4C7TA

Focal adhesion kinase catalytic domain in complex with a diarylamino- 1,3,5-triazine inhibitor
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
271
structure length
259
Chain Sequence
DYEIQRERIELGRCIGEGQFGDVHQGIYMSPENPAMAVAIKTCKNCTSDSVREKFLQEALTMRQFDHPHIVKLIGVITENPVWIIMELCTLGELRSFLQVRKFSLDLASLILYAYQLSTALAYLESKRFVHRDIAARNVLVSATDCVKLGDFGLSRYMLPIKWMAPESINFRRFTSASDVWMFGVCMWEILMHGVKPFQGVKNNDVIGRIENGERLPMPPNCPPTLYSLMTKCWAYDPSRRPRFTELKAQLSTILEEEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords FOCAL ADHESION KINASE 1
publication title Inhibition of Both Focal Adhesion Kinase and Fibroblast Growth Factor Receptor 2 Pathways Induces Anti-Tumor and Anti-Angiogenic Activities.
pubmed doi rcsb
source organism Gallus gallus
total genus 81
structure length 259
sequence length 271
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2013-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4c7tA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4c7tA01
3OW3A 2HWPA 3NRMA 4G5PA 3TTIA 3LCOA 4O0XA 5A6OA 4M15A 4PWNA 3KMMA 2JDSA 3NIEA 4NWMA 4D5HA 4O6LA 5IF1A 4DH8A 3SGCA 2OKRA 4L9IA 3BEAA 2WOUA 2BZIB 3VN9A 2UZBA 4E20A 4CNHA 3K5UA 1JLUE 3AD6A 5DR6A 2R0UA 4DLJA 3OROA 1QL6A 2WMWA 1PMEA 4HYUA 4XUFA 4F99A 2OFUA 4FT3A 4IH8A 2ITPA 4AZSA 5M08A 1YXSA 3A4OX 4R7IA 3F3WA 3FZ1A 2WQOA 2WELA 3Q52A 3DK7A 4EJNA 4I0TA 5GHVA 4FICA 3UO4A 5HVKA 5I4NA 2R3LA 3FMLA 3P9JA 4PMSA 3FLYA 5L6WL 2GTMA 1ZYLA 3QHRA 2X7FA 4JBOA 4L3LA 3HDNA 4YJVA 2GFSA 2BTSA 2X8IA 4JAJA 4NIFB 2BZJA 3PXZA 3K54A 4ACMA 2BR1A 4O22A 3VRZA 1FQ1B 3D94A 3KF4A 4L44A 4B0GA 3MY5A 2AUHA 2UZVA 2QU5A 5GJFA 3E88A 5BVDA 4XV9A 2J2IB 3E3BX 3FZRA 4EK8A 3AG9A 4IVAA 3UNKA 2VTRA 2JIUA 5ETCA 2YWVA 1BLXA 4KIKB 5FTGA 4DLIA 5AP1A 4E26A 3TNQB 5DFPA 4DG3E 2I0YA 3PE1A 2YAKA 2V7OA 3TZ7A 4F7LA 4GT4A 2Z7LA 4RJ6A 3G90X 3WZJA 4PL4A 4QNYA 4R6VA 5CEOA 3BU6A 4N6YA 1ZZLA 3R7UA 3ZONA 4LV5A 4TZRA 2VO7A 3PFQA 4D2TA 4FSUA 4JG6A 4X6QC 4BCGA 4TL0A 4UMUA 5M51A 2C3LA 3D7TA 4CV9A 4HYSA 5K5XA 1FMKA 3AC8A 4FIJA 4FTOA 3WI6A 2WOTA 4BTFA 3ATTA 4YJNA 4QMSA 3QX4A 4MHAA 4DN5A 2UW4A 4ZZMA 3OXTA 2PY3A 4DITA 4EZ3A 3VC4A 3Q4UA 4M69A 4CVAA 4Y73A 4U3YA 4L00A 2JIIA 4MEDA 4J95A 4XLVA 3O96A 2CNQA 3MB7A 4K1BA 5CQUA 2B55A 4AN2A 5CF4A 3U55A 4FEWA 4Y5HA 3BYMA 3WF7A 4ZLYA 3DK6A 3RALA 4BCHA 5CQWA 5AFVA 5I9ZA 5FXQA 2XKCA 1JBPE 3JXWA 4EOKA 3UQFA 2E9NA 4WRGA 4WOVA 4U79A 5KE0A 3PXYA 3TM0A 4USFA 1ZMUA 3LAUA 5EI6A 4BDIA 3HP2A 1H8FA 3OWPA 1IA8A 5HNGA 5A4EA 1MQ4A 5K4JA 2R64A 4XBUA 1YDSE 2QURA 1Q62A 5CEMA 3TUDA 4IE9A 2W1FA 2WHBA 4TYEA 3Q9ZA 3R7YA 1GAGA 5HICA 5L2WA 4XYFA 2ACXA 2WTKB 4PTGA 4YJPA 3R8UA 4A7CA 5KKRC 2HY81 3IG7A 3DOGA 3GENA 1YOLA 4ZS0A 3E62A 2A1AB 1IEPA 1YI3A 3UZTA 4O0UA 1W98A 5HG7A 4I6FA 2HAKA 3FQHA 5JT2A 4JVGA 4UMRA 1UU3A 2OH4A 3POOA 4EOJA 2P2IA 2Z7RA 3C51A 2YZLA 3PWDA 1OGUA 2G9XA 2WNTA 3O8TA 5IQHA 3OC1A 4WKQA 4AOTA 3BIZA 4E73A 4LUDA 4ZTRA 4MWIA 4CT2A 2C0IA 2C1BA 1OIUA 2WTIA 2X8EA 5D1JA 4RC4A 3IW4A 3R9NA 4CMTA 1H01A 2C47A 3COMA 3TNPC 4TW9A 3KXGA 5EM6A 1IG1A 3D14A 5J5SA 2PVLA 1AGWA 5B0XA 1GZOA 2UW3A 3O0GA 3MV5A 3PY1A 3EFLA 4H36A 3VBVA 5KBQA 3DNDA 4JRNA 3BV2A 4QT1A 4QTDA 4GU6A 4RLKA 3V5JA 1GZ8A 3SXRA 3DBEA 4F4PA 2QOHA 3BEGA 5EYCA 4DEEA 4EH8A 4AN9A 2PVKA 1UKIA 1NY3A 2EXCX 2QHMA 3P23A 4FTAA 4G6OA 3HVCA 4GT3A 3AXWA 4IX6A 3R7OA 4D2WA 4FG7A 1FGKA 2CMWA 4WNPA 2VTMA 4FV4A 2Y0AA 3KRLA 5EOLA 4ALUA 1FVRA 5H2UA 3TN8A 5IKWA 4AZFA 3DKFA 1AQ1A 4EOQA 3E93A 4ORKA 5I3OA 4YJUA 3OOGA 3QTQA 3DFCB 3UMXA 4O0WA 5C8NA 4M7IA 1SNUA 3MSSA 4GYIA 