4FKSA 2AQXA 3Q9XA 3FLWA 4YHTA 3R21A 4DGGA 4FTLA 5IDPA 3PFYA 3QAME 3PSCA 4MVFA 3A7JA 3KU2A 3QZHA 2WU7A 4CKIA 4NFNA 4FV8A 2HOGA 3F5UA 4F6WA 4JG6A 3HAMA 3KXGA 4BKYA 4YNOA 1OKVA 2QO2A 2WTKB 4LL0A 3L8VA 4QQ5A 3SRVA 5EKNA 1ZRZA 2EXCX 3FUPA 3QTZA 5GZ9A 1K9AA 1QPEA 2Y8OA 3NNUA 4PMTA 2OJFE 2W1ZA 4OAUC 4ZMFA 4KS8A 4KAOA 2OXXA 3QTXA 4DH3A 4AUAA 2XMYA 5LWNA 3ULZA 4IM0A 4ONAA 4YZ9A 3R7IA 5I9WA 2BZJA 4HPTE 3PYYA 5A14A 1GOLA 2WTWA 3P23A 1VLRA 5M55A 2E9UA 4KIPA 3RK5A 4O0RA 4FC0A 3F3TA 4IEBA 2ZV8A 3EMGA 4YJOA 5F20A 2QG5A 4M97A 2H8HA 4IVDA 4X6RA 3UJGA 2ITNA 3KK8A 5CX9A 4GUBA 2G9XA 4OTIA 2ONLA 3S3IA 4D9UA 4BGHA 1RDQE 3P9JA 4C4GA 3KXHA 3EKNA 5AA8A 5FGKA 4IW0A 4BRXA 1OIUA 2OWBA 3QQLA 4QYHA 5LVLA 4BCKA 3C50A 4J99A 5H8EA 5M56A 3FMNA 2ACXA 2B1PA 5FLFA 3R8UA 4FICA 2QO9A 3PPKA 5IISA 4MXCA 5D12A 4AN3A 5L6OA 3Q52A 3E64A 5TO8A 4EYMA 4U40A 5K4JA 4FG9A 2PZIA 3W0OA 2QOFA 2GQSA 4FIEA 3MYGA 3FY2A 3O51A 4W9WA 4W9XA 4KBKA 4HOKA 1MRYA 3OFMA 1H1SA 2X7GA 4PTEA 4F1MA 2PY3A 3BHYA 4QP4A 5AM7A 2UZOA 3TNQB 3FKOA 2GNJA 4CFVA