4C7TA

Focal adhesion kinase catalytic domain in complex with a diarylamino- 1,3,5-triazine inhibitor
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
271
structure length
259
Chain Sequence
DYEIQRERIELGRCIGEGQFGDVHQGIYMSPENPAMAVAIKTCKNCTSDSVREKFLQEALTMRQFDHPHIVKLIGVITENPVWIIMELCTLGELRSFLQVRKFSLDLASLILYAYQLSTALAYLESKRFVHRDIAARNVLVSATDCVKLGDFGLSRYMLPIKWMAPESINFRRFTSASDVWMFGVCMWEILMHGVKPFQGVKNNDVIGRIENGERLPMPPNCPPTLYSLMTKCWAYDPSRRPRFTELKAQLSTILEEEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Inhibition of Both Focal Adhesion Kinase and Fibroblast Growth Factor Receptor 2 Pathways Induces Anti-Tumor and Anti-Angiogenic Activities.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Transferase
molecule keywords FOCAL ADHESION KINASE 1
total genus 81
structure length 259
sequence length 271
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2013-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4c7tA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4c7tA01
4DHFA 3QA0A 4HGLA 2QCSA 4B6LA 3R63A 2BRGA 1Q8YA 3TG1A 4CFMA 4KSPA 2HZIA 5A6OA 5IMEA 2XJ1A 3BEGA 2G2FA 3PLSA 5IA4A 1FVRA 5C9CA 3R9NA 4XG3A 4GEOA 5L8JA 2V62A 1OUKA 3E88A 4YJSA 3NNXA 5FD2A 4GUBA 1BL7A 4B99A 3LCSA 3H4JA 3KY2A 3LFNA 4KNBA 4M15A 4S30A 4EI4A 5CS6A 3GCVA 3RWQA 3UJGA 2JEDA 4I92A 4RFMA 3LHJA 4RWIA 3IDCA 3P08A 5EYDA 3KXZA 2CNQA 3NIZA 4U40A 1JKTA 1YOMA 2NO3A 3ALOA 2BMCA 1QPDA 3LZBA 3MTLA 4WG5A 4ACCA 3A61A 4EH4A 4KSQA 4P4CA 2OXXA 2QOKA 3OTVA 3FHIA 4FF8A 4NYEA 3JY0A 3MH1A 4A9SA 2HXLA 1BMKA 3OOGA 5IH5A 4IAZA 4XG4A 4MD7E 4WIHA 3HGKA 1ND4A 1UA2A 3AOXA 2IW9A 2XNBA 3D7TA 1O9UA 4NT4A 3ORPA 3PPZA 4DITA 5KMNA 2F49A 2ZVAA 2PVMA 1WCCA 2ITNA 4E93A 4E8AA 4FSQA 2CLQA 4FKRA 3UE4A 2HZ0A 4FG8A 3SAYA 2ITPA 1REKA 4DINA 5M09A 3KCKA 3CIKA 3SLSA 4GW8A 3FXWA 4LYNA 4E4NA 5IEYA 5HLWA 3AGMA 4JXFA 3ROCA 3GCQA 3I60A 2PUUA 2O64A 3E7OA 3H9RA 5A9UA 3IW4A 5EKNA 3PJ2A 3BHYA 5CTPA 5HO6A 2B9IA 4YLJA 3KB7A 2X9EA 2VO0A 2J0KA 2VTIA 2XNOA 4Y83A 4EOKA 3LOKA 2J0IA 3N4TA 5AM6A 4FYOA 2YLEA 3RVGA 4O6LA 2QOCA 5GZ8A 3SQQA 3CE3A 1OIYA 4M13A 4D4YA 1XKKA 3EN5A 5I3RA 3EQGA 2C0OA 3F5PA 2CGUA 2ITQA 4FV3A 5KO1A 3RMFA 3ZFXA 1K2PA 3WZEA 4RQVA 4RJ3A 5E90A 4O83A 4K77A 3O7LB 3QUDA 3S0OA 5CQUA 5CNOA 4ORKA 2H34A 5FP5A 3ZLWA 3ACJA 1H08A 3ENMA 4CTBA 3MGYA 3ZLYA 4W9XA 2WTCA 2JKKA 4BB4A 4FSMA 4FMQA 4MXYA 3NGAA 4X2GA 1OL6A 3LFQA 5K9IA 3HP5A 3V5WA 4R3CA 3VHKA 5EYMA 1JNKA 4MCVA 4FKQA 1OB3A 4GG7A 3RJCA 3F7WA 4FSUA 4PMTA 2ZYBA 2YCFA 4MXOA 4A07A 4HGSA 5KHWA 1U59A 4Q2AA 2RL5A 5FXRA 2QC6A 3DBQA 2DUVA 4FICA 4I6QA 1CTPE 4IX5A 2BROA 3V3VA 5HG5A 3R21A 4BBMA 4DFBA 3ZEWA 3MIYA 3FLSA 4CYIA 2XM8A 3G90X 3LFDA 2W1FA 4E6QA 3PA4A 2CJMA 2BZIB 3ZBXA 1P2AA 2PY3A 4BDDA 1U4DA 4O91A 3E5AA 5I9WA 5M06A 1YWVA 4YHTA 3Q2JA 3W2CA 3GBZA 3QTUA 1Q8TA 1XQZA 2GNJA 4I5MA 2I1MA 3FC2A 2JDVA 3TUBA 2R3RA 2W5BA 2YDIA 4IAIA 4APCA 4DBNA 2XK6A 4X6RA 4H39A 2VO3A 4D2VA 4NW6A 2ZV8A 4G6OA 3TI1A 1SNUA 2BDWA 3DJ6A 3GVUA 3K54A 1M2QA 3UTOA 4EKLA 4ERWA 3C50A 5E8SA 3VIDA 4GV1A 2WTWA 1R3CA 2JDRA 2VGPA 3EFLA 5KMOA 1YXVA 3FLWA 5E9EA 3L9NA 2CHLA 3PY3A 5AJQA 5E1EA 5AP6A 2WQBA 2C3KA 5GIPE 2XKCA 5JRQA 4RJ6A 3ZO3A 4L7SA 4YJRA 4BI2A 2F2CB 5IG1A 2BILB 4BTJA 4FGRA 4FNYA 2QVSE 4YPDA 5JFSA 2UZVA 2WMRA 1AGWA 3UPZA 3U54A 4FTMA 3UNZA 1R39A 3HUCA 3QD2B 4FKWA 4ANQA 4UEUA 4WSQA 4GSBA 4TW9A 4QMUA 2QR7A 3V6RA 4FNWA 4FV6A 1GZ8A 2W1DA 4HCVA 2YHVA 5DEYA 4ZXTA 4WNPA 3EN6A 4LRKA 5CVFA 3SXSA 1YHWA 2OJFE 3Q52A 3IO7A 4CT1A 2QHMA 3D2KA 4M14A 4JT3A 4KAOA 3OBJA 4DT9A 3A60A 4FKUA 3VS5A 2OU7A 4ALVA 2QONA 5K5NA 4BBFA 3IW7A 4PPAA 5EFQA 5M53A 1RDQE 5EG3A 4EL9A 4EBVA 1ZMWA 2HWPA 4RX9A 2PUPA 3SG9A 2YLFA 1XH5A 4TYGA 3GC9A 4QD6A 5CU0A 5EW8A 2PMLX 1H1RA 2A1AB 5CEPA 2JAMA 3SOAA 3CBLA 3I79A 1SNXA 2XBJA 3WF8A 3EH9A 1UVRA 3I4BA 2J4ZA 3DB8A 2OIDA 3DKOA 3K3JA 3VQHA 2WTVA 4AW0A 3QRTA 2R7BA 4JS8A 4M68A 2C5NA 2VTSA 4RVMA 4BDAA 2IZTA 2RFNA 3Q5ZA 3ZSIA 1J7IA 2GDOA 5CSPA 1OL7A 4BDJA 1URCA 4DEDA 4MNFA 4EQCA 3R01A 1APME 2OZAB 4XP2A 4D2TA 3PVWA 4M66A 5CYIA 3FZ1A 3MW1A 4BGHA 3ZM4A 1UKHA 5AR3A 3UNJA 3DKGA 4CMTA 2PZPA 3BYSA 3S00A 5F95A 3NSZA 1E1VA 3QHWA 4YZNA 4JDHA 3L8XA 4I24A 4EZ5A 1UWHA 5HBHA 2PUNA 3DTWA 5ANIA 4I21A 4P5ZA 4L42A 4B4LA 4U79A 5KKRB 2QODA 2WNTA 5IQGA 2J6MA 2ITUA 4QMZA 5HVYA 2Y6MA 4FZAB 2WMSA 4C4HA 5JMSA 4LL5A 4NCTA 5GJFA 2UVXA 1ZMVA 5LWNA 4C2WA 4ACMA 3FLZA 3GU4A 5IEVA 3IK3A 4L43A 3Q4UA 3T3VA 3TTIA 1OBDA 3ZC6A 2KULA 3EIDA 4M7IA 3EL8A 3CQEA 4KIPA 4WSYA 5EI2A 2PWLA 2XUUA 3IDPA 5ACKA 4E5WA 2WFYA 3O7LD 2CPKE 3R1SA 1OVEA 1BI8A 1PXLA 3D7TB 4PDOA 4B8LA 2OW3A 2ERKA 4ANNA 1XJDA 4C7TA 5BVOA 5KHXA 2HY0A 4W4VA 4ZMEA 4PPBA 2PSQA 3ZONA 4ZTRA 2C0TA 2Q0NA 4ASZA 4EC8A 4ZSGA 3G51A 4C8BA 2BRHA 5FTOA 4IAAA 4O2ZA 2P2IA 2RSVA 3PXRA 5GJGA 3QKLA 4OTPA 4DYMA 4H36A 5HQ0A 4A4XA 3OY1A 4ITJA 1YRPA 4M8TA 2WQNA 1Y6BA 3IGGA 3K3IA 2CKEA 4R6VA 5ANKA 3SOCA 1WBSA 4I22A 3K2LA 3DAKA 5FTGA 2XYUA 3F9NA 4O0TA 4USFA 3G9LX 2B0QA 2BTSA 1ZXEA 3FBVA 4WRGA 3COMA 3DU8A 4EOSA 3UOJA 4OBPA 4NM0A 5EH0A 4C4IA 3EQBA 3SXRA 5H9BA 3LFCA 3P79A 4XCUA 2R3KA 4F65A 3HMNA 5CWZA 2R3FA 3MFTA 1YW2A 4ZTSA 3PUPA 3HDNA 4U0IA 4DE4A 4WOVA 5HZNA 5HLNA 