5AR8A 4GG7A 3LIJA 3OF0A 2Z8CA 2I1MA 2XZSA 3OMVA 2CCHA 4I23A 4F65A 2CNVA 2PPQA 3NZ0A 1BL6A 2X6EA 3Q2MA 5IA2A 5IUHA 5FM3A 3RK7A 2WGJA 4YHTA 4D2VA 4FR4A 1ZMWA 1NVRA 4FG9A 3DB6A 2CDZA 5HE0A 2B4SB 1FINA 2YEXA 4J52A 4F6WA 3NYVA 3EFJA 3FI2A 3ORIA 2CKOA 4W9WA 3V04A 3TTJA 3PXFA 2G2HA 4FVRA 4ONAA 2WMAA 2BFXA 4KSPA 4RIXB 5KMKA 2CJMA 4O7NA 3H9OA 2YDJA 2OIDA 3ZLXA 4ZSLA 1PKDA 1U59A 4JIAA 2YN8A 4YC6A 3OTUA 1H08A 4AQCA 4CV8A 2UZEA 4ANNA 4FGRA 5H9BA 3G6GA 3Q9XA 4CKRA 5AIKA 3TDWA 5ANEA 4BGQA 2XA4A 4GIHA 5AAFA 2HYYA 4BCNA 2QO7A 4D0XA 4FEXA 5IA1A 2BAJA 4FSTA 4WIHA 2VTQA 3HMOA 1W82A 3KY2A 4EONA 4DG2E 3PY0A 3IGGA 3HV6A 2GS6A 3O50A 3HL7A 1KV2A 4USEA 4QOXA 3ORMA 4FT9A 2R3QA 4L52A 3UP7A 3QD2B 5HO8A 4MVFA 2QKWB 3E64A 4JG8A 5D12A 4HGSA 3BLHA 4RSSA 4AP7A 3H4JA 1UU7A 3PDTA 4FC0A 4YPDA 5AAGA 3W32A 4QMTA 1KV1A 3W10A 3UIBA 3F2AA 4ERWA 4QMYA 3KA0A 3DJ6A 2J50A 3GC9A 4HGEA 4RC3A 5E1EA 1OITA 4AACA 4D4YA 3FLNC 3WZUA 1BKXA 3CD3A 3MPTA 3A4PA 3TUCA 5BVOA 5EYMA 4M0ZA 4OTFA 4OAUC 1GOLA 2GHMA 5E8SA 2IW9A 1Y6AA 3B8RA 4QP8A 4GYGA 5IQCA 3R6XA 2R9SA 3PG1A 5HVYA 2C0TA 2QU6A 4H3QA 4QYHA 4WO5A 5DWRA 5FBOA 3JUHA 3ORNA 2NPQA 4ANQA 4JNWA 1OI9A 5FUTA 2W1DA 3G0FA 2BDWA 4GV1A 4PRJA 4GK3A 4BCFA 4UV0A 4BZDA 3L9MA 5I5ZA 3VBTA 3DJ5A 3GU5A 2R3PA 3PXKA 3Q4TA 1WVYA 4EHZA 4CTBA 5AP6A 1V1KA 4GK4A 3V5WA 2ITYA 3BHHA 3RAWA 4C57A 2GDOA 4I20A 4JXFA 4BI1A 4EOLA 4C62A 4HVGA 4QMVA 3TCPA 4MBLA 1DI8A 3A7GA 2VNYA 3MA6A 4G3GA 2VWUA 2AYPA 2ZMCA 3F5PA 2PVMA 2FO0A 2ERZE 2PVRA 4A4OA 2B9FA 4NTSA 3PIXA 3N51A 4XG2A 2Y4IB 2YM8A 4DFLA 4OTHA 1WVWA 3RM7A 3SA0A 4S33A 3FV8A 3EQFA 4HCTA 2F7ZE 2VWZA 2GFCA 3QCQA 1Y91A 4RRVA 4WBBB 4D4SA 4BCOA 4I6BA 4MD8E 2KULA 3K5VA 4FGBA 4Y8DA 5IDNA 3F3TA 4USDA 5JKGA 2BRGA 4LL0A 5K3YA 5AP5A 4G2FA 2QVSE 3VUGA 2CNUA 3UGCA 3M2WA 3SRVB 4MXZA 3BI6A 5DT3A 4KRCA 5EW3A 4ANOA 2HCKA 4EI4A 2YIQA 2XK9A 2O63A 4BCQA 2XMYA 5IUGA 1H0WA 3GC0A 4CFFA 1WBWA 3RPRA 4IBMA 4JRVA 4QP9A 4Z55A 4HNIA 3L1SA 5E8TA 2YFXA 5IQFA 2EUFB 5HBHA 2PMLX 3PJCA 3R63A 1LEZA 4AZVA 4D28A 3JVSA 5C1QB 5KMOA 4D1SA 4PL3A 3D5UA 5AR7A 1YWNA 2SRCA 1YDRE 3TV6A 2R3KA 3NPCA 4W4WA 4BGHA 4BCMA 4C4FA 3LQ3A 3EFKA 3R30A 3GUBA 4PL5A 4O21A 4QMMA 4R78A 2UZNA 5LMAA 5CU2A 1FVVA 2W1ZA 3RHXA 4BGGA 3CTHA 5FXSA 4D58A 4AA5A 5JK3A 4M68A 3JPVA 3V5LA 4AOJA 2XNEA 3DZOA 4RJ8A 4UX9A 3FQSA 3UOKA 2B9JA 2PE0A 3I5ZA 3QTSA 3EL7A 5C26A 3W2PA 4E5WA 3DBCA 4F6UA 3KCKA 3MBLA 3WZKA 4FSYA 5LQFA 4QP3A 2LAVA 1J1CA 2G1TA 4L7FA 3SXFA 3UG2A 5I0BA 3FI3A 3CXWA 5ETIA 1XWSA 3VS0A 5IQGA 4A06A 2FB8A 4FZ6A 4G16A 2IW6A 3UIUA 3FZSA 3D7ZA 5KZ0A 4QMQA 2Q0BA 3FWQA 2DUVA 2UZTA 3NSZA 4G6LA 5HLPA 4IAFA 5CALA 4XHKB 4FKOA 4GFMA 4UWCA 4CFWA 3IQ7A 2X81A 2X2LA 3BLQA 4MBIA 4ANLA 4EH9A 4IM0A 5AM6A 4CFNA 3R1NA 3HRCA 2NRUA 5C8MA 2R3NA 3IW5A 5DA3A 2R3OA 5HCZA 4HOKA 5LMKA 2W7XA 4GVJA 4X21A 5JZNA 4NUSA 3KREA 3JVRA 4PQNA 3E5AA 2J0LA 2C68A 2BIYA 2GNIA 4FKGA 5AEPA 2QOQA 3H0YA 4FKUA 5C4KA 4RC2A 4QMWA 4U8ZA 4PMPA 2O2UA 3RAIA 3FI8A 3UZPA 4U81A 4IM3A 4Y95A 3TZ8A 2HZ0A 3KMUA 3I0OA 3EQHA 2YJRA 3VNTA 4CXAA 3CY3A 3OXIA 1KE7A 1Q24A 1UWHA 3MY1A 4EEVA 3UC3A 3KB7A 2IN6A 4J96A 2BILB 3LXKA 4I3ZA 2UZWE 5FEEA 4GK2A 4GH2A 3EN6A 3VQUA 4ZTLA 4ZSGA 4O86A 4IDVA 3UIXA 5HIDA 3FYJX 3LCSA 5I9XA 2UW5A 5AR2A 4AAAA 2XNGA 4CYIA 1ZZ2A 2OZAB 2XH5A 3I81A 3CJGA 4XG7A 2VWWA 2WMRA 3G51A 2PULA 1JVPP 3HKOA 3QTUA 4FZFB 4UYAA 3OWKA 3DKGA 2JKMA 2NO3A 4WA9A 2BHEA 3OCBA 2XBAA 3POZA 5HVJA 3QTXA 5AUWA 5IEVA 4CQGA 2YCFA 4FTIA 4KIQA 2QR8A 2OJFE 3R9RA 5AUUA 2BKKA 4ZP5A 3ZSGA 3PZEA 4KS7A 3TZMA 1ND4A 4YC3A 4RJ5A 2VN9A 3FMJA 4WRSA 