1OIRA 4XHKB 4YC3A 2QO2A 3F3WA 3DNDA 5IA5A 3TACA 1PXPA 4AZSA 4BC6A 4F0IA 3KF4A 3VF9A 4QPSA 2B53A 3ACKA 2QKRA 2ZB1A 4BGGA 4U8ZA 5HD7A 3LXKA 3NDMA 3SXFA 4XX9A 3D2IA 1CM8A 1ZYJA 2FA2A 2W05A 3I7CA 4NL0A 5AUVA 4MHAA 4JJRA 4FIIA 1FMOE 4E4MA 5TF9A 1YWRA 5FWKK 3COKA 3FHRA 2RKUA 4FIJA 4MEDA 2J0JA 4F08A 4PL3A 3C7QA 1QPCA 4FIEA 4O0YA 3CY2A 5B2MA 4E5BA 4BIDA 4O1OA 5CQWA 4RG0A 4NTSA 3GU6A 5AM7A 5A4TA 3TJCA 3DFCB 4IB1A 5E91A 3QBNA 4H3BA 2BRMA 4EK6A 5HG9A 4R7BA 3RNIA 3LJ0A 3ITZA 4MK0A 5HGIA 3V5LA 3VRZA 1PXKA 1W83A 2UZUE 4IZYA 5CU2A 2VNYA 3WBLA 3W8QA 3ZYAA 1GIJA 4XG8A 5AP0A 1YXUA 5DHJA 1SVGA 3NS9A 4UN0C 3C4CA 5HX6A 3A99A 3NUXA 3BLQA 3DJ7A 4RWLA 3QRIA 2XIXA 2C5OA 3M11A 4AA0A 1NT2A 4WBBB 4BWPA 3SG8A 3RI1A 2XEZA 2PZ5A 5LOHA 2VO6A 3IKAA 4IACA 4YBKA 3TNWA 4F7JA 3OW4A 5EKOA 2C6MA 4LV8A 4D5KA 2YABA 3V5JA 4YC6A 4MNEA 2VU3A 2PTKA 4JDKA 3MSSA 1MQ4A 4FG9A 4L45A 4CFUA 4IX3A 1A06A 4GRBA 2ITOA 4FIHA 4CMOA 5AP4A 4ACHA 5M4IA 1QCFA 4XV9A 4IAFA 4TT7A 3QTWA 3R2YA 5HIDA 5E1SA 4AWIA 4DN5A 3VS3A 2WQOA 4NEUA 3TWJA 2RFDA 1B6CB 4QYGA 4O38A 1UWJA 2P55A 1DI9A 3MA6A 3TKUA 5DIAA 2E2BA 3VUIA 4LGDA 2WB8A 2PULA 2QO7A 4FZ6A 3CP9A 4GT5A 4UWCA 4AGUA 4EC9A 4CTCA 4CLIA 3AT3A 3FLNC 4HZRA 3EN7A 4EHVA 4D9UA 4JAIA 2V55A 5J9LA 4IAYA 2UVYA 1P5EA 3V5QA 4PDPA 1PYXA 4FI1A 5L6WL 2P4IA 4TWOA 2BHEA 4FSRA 2BDJA 4H3PA 3RAWA 1NVQA 2VWIA 2H6DA 1VYZA 4AW5A 4YJQA 1WBPA 1GOLA 3B2TA 2C68A 4RIOA 3R8LA 3V5PA 4ALUA 4EUTA 3L9PA 1P4FA 5EQPA 4LRMA 2NNWB 3DAJA 3PFQA 4DG2E 5A14A 1IEPA 3NCZA 4I23A 4A06A 4RX5A 4F9AA 4IIRA 3JUHA 4LGHA 4EOIA 5B2LA 3S1HA 5J1WA 1PYEA 3ZZEA 3KU2A 5HU9A 4ZTNA 4X21A 5I9YA 3GC0A 3BYMA 3S4QA 4EKKA 3O8UA 4ZSJA 1QPEA 1PKDA 2WMTA 5M57A 4QYEA 3SGCA 3UYSA 4CKIA 4QTAA 2ERZE 2UZEA 2VX3A 2RIOA 3R71A 5BQ0A 1ZARA 2PMIA 4IC7A 3SW7A 4XOYA 3RPSA 1SMHA 4MQ1A 2OIQA 2CGWA 2GNHA 4BDCA 2JC6A 1ZAOA 2WTDA 3M2WA 3ORTA 3PJCA 4V01A 4BDBA 1V0BA 2Y6OA 4DFNA 2W96B 2PL0A 5F20A 4J53A 2C6OA 3UIUA 3QTSA 3DS6A 3VULA 3C5IA 5C01A 4TYIA 4F7NA 4Z16A 2PHKA 3QU0A 2GSFA 4RX7A 4D4SA 4UYAA 3GT8A 4TRLA 3F2NA 3QTQA 4JQEA 4E1ZA 3HV7A 3ZUUA 3HMMA 3UP7A 4O7VA 5DE2A 2X7GA 3Q96A 4FTQA 5TKDA 2UUEA 3UZPA 4HVGA 3OEFX 4C02A 4DFZE 3F61A 2ZDTA 3HECA 5KX8A 2I7QA 4YTHA 3ZBFA 2XNNA 1H1WA 1SYKA 5E92A 3Q3BA 2G15A 2GS6A 3HV4A 3KXXA 1IASA 2Y9QA 5DG5A 3G0FA 2I40A 1JVPP 2AC5A 2R3NA 3E92A 2W17A 5HI2A 3B8QA 4QT1A 4R8QA 4E20A 3ERKA 5CANA 3QCYA 4Q5EA 4S32A 2WTKC 4RLKA 4EOPA 3MPAA 3PSBA 4EZ7A 4ZY5A 2BAQA 4AG8A 4Z3VA 1IR3A 2Y7JA 3KRRA 1H00A 3COHA 4HNIA 4TTHB 2PU8A 2YISA 4JBOA 4C35A 3QALE 3CLYA 4HCTA 1JAMA 4BZDA 5AAGA 4JBQA 5HKMA 3ZFYA 4GIIA 4F09A 3A7GA 3OD6X 5C26A 4GK4A 1Q3WA 4TYEA 2IJMA 4FSNA 5JKGA 5IA2A 5L3AA 3BHVA 2Q83A 2OIBA 3F6XA 1XH4A 2QD9A 3HX4A 4JVGA 3TTJA 4EWHA 2XK8A 1NVSA 3PLAE 3ELJA 2JD5A 3E87A 4FYNA 2XK7A 4AS0A 4QMNA 4IH8A 5AIRA 3G0EA 2XA4A 3EWHA 3FQEA 3I7BA 3CTJA 3MB6A 3I5ZA 5CEQA 3P78A 2ITZA 1ZOHA 2OG8A 1XHAA 4D1XA 2FH9A 1JSVA 3FMMA 3PXYA 4GK3A 3ZM9A 3U9CA 3F3ZA 3QAME 3RK5A 5IH4A 5AFVA 5AAEA 3F3VA 2X8DA 3N9XA 4IWQA 2JITA 4BDFA 5BVKA 2R64A 3FV8A 4JX7A 5HVJA 4PWNA 3IONA 4I5PA 4K0YA 5IQIA 3BCEA 4J95A 2IZUA 4HVHA 4TYJA 4FIGA 3D0EA 4E26A 5HD4A 1WBOA 4FV8A 3GU5A 3LE6A 4GT4A 4O0UA 5A4QA 5BMMA 4KA3A 4FV7A 4DGOA 2OSCA 2YM7A 3P7CA 4FC0A 3QFVA 3PWDA 1JLUE 3FMHA 2JKQA 4AW2A 4U43A 2XKDA 2SRCA 5M55A 3TCPA 2WPAA 2F7XE 3TXOA 4ID7A 3UQGA 2IG7A 3W16A 4NZWB 3P7AA 4RRVA 5BYLA 3POOA 4RWKA 5EYKA 3BELA 4UBAA 2WU7A 1WBWA 5LQFA 4ZTLA 4ZTQA 5J9ZA 5CAVA 2YIQA 4PMMA 2WOUA 1GZNA 2UW3A 5KCVA 4GS6A 3SRVA 4A9YA 4TL0A 4ONAA 3TZ8A 3HRCA 3CCNA 3CXWA 2IPXA 2HELA 4UZHA 4C2VA 2W0JA 2ACXA 1OZ1A 3O2MA 4M69B 4AGCA 3A7HA 4FNZA 4FTCA 3S2PA 3W55A 2C6KA 4YLLA 2I0HA 3D15A 3FMEA 4BTFA 2A2AA 3LLTA 5CY3A 4QP4A 5LWMA 3D9VA 4ZAUA 2HCKA 2XKFA 3EKNA 4H1MA 3BHHA 5FM3A 3TL8A 2A0CX 4EQMA 5CASA 4DH1A 3H0ZA 4AFJA 4RBLA 4ACGA 3UYTA 1STCE 3FPQA 3FUPA 5BYYA 4IJ9A 3UC3A 3F82A 3G6HA 3HVCA 5KKRC 2XF0A 3FSFA 4QQ5A 3NVKI 4ASEA 1A48A 4I6FA 3QQFA 3JYAA 3BGZA 4GK2A 4L68A 2G2IA 5CU6A 5ETCA 3N51A 3EQRA 3A7FA 3OEZA 3FKLA 4X2FA 3I5NA 3KKVA 1ZMUA 5CXHA 4YSMA 4BTMA 4CFXA 4ZJVA 5HG8A 4JAJA 4PTGA 4KB8A 4IJPA 4IM2A 4BDKA 2YM8A 3VO3A 4XG2A 3PPJA 3UPXA 3F88A 4E73A 3HRBA 3FPMA 5FP6A 4QRCA 4UWYA 3TNHA 3TUCA 3EZRA 3FY0A 4UY9A 3TDWA 1ZY4A 2ONLC 3ZXTA 3R7EA 2F9GA 4CCBA 3QWJA 2W1IA 2OH0E 5F94A 3QKKA 4BGQA 2W5HA 2YIYA 1YWNA 4ZMFA 3D5VA 2HK5A 2JDSA 3FZRA 3EHAA 4U9AA 4Y46A 5DFPA 3KGAA 5HTCA 3WIGA 1AD5A 2EU9A 5EK7A 2GNGA 3O96A 4NUSA 1O6LA 3C0IA 3C4FA 4AGDA 3BV3A 4XRLA 4KWPA 4OT6A 1PKGA 3NWWA 3EL7A 4JRVA 3P9JA 3LCKA 4IANA 4IHPA 3L8VA 3R7GA 4DGLC 2YDJA 1YXSA 4BIEA 3U4UA 4UMQA 1CMKE 2PE1A 5BVFA 3RAHA 3FLYA 4P90A 1YQJA 4EH2A 4MBLA 2J5FA 3VBTA 5HE3A 2IZRA 3CKWA 1UU3A 4O81A 3VN9A 4CZUA 1Q8ZA 4O0RA 4RMZA 3U8WA 1VEBA 4JDIA 3Q6WA 4BRXA 5HCXA 2IWIA 3LXLA 2BRBA 4LL0A 4EHGA 1CDKA 3OXZA 4QYHA 5BVWA 3GU8A 3NYNA 2P2HA 4GUEA 3MVMA 4M69A 3UVRA 3OT3A 4FSYA 4WNMA 2OWBA 3BRBA 3QRUA 5GZ9A 3CJFA 1PMVA 1ZYLA 1TQPA 2RF9A 3OMVA 3UVQA 2R3HA 4NIFA 3QKMA 5FUTA 2XIYA 1XR1A 5D10A 1Q99A 2BHHA 2O63A 4A4OA 4RC3A 4XLVA 4BDHA 4PY1A 3NAXA 4F99A 3KXHA 3NAYA 3LW0A 4GT3A 2ZV2A 4DLIA 5GZAA 2WQMA 4U5JA 4V04A 4GU9A 3CQUA 3HMIA 