2BCJA 4I93A 3HV5A 4DHFA 3HECA 4JBVA 4QD6A 4KSQA 5ANKA 2XIKA 5AV2A 3SAYA 3UOHA 4CCUA 3CP9A 4B99A 4NSTA 4NM5A 4C2VA 1MRYA 2PZRA 5IZFA 4QTAA 4L6QA 4WBOA 5JFXA 2XJ0A 2XNMA 2CGWA 4FKVA 2PYWA 3UQGA 4R3CA 2WQBA 5LVNA 4N57A 4RX7A 2XK4A 3ITZA 3OCSA 3QQFA 3VS6A 4S2ZA 5GIPE 4QQTA 4OTDA 3ZLYA 5TR6A 1Q5KA 4F64A 2EXMA 2OIBA 4LGDA 5JFWA 1P2AA 3UP2A 3NVMB 4NJDA 4FEUA 1UA2A 3MYGA 4M3QA 3KMWA 4H58A 3PRIA 3EHAA 4F08A 5K9IA 2W17A 4BKZA 2CLQA 3ZEPA 5LWNA 3DTCA 3BZ3A 4HCVA 5A4TA 2XBJA 2BIKB 4L8MA 3OW4A 4NKSA 1WBVA 4C02A 1Q8WA 1XO2B 2P2HA 5C27A 4E8AA 5DNRA 4DFXE 5LWMA 4FIEA 3EN4A 2X2MA 1M17A 2Y6OA 3E8NA 3HX4A 2EXEA 2DYLA 1W83A 3QALE 4XG8A 5CZIA 3RPVA 3CCNA 4CFXA 5HU9A 2H34A 3R02A 4U44A 2XIZA 3SW4A 2YIRA 3ACKA 3EMGA 5E91A 3ZZEA 1V0PA 5M09A 3ZUVA 4WD5A 3QYWA 2J5EA 3RAHA 4DCEA 4EK6A 3AGMA 4XCUA 2BPMA 4FTTA 2BDFA 3FC2A 2E2BA 3HEGA 2PVFA 5CVFA 3QLGA 3NUAA 4MK0A 3O23A 5C01A 3ZC5A 4NU1A 2BZKB 2GU8A 4YLLA 4M14A 4E3CA 1YQJA 2OJ9A 3R0TA 1MP8A 1JKSA 3VS2A 2NP8A 4Q2AA 5BVWA 3FHRA 2BKZA 4CLIA 2XVDA 4R77A 3F3VA 1R0PA 4HJOA 4GS6A 4O82A 5DRDA 3GT8A 1ZLTA 3NVKI 1OUKA 5CSVA 4PDPA 3K3IA 1V0BA 4GVAA 3PPZA 4AGDA 2BZHB 2WQMA 3QZFA 4PP7A 3IDCA 3GEQA 4J99A 5ANIA 4F1OA 2C30A 5DVRA 2F49A 3F7WA 3FZOA 4EKKA 3FI4A 5IEYA 2AC5A 2C5XA 4FK6A 4FKPA 2QHNA 3DDPA 4FTNA 5BVEA 4CRSA 4RJ7A 3RMFA 3C50A 5FQDC 2OI4X 2CGXA 2YHVA 5CAVA 5HBJA 2W1IA 2ZV9A 3GU8A 4FNXA 4YTFA 4AZTA 4MF0A 3REPA 1F3MC 1ZXEA 4GFOA 3KN5A 3FEGA 4HW7A 4JQEA 3U4UA 2UW9A 3QA8A 2OW3A 1PF8A 2ZB0A 3EJ1A 5M57A 3JY0A 4L43A 5EKOA 2Q0NA 5IA4A 4ID7A 1J7IA 2VTHA 5BUIA 5DLSA 2W05A 3C5IA 3NNXA 5TO8A 4BDCA 2R2PA 3NUYA 2GS7A 2OLCA 4YJOA 1EH4A 3NNVA 5DRBA 3VQHA 3D2IA 1XHAA 2XRUA 3D7TB 2RFEA 4FIHA 5J95A 4G9CA 5I9UA 2J0MB 3OT3A 5ETAA 1YDTE 3BE2A 3L8XA 3VF8A 4K8AA 3EQRA 1UV5A 4JT3A 2E9UA 2YCRA 4TNDA 4M69B 4PY1A 1ZOEA 3MVLA 1GZKA 2QOLA 4HNFA 2PZIA 2R4BA 3DLZA 3SLSA 3P0MA 4ZTNA 1UNHA 3FKNA 2WU6A 1M2PA 4FOBA 1G8AA 3CY2A 3FAAA 5EI2A 4ZEGA 4BIBA 3VW8A 5BYYA 4NEUA 3IW6A 5JGDA 5CXHA 2R3JA 3LQ5A 5DHJA 2X7OA 4TNBA 3GI3A 3O17A 2IZTA 2UZOA 4HPTE 4DEDA 1XH4A 3B2TA 3CE3A 4BI2A 2R3MA 3WARA 2RKUA 5IH5A 4H1MA 5HQ0A 5AA8A 2I0HA 5ICPA 5CTPA 3LFEA 3TUBA 3TACA 2QKRA 4XP3A 3W8QA 5DE2A 1PKGA 5FEQA 2C5OA 2WD1A 5HEZA 1AD5A 2YM7A 3OOMA 4O1OA 5EHYA 3EIDA 3VUKA 5E8VA 2WEVA 3EYHA 5CYIA 4AW1A 4ZSAA 2V5QA 2W99B 4YTCA 5FEDA 1YHVA 2OF2A 1BL7A 4HGTA 3BGPA 5E92A 4XLIA 4HVHA 5JFVA 2QO9A 3IW7A 2GMXA 3CGOA 4W9XA 1PMUA 2WQEA 4L3PA 3PJ2A 2XIRA 1E1VA 4FL1A 2JFLA 4W4VA 4IAIA 3V51A 3IOPA 2BAKA 4YBKA 1RW8A 5KMMA 3A2CA 5CNOA 4AUAA 4RFZA 5CU3A 4BL1A 5JSMA 3QGWA 1CKJA 4FOCA 4I5CA 4MCVA 4GJ3A 5CT7A 3ATSA 1WMKA 3QF9A 4K9YA 4FF8A 4DEHA 3AMBA 3LFBA 4O83A 3ETAA 3SQQA 3SHEA 2C6MA 5J1VA 4Q9SA 1FBNA 3MFTA 3BQCA 3FBVA 4AN3A 3E92A 2XCHA 1ZYSA 5E8XA 4GT5A 3KF7A 4KNBA 5EDQA 2FUMA 1W7HA 3MH0A 2XK3A 1WBSA 3EOCA 3KRRA 2Y4IC 3PSBA 4IJ9A 4YSMA 5F4NA 3R7EA 1OL7A 3H0ZA 4ITHA 4Z7HA 2ITNA 3S3IA 4YNOA 3UVQA 2XNOA 4S30A 2HXLA 3QXPA 5A6NA 5CT0A 4NM7A 3T9IA 4F7JA 4WG3A 3GCPA 2YDIA 2J7TA 5KUPA 4R3PA 3LKMA 4YHJA 4Z7GA 3FY0A 4D2PA 3ZO2A 2PHKA 2F57A 4F63A 1I44A 3KQ7A 4DH7A 2P55A 4IMYA 5J79A 4EOOA 5EM7A 3QCSA 3R21A 3F9NA 3OWLA 1NVSA 3ZH8A 4CZTA 1OPJA 2I7QA 2QQ7A 4UBAA 4BFMA 3L9NA 3NCGA 2FSTX 4CG8A 1ZOGA 2C0OA 4K77A 2XYUA 4Q5HA 4Q5EA 3VJOA 4GRBA 4B6LA 1OIYA 2I40A 2WMVA 3UYSA 1S9JA 4G9RA 4KD1A 1YRPA 4MXOA 3F5UA 5EI8A 1DAWA 3ROYA 4OTIA 4Y46A 4NW6A 2F2UA 5CANA 3PVUA 4Y72A 5AP4A 2EVAA 4BDKA 3EKNA 5DN3A 3D0EA 4QP2A 5E8YA 3VUHA 4EZ7A 5M53A 3CKXA 4FTKA 5I3RA 3HNGA 2ZYBA 3OP5A 1H1QA 4RVLA 2HW7A 1H4LA 