3QWKA 4CFVA 2OH4A 3BHTA 4AE6A 1TKIA 4KIKB 2RFEA 4FTJA 4L67A 5E8WA 2CGXA 2XMYA 3LKMA 4AAAA 5CAUA 4YSJA 3SC1A 5GINE 4EWQA 4CXAA 5IF1A 1IA9A 3OT8A 4XOZA 3UZTA 2O3PA 1PF8A 4Z9LA 3MI9A 1ZYCA 2VN9A 2PVLA 3F5GA 4DTBA 3R7YA 4BI0A 4FKJA 4GH2A 1H28A 4YJPA 3AMYA 3E8NA 4YP8A 3GNIB 4FKIA 3AGLA 3V6SA 5H3QA 4BCJA 2EWAA 3W2PA 1PXOA 3E8CA 1M7NA 2VAGA 2OICA 3VBQA 3QTXA 3UQCA 3ORKA 4JX3A 3GFWA 4FL2A 5AP1A 4RVTA 5K0KA 5HBJA 4CYJA 2VTRA 2A27A 5CVHA 5F9EA 5KMLA 1OKZA 2BDFA 3LFSA 3T3UA 4FZFB 4AOTA 3MFSA 4WBOA 5J79A 2X7OA 4OAVB 3QGYA 4O7NA 4CV8A 4GCJA 3DFAA 4NFMA 4C57A 3ZLSA 3O8PA 3ALNA 3R73A 3QXPA 3R22A 4G16A 4DFLA 2FSOX 3NX8A 4RFYA 4B7TA 4E5AX 5M08A 3HV3A 4J98A 5TO8A 1W0XC 3QGWA 4KS8A 3UQFA 2YFXA 2ITXA 3U55A 3KK8A 3MY0A 4E4LA 4QMVA 2VWUA 1G8SA 4JBPA 4WNKA 4DF3A 4G31A 5DN3A 2PVKA 1U5RA 4JQ8A 4NFNA 5L2TA 1KV1A 3OXTA 4RA5A 4Y95A 5EDPA 3DLSA 4C4EA 4AQCA 4OAUC 4M3QA 3F69A 4PDSA 5JEBA 3PJ8A 3KCFA 3SD0A 2C1BA 3RPRA 4ZTMA 4O86A 4D1ZA 4EJ7A 1U54B 3QHRA 4I4EA 4XUFA 5FDPA 4IX6A 5E8UA 4BN1A 4UMUA 2W7XA 3AC5A 3BPRA 2CKPA 1YDSE 1BKXA 1GJOA 2GFSA 3G6GA 3H9FA 4RJ4A 3WARA 3D5WA 5A4CA 3ENHA 2XK3A 4AE9A 2IVSA 3AXWA 1OKYA 3IOKA 3QQUA 2C6DA 1V0PA 3R1NA 5AUUA 3VS0A 5A6NA 3VUHA 2R9SA 2W9ZB 1HCLA 4PNKA 3VAPA 3PG3A 2WMQA 4RZVA 3I0QA 2QOOA 4L3LA 3V01A 2REIA 3HMPA 3DBFA 2OKRA 4BHZA 1ZLTA 3A62A 4GG5A 1Z9XA 1ZZ2A 3VS1A 2QURA 4EYMA 4O27B 4F1MA 5BUJA 3FQSA 2ITTA 3UGCA 3D4QA 3SRVB 5HIEA 2BAKA 4K8AA 4R3PA 1BUHA 2ESMA 3VRYA 4BKZA 2EXCX 1R0EA 4FT9A 3GENA 2AYPA 4LRJA 3GC8A 2UZDA 4DEGA 3LJ1A 5CALA 4CKJA 4BTKA 5JGBA 3TV6A 1V1KA 4LOPA 1OPLA 2RGPA 2BR1A 2W4JA 2O5KA 4I20A 3PP1A 5G6VA 4DFYA 2OJGA 2IW8A 3MFRA 1PY5A 3GU7A 2I0VA 4RJ5A 5LARA 4IVBA 4F6UA 2GNIA 4X3FA 3ZHPC 2LGCA 3HUBA 5C03A 5L8LA 4ENXA 4HYUA 1ZOEA 2J90A 3BU5A 4H3QA 3NUPA 4AT5A 1WZYA 3QZGA 4QTDA 3BWJA 3FZTA 3K5VA 3M1SA 3IECA 1R1WA 2VO7A 4R5SA 4X3FC 4YO4A 3NW5A 4FA2A 2Z2WA 2LAVA 4A9TA 4PPCA 2J5EA 4YBJA 2X2LA 3NUYA 3SHEA 3OY3A 5HIBA 2F7ZE 4I6HA 4K9YA 5HNBA 2R3OA 1GZOA 2G2HA 1L3RE 3OCTA 3LIJA 4RSSA 4S31A 3EN9A 4ZY6A 4ZY4A 1FBNA 4EH8A 3OZ6A 2XKEA 3MY5A 1H1PA 4N0SA 5LMKC 4MAOA 5M07A 2DWBA 2HZ4A 3EJ1A 4TY1A 5IUGA 3MTFA 4OT5A 4RPVA 1MQBA 4HZSA 4KS7A 5BUIA 2OXDA 4NJ3A 3CPCA 4S34A 4DC2A 5HE1A 1TQIA 3E64A 1TVOA 2XZSA 3QXOA 3HAMA 1I44A 3QC9A 2YWVA 4R78A 2WELA 3CY3A 5IQDA 2YCRA 2PVYA 4TYHB 4Y72A 1XH9A 5JZNA 4JI9A 3ZOSA 5FTQA 2J2IB 5B7VA 5IH6A 4EJNA 3PRFA 4FEUA 3UDBA 3B2WA 4GJ2A 2Z8CA 2GHGA 3RHKA 2BZJA 2E9OA 4N70A 4R7IA 5IU2A 4B8MA 1M52A 4USDA 4GFGA 2V7AA 2VV9A 4C4GA 5EM7A 1M2RA 3NCGA 2X4FA 5DR9A 4WNOA 5T68A 3FI4A 5EDRA 2C6IA 2E9NA 4O7RA 3MS9A 4J96A 4AF3A 3G33A 3E8EA 4FKSA 1REJA 2GTMA 2R3QA 4YZMA 4CFWA 1ZOGA 4XNEA 3UNKA 4G3DA 2WEIA 5M56A 3GC7A 3H0YA 1A9UA 1Y8GA 2GNFA 5K3YA 1W82A 3PPKA 3UODA 4L00A 4CMUA 5M4FA 3FJQE 4B0GA 3D5XA 2Q0BA 4G5PA 4W8EA 4BVUA 4G6NA 3WZJA 3Q2MA 1PXJA 3RTPA 2YDKA 4MF0A 2DS1A 2JDOA 4FKPA 2R0IA 2GPHA 1LUFA 4D1SA 4K6ZA 2HAKA 2VTTA 4AFEA 3FI3A 4C0TA 2GQRA 3N4VA 3QZIA 1JKLA 3OF0A 3LQ3A 5EW9A 2YZLA 5I9VA 5G1XA 3NRMA 3R6XA 4C33A 2WQEA 3DXNA 3CR0A 1ZYDA 3LFAA 3LJ2A 4AN2A 4O7TA 2KTYA 5FXSA 3NIEA 4OGRA 5LVOA 2W1ZA 2VWWA 4UWBA 3ZUTA 5CZIA 4BYJA 4F7SA 2XB7A 3RZFA 5HESA 4CLJA 5HVKA 3M42A 4MBIA 4OTHA 4DFUA 4ACDA 1OI9A 3S95A 4UALA 4AZFA 3R7IA 1DM2A 3DZQA 1YHVA 5DA3A 2GS7A 4EH9A 3MVHA 4KBKA 2JFMA 3N4UA 4IADA 4BCMA 2XRWA 2Z7SA 3V5TA 4AN3A 3ZLXA 1JPAA 3NEWA 1K9AA 1YI4A 4HCUA 2V5QA 5BX0A 4EYJA 4F0FA 4C3RA 5B2KA 1R0PA 4A7CA 3MPMA 3LFBA 4I6BA 2R3PA 2HXQA 3PXKA 3OS3A 4LMUA 2F7EE 2QO9A 2I0YA 3KL8A 2HZNA 3BI6A 4YHFA 4JIAA 2PVHA 5DR2A 5DGZA 4AZVA 3RPYA 5DLSA 3DJ5A 5C4LA 4YNEA 3GEQA 3A4OX 1OIQA 1LP4A 3IQ7A 4XJ0A 4P5QA 1FINA 3PIZA 2VTHA 4PUZA 4AGWA 3WYXA 4D2WA 3LVPA 3GQIA 4IAKA 3ZRLA 2VTLA 2F2UA 4K2RA 2E9PA 3RAKA 1XBCA 2Y8OA 1OPJA 2X8EA 3CGFA 2VUWA 4YMJA 1LPUA 2XVDA 4GKIA 5J87A 3VUGA 2BCJA 3L1SA 3NNVA 4F9WA 4QMTA 3W32A 2GHMA 3E93A 4I41A 3NUUA 2YCQA 4FSZA 5D11A 5I9XA 2BRNA 4WUAA 2R3GA 2X7FA 5TR6A 4FKOA 1LEWA 5DMZA 3UO5A 4J7BA 1OECA 4CQEA 3BU3A 4WA9A 3PY0A 4YJUA 3GP0A 4I93A 3P7BA 3VBXA 3AC1A 3VBVA 3U6JA 3SDJA 4NU1A 3DXQA 4G9RA 3D5UA 2OI4X 4KIOA 1KOAA 4I1ZA 3V8SA 1MRYA 4CCUA 5IQHA 3FMJA 3ROYA 5ANOA 4JL9A 4NKSA 4UMPA 3SW4A 4AA5A 3UG1A 2WXVA 2X6DA 4OLIA 1J7LA 4Y5HA 4FZ7A 2BAJA 4HJOA 3WZKA 4RC2A 4FUYA 4GMYA 4RQKA 2X1NA 4C37A 3DT1A 4M0YA 5JQ8A 4YTIA 4ASXA 3NNUA 4L7FA 2CCHA 4K11A 4KKEA 1RE8A 3BHUA 5CEKA 2I0EA 1F0QA 2W99B 1L8TA 4MH7A 1RQQA 5DI1A 3LCDA 5JK3A 2HOGA 3Q04A 3ZZWA 1YI6A 3IW8A 3KN6A 4EH6A 3AMBA 4H1JA 1T46A 4BCOA 4R1YA 4YR8A 1H1SA 4IXPA 2YACA 3E63A 3MIAA 4KRCA 2Z7QA 4V0GA 4EOJA 3DKCA 3ORMA 4KIKA 1PXNA 3B8RA 3F3UA 1Q41A 4FTRA 4I94A 1Q97A 2G9XA 4H58A 3QYZA 5E8ZA 2C5VA 3BLHA 3DK3A 3R1QA 2W9FB 4BCFA 4QP2A 2CGVA 5KMMA 1PXIA 4FTTA 4UXLA 3E7VA 3MPTA 4L6QA 1J7UA 3DNEA 4NKAA 2GS2A 3QA8A 3U4WA 5EQEA 4DGMA 2CDZA 3FYKX 2OBJA 4UMRA 4CFNA 4XP3A 3UIXA 4DH8A 3EQPA 5C8KA 5EOLA 1CSNA 2BALA 2CCIA 3LFFA 2EUFB 3FMKA 3MBLA 2W1GA 4LQMA 4P2KA 4YJOA 5ETAA 4L8MA 3OTUA 1WVWA 3Q9YA 4YJTA 5J7HA 1FMKA 1IA8A 3CD8A 2QQ7A 2CLXA 4OBOA 1XBBA 4QNYA 3RKBA 3UOKA 4O0XA 3A8XA 5J5SA 4G5JA 3EFKA 4UYNA 3DA6A 4W9WA 5HICA 4X2NA 2PZYA 3V8TA 2QU6A 2P0CA 2BIKB 