4TRLA 4NH1A 3BELA 1SVGA 4IZAA 2JAVA 2H8HA 3R2YA 2R7BA 3EQBA 3VWAA 2HZNA 4M13A 3SOCA 4MNFA 2BVAA 1YHWA 3O51A 1U5QA 3FMDA 4IXPA 3QGYA 3AQVA 2ZV8A 1DI9A 3P7AA 4QQJA 4J71A 4BCPA 5DT0A 4TWOA 1VYZA 4TKSA 5EFQA 2XUUA 3LLTA 4TYHA 3WIGA 4F9BA 4EUUA 3FC1X 5LCJA 4MX9A 2JDVA 3QQHA 5BMMA 4O81A 2PSQA 1OKWA 2ONLC 2OBJA 3MA3A 2RG5A 3ORPA 3NAXA 4FIIA 2C6OA 4OLIA 4O96A 2QO2A 4FKTA 4OTPA 2IPXA 4J7BA 4F0IA 3UYTA 4FTMA 1OMWA 5HX6A 1GIJA 5AWMA 3R04A 3COIA 1VR2A 5ANJA 3NS9A 4O0TA 4FYOA 2ITZA 1MRVA 4CFUA 4AS0A 4YZNA 5GJGA 1LPUA 3EWHA 4HGLA 4PX6A 3DLSA 3NLBA 4E5BA 3SG8A 1ZWSA 4KBKA 4YTHA 2WXVA 4EHGA 3FMEA 1MRUA 2YCQA 5AUVA 4ZZNA 5M4CA 3SVVA 5HD4A 4C38A 4C36A 2FVDA 3CD8A 3QRIA 4FZAB 2OXXA 3OWJA 3F82A 4QPAA 4WNMA 4K6ZA 4HVIA 3G15A 4IAKA 1S9IA 1RQQA 2CKEA 2O0UA 3R71A 2C69A 4KA3A 3EQIA 3HP5A 3L8VA 3T9TA 1OL6A 3GP0A 3QRKA 5F94A 4EQMA 2BRMA 2XK6A 3UMWA 4TY1A 4AF3A 2QOBA 3OEZA 4D5KA 2CKPA 1O9UA 5GIOE 2YM4A 3TKUA 2VGOA 3DB8A 1LEWA 3QC9A 5B2LA 2PE2A 4MKCA 3VUMA 3ZOSA 1B39A 4K33A 2LGCA 2WU7A 4IZ5A 3V01A 2QNJA 5LVMA 2WMQA 2BHHA 1XH5A 1K3AA 3MFRA 3MJ2A 1Q3WA 2JKOA 3OCTA 5CEKA 5KMLA 2WIPA 4YLKA 4MXYA 4ZJIA 3QUEA 3AC5A 3Q6UA 4DC2A 2QOCA 4C3FA 5H8GA 4FKLA 3R8ZA 2VNWA 3QTIA 3H3CA 2ZOQA 2WAJA 3R00A 4H39A 3WYXA 5IQDA 2ITUA 1VEBA 2IVTA 5DOSA 4IB0A 1KWPA 4XV3A 5CENA 2YZAA 3WF8A 2RSVA 2Z2WA 4RWLA 3LMHA 4A9RA 4UMTA 3LCTA 4EH5A 2QLQA 3FLQA 5GZ9A 4AOIA 3KXZA 4YZCA 1YHSA 5FGKA 3NYXA 4AW0A 3C4FA 3ANQA 4QPMA 4BBEA 2YA9A 2JAMA 4G3FA 3VBQA 3ZDUA 3ZFYA 4ZY5A 1Q97A 3D5XA 4BN1A 4BB4A 5CF5A 3MH2A 4YO4A 4DA5A 1F5QA 2YJSA 3MWUA 3AD5A 3TV7A 3N4VA 3E63A 5M44A 2VTOA 3D2KA 1RJBA 1Y8YA 4QMNA 1ZMVA 2X4ZA 2YCSA 4RIYA 4RVKA 5JH6A 2YWPA 3ZBXA 2XKDA 3UZRA 2A4LA 4RIWA 5AP0A 2X8DA 3OTVA 3KU2A 4TT7A 2B7AA 4BWPA 4E5AX 2QOOA 4PNIA 3LHJA 3HAMA 3KK9A 4ARKA 3D4QA 3F7ZA 3HRBA 4S34A 4C0TA 2PUIA 4AFEA 5JZJA 3UDBA 2BALA 2XEZA 3NUSA 4QMOA 5DH3A 5J8IA 3GQLA 2C6TA 4P5ZA 4FL2A 4RJ3A 1CDKA 3PWYA 3R7VA 3RI1A 5LARA 4QP1A 2PTKA 2J0KA 3A99A 4BCKA 3U87A 3R1SA 5IA5A 1XBBA 4TYIA 3Q4CA 4P7EA 3RAKA 4BDDA 3H9FA 5HIBA 3UC4A 2PMNX 3EH9A 3SKCA 4Z16A 1XH7A 2RF9A 3OCGA 2JGZA 4KKEA 2IW8A 3U9CA 2H9VA 4AXAA 4LGHA 2W4KA 3V8TA 4DH1A 3LM0A 3OEFX 4XV1A 5IEXA 2WQNA 2IZUA 5JEBA 4NT4A 4ANBA 4AZWA 2ZJWA 3NEWA 3QXOA 5EG3A 1H0VA 3F2RA 4DBNA 4YO6A 1CMKE 5M55A 4F70A 5FLFA 3C4CA 3ZSHA 3VW6A 4HZSA 4C4JA 4ZTQA 4FV5A 4NJ3A 5HOAA 5CY3A 3U4WA 2VTAA 3PA5A 3BYVA 4IX5A 4F9YA 4ANMA 5DIAA 3KRJA 5LOHA 2IVSA 2YIWA 3GB2A 3HAVA 3FL5A 4U7ZA 3P4KA 5DBXA 5HZNA 3HRFA 2NRYA 3QKKA 3R9DA 4QP4A 2XJ1A 2YERA 4FK3A 3FMNA 5DR9A 4L67A 3BYUA 4GIIA 4F9CA 4DH3A 1ZAOA 3C4ZA 5LXMA 3AT4A 4FV3A 2OK1A 4N70A 3ID6C 3NNUA 3IDPA 4UWYA 3BWFA 3NUPA 2UUEA 4X2FA 5J7HA 4J8MA 3CS9A 3R73A 5I9YA 3PY3A 3P86A 4J97A 4OBOA 5EK7A 4D55A 4EKLA 4GUBA 1REJA 5D7VA 3VHEA 4CTCA 4PNKA 4O7RA 1DM2A 1YXVA 4EH4A 1Q99A 4AG8A 3A62A 4JX3A 2V7AA 3QRJA 4IQ6A 2O65A 4LMNA 5ACBC 4HVSA 5C8KA 4JS8A 2ITXA 3RCDA 2ZDTA 1RDQE 2WMXA 3Q4ZA 3RJCA 2UZLA 3P7CA 2Y6MA 2R7IA 3RWPA 3ENHA 4UMPA 4MF1A 4X7QA 3RK5A 1UU9A 1Q8UA 4WG5A 3AOXA 4E4MA 3G9NA 1VYWA 3I1AA 4XOYA 5E90A 4RX5A 1FMOE 1F0QA 4FSZA 4R1VA 5HIEA 5IH4A 2W1HA 2W1CA 3BPRA 4BHNA 1FOTA 1UU8A 1YI6A 2J0JA 4LRMA 4KB8A 5HG5A 5CWZA 4XNEA 2B1PA 1Q41A 3ORKA 4YJSA 4BZNA 5A14A 2XM9A 3RNIA 4J53A 2ITTA 2PVYA 1PXOA 3OD6X 3VUIA 3E3PA 5F20A 4D2SA 1UVRA 3IONA 4GEOA 5EYDA 4RGJA 4XG3A 4X2NA 3S2PA 2JDRA 5D11A 4PDSA 5IQBA 4DTAA 5CSWA 4O0SA 1ZYDA 3QWKA 4FI1A 4MQ1A 3U6HA 5C4LA 1M52A 4YGAA 4FTQA 5HI2A 3N4TA 3QQKA 2EB3A 3NUNA 2ZDUA 5EQPA 3AMYA 2UW6A 3MFUA 2QONA 3VF9A 3LXLA 2WFYA 4L01A 3QD3A 3ZU7A 3BHVA 3C5UA 4KKHA 5BUEA 2OJIA 5IH6A 5J9ZA 4O7ZA 2UZUE 5KHXA 3DAKA 3W55A 3QU0A 3NYNA 2C3IB 2WMTA 3R1YA 4I0SA 5IU2A 2UZDA 5EDRA 3F69A 4DBXA 3QHWA 2G01A 5IG1A 2FYSA 5HTBA 2VV9A 5D10A 3M42A 3VBYA 3WF9A 5AV0A 3L9LA 5G1XA 5L4QA 3C1XA 5L2TA 4DGMA 3ZO1A 4FNZA 3ZYAA 4X3FA 4W8DA 5BYLA 4U45A 2GHGA 4FA2A 5LVPA 2GQRA 3QRTA 4EQCA 3GU4A 4JIKA 3MTFA 3CIKA 4P90A 3R8PA 1R78A 2G15A 3QRUA 4RA4A 2XIYA 1W0XC 4BTJA 4BWXA 3FDNA 3HV7A 3BBWA 2C5YA 2GNGA 1GZNA 3DJ7A 3KN6A 3QQUA 1WBNA 2VX1A 2A19B 4AA0A 1H1SA 4B8MA 2XK7A 2GSFA 1ERKA 2W96B 5L8KA 3FQEA 3PVBA 4A07A 1YOJA 2XF0A 3VS5A 5FP6A 3K2LA 1GJOA 5JMSA 4R1YA 3PPJA 1BI8A 3W2OA 1H1WA 1WVXA 2IZRA 4PP9A 5B2KA 4PTCA 3QLFA 1QPDA 2Z7QA 4ANSA 3TNIA 3DTWA 5K0XA 4G5JA 5IQIA 4M97A 1KE6A 3RZBA 3A7FA 3GOKA 3K3JA 4ZAUA 4V0GA 2Y8OA 4FKWA 1YW2A 2BRBA 4BTMA 4FTCA 1M7NA 1CKPA 3T8OA 4EH3A 4NL0A 1PHKA 2B9HA 3NR9A 4O0RA 5J9YA 2BROA 3WE8A 2VX0A 3ODZX 4IAZA 5LMBA 1KSWA 4O38A 2VO0A 2I0EA 4RFMA 1YOMA 2F7XE 1G3NA 2WPAA 3FYKX 5D9HA 4XX9A 3GCUA 4E4LA 3DXPA 4MD7E 2CHLA 5L6OA 5L3AA 3PG3A 4K0YA 2E9PA 3Q3BA 3R22A 1U54A 3KXMA 1KE8A 3AT2A 3P7BA 4L3JA 5HCXA 3ANRA 4WHZA 2ITWA 5CZHA 2FA2A 4RG0A 4YP8A 5KKRB 2IWIA 3OVVA 4IW0A 3TI1A 1JNKA 3MTLA 5FDPA 3NIZA 1Z5MA 4UN0C 4JDIA 3A8XA 3WZDA 4CQEA 3RVGA 4K11A 2ERKA 4M66A 3TKHA 4DFZE 3QL8A 4FODA 5L8JA 5TKDA 3SDJA 2W4OA 2V0DA 3MDYA 4J8NA 4TTHB 4I94A 3ZMMA 3LCKA 4BY9E 4IVBA 4ERKA 4X0MA 4CG9A 2GNFA 4FKRA 5HD7A 1H26A 2R5TA 1ZY5A 5CAQA 3KCFA 4IACA 3QX2A 3MIAA 4QO9A 1SNXA 5HHWA 4KRDA 3MB6A 5GNKA 4YC8A 3QCXA 4AW2A 3E8CA 2B52A 5CEIA 3V3VA 4C61A 2YIYA 2FGIA 1W84A 5HNBA 3G0EA 3MS9A 4DT9A 3HV4A 2X39A 3L9PA 3BYOA 4IZYA 3AC1A 5DR2A 3VS4A 4R5YA 4EWQA 3CQUA 4JBPA 2PUNA 4ZLOA 1SVEA 2OJGA 4EH2A 3O8UA 3FPQA 4PDYA 5GJDA 1TQIA 3ZDIA 4KIPA 3DY7A 5FM2A 4FZ7A 2HZ4A 3FZPA 4JR7A 3FXZA 2VTJA 4YNEA 4APCA 2WTKC 2WB8A 2QODA 3C0HA 5CAUA 4DYMA 3A60A 3HMIA 3A8WA 4F7SA 4ACGA 4IVCA 1GNGA 3FE3A 5H8BA 4Y5QA 2RFSA 4LGGA 4R5SA 3DGKA 4I1ZA 5DYJA 4E93A 3VO3A 2JEDA 1H00A 1PXNA 5CEQA 3V8WA 3MVMA 2JDOA 3KRWA 3Q53A 3NYOA 2RFNA 3LE6A 2QOFA 5EW9A 3U9NA 4PF4A 3EQPA 3GVUA 1YWVA 5KMNA 2W1GA 4BDEA 4BIEA 4WSYA 1FVTA 3KULA 4FG8A 5H3QA 3VS1A 2XNPA 3CR0A 3AC2A 3F5GA 4L68A 3IGOA 4A9UA 2J51A 3P78A 4MXXA 4TWPA 3UVRA 4FUYA 3DBFA 1A9UA 4ITJA 3ULZA 4EWHA 1QPCA 5KMJA 3ZRLA 5M06A 5FG8A 5BNJA 2VWBA 3F2NA 4U80A 5GZAA 2JBPA 4F1TA 1XR1A 2C6EA 2XKEA 3BHYA 2WTVA 4IB1A 4JJRA 2C5NA 1XBCA 4OT6A 1JSVA 2BMCA 4IB5A 3TG1A 3F66A 3GCQA 3RNYA 3FKOA 3QZIA 4EK4A 1OKZA 2DQ7X 2UW8A 3CPBA 5KNJA 3LXPA 4O7YA 4QTCA 4KBCA 4UEUA 3W33A 4BDFA 3S95A 5JQ8A 2VTNA 3F3ZA 4GFGA 4RFYA 4R8QA 4D4RA 2CSNA 3KVXA 3I4BA 3CTQA 4FKSA 4FSMA 3ZXZA 3EQGA 3NGAA 3COHA 3ELJA 2HY0A 5T68A 3I60A 4EBVA 3PP1A 4F9AA 4MNEA 4DH5A 4PDOA 2UVYA 4MWHA 2REIA 1CKIA 4BC6A 5AP3A 3ORTA 1FGIA 4K18A 4LI5A 4FIFA 1M2QA 2BAQA 2CN8A 5CI7A 2W9ZB 3ZCLA 3ZO4A 4EBWA 5L6PA 2R3FA 4R3RA 4JBQA 3GC8A 4HYIA 1SYKA 5KBRA 1J91A 5CU4A 3ZZWA 4H1JA 5IA3A 4DGGA 4QRCA 4L46A 5IDPA 2I0VA 3WBLA 4C37A 3LFSA 1M2RA 3H10A 4KKGA 3T3VA 3LCDA 2EB2A 3EZVA 3BGZA 3MPMA 4CYJA 4AWIA 3D5VA 2JDTA 1Y57A 3EQCA 4UB7A 5T6KA 4C3RA 5HE1A 5CF6A 2HW6A 5L8LA 5BUJA 1NW1A 5ANGA 3OZ6A 4DAWA 4LG4A 3CPCA 4AT3A 3I7BA 4AE9A 3F6XA 2B54A 2HK5A 3DAEA 4ITIA 3A7IA 4BDAA 2ETMA 1BMKA 2BUJA 3LFFA 4QYGA 4AA4A 4CKIA 3R1QA 2VWYA 4TYGA 4U41A 4RQVA 5E9EA 1BX6A 2VRXA 2RG6A 5DGZA 4LRJA 3JY9A 1J7UA 5M07A 3VIDA 3QFVA 4F9WA 4Z3VA 5HORA 4FKJA 1XKKA 3QBNA 4D2RA 3FHIA 2C3KA 3WIKA 4JLCA 1T46A 2GNLA 5E8UA 3RP9A 3KL8A 4II5A 2W4JA 2QG7A 3DNEA 3TEIA 3RZFA 