3GCPA 2QOHA 4HNFA 4F7LA 3MY1A 1XO2B 2OF4A 4ANSA 4CZYB 4O22A 4RC4A 1OPKA 4NM5A 5D1JA 5EI8A 4NM7A 3JY9A 5I0BA 2XBAA 3AC3A 1UKIA 2QLQA 3WF6A 4F0GA 5CVGA 5AUYA 4EONA 2X9FA 1E9HA 2BFYA 3WE8A 2JKOA 5JSMA 3FI2A 4OTRA 3QQGA 2IVUA 3CGOA 3UZRA 3HP2A 2WMUA 3TNQB 4D0WA 4E6CA 2OJIA 1KV2A 3NYVA 4LG4A 2B9JA 1RJBA 4FT5A 3F2AA 4FNXA 4IM3A 3W2SA 1PMUA 2P3GX 3R0TA 4KBAA 2IO6A 4EH3A 4P7EA 3VVHA 3Q32A 4ZLOA 4DAWA 3MJ2A 1FOTA 4JBVA 3FZSA 4O84A 3RPOA 2X2MA 4G3EA 3FYJX 4YHJA 3REPA 4IZAA 3DKFA 3ANQA 4UB7A 2W4OA 1XH6A 3QZHA 3EQHA 2F57A 4WT6A 2B55A 2UZNA 3RCJA 5ANGA 4FOCA 2PVNA 5DRBA 5AV4A 5HEZA 2V0DA 4M84A 3R8ZA 4BDEA 5HNIX 4O7SA 4DA5A 5TOZA 2WIHA 2XIRA 3DV3A 4EORA 2C47A 3DBCA 5JQ5A 5HCZA 4OTIA 5D9HA 3PE2A 4HPTE 5K0XA 3KQ7A 3RZBA 4PF4A 2ZDUA 5CEMA 4PMPA 2YIRA 5IQAA 2G1TA 4MWIA 2YM5A 4EK3A 3BQCA 2H8HA 2R3MA 4FV0A 2C6LA 4L52A 3TKHA 2ONLA 5EM6A 2B7AA 3L9MA 3OHTA 3UIMA 5KNJA 3NLBA 4DH3A 4FVRA 4A9UA 1NW1A 4O7ZA 3ZXZA 4FEXA 4KBCA 4Y85A 5DBXA 4BYIA 4FTLA 2JKMA 3Q4CA 4MYGA 2EB3A 2WEVA 3TZMA 4QPMA 3PWYA 3PYYA 3R9HA 4ZLZA 1KE6A 4XV2A 4CFFA 1SVHA 4F6SA 4BWXA 1X8BA 1GIIA 4DTAA 4JDJA 2R7IA 3RCDA 4EOOA 4HPUE 4QOXA 4FV2A 4YLKA 2UZTA 2XRUA 5HNGA 4FV9A 4AW1A 4IWPA 2OZOA 3DGKA 3IS5A 3TDVA 3CJGA 2QU5A 4QYYA 2J51A 4IB5A 2UW8A 3KF7A 4CVAA 2F4JA 4I5CA 1H27A 2YWPA 4M12A 2I6LA 2XK4A 1OGUA 2VX0A 1SM2A 3OWPA 3F2RA 2WTIA 4E3CA 4LFIA 2CNVA 3IPHA 4MD9E 3RM7A 4JNWA 4WO5A 2VGOA 5IISA 3ODYX 2VWVA 5BUEA 5I9UA 3NMUF 3DK6A 3LCOA 2PVJA 2C6TA 2XNPA 1TQMA 1BI7A 3F66A 3OBGA 4G2FA 4YZCA 3DAEA 4FV1A 2OJJA 4L9IA 4AT3A 4BZOA 2QG7A 4FX3A 2QR8A 5H2UA 2VWYA 5IA3A 1Y57A 2C3LA 3QD0A 4O21A 5CT7A 5DVRA 4HVSA 2C3JA 3C51A 5HG7A 1EH4A 4QP7A 2EB2A 3NNWA 3ZO2A 5LMKA 4RGJA 3FSKA 4LM5A 3C5UA 1JBPE 3OVVA 3MH2A 5CF6A 3I81A 4BCIA 2WMBA 4FSWA 2BIYA 1WBTA 4CRSA 4XP0A 4KINA 4IWOA 4RWJA 3MN3A 3G15A 4OR5A 4YPSA 3FZPA 2W1HA 4GFOA 5T6KA 4QMSA 1URWA 3G5DA 3BX5A 2QOFA 2AUHA 2WGJA 2X39A 2XYNA 4HOKA 4ANLA 2FB8A 4IB3A 5E8YA 4C3FA 4C4JA 3FMNA 4EOMA 3F3TA 4FK6A 3W2RA 4AX8A 5C8NA 1K3AA 3NUNA 4QNAA 3R7OA 5CLPA 3UO6A 1KOBA 1H26A 3GCSA 1ZWSA 2ITYA 5AV3A 1FQ1B 3D94A 4XH6A 4CZTA 4ANOA 3G9NA 2RFSA 4V05A 1GZKA 1S9JA 4U3YA 5KMKA 3DBEA 3DB6A 5CZHA 4IM0A 1WAKA 3ZRKA 4PQNA 3CC6A 2W5AA 3KK9A 3RBWA 4IWDA 3KRXA 4QMMA 4FKGA 4FV4A 2FUMA 5FBNC 1CKIA 3JS2A 4A4LA 1M17A 4TWNA 2YEXA 3FKNA 3LM0A 4RX8A 4RFZA 3TZ7A 2EXMA 2WOTA 4DT8A 3FXXA 4C34A 4ANBA 5JGDA 1GAGA 3R83A 3EZVA 3ZDIA 4YJNA 3II5A 3BE2A 4FTUA 3RM6A 2BVAA 3FL5A 1Y6AA 2PVRA 5HORA 2OZAA 3VQUA 4GL9A 2YIWA 3KULA 4PDYA 3P23A 1Y8YA 4FSTA 5J8IA 3GOPA 5L6OA 2X0GA 1PW2A 3ZH8A 4RJ8A 1VJYA 3TNIA 4WUNA 3EYHA 4TXCA 4RJ7A 3OCSA 3FXZA 4F1TA 2GFCA 5JZJA 3MESA 4QP6A 5ANEA 4HVDA 1CKJA 1OIUA 3GQLA 5CX9A 3ZSHA 5IZFA 4MF1A 4D2RA 2BKZA 4FUXA 3WILA 5L2IA 4FODA 4YO6A 2FO0A 3RAIA 3EQCA 3VS6A 4GVJA 4F6WA 2ITVA 2CMWA 3OUKA 4BCHA 1WVYA 3OUNB 4UZDA 1P14A 4BF2A 3BE9A 3FEGA 3QRKA 5HOAA 5C27A 1E1XA 4F64A 1OL1A 5HHWA 1T45A 2UW6A 2JBPA 2CN5A 3KN5A 4FKLA 4YURA 2Y4IB 4XRJA 4QQTA 5LMBA 3ORNA 5AV2A 4CT2A 3A2CA 4C3PA 2PMNX 2GNLA 4MBJA 4FIFA 4I3ZA 3HAVA 3U87A 2WHBA 1KSWA 3FC1X 3PJ1A 3WIKA 4U45A 5AWMA 5J5TA 4PMSA 3PVBA 4ZEGA 2FYSA 2XP2A 5AR4A 3TEIA 1PRYA 1Q8UA 5FEEA 2VTAA 4CEGA 1XWSA 3BQRA 1FGKA 4FT3A 4EH5A 3CQWA 4OTFA 3P0MA 4BR3A 1G5SA 3KVXA 5DT0A 4GKHA 4ZS4A 2OGVA 2ZM1A 3C0GA 3ETAA 3I0OA 2NPQA 5BPYA 3ATSA 2XCKA 3KMWA 2JFLA 5M44A 4EK8A 5K5XA 3AD4A 4NWMA 4QP1A 4H05A 1F5QA 4O0VA 5C8MA 3OP5A 4FR4A 4YUQA 3NPCA 5E8TA 5DOSA 4QTCA 3SX9A 3Q6UA 4FV5A 3UC4A 4L3JA 2R0UA 2X2KA 1WVXA 4FEWA 5H8GA 2VTJA 4DH7A 3QX4A 2YA9A 3BYOA 4LMNA 4MQ2A 4LOQA 1BYGA 4JG8A 3WE4A 3MA3A 3FZOA 1NVRA 2R3JA 2VD5A 3UMXA 1KE8A 3DOGA 4JR3A 3CD3A 3AC4A 3CTHA 1ZZLA 2ZMCA 4PX6A 2C6EA 2Y0AA 2Z7LA 4PV0A 5BVNA 5J9YA 5AA8A 2R3IA 1JOWB 3FE3A 3OFMA 5FEDA 5LVPA 3MVJA 5CXZA 3TM0A 4RVKA 1BL6A 4ZK5A 3MFUA 4FT7A 3QUPA 3ET7A 4HW7A 3BGPA 4NM3A 4Y5QA 4U80A 2CKQA 4D0XA 3ZU7A 2ZMDA 3KRLA 2OFUA 5LVMA 2YIXA 1OL5A 4DEEA 5C4KA 2IVVA 3DBDA 3ZCLA 3U51A 4EQUA 4DCEA 4ENYA 1H4LA 4I4FA 3ULZA 3POZA 3KXGA 3BBTB 3C4WA 3Q60A 2ZV7A 3O17A 5CSVA 2C0IA 3PIYA 3C4EA 2E9UA 3KMMA 4MXAA 5HCYA 5HTBA 4ZOGA 4L46A 3QX2A 4PP9A 2WMXA 1FVTA 2O65A 2YM4A 1LEZA 4DGGA 3QTZA 4DTKA 4ZLYA 3FAAA 1H8FA 5LVLA 5EM8A 5L2SA 5EDQA 5DT4A 3EQFA 4FEQA 5CEIA 1OM1A 5E8XA 4QQCA 4FTAA 5IMXA 2OXYA 2WMVA 2PZIA 4LI5A 3FY2A 3THBA 2UW9A 5HU3A 3BYVA 4IE9A 4IQ6A 4OW8A 3VS4A 4OTGA 4LOOA 2OJ9A 2QKWB 4FZDB 3FDNA 3CKXA 3PZHA 4NTTA 2GHLA 4PRJA 1H25A 4HVIA 3PP0A 4GJ3A 4QQJA 5LCKA 2RG5A 3PIXA 4J52A 4QTBA 5D12A 3NW7A 3AG9A 2BKKA 4TZRA 4ARKA 2GQSA 4L44A 5KBRA 4OBQA 2ZM4A 5AR8A 2UZBA 3W10A 2YJRA 4KUJA 3PRIA 4TN6A 2C1AA 2J9MA 3MWUA 2AC3A 2Z7RA 1Z57A 4R1VA 3R8UA 3VJNA 2BUJA 3TV4A 4X6QC 4MTAA 4YNOA 4UV0A 5AP3A 5FQDC 5KZIA 2ETRA 3MYGA 1W98A 3KXMA 2W4KA 5J1VA 4X2KA 2PE2A 3ZTXA 5JGAA 3HEGA 4E4XA 4L53A 4BZNA 4G34A 5F1ZA 3H10A 4Z7GA 2UV2A 3LCTA 4BCQA 2GU8A 3I6WA 3NYOA 3IW6A 5CSXA 1ERKA 3CTQA 4QMWA 3R00A 4K1BA 4E7WA 3FQHA 4PNIA 3VUDA 2VTMA 4S2ZA 5AIKA 4ANMA 3LQ8A 4XV1A 3ZS5A 3PXQA 1JKKA 4D58A 2WO6A 3HA6A 3RALA 3DTCA 3CEKA 2XM9A 1HCKA 2C4GA 4J1RA 4D2SA 1Q61A 4PP7A 2FSLX 3Q9ZA 4QP9A 5AR5A 3RHXA 4O0WA 1G3NA 3DXPA 4NH1A 2HY81 3HYHA 1DI8A 3IW5A 4LUEA 4F70A 4AOJA 4FEVA 2HW7A 3P86A 3TV7A 4FVPA 3AQVA 5EOBA 3CSVA 4AACA 4JG6A 1WBNA 3VBYA 3PA3A 3EB0A 3PXFA 4I5HA 5IA1A 4F9YA 2VWZA 4QMYA 4IDVA 4U81A 3R7UA 3VUMA 4IW0A 5I4NA 4OTQA 4RIWB 5A4LA 4AZTA 3UP2A 1YVJA 5A54A 2PMOX 4CG9A 4BY9E 1PXMA 4EH7A 4ALWA 5AUXA 3QQKA 1W7HA 1MUOA 1XBAA 2NP8A 1OKVA 3WF5A 5BVDA 4F9CA 3BBWA 3K5UA 2PE0A 3MVLA 3D83A 3UMWA 1UV5A 3EQDA 3PY1A 3QLGA 3U9NA 3ZDUA 4XBUA 1UNHA 1UNGA 5JFVA 3LMIA 5IQEA 5ICPA 2ZM3A 2PVFA 1B39A 3BEAA 1R78A 4RLLA 4WKQA 4S33A 4NW5A 3Q5IA 3KMUA 3L8SA 3W18A 5D41A 1GY3A 4BHNA 3MV5A 1JWHA 3A7IA 3QD4A 4J71A 3TJDA 3EKKA 4K33A 4AU8A 4FTNA 4QPAA 3MB7A 3NUSA 4O96A 2WTKB 3HLLA 5F4NA 3WYYA 1WMKA 3NW6A 5BVEA 2ETMA 3SVVA 3QF9A 2VTQA 2UW5A 3ANRA 3LAUA 4RVLA 2YZAA 4BIBA 3LQ5A 4YTFA 3U6IA 2R3LA 4Z55A 4I0SA 4XLIA 4YC8A 5AV1A 4ZZOA 5BYZA 4C62A 4FKTA 3KVWA 3Q4ZA 3QCXA 3QCQA 4E6AA 2B4SB 4PL5A 3G2FA 5LMAA 2QOBA 4FKVA 4JQ7A 4BICA 5L6PA 3PXZA 3QUEA 4XG7A 1IAHA 4JLCA 2C30A 3ID6C 1OITA 4QMQA 1UU9A 4W4YA 5DT3A 2XJ0A 3C4ZA 4GFMA 5ANJA 3GI3A 2A19B 3EQIA 4Q9SA 4FVQA 4X3JA 2HIWA 5TT7A 1FVVA 1S9IA 2UVZA 3Q9XA 4XYFA 5AMNA 1Z5MA 4EZ3A 3KREA 2UW4A 5ETFA 3V51A 1PMEA 3HZTA 3U6HA 1PMNA 3GUBA 4RIWA 3LXPA 4YZDA 4BWKA 4ZP5A 3ZO1A 1KUTA 3FMDA 1YDRE 3ZFMA 5AX9A 4ZJIA 4HGTA 4O7WA 3A7JA 4IX4A 3SV0A 5CU4A 2ZV9A 5AP5A 3IOPA 5IDNA 4GYIA 3VWAA 4C59A 3UOLA 4DFXE 4FT0A 4IC8A 5FM2A 5HTIA 3BKBA 3BWFA 2HW6A 4JR7A 4EBWA 3ZRMA 4R77A 4CG8A 3GGFA 5DEWA 3QC4A 4YZBA 5BNJA 4O6EA 4XBRA 4U3ZA 3UVPA 4U42A 4I0TA 4QMPA 1OMWA 2XS0A 1YOLA 2CN8A 4ZTHA 3PDTA 2CSNA 4MXXA 4DEHA 3A8WA 2YERA 1H0VA 5L2QA 4DG0E 5J95A 4FTOA 3RNYA 3W8LA 4MD8E 2FSTX 1P4OA 4FK3A 4DCAA 5I9ZA 5KBQA 1YXTA 4QP8A 4RZWA 4WRSA 5AR7A 3R9DA 3VNTA 3DCVA 4IBMA 4FL1A 1GNGA 2DQ7X 4MNEB 3ZC5A 4CV9A 3P5KA 4BFMA 2JAVA 1H0WA 2O0UA 3HV6A 3OWKA 2YITA 5GNKA 4C36A 1I09A 2QOIA 4IVDA 2YAAA 3PTGA 5H8BA 4U44A 5L4QA 3TT0A 2CKOA 4QTEA 3BZ3A 4BDGA 4ERKA 3R28A 4IFGA 4QYFA 3BU6A 2Z02A 2XNEA 2B9FA 2UZLA 4U7ZA 5IUIA 1JQHA 2IN6A 4EHEA 1NXKA 3S3IA 1U54A 2WU6A 1J91A 2XNMA 3AC2A 3DDPA 3I1AA 2XIZA 5CI6A 5AUWA 5AX3A 5LJJA 3NUAA 5K4JA 1H01A 2EXEA 5K4IA 5JRSA 4BL1A 1YOJA 2XH5A 3E62A 2QI8A 4QMOA 5DPVA 2H9VA 1HOWA 3LMHA 4KIQA 4QMLA 3GCUA 5EQYA 4O2PA 2ETKA 1VR2A 3ORLA 5AA9A 5CEOA 5IQBA 3LFEA 5HE2A 2UZWE 3IG7A 5LCJA 1SVEA 2OK1A 3DLZA 5ANDA 2DYLA 1M7QA 1O6YA 3KRWA 4QP3A 5CSWA 1YHSA 3TUDA 3LMGA 3A4PA 4L3PA 4AP7A 4F4PA 3RGFA 4NK9A 1U5QA 3JVRA 2VTOA 5A3XA 4L01A 4UMTA 3KEXA 1AQ1A 3R04A 4D28A 4DG3E 4G9CA 3OXIA 3R2BA 2PPQA 2W1CA 3OCGA 4DGNA 4O7LA 3ORIA 2P33A 3PVUA 3VJOA 2QOLA 3HRFA 5IQFA 3FI8A 4BKYA 4IDTA 3KULB 4KD1A 2R2PA 3PVGA 3QTRA 1IG1A 4EHZA 4C61A 3H30A 3HNGA 3QLFA 4DBXA 4IVAA 4O1PA 4XMOA 5DYJA 5FG8A 4YZ9A 3EMGA 4U6RA 3RWPA 1ZRZA 5IPJA 2CNUA 2XIKA 2YN8A 4D2PA 2JIIA 3OG7A 4W4WA 3COIA 4X0MA 5HX8A 4F63A 4G3GA 1V0OA 4FL3A 4W4XA 4G3CA 4RIYA 4XG9A 5CF4A 5JFWA 4A9RA 2R4BA 5J7BA 1QPJA 3LPBA 2YCSA 4TPTA 2JIUA 3FWQA 2XNGA 3CPBA 3L8PA 2FSMX 4IZ7A 4F9BA 3R02A 4ZSLA 2VZ6A 2JBOA 3HL7A 3IGOA 4IFCA 4IZ5A 4MX9A 4DH5A 3AD5A 3DZOA 3EN4A 4EUUA 4HYHA 5CSHA 1YDTE 5L2WA 2X4ZA 2PK9A 2QG5A 5AEPA 4BDIA 4LGGA 3JPVA 2WIPA 4M97A 3WOWA 2VTNA 3VHEA 4AUAA 1W84A 2RG6A 4M0ZA 3E8DA 4BKJA 3MH0A 4N6YA 4JG7A 2B52A 5M4UA 3C13A 1PHKA 3BGQA 4JRNA 5FGKA 5KE0A 1PJKA 1Q24A 3ZUVA 5C1QB 4USEA 4WG4A 1YXXA 4II5A 3JR1A 3R8PA 1ATPE 3VS7A 1MRVA 3FLQA 3PG1A 4XS2A 3QL8A 4D9TA 3HDMA 4O7YA 2YM6A 4XV3A 4GIHA 4QMXA 2Z60A 3QD3A 2O8YA 4UXQA 4WD5A 4CD0A 4EK4A 5FBOA 4XG6A 4ZZMA 3KRJA 3AD6A 4ASDA 3NYXA 3UG2A 1DAYA 3MJ1A 4YU2A 1YI3A 5AR2A 3TZ9A 5A46A 2B1PA 5DRDA 5T3QA 4FTIA 3O0GA 3QQLA 4O0SA 3BLRA 4YGAA 2QHNA 3C9WA 4MWHA 3D14A 3TKIA 1QMZA 3GOKA 2VWBA 2WD1A 4RIXA 5JH6A 5HBEA 2XK9A 2C3IB 2VX1A 4CGAA 4FE2A 4DEBA 2OFVA 1H24A 4K18A 5AP2A 4GYGA 4PTEA 5CI7A 2WTJA 2HWOA 4B9DA 2QNJA 2JDTA 3VW6A 5H8EA 4G3FA 4OUCA 2HYYA 5AUTA 5KZ0A 3H9OA 3VUTA 4JOAA 4DLJA 3OWJA 4Z7HA 4JIKA 3OWLA 4RT7A 1KE7A 2UW0A 3MH3A 1H07A 2GTNA 2VWXA 5AP7A 3KFAA 2FGIA 5D7AA 3UO4A 4BCGA 4FG7A 3LM5A 4TKSA 4C4FA 1RW8A 2UW7A 1UU8A 4U41A 4FTKA 4ZJJA 2WKMA 4QO9A 5CF8A 2VTPA 5DNRA 3WZDA 1GIHA 1F3MC 3QYWA 2NRYA 5EHYA 4D4VA 3QTIA 1QL6A 5EM5A 4DEIA 2YJSA 3ZO4A 3DDQA 5B0XA 2Y4PA 3DQWA 2WZJA 3QZFA 4ZIMA 1UNLA 3DQXA 3F7ZA 3KXNA 4I0RA 1Q3DA 3V04A 1KE5A 1Q62A 2GMXA 2BPMA 2WMWA 4J8MA 1LR4A 5FDXA 1BX6A 4CRLA 3AMAA 5E4HA 3BV2A 4RIYB 4XEYA 2BFXA 2XJ2A 3EFJA 5GJDA 4Q9ZA 1M2PA 4ZZNA 4KKGA 5M4CA 4ZSAA 3LLAA 4TWPA 4AT4A 1IRKA 4OTDA 3KC3A 2B54A 3VC4A 1XH7A 3LXNA 5D7VA 3TNPC 4G17A 5A4EA 2H96A 4D5HA 4FBXA 3OOMA 5AADA 3R1YA 4R3RA 4X7QA 3E3PA 4HYIA 1M14A 3FKOA 4Q5HA 4X3FB 4EOQA 1XH8A 1FGIA 5HLPA 5ETIA 1NA7A 5FRIA 2IVTA 5EHOA 3BYUA 2JGZA 4KRDA 3H3CA 3ZSGA 5HO7A 2JIVA 3EFWA 3GB2A 2WMAA 3FMLA 4NIFB 5FXQA 5BMSA 3KA0A 3C0HA 5DH3A 2ZB0A 2NRUA 3O23A 5CENA 1U46A 4BI1A 1FPUA 1KWPA 2BZHB 3HA8A 3R9RA 4BBEA 3L9LA 3E3BX 2C5YA 2QLUA 1VZOA 3C4XA 4WHZA 1CKPA 1ZYSA 2HENA 1KE9A 5TE0A 4C38A 1JKSA 2FVDA 3EOCA 4EEVA 4N4SA 4DEAA 5JT2A 4BCPA 4E6DA 5FEQA 4CKRA 3FL4A 5GIOE 5AUZA 2W1EA 3QQHA 3RK7A 2BTRA 4MXZA 4ZS0A 3PE1A 4ZSEA 5KUPA 3D7ZA 4G1WA 3ATTA 2R5TA 5I5ZA 3W33A 1OKWA 2E9VA 2EVAA 3TIZA 3VBWA 2QOQA 4PTCA 4AOIA 3UOHA 4LUDA 