1G5SA 4FTLA 4YJTA 4FL3A 2Y4PA 5EQYA 3DT1A 4ZOGA 5AX3A 3MESA 2PZYA 5BPYA 1PXLA 3QCYA 4BRXA 4U0IA 5KHWA 4G6NA 4J1RA 5JN2A 4UZDA 4LUEA 2QLUA 3QA0A 4U42A 3WF5A 4O0VA 3DU8A 5TE0A 4ZJVA 5BX0A 2UW7A 4DFUA 5E4HA 1SVHA 1ZARA 1YKRA 3LJ1A 2B9IA 3QAME 4TYHB 3Q32A 5L2QA 4KUJA 4BBFA 4UXQA 4DTKA 3CQWA 1O6KA 3W2QA 2VTPA 4TN6A 1KOAA 4D0WA 4XG4A 5AADA 5F95A 1NVQA 5KZIA 2PUPA 5LMKC 3BWJA 3Q5IA 3UNZA 3N9XA 5FP5A 4IWOA 5A9UA 1OL2A 1K9AA 5D41A 3EN9A 1PXKA 3DPKA 1TQMA 3DV3A 4DEGA 3E7OA 3HDMA 3GCSA 4I0RA 3Q04A 1A06A 2F4JA 1ZYCA 2HIWA 4E4XA 2X1NA 2JIVA 5DEWA 4OTRA 1B38A 2OU7A 3EB0A 3ZUUA 4F0GA 5A4LA 1T45A 4O84A 2E9OA 5JQ5A 4IADA 4U5JA 1H28A 3UE4A 4ALVA 4AU8A 3W8LA 4KABA 4PPAA 3TJCA 3VS3A 4YZBA 2X9EA 3EN7A 3NNWA 3WOWA 1JSTA 1PRYA 3VHKA 4G3CA 3DCVA 3PIYA 4NM3A 4GMYA 3BKBA 3P5KA 2X4FA 4OTGA 4RVMA 3V6SA 3L8PA 5DEYA 1TKIA 1OKVA 3BU5A 1LUFA 3DZQA 2A27A 4O7TA 3ZRKA 2J5FA 3OBGA 1CM8A 4JDHA 4N4SA 4O7VA 2F9GA 5M4UA 3B2WA 4HYHA 3LFDA 1IRKA 3CTJA 4GG5A 4JDKA 5DI1A 1G8SA 3ZC6A 1ZY4A 5EOBA 1OPKA 4U43A 4D9TA 4KINA 2BRNA 3QUDA 4QMUA 2PVHA 3G33A 4IC8A 3Q2JA 5CAOA 3SG9A 4CGAA 1IA9A 3PE2A 4FVPA 2DS1A 1NA7A 3NMUF 4XP2A 3ZM9A 2GQGA 1XBAA 3I5NA 3UBDA 2A2AA 4P2KA 1IAHA 4QYEA 2HZIA 5CX9A 1JAMA 3RM6A 4LM5A 5DG5A 4YZMA 1XJDA 3TNWA 4ZY4A 4PUZA 2XIXA 5CU0A 2OG8A 4I24A 4BTKA 2XYNA 4AX8A 1OBDA 3F3UA 4KS8A 5JRQA 4FKIA 2YM6A 5E8WA 1R3CA 1Q8TA 2C5VA 3OXZA 1LP4A 3E8DA 4BI0A 2Q83A 4DTBA 4G17A 3MW1A 4MYGA 1PXMA 2O3PA 3I6UA 2J9MA 3NCZA 4FMQA 5AR4A 4EC8A 4OTWA 3UQCA 5J1WA 4OR5A 3W16A 4IJPA 1JPAA 5EYKA 1MUOA 3ZTXA 2OGVA 5ETFA 2J6MA 3F61A 3IKAA 5KX8A 4FYNA 2CPKE 5JFSA 3S1HA 5J9LA 5CVHA 1PMVA 2ESMA 4FV8A 4V05A 4RIYB 2JBOA 4F6SA 5LJJA 4RIOA 2R3RA 4RIWB 2O64A 3LQ8A 3QZGA 2YABA 3EYGA 4C58A 5CEPA 5KCVA 3TV4A 2WZJA 4ALWA 1JSUA 2RIOA 3KXXA 5AR5A 3QYZA 4CD0A 5K4IA 5HKMA 3SW7A 4J98A 4FX3A 3ORXA 4UYNA 5EQEA 3OS3A 3SD0A 2OJJA 2X2KA 3BCEA 3ERKA 2YISA 4V01A 5EKNA 4X2KA 4CLJA 3D5WA 3VULA 5BMSA 3H30A 1ATPE 3OY3A 4RPVA 1OUYA 4I6QA 4EC9A 1BYGA 3PUPA 3HMNA 2YITA 5B7VA 4NCTC 2ZM1A 3I7CA 3KVWA 5H8EA 3WILA 3OY1A 1OL5A 2OF4A 4FNWA 4FTJA 5E7RA 3BE9A 1APME 2VUWA 3LMGA 4NFMA 4O2PA 3FKLA 3Q5ZA 5AIRA 1UNGA 3BBTB 3PIZA 4L45A 3GU7A 2OSCA 2VD5A 2XCKA 3E87A 2P3GX 4UWBA 1CSNA 4CSVA 3II5A 4IFGA 2W0JA 4PPBA 1BI7A 5FDXA 4BDJA 4DGNA 1DAYA 5A4QA 1Q3DA 3SXSA 4A9TA 3U6IA 3V8SA 2CCIA 5HLNA 4C7TA 3IO7A 2QD9A 4IWQA 4X6RA 3O2MA 4BYIA 4APPA 1L3RE 3QUPA 4WUAA 4YTIA 4FV1A 1Q8YA 3KKVA 4ASXA 3R83A 4M8TA 3RPOA 4AFJA 5LVOA 3I0QA 1H1PA 4XP0A 2V55A 5HNIX 2OO8X 3PPKA 2BDJA 1U4DA 2JD5A 3NUUA 3PJ8A 4XEYA 2W5BA 4L53A 2DWBA 1PXPA 4TPTA 3VAPA 3FLWA 3QZHA 4O91A 4FUXA 4MXCA 3W2CA 3WF6A 2R0IA 3ZHPC 5AA9A 4IDTA 3FJQE 4ZTHA 5IPJA 5FRIA 4RWKA 5FTQA 4RQKA 2Y7JA 1Q8ZA 4M84A 4DGLC 4IAAA 4YSJA 3ZS5A 4W4XA 1X8BA 2XRWA 3LJ2A 3CSVA 3TDVA 4BKYA 1P5EA 3R2BA 4PPCA 3G6HA 3FLZA 2PL0A 2W9FB 2ZMDA 4CEGA 5FTOA 5FXRA 2EU9A 4YU2A 4O0YA 4S32A 1I09A 4MBJA 1OKYA 5A54A 4BBMA 1WCCA 3FSKA 3PVWA 3Q96A 4FT5A 1U5RA 2XEYA 4V04A 4PTEA 4LYNA 2CGVA 4QPSA 5TT7A 5EDPA 2RGPA 1H1RA 2QC6A 1WBOA 3R8VA 3RKBA 5IMEA 4BR3A 2WTJA 3O71A 1ZOHA 3R8LA 3U51A 3W2SA 3FMKA 4EL9A 5BYZA 4QTEA 2PUUA 1ZRZA 4WSQA 1Z57A 5AR3A 5M4IA 3VUTA 2X6DA 2R3IA 1H27A 3ZBFA 4RBLA 1Y6BA 1KE9A 1J1BA 1VZOA 2QOIA 4FSRA 4QMLA 4FTUA 2WEIA 4CRLA 4U9AA 4RLLA 1H24A 1NT2A 2VAGA 3WYYA 4YJQA 2PZPA 3FL4A 4YHFA 5DT4A 1STCE 4QTBA 5CXZA 2R3GA 5CU6A 4O27B 4P5QA 4ZY6A 4DEBA 5FD2A 2YDKA 4BKJA 2PWLA 1E9HA 3E8EA 5GZ8A 4NIFA 3KFAA 3BLRA 2RL5A 5E8ZA 4IWPA 2QCSA 3EL8A 4XBRA 2JFMA 3D9VA 4C33A 4JX7A 3ACJA 1CTPE 2ZM3A 3A7HA 