4PL4A 1B38A 5HO8A 1MRUA 1ZY5A 2V7OA 4FOBA 4ITHA 1G8AA 2ITWA 1WFCA 4N6ZA 4AN9A 5AV0A 2IW6A 5L8KA 4RIXB 1W8CA 5EHLA 2B9HA 3R9OA 3AT4A 3AT2A 4HGEA 4WG3A 4IMYA 2G01A 5IA0A 3F5XA 3PSCA 2BZKB 3WI6A 4F1OA 5CAPA 4R5YA 1MP8A 3RP9A 3QQJA 4D55A 5IKWA 3Q53A 4TNBA 2W06A 4NCTC 1WBVA 3DK7A 1J1BA 3TN8A 4AA4A 4AZWA 2OF2A 4RA4A 4NJDA 5IUHA 4GU6A 5CT0A 1Q5KA 3JXWA 3O8TA 5KMIA 3NR9A 3RPVA 4MVFA 3T8OA 3QRJA 4BCNA 3HKOA 3O71A 4EOLA 4UX9A 3OCBA 4W8DA 4J8NA 5EW3A 5I3OA 3ZEPA 3VS2A 3HV5A 3PA5A 5HE0A 2J50A 3QCSA 2PUIA 4KABA 5DR6A 4V0GB 1O6KA 3RK9A 3UBDA 5M51A 3C1XA 2ZOQA 4M67A 5JN2A 4TNDA 5ACBC 4EK5A 3VW8A 3SKCA 2J0MB 4ITIA 4IB0A 2OLCA 4FGBA 4HYSA 4YTCA 2J7TA 2PYWA 3W2QA 2C69A 3P4KA 5CU3A 3EYGA 3WF9A 5IQCA 5FLFA 2OO8X 3F5UA 3PSDA 2PZRA 3TIYA 2YM3A 4R7HA 4Y8DA 3Q4TA 4D4RA 3CS9A 4LV5A 3NVMB 3PZEA 2IZSA 2X8IA 5DWRA 3NZ0A 4J99A 3VF8A 4NSTA 4U97A 3I6UA 3P1AA 5LVNA 1Q8WA 3OW3A 4TWCA 1SZMA 1VYWA 5IDPA 2XCHA 5CAOA 2O2UA 3SA0A 4OTWA 3DY7A 3T9TA 3ORXA 2V22A 1Q4LA 3R8MA 2WAJA 2X81A 1JSUA 3Q9WA 5CNNA 3O51A 1DAWA 3WF7A 5CAQA 5IEXA 5LXMA 4O82A 2C5XA 3PJ3A 1J3HA 1OL2A 2UZOA 1DS5A 4KKHA 1IAJA 3R30A 4N57A 4TYHA 4CSVA 4C58A 2YAKA 4G6LA 1UU7A 4IVCA 2VRXA 4X2JA 3ULIA 1JSTA 2A4LA 3OC1A 5EYCA 2GQGA 4J97A 1J1CA 5AAFA 3W1FA 5CF5A 2XEYA 2ZJWA 4APPA 4IEBA 3AC8A 3R8VA 2ZAZA 4AXAA 3OROA 5GHVA 4MKCA 3IDBA 4YJVA 3VUKA 3HMOA 3JVSA 4CNHA 3WZUA 3ORZA 3O50A 3R7VA 3W2OA 3ZMMA 2VNWA 5E8VA 5JFXA 3ODZX 4BCKA 1H1QA 1Y91A 1OUYA 3V8WA 4MXCA 2J0LA 4CQGA 3T9IA 2X6EA 2Y4IC 1NY3A 4GVAA 3RINA 1YKRA 2GCDA 3GFEA 5KMJA 3GXLA 3UIBA 3BIZA 3MDYA 5E7RA 4Y73A 2JLDA 5EI6A 5ITAA 1OBGA 1BLXA 4AZEA 3DPKA
chains in the Genus database with same CATH superfamily
4DHFA 3QA0A 4HGLA 2QCSA 4B6LA 3R63A 2BRGA 1Q8YA 3TG1A 4CFMA 4KSPA 2HZIA 5A6OA 5IMEA 2XJ1A 3BEGA 2G2FA 3PLSA 5IA4A 1FVRA 5C9CA 3R9NA 4XG3A 4GEOA 5L8JA 2V62A 1OUKA 3E88A 4YJSA 3NNXA 5FD2A 4GUBA 1BL7A 4B99A 3LCSA 3H4JA 3KY2A 3LFNA 4KNBA 4M15A 4S30A 4EI4A 5CS6A 3GCVA 3RWQA 3UJGA 2JEDA 4I92A 4RFMA 3LHJA 4RWIA 3IDCA 3P08A 5EYDA 3KXZA 2CNQA 3NIZA 4U40A 1JKTA 1YOMA 2NO3A 3ALOA 2BMCA 1QPDA 3UVRA 3LZBA 3MTLA 4WG5A 4ACCA 3A61A 4EH4A 4KSQA 4P4CA 2OXXA 2QOKA 3OTVA 3FHIA 4FF8A 4NYEA 2NYAA 3JY0A 3MH1A 4A9SA 2HXLA 1BMKA 3OOGA 5IH5A 4IAZA 4XG4A 4MD7E 4WIHA 3HGKA 1ND4A 1UA2A 3BL9A 3AOXA 2IW9A 2XNBA 3D7TA 1O9UA 4NT4A 3ORPA 3PPZA 4DITA 5KMNA 2F49A 2ZVAA 2PVMA 1WCCA 2ITNA 4E93A 4E8AA 4FSQA 2CLQA 4FKRA 3UE4A 2HZ0A 4FG8A 3SAYA 2ITPA 1REKA 4DINA 5M09A 3KCKA 3CIKA 3SLSA 1XMLA 4GW8A 3FXWA 4LYNA 4E4NA 5IEYA 5HLWA 3AGMA 4JXFA 3ROCA 3GCQA 3I60A 2PUUA 2O64A 3E7OA 3H9RA 5A9UA 3IW4A 5EKNA 3PJ2A 3BHYA 5CTPA 5HO6A 2B9IA 4YLJA 3KB7A 2X9EA 2VO0A 2J0KA 2VTIA 2XNOA 4Y83A 4EOKA 3LOKA 2J0IA 3N4TA 5AM6A 4FYOA 2YLEA 3RVGA 4O6LA 2QOCA 5GZ8A 3SQQA 3CE3A 1OIYA 4M13A 3BL7A 4D4YA 1XKKA 3EN5A 5I3RA 3EQGA 2C0OA 3F5PA 2CGUA 2ITQA 4FV3A 5KO1A 3RMFA 3ZFXA 1K2PA 3WZEA 4RQVA 4RJ3A 5E90A 4O83A 4K77A 3O7LB 3QUDA 3S0OA 5CQUA 5CNOA 4ORKA 2H34A 5FP5A 3ZLWA 3ACJA 1H08A 3ENMA 4CTBA 3MGYA 3ZLYA 3AKJA 4W9XA 2WTCA 2JKKA 4BB4A 4FSMA 4FMQA 4MXYA 3NGAA 4X2GA 1OL6A 3LFQA 5K9IA 3HP5A 3V5WA 4R3CA 3VHKA 5EYMA 1JNKA 4MCVA 4FKQA 1OB3A 4GG7A 3RJCA 3F7WA 4FSUA 4PMTA 2ZYBA 2YCFA 4MXOA 4A07A 4HGSA 5KHWA 1U59A 4Q2AA 2RL5A 5FXRA 2QC6A 3DBQA 2DUVA 4FICA 4I6QA 1CTPE 4IX5A 2BROA 3V3VA 5HG5A 3R21A 4BBMA 4DFBA 3ZEWA 3MIYA 3FLSA 4CYIA 2XM8A 3G90X 3LFDA 2W1FA 3W0MA 4E6QA 3PA4A 2CJMA 2BZIB 3ZBXA 1P2AA 2PY3A 4BDDA 1U4DA 4O91A 3E5AA 5I9WA 5M06A 1YWVA 4YHTA 3Q2JA 3W2CA 3GBZA 3QTUA 1Q8TA 1XQZA 2GNJA 4I5MA 2I1MA 3FC2A 2JDVA 3TUBA 2R3RA 2W5BA 2YDIA 4IAIA 4APCA 4DBNA 2XK6A 4X6RA 4H39A 2VO3A 4D2VA 4NW6A 2ZV8A 4G6OA 3TI1A 1SNUA 2BDWA 3DJ6A 3GVUA 3K54A 1M2QA 3UTOA 4EKLA 4ERWA 3C50A 5E8SA 3VIDA 4GV1A 2WTWA 1R3CA 2JDRA 2VGPA 3EFLA 5KMOA 1YXVA 3FLWA 5E9EA 3L9NA 2CHLA 3PY3A 5AJQA 5E1EA 5AP6A 2WQBA 2C3KA 5GIPE 2XKCA 5JRQA 4RJ6A 3ZO3A 4L7SA 4YJRA 4BI2A 2F2CB 5IG1A 2BILB 4BTJA 4FGRA 4FNYA 2QVSE 4YPDA 5JFSA 2UZVA 2WMRA 1AGWA 3UPZA 3U54A 4FTMA 3UNZA 1R39A 3HUCA 3QD2B 4FKWA 4ANQA 4UEUA 4WSQA 4GSBA 4TW9A 4QMUA 2QR7A 3V6RA 4FNWA 4FV6A 1GZ8A 2W1DA 4HCVA 2YHVA 5DEYA 4ZXTA 4WNPA 3EN6A 4LRKA 5CVFA 3SXSA 1YHWA 2OJFE 3Q52A 3IO7A 4CT1A 2QHMA 3D2KA 4M14A 4JT3A 4KAOA 3OBJA 4DT9A 3A60A 4FKUA 3VS5A 2OU7A 4ALVA 2QONA 5K5NA 4BBFA 3IW7A 4PPAA 5EFQA 5M53A 1RDQE 5EG3A 4EL9A 4EBVA 1ZMWA 2HWPA 4RX9A 2PUPA 3SG9A 2YLFA 1XH5A 4TYGA 3GC9A 4QD6A 5CU0A 5EW8A 2PMLX 1H1RA 2A1AB 5CEPA 2JAMA 3SOAA 3CBLA 3I79A 1SNXA 2XBJA 4O4DA 3WF8A 3EH9A 1UVRA 3I4BA 2J4ZA 3DB8A 2OIDA 3DKOA 3K3JA 3VQHA 2WTVA 4AW0A 3QRTA 2R7BA 4JS8A 4M68A 2C5NA 2VTSA 4RVMA 4BDAA 2IZTA 2RFNA 3Q5ZA 3ZSIA 1J7IA 2GDOA 5CSPA 1OL7A 4BDJA 1URCA 4DEDA 4MNFA 4EQCA 3R01A 1APME 2OZAB 4XP2A 4D2TA 3PVWA 4M66A 5CYIA 4DHIB 3FZ1A 3MW1A 4BGHA 3ZM4A 1UKHA 5AR3A 3UNJA 3DKGA 4CMTA 2PZPA 3BYSA 3S00A 5F95A 3NSZA 1E1VA 3QHWA 4YZNA 4JDHA 3L8XA 4FRFA 4I24A 4EZ5A 1UWHA 5HBHA 2PUNA 3DTWA 5ANIA 4I21A 4P5ZA 4L42A 4B4LA 4U79A 5KKRB 2QODA 2WNTA 5IQGA 2J6MA 2ITUA 4QMZA 5HVYA 2Y6MA 4FZAB 2WMSA 4C4HA 5JMSA 4LL5A 4NCTA 5GJFA 2UVXA 1ZMVA 5LWNA 4C2WA 4ACMA 3FLZA 3GU4A 3ML1A 5IEVA 3IK3A 4L43A 3Q4UA 3T3VA 3TTIA 1OBDA 3ZC6A 2KULA 3EIDA 4M7IA 3EL8A 3CQEA 4KIPA 4WSYA 5EI2A 2PWLA 2XUUA 3IDPA 5ACKA 4E5WA 2WFYA 3O7LD 2CPKE 3R1SA 1OVEA 1BI8A 1PXLA 3D7TB 4PDOA 4B8LA 2OW3A 2ERKA 4ANNA 1XJDA 4C7TA 5BVOA 5KHXA 2HY0A 4W4VA 4ZMEA 4PPBA 2PSQA 3ZONA 4ZTRA 2C0TA 2Q0NA 2X0QA 4ASZA 4EC8A 4ZSGA 3G51A 4C8BA 2BRHA 5FTOA 4IAAA 4O2ZA 2P2IA 2RSVA 3PXRA 5GJGA 3QKLA 4OTPA 4DYMA 4H36A 5HQ0A 4A4XA 3OY1A 4ITJA 3AKLA 1YRPA 4M8TA 2WQNA 1Y6BA 3IGGA 3K3IA 2CKEA 4R6VA 5ANKA 3SOCA 1WBSA 4I22A 3K2LA 3DAKA 5FTGA 2XYUA 3F9NA 4O0TA 4USFA 3G9LX 2B0QA 2BTSA 1ZXEA 3FBVA 4WRGA 3COMA 3DU8A 4EOSA 3UOJA 4OBPA 4NM0A 5EH0A 4C4IA 3EQBA 3SXRA 5H9BA 3LFCA 3P79A 4XCUA 2R3KA 4F65A 3HMNA 5CWZA 2R3FA 3MFTA 1YW2A 4ZTSA 3PUPA 3HDNA 4U0IA 4DE4A 4WOVA 5HZNA 5HLNA 1OIRA 4XHKB 4YC3A 2QO2A 3F3WA 3DNDA 5IA5A 3TACA 1PXPA 4AZSA 4BC6A 4F0IA 3KF4A 3VF9A 4QPSA 2B53A 3ACKA 2QKRA 2ZB1A 1TZDA 4BGGA 4U8ZA 5HD7A 3LXKA 3NDMA 3SXFA 4XX9A 3D2IA 1CM8A 1ZYJA 2FA2A 2W05A 3I7CA 4NL0A 5AUVA 4MHAA 3NFFB 4JJRA 4FIIA 1FMOE 4E4MA 5TF9A 1YWRA 5FWKK 3COKA 3FHRA 2RKUA 4FIJA 4MEDA 2J0JA 4F08A 4PL3A 3C7QA 1QPCA 4FIEA 4O0YA 3CY2A 5B2MA 4E5BA 4BIDA 4O1OA 5CQWA 4RG0A 4NTSA 3GU6A 5AM7A 5A4TA 3TJCA 3DFCB 4IB1A 5E91A 3QBNA 4H3BA 2BRMA 4EK6A 5HG9A 4R7BA 3RNIA 3LJ0A 3ITZA 4MK0A 5HGIA 3V5LA 3VRZA 1PXKA 1W83A 2UZUE 4IZYA 5CU2A 2VNYA 3WBLA 3W8QA 3ZYAA 1GIJA 4XG8A 5AP0A 1YXUA 5DHJA 1SVGA 3NS9A 4UN0C 3C4CA 5HX6A 3A99A 3NUXA 3BLQA 3DJ7A 4RWLA 3QRIA 2XIXA 2C5OA 3M11A 4AA0A 1NT2A 4WBBB 4BWPA 3SG8A 3RI1A 2XEZA 2PZ5A 5LOHA 2VO6A 3IKAA 4IACA 4YBKA 3TNWA 4F7JA 3OW4A 5EKOA 2C6MA 4LV8A 4D5KA 2YABA 3V5JA 4YC6A 4MNEA 2VU3A 2PTKA 4JDKA 3MSSA 1MQ4A 4FG9A 4L45A 4CFUA 4IX3A 1A06A 4GRBA 2ITOA 4FIHA 4CMOA 5AP4A 4ACHA 5M4IA 1QCFA 4XV9A 4IAFA 4TT7A 3QTWA 3R2YA 5HIDA 5E1SA 4AWIA 4DN5A 3VS3A 2WQOA 4NEUA 3TWJA 2RFDA 1B6CB 4QYGA 4O38A 1UWJA 2P55A 1DI9A 3MA6A 3TKUA 5DIAA 2E2BA 3VUIA 4LGDA 2WB8A 2PULA 2QO7A 4FZ6A 3CP9A 4GT5A 4UWCA 4AGUA 4EC9A 4CTCA 4CLIA 3AT3A 3FLNC 4HZRA 3EN7A 4EHVA 4D9UA 4JAIA 2V55A 5J9LA 4IAYA 2UVYA 1P5EA 3V5QA 4PDPA 1PYXA 4FI1A 5L6WL 2P4IA 4TWOA 2BHEA 4FSRA 2BDJA 4H3PA 3RAWA 1NVQA 2VWIA 2H6DA 1VYZA 4AW5A 4YJQA 1WBPA 1GOLA 3B2TA 2C68A 4RIOA 3R8LA 3V5PA 4ALUA 4EUTA 3L9PA 1P4FA 4QDEA 4LRMA 5EQPA 2NNWB 3DAJA 3PFQA 4DG2E 5A14A 1IEPA 3NCZA 4I23A 4A06A 4RX5A 4F9AA 4IIRA 3JUHA 4LGHA 4EOIA 5B2LA 3S1HA 5J1WA 1PYEA 3ZZEA 3KU2A 5HU9A 4ZTNA 4X21A 5I9YA 3GC0A 3BYMA 3S4QA 4EKKA 3O8UA 4ZSJA 1QPEA 1PKDA 4LV7A 2WMTA 5M57A 4QYEA 3SGCA 3UYSA 4CKIA 4QTAA 2ERZE 2UZEA 2VX3A 2RIOA 3R71A 5BQ0A 1ZARA 2PMIA 4IC7A 3SW7A 4XOYA 3RPSA 1SMHA 4MQ1A 2OIQA 2CGWA 2GNHA 4BDCA 2JC6A 1ZAOA 2WTDA 3M2WA 3ORTA 3PJCA 4I6LA 4V01A 4BDBA 1V0BA 2Y6OA 4DFNA 2W96B 2PL0A 3PUFC 5F20A 4J53A 2C6OA 3UIUA 3QTSA 3DS6A 3VULA 3C5IA 5C01A 4TYIA 4F7NA 4Z16A 2PHKA 3QU0A 2GSFA 4RX7A 4D4SA 4UYAA 3GT8A 4TRLA 3F2NA 3QTQA 4JQEA 4E1ZA 3HV7A 3ZUUA 3HMMA 3UP7A 4O7VA 5DE2A 2X7GA 3Q96A 4FTQA 5TKDA 2UUEA 3UZPA 4HVGA 3OEFX 4C02A 4DFZE 3F61A 2ZDTA 3HECA 5KX8A 2I7QA 4YTHA 3ZBFA 2XNNA 2IF8A 1H1WA 1SYKA 5E92A 3Q3BA 2G15A 2GS6A 3HV4A 3KXXA 1IASA 2Y9QA 5DG5A 3G0FA 2I40A 1JVPP 2AC5A 2R3NA 3E92A 2W17A 5HI2A 3B8QA 4QT1A 4R8QA 4E20A 3ERKA 5CANA 3QCYA 4Q5EA 4S32A 2WTKC 4RLKA 4EOPA 3MPAA 3PSBA 4EZ7A 4ZY5A 2BAQA 4AG8A 4Z3VA 1IR3A 2Y7JA 3KRRA 1H00A 3COHA 4HNIA 4TTHB 2PU8A 2YISA 4JBOA 4C35A 3QALE 3CLYA 4HCTA 1JAMA 4BZDA 5AAGA 4JBQA 5HKMA 3ZFYA 4GIIA 4F09A 3A7GA 3OD6X 5C26A 4GK4A 1Q3WA 4TYEA 2IJMA 4FSNA 5JKGA 5IA2A 5L3AA 3BHVA 2Q83A 2OIBA 3F6XA 1XH4A 2QD9A 3HX4A 4JVGA 3TTJA 4EWHA 2XK8A 1NVSA 3PLAE 3ELJA 2JD5A 3E87A 4FYNA 2XK7A 4AS0A 4QMNA 4IH8A 5AIRA 3G0EA 2XA4A 3EWHA 3FQEA 3I7BA 3CTJA 3MB6A 3I5ZA 5CEQA 3P78A 2ITZA 1ZOHA 2OG8A 1XHAA 4D1XA 2FH9A 1JSVA 3FMMA 3PXYA 4GK3A 3ZM9A 3U9CA 3F3ZA 3QAME 3RK5A 5IH4A 5AFVA 5AAEA 3F3VA 2X8DA 3N9XA 4IWQA 2JITA 4BDFA 5BVKA 2R64A 3FV8A 4JX7A 5HVJA 4PWNA 3IONA 4I5PA 4K0YA 5IQIA 3BCEA 4J95A 2IZUA 4HVHA 4TYJA 4FIGA 3D0EA 4E26A 5HD4A 1WBOA 4FV8A 3GU5A 3LE6A 4GT4A 4O0UA 5A4QA 5BMMA 4KA3A 4FV7A 4DGOA 2OSCA 2YM7A 3P7CA 4FC0A 3QFVA 2ZFYA 3BLAA 3PWDA 1JLUE 3FMHA 2JKQA 4AW2A 4U43A 2XKDA 2SRCA 5M55A 3TCPA 2WPAA 2F7XE 3TXOA 4ID7A 3UQGA 2IG7A 3W16A 4NZWB 3P7AA 4RRVA 5BYLA 3POOA 4RWKA 5EYKA 3BELA 4UBAA 2WU7A 1WBWA 5LQFA 4ZTLA 4ZTQA 3NFGB 3W0QA 5J9ZA 5CAVA 2YIQA 4PMMA 2WOUA 1GZNA 2UW3A 5KCVA 4GS6A 3SRVA 4A9YA 4TL0A 4ONAA 3TZ8A 3HRCA 3CCNA 3CXWA 2IPXA 2HELA 4UZHA 4C2VA 2W0JA 2ACXA 3TMOA 1OZ1A 3O2MA 4M69B 4AGCA 3A7HA 4FNZA 4FTCA 3S2PA 3W55A 2C6KA 4YLLA 2I0HA 1ST0A 3D15A 3FMEA 4BTFA 2A2AA 3LLTA 5CY3A 4QP4A 5LWMA 3D9VA 4ZAUA 2HCKA 2XKFA 3EKNA 4H1MA 3BHHA 5FM3A 3TL8A 2A0CX 4EQMA 5CASA 4DH1A 3H0ZA 4AFJA 4RBLA 4ACGA 3UYTA 1STCE 3FPQA 3FUPA 5BYYA 4IJ9A 3UC3A 3F82A 3G6HA 3HVCA 5KKRC 2XF0A 3FSFA 4QQ5A 3NVKI 4ASEA 1A48A 4I6FA 3QQFA 3JYAA 3BGZA 4LDTA 4GK2A 4L68A 2G2IA 5CU6A 5ETCA 3N51A 3EQRA 3A7FA 3OEZA 3FKLA 4X2FA 3I5NA 3KKVA 1ZMUA 5CXHA 4YSMA 4BTMA 4CFXA 4ZJVA 5HG8A 4JAJA 4PTGA 4KB8A 4IJPA 4AAYA 4IM2A 4BDKA 2YM8A 3VO3A 4XG2A 3PPJA 3UPXA 3F88A 4E73A 3HRBA 3FPMA 5FP6A 4QRCA 4UWYA 3TNHA 3TUCA 4FJVA 3EZRA 3FY0A 4UY9A 3TDWA 1ZY4A 2ONLC 3ZXTA 3R7EA 2F9GA 4CCBA 3QWJA 2W1IA 2OH0E 5F94A 3QKKA 4BGQA 