3DQXA 3NAYA 4EK5A 3SV0A 3ZM4A 5BVFA 4FKQA 3VVHA 4BWKA 5LCKA 2J4ZA 2OFVA 2Z7SA 4FNYA 3C9WA 2IG7A 3E7VA 3IK3A 4KIKA 3W18A 2BTRA 4YUQA 1O6YA 4DEIA 1Z9XA 5K5NA 2ETKA 3CKWA 2YAAA 4C2WA 4EOIA 4L42A 3TIZA 4CZYB 3I6WA 1GIHA 5K0KA 4QMPA 3FXWA 3HMPA 5FBNC 3UODA 4Y83A 4QP6A 5J7BA 3GBZA 4GJ2A 1HCLA 4X3FB 4A9YA 4D1XA 3TKIA 4ASDA 3CLYA 3UO5A 3VS7A 4IVDA 4DE4A 2W5AA 4LFIA 3MI9A 4RT7A 4ENXA 4N0SA 3LOKA 3G9LX 2HWOA 4O2ZA 1IAJA 2JC6A 3GCVA 3HYHA 4A4XA 3PP0A 5GINE 4JI9A 3BHUA 4LOPA 4FSQA 3T3UA 2OZOA 4OTQA 4YJRA 1K2PA 4EORA 2PVJA 3HZTA 3H9RA 3EKKA 2CN5A 4BF2A 5T3QA 5BQ0A 2IZSA 4B9DA 3FMHA 4EYMA 3QTZA 4R7BA 3RCJA 2ZV7A 4ZJJA 4LOOA 4I6HA 4HZRA 3NWWA 2C3JA 4RZVA 3BYSA 3MGYA 4V0GB 3ZRMA 5CASA 5C9CA 1WFCA 3A61A 3RBWA 2ZAZA 2XKFA 3Q6WA 3KGAA 3CJFA 4E4NA 4LV8A 4I41A 3BU3A 4ENYA 3M11A 2OXDA 5TOZA 3IOKA 1SM2A 2UV2A 5AUXA 4A4LA 2WMUA 3CBLA 3HGKA 4I21A 4FSWA 1TVOA 4ACCA 3HUCA 1YWRA 3LPBA 2VTTA 2G2FA 3LLAA 4XRJA 5HG9A 2XK8A 4YLJA 4HPUE 4CCBA 2OH0E 2PZ5A 3QWJA 4NK9A 3RGFA 3PTGA 5CI6A 5BVKA 4XG6A 3R8MA 1U54B 4LRKA 1Y8GA 4D9UA 1PXJA 4DGOA 4S31A 5AV1A 3TJDA 4WG4A 3RK9A 2XM8A 4GKIA 4BYJA 3O8PA 3QQGA 4LMUA 1J3HA 3DXNA 4IHPA 2QI8A 1H07A 3DBDA 5E1SA 4RJ4A 2XP2A 5CSHA 5DMZA 3HV3A 2E9VA 2WTDA 4BICA 1PXIA 3NW6A 2ITOA 5A4CA 4EYJA 2PMOX 4BHZA 3PA3A 3ZXTA 3QQJA 1BUHA 4JAIA 3PVGA 4XMOA 4EOMA 3KK8A 3C0GA 4TWCA 3BRBA 4O7SA 2BRHA 3AC4A 3NDMA 3PXQA 2IO6A 3BV3A 4IC7A 3THBA 3R9OA 3AT3A 3V5TA 2P0CA 3VJNA 4BVUA 2A0CX 3ZFXA 4E6CA 3D83A 4C4EA 4UALA 3HA6A 4FT7A 5C03A 2IJMA 1KOBA 1YXXA 4O1PA 4ZSJA 4GSBA 4ACDA 4FV9A 4IAYA 3KEXA 3DA6A 4YURA 1QPEA 3TXOA 2EWAA 3C4XA 2UVXA 1R1WA 2FH9A 2X9FA 3MJ1A 2OXYA 4HCUA 4JG7A 4CT1A 3BGQA 4QYFA 4PV0A 3AC3A 4UXLA 3ZLWA 1URWA 5IUIA 4MTAA 5A46A 2OIQA 3GU6A 3UOLA 4MD9E 4ASEA 4B8LA 4XG9A 4ZTSA 3R28A 1W8CA 5LVLA 4I5HA 5EM8A 4EOSA 1J7LA 3COKA 4OBPA 1JWHA 4XS2A 3IECA 3IPHA 4PMTA 4U6RA 5EHLA 5HX8A 5L2SA 1QPJA 4NKAA 1RE8A 1URCA 3PLAE 3LVPA 5CNNA 4BDGA 4D4VA 4FEQA 2Z60A 3IS5A 2J0IA 3R7IA 3NW7A 1WBTA 3O7LB 4FSNA 4QQ5A 4I4FA 4RX9A 1M14A 3KULB 2FSMX 1L8TA 5HGIA 4C4IA 3AMAA 1JKLA 3MY0A 1Q61A 4RIXA 5KO1A 4FEVA 2VGPA 4XJ0A 4DF3A 1YXUA 3R9HA 5J5TA 4FV6A 3QD4A 4C8BA 2YLFA 3BX5A 4ZIMA 3QKMA 3TZ9A 3V5PA 4EHVA 4EZ5A 3FMMA 3UTOA 2H6DA 5J87A 3C4EA 4H3BA 3UIMA 4ZLZA 4DEAA 3C4WA 2PVNA 2NNWB 2YACA 4YZDA 2WTCA 4TYJA 1PMNA 3QD0A 4C35A 2ZB1A 2B53A 4H3PA 5JGAA 3ZSIA 4EHEA 2YM5A 4ZK5A 4DFBA 2HXQA 2CGUA 4M0YA 2GHLA 3SOAA 3Q60A 2WKMA 5HE2A 2VTSA 3UG1A 3PSDA 4G3DA 4QYYA 3FPMA 4NFNA 4EJ7A 2VWVA 3L8SA 2R3HA 4DG0E 1M7QA 3ULIA 3R01A 2F7EE 2VU3A 4B4LA 1XH9A 2FSLX 4C3PA 4FE2A 4TWNA 4M67A 3QKLA 3GQIA 4UMQA 4FVQA 4MNEB 2UVZA 4D1ZA 3TT0A 4OW8A 3SC1A 2GTNA 4IX3A 1OIQA 3GOPA 4DFYA 4IM2A 4JDJA 5HO6A 4EH6A 3DAJA 4RZWA 4TXCA 2WO6A 3RPSA 3UOJA 4R7HA 4FT0A 4JQ7A 4WUNA 3B8QA 2UW0A 3GGFA 3LXNA 2X7GA 4CKJA 5EW8A 5CSXA 3Q9WA 2GPHA 3F88A 3ODYX 3EFWA 5CSPA 5IISA 3AGLA 5HO7A 2GNHA 4OBQA 3HMMA 4ZS4A 1OIRA 3ALOA 4ZZOA 4ZTMA 5IA0A 3U8WA 4EQUA 3OUNB 1UNLA 3KRXA 4QMZA 4W4YA 1JQHA 3ZO3A 2C6LA 4H05A 4QNAA 1UKHA 2W5HA 3GXLA 4F0FA 3VRYA 4NZWB 3LFCA 4A9SA 3LFAA 5B2MA 5HESA 5HU3A 3ZFMA 4DFNA 4OAVB 1OZ1A 2IVUA 3GFEA 2VO6A 2W1EA 3KXNA 1P4FA 3PZHA 3LW0A 1YXTA 1WAKA 3GNIB 4XH6A 3M1SA 4YR8A 3TIYA 4I4EA 3BQRA 3V6RA 1PW2A 3OHTA 3PXRA 3PYYA 4XRLA 4AE6A 4CFMA 5CS6A 4BDHA 4W8EA 3DBQA 4MH7A 4RA5A 3HA8A 5L2IA 3SX9A 2JITA 3O7LD 1SZMA 1OBGA 1Q4LA 2AC3A 1OECA 3TNHA 4N6ZA 3FUPA 3U54A 1XH8A 4MQ2A 4Z9LA 2Z02A 1HCKA 3FSFA 4E6DA 5JRSA 3U6JA 3ZEWA 3LMIA 4FBXA 5EHOA 3KC3A 4C59A 1OB3A 2ITVA 2V22A 3IW8A 3DKCA 4G1WA 3MN3A 4E6QA 4X2JA 3W1FA 3UPZA 4RWJA 3S4QA 2C4GA 3OBJA 4G3EA 4JOAA 5AUZA 3R7GA 3JS2A 3G5DA 4RX8A 4BIDA 3PJ3A 5ACKA 3W2RA 1OM1A 1KE5A 4CMOA 3SRVA 4K2RA 1MQBA 3DQWA 3MIYA 5DPVA 4NYEA 3LM5A 3I79A 1QMZA 3VUDA 1OPLA 3MH3A 5A3XA 2O5KA 2GNJA 3AD4A 4PMMA 1TQPA 2VO3A 2I6LA 1IASA 3G2FA 3IDBA 3QQLA 5FWKK 4DT8A 2ZM4A 4DINA 4EUTA 3GC7A 2PE1A 1R0EA 1JOWB 2Y9QA 2VX3A 1SMHA 3C0IA 2HOGA 3ENMA 2ZVAA 4FIGA 1YVJA 4XV2A 4YPSA 5AP2A 3PRFA 4G31A 3NW5A 3D15A 3MVJA 4I92A 4LL5A 3ZLSA 5M56A 5AV4A 4OGRA 2X0GA 3JYAA 2XNBA 3DK3A 5D7AA 3ALNA 1KUTA 2YLEA 2XJ2A 5JGBA 4O7LA 4AGWA 4C4HA 5F9EA 4LQMA 2P4IA 2PK9A 3MH1A 4LOQA 1HOWA 1JKTA 3JR1A 3TWJA 2QOKA 4GU9A 1LR4A 2ZV2A 3PJ1A 5AJQA 3UJGA 4BZOA 4BDBA 4NW5A 2F2CB 2OICA 5TF9A 3TL8A 2VTLA 3C13A 2J90A 4BCIA 4BCJA 3CGFA 4E1ZA 5I9VA 4KWPA 5CLPA 3QTWA 3PLSA 3LFNA 4QQCA 4EOPA 1WZYA 4NM0A 2VTIA 2JKQA 1YI4A 4ACHA 3VBWA 2ITQA 4F09A 3FLSA 1IR3A 4KAOA 1ZYJA 4NCTA 4FV0A 5AMNA 3MPAA 4U40A 1OVEA 2WMBA 3FY2A 3FZTA 2B0QA 2ONLA 4DCAA 1PYXA 2C1AA 5CVGA 3RPYA 1H25A 4AZEA 2JKKA 5IQEA 1UWJA 3BHTA 5EH0A 4GUEA 4FTRA 5M4FA 3ZUTA 3S00A 4M12A 4RMZA 4KIOA 3NX8A 4UY9A 3UPXA 1V0OA 5HTIA 5IMXA 2XS0A 3RTPA 2OWBA 4AT4A 3DKOA 4NTTA 5AV3A 3QTRA 4AW5A 2FSOX 4IFCA 4JR3A 5HCYA 2JLDA 3DFAA 4G34A 2ETRA 3EN5A 1PYEA 3RHKA 4HVDA 3CEKA 4IWDA 4U97A 4CZUA 2XB7A 2PMIA 4OT5A 4C34A 3OFMA 3RINA 2RFDA 4AGCA 5CAPA 2O8YA 2G2IA 3EZRA 3FXXA 3QC4A 5F1ZA 4ZMEA 3S0OA 3ORLA 4EH7A 3WZEA 4L7SA 1XQZA 1E1XA 4MAOA 2VWIA 3F5XA 4X3JA 3UNJA 4YBJA 4X3FC 1R39A 3HLLA 1DS5A 1O6LA 5HBEA 4O6EA 2BFYA 3DS6A 1JKKA 4GCJA 4IX4A 1B6CB 3DXQA 2OZAA 4IB3A 2WIHA 3KXHA 5HLWA 2WMSA 5AUYA 4YZ9A 2HELA 4GW8A 2IVVA 2KTYA 2VZ6A 3OUKA 3A7JA 1FPUA 2C6IA 4AT5A 3EQDA 4RWIA 3UO6A 4UZHA 3WE4A 5AP7A 3OT8A 4KBAA 2PU8A 3DDQA 3ET7A 1GIIA 3MVHA 4FV2A 4YMJA 2VWXA 4I5MA 4P4CA 4IEBA 4WNKA 5HE3A 4FV7A 4U3ZA 5CF8A 4ZXTA 4E6AA 1OL1A 4EK3A 4F7NA 2CLXA 1PY5A 4QMXA 2GCDA 1XH6A 4ZSEA 5EM5A 4O7WA 1REKA 3P79A 2GS2A 3C7QA 2QR7A 1QCFA 3Q9YA 3PSCA 3MFSA 5BVNA 4ZMFA 3ORZA 1VJYA 3PA4A 4AGUA 3UVPA 4Q9ZA 4JQ8A 2V62A 4C4GA 2QG5A 3N4UA 4WNOA 4QP7A 1U46A 4XOZA 3V5QA 3LFQA 4IIRA 4I5PA 4Y85A 3NUXA 1A48A 2CKQA 5AX9A 4E7WA 4CFVA 3RWQA 2P33A 4GL9A 3OG7A 4JL9A 5ITAA 3LJ0A 4WT6A 5KMIA 5AAEA 5ANOA 2XNNA 4IZ7A 1P14A 3LZBA 4X2GA 4OUCA 2WTWA 4ASZA 2H96A 1WBPA 2YIXA 2W06A 2YM3A 1P4OA 4B7TA 5AUTA 5HG8A 4MXAA 3ROCA 5HTCA 1NXKA 1PJKA 3P1AA 5G6VA 4FZDB 4IANA 3GFWA 4I22A 5IQAA 2C6KA 3VBXA 4F1MA 3HUBA 2GQSA 3P08A 1GY3A 5I9WA 5AM7A 5ANDA 2C6DA 2HENA 3CQEA 4CMUA 4GKHA 4RVTA 3CC6A
chains in the Genus database with same CATH superfamily
3OW3A 2HWPA 3NRMA 4G5PA 3TTIA 3LCOA 4O0XA 5A6OA 4M15A 4PWNA 3KMMA 2JDSA 3NIEA 4NWMA 4D5HA 4O6LA 5IF1A 4DH8A 3SGCA 2OKRA 4L9IA 3BEAA 2WOUA 2BZIB 4FJVA 3VN9A 2UZBA 4E20A 4CNHA 3K5UA 1JLUE 3AD6A 5DR6A 2R0UA 4DLJA 3OROA 1QL6A 2WMWA 1PMEA 4HYUA 4XUFA 4F99A 2OFUA 4FT3A 4IH8A 2ITPA 4AZSA 1VLRA 1YXSA 3A4OX 4R7IA 3F3WA 3FZ1A 2WQOA 2WELA 3Q52A 3DK7A 4EJNA 4I0TA 5GHVA 4FICA 3UO4A 5HVKA 5I4NA 2R3LA 3FMLA 3P9JA 4PMSA 3FLYA 5L6WL 2GTMA 1ZYLA 3QHRA 2X7FA 4JBOA 4L3LA 3HDNA 4YJVA 2GFSA 2BTSA 2X8IA 4JAJA 4NIFB 2BZJA 3PXZA 3K54A 4ACMA 2BR1A 4O22A 3VRZA 1FQ1B 3D94A 3KF4A 4L44A 4B0GA 3MY5A 2AUHA 2UZVA 2QU5A 5GJFA 3E88A 5BVDA 4XV9A 2J2IB 3E3BX 3FZRA 4EK8A 3AG9A 4IVAA 3UNKA 2VTRA 2JIUA 5ETCA 2YWVA 1BLXA 4KIKB 5FTGA 4DLIA 5AP1A 4E26A 3TNQB 5DFPA 4DG3E 2I0YA 3PE1A 2YAKA 2V7OA 3TZ7A 4F7LA 4GT4A 2Z7LA 4RJ6A 3G90X 3WZJA 4PL4A 4QNYA 4R6VA 5CEOA 3BU6A 4N6YA 1ZZLA 3R7UA 3ZONA 4LV5A 4TZRA 2VO7A 3PFQA 4D2TA 4FSUA 4JG6A 4X6QC 4BCGA 4TL