2W5HA 2YIYA 1YWNA 4ZMFA 3D5VA 2HK5A 2JDSA 3FZRA 3EHAA 4U9AA 4Y46A 5DFPA 3KGAA 5HTCA 2IEWA 3WIGA 1AD5A 2EU9A 5EK7A 2GNGA 3O96A 4NUSA 1O6LA 3C0IA 3C4FA 4AGDA 3BV3A 4XRLA 4KWPA 4OT6A 1PKGA 3NWWA 3EL7A 4JRVA 3P9JA 3LCKA 4IANA 4IHPA 3L8VA 3R7GA 4DGLC 2YDJA 1YXSA 4BIEA 3U4UA 4UMQA 1CMKE 2PE1A 5BVFA 3RAHA 3FLYA 4P90A 1YQJA 4EH2A 4MBLA 2J5FA 3VBTA 5HE3A 2IZRA 3CKWA 1UU3A 4O81A 3VN9A 4CZUA 4AXCA 1Q8ZA 2A98A 4O0RA 4RMZA 3U8WA 1VEBA 4JDIA 3Q6WA 4BRXA 5HCXA 2IWIA 3LXLA 2BRBA 4LL0A 4EHGA 1CDKA 3OXZA 4QYHA 5BVWA 3GU8A 3NYNA 2P2HA 4GUEA 3MVMA 4M69A 4O4CA 3OT3A 4FSYA 4WNMA 2OWBA 3BRBA 3QRUA 5GZ9A 3CJFA 1PMVA 1ZYLA 1TQPA 2RF9A 3OMVA 3UVQA 2R3HA 4NIFA 3QKMA 5FUTA 2XIYA 1XR1A 5D10A 1Q99A 2BHHA 2O63A 4A4OA 4RC3A 4XLVA 4BDHA 4PY1A 3NAXA 4F99A 3KXHA 3NAYA 3LW0A 4GT3A 2ZV2A 4DLIA 5GZAA 2WQMA 4U5JA 4V04A 4GU9A 3CQUA 3HMIA 3QWKA 4CFVA 2OH4A 3BHTA 4AE6A 1TKIA 4KIKB 2RFEA 4FTJA 4L67A 5E8WA 2CGXA 2XMYA 3LKMA 4AAAA 5CAUA 4YSJA 5M4CA 3SC1A 5GINE 4EWQA 4CXAA 5IF1A 1IA9A 3OT8A 2AEGA 4XOZA 3UZTA 2O3PA 1PF8A 4Z9LA 3MI9A 1ZYCA 2VN9A 2PVLA 3F5GA 4DTBA 3R7YA 4BI0A 4FKJA 4GH2A 1H28A 4YJPA 3AMYA 3E8NA 4YP8A 3GNIB 4FKIA 3AGLA 3V6SA 3W0NA 5H3QA 4BCJA 2EWAA 3W2PA 1PXOA 3E8CA 1M7NA 2VAGA 2OICA 3VBQA 3QTXA 3UQCA 3ORKA 4JX3A 3GFWA 4FL2A 5AP1A 4RVTA 5K0KA 5HBJA 4CYJA 2VTRA 2A27A 5CVHA 5F9EA 5KMLA 1OKZA 2BDFA 3LFSA 3T3UA 4FZFB 4AOTA 3MFSA 4WBOA 5J79A 2X7OA 4OAVB 3QGYA 4O7NA 4CV8A 4GCJA 3DFAA 4NFMA 4C57A 3ZLSA 3O8PA 3ALNA 3R73A 3QXPA 3R22A 4G16A 4DFLA 2FSOX 3NX8A 4RFYA 4B7TA 4E5AX 5M08A 3HV3A 4J98A 5TO8A 1W0XC 3QGWA 4KS8A 3UQFA 2YFXA 2ITXA 3U55A 3KK8A 3MY0A 4E4LA 4QMVA 2VWUA 1G8SA 4JBPA 4WNKA 4DF3A 1W2FA 4G31A 5DN3A 2PVKA 2XAMA 1U5RA 4JQ8A 4NFNA 5L2TA 1KV1A 3OXTA 4RA5A 4Y95A 5EDPA 3DLSA 4C4EA 4AQCA 4OAUC 4M3QA 3F69A 4PDSA 5JEBA 3PJ8A 3KCFA 3SD0A 2C1BA 3RPRA 4ZTMA 4O86A 4D1ZA 4EJ7A 1U54B 3QHRA 4I4EA 4XUFA 5FDPA 4IX6A 5E8UA 4BN1A 4UMUA 2W7XA 3AC5A 3BPRA 2CKPA 1YDSE 1BKXA 1GJOA 2GFSA 3G6GA 3H9FA 4RJ4A 3WARA 3D5WA 5A4CA 3ENHA 2XK3A 4AE9A 2IVSA 3AXWA 1OKYA 3IOKA 3QQUA 2C6DA 1V0PA 3R1NA 5AUUA 3VS0A 5A6NA 3VUHA 2R9SA 2W9ZB 1HCLA 4PNKA 3VAPA 3PG3A 2WMQA 4RZVA 3I0QA 2QOOA 4L3LA 3V01A 2REIA 3HMPA 3DBFA 2OKRA 4BHZA 1ZLTA 3A62A 4GG5A 1Z9XA 1ZZ2A 3VS1A 2QURA 4EYMA 4O27B 1OGYA 4F1MA 5BUJA 3FQSA 2ITTA 3UGCA 3D4QA 3SRVB 5HIEA 2BAKA 4K8AA 4R3PA 1BUHA 2ESMA 3VRYA 4BKZA 2EXCX 1R0EA 4FT9A 3GENA 2AYPA 4LRJA 3GC8A 2UZDA 4DEGA 3LJ1A 5CALA 4CKJA 4BTKA 5JGBA 3TV6A 1V1KA 4LOPA 1OPLA 2RGPA 2BR1A 2W4JA 2O5KA 4I20A 3PP1A 5G6VA 4DFYA 2OJGA 2IW8A 3MFRA 1PY5A 3GU7A 2I0VA 4RJ5A 5LARA 4IVBA 4F6UA 4O4BB 2GNIA 4X3FA 3ZHPC 2LGCA 3HUBA 5C03A 5L8LA 4ENXA 4HYUA 1ZOEA 2J90A 3BU5A 4H3QA 3NUPA 4AT5A 1WZYA 3QZGA 4QTDA 3BWJA 3FZTA 3K5VA 3M1SA 3IECA 1R1WA 2VO7A 4R5SA 4X3FC 4YO4A 3NW5A 4FA2A 2Z2WA 2LAVA 4A9TA 4PPCA 2J5EA 4YBJA 2X2LA 3NUYA 3SHEA 3OY3A 5HIBA 2F7ZE 4I6HA 4K9YA 5HNBA 2R3OA 1GZOA 2G2HA 1L3RE 3OCTA 3LIJA 4RSSA 4S31A 3EN9A 4ZY6A 4ZY4A 1FBNA 4EH8A 3OZ6A 2XKEA 3MY5A 1H1PA 4N0SA 5LMKC 4MAOA 5M07A 2DWBA 2HZ4A 3EJ1A 4TY1A 5IUGA 3MTFA 4OT5A 4RPVA 1MQBA 4HZSA 4KS7A 5BUIA 2OXDA 4NJ3A 3CPCA 4S34A 4DC2A 5HE1A 1TQIA 3E64A 1TVOA 2XZSA 3QXOA 3HAMA 1I44A 3QC9A 2YWVA 4R78A 2WELA 3CY3A 5IQDA 2YCRA 2PVYA 4TYHB 4Y72A 1XH9A 5JZNA 4JI9A 3ZOSA 5FTQA 2J2IB 5B7VA 5IH6A 4EJNA 2X0PA 3PRFA 4FEUA 3UDBA 4JMQA 3B2WA 4GJ2A 2Z8CA 2GHGA 3RHKA 2BZJA 2E9OA 4N70A 4R7IA 5IU2A 4B8MA 1M52A 4USDA 4GFGA 2V7AA 2VV9A 4C4GA 5EM7A 1M2RA 3NCGA 2X4FA 5DR9A 4WNOA 5T68A 3FI4A 5EDRA 2C6IA 2E9NA 4O7RA 3MS9A 4J96A 4AF3A 3G33A 3E8EA 4FKSA 1REJA 2GTMA 2R3QA 4YZMA 4CFWA 1ZOGA 4XNEA 3UNKA 4G3DA 2WEIA 5M56A 3GC7A 3H0YA 1A9UA 1Y8GA 2GNFA 5K3YA 1W82A 3PPKA 3UODA 4L00A 4CMUA 5M4FA 3FJQE 4B0GA 3D5XA 2Q0BA 4G5PA 4W8EA 4BVUA 1W2CA 4G6NA 3WZJA 3Q2MA 1PXJA 3RTPA 2YDKA 4MF0A 2DS1A 2JDOA 4FKPA 2R0IA 2GPHA 1LUFA 4D1SA 4K6ZA 2HAKA 2VTTA 4AFEA 3FI3A 4C0TA 2GQRA 3N4VA 3QZIA 1JKLA 3OF0A 3LQ3A 5EW9A 2YZLA 5I9VA 5G1XA 3NRMA 3R6XA 4C33A 2WQEA 3DXNA 3CR0A 1ZYDA 3LFAA 3LJ2A 4AN2A 4O7TA 2KTYA 5FXSA 3NIEA 4OGRA 5LVOA 2W1ZA 2VWWA 4UWBA 3ZUTA 5CZIA 4BYJA 4F7SA 2XB7A 3RZFA 5HESA 4CLJA 5HVKA 3M42A 4MBIA 4OTHA 4DFUA 4ACDA 1OI9A 3S95A 4UALA 4AZFA 3R7IA 1DM2A 3DZQA 1YHVA 5DA3A 2GS7A 4EH9A 3MVHA 4KBKA 2JFMA 3N4UA 4IADA 4BCMA 2XRWA 2Z7SA 3V5TA 4AN3A 3ZLXA 1JPAA 3NEWA 1K9AA 1YI4A 4HCUA 2V5QA 5BX0A 4EYJA 4F0FA 4C3RA 5B2KA 1R0PA 4A7CA 3MPMA 3LFBA 4I6BA 2R3PA 2HXQA 3PXKA 3OS3A 4LMUA 2F7EE 2QO9A 2I0YA 3KL8A 2HZNA 3BI6A 4YHFA 4JIAA 2PVHA 5DR2A 5DGZA 4AZVA 3RPYA 5DLSA 3DJ5A 5C4LA 4YNEA 3GEQA 3A4OX 1OIQA 1LP4A 3IQ7A 4XJ0A 4P5QA 1FINA 3PIZA 2VTHA 4PUZA 4AGWA 3WYXA 4D2WA 3LVPA 3W0OA 3GQIA 4IAKA 3ZRLA 2VTLA 2F2UA 4K2RA 2E9PA 3RAKA 1XBCA 2Y8OA 1OPJA 2X8EA 3CGFA 2VUWA 4YMJA 1LPUA 2XVDA 4GKIA 5J87A 3VUGA 2BCJA 3UDTA 3W0RA 3L1SA 3NNVA 4F9WA 4QMTA 3W32A 2GHMA 3E93A 4I41A 3NUUA 2YCQA 4FSZA 5D11A 5I9XA 2BRNA 4WUAA 2R3GA 2X7FA 5TR6A 4FKOA 1LEWA 5DMZA 3UO5A 4J7BA 1OECA 4CQEA 3BU3A 4WA9A 3PY0A 4YJUA 3GP0A 4I93A 3P7BA 3VBXA 3AC1A 3VBVA 3W0SA 3U6JA 3SDJA 4NU1A 3DXQA 4G9RA 3D5UA 2OI4X 4KIOA 1KOAA 4I1ZA 3V8SA 1MRYA 4CCUA 5IQHA 3FMJA 3ROYA 5ANOA 4JL9A 4NKSA 4UMPA 3SW4A 4AA5A 3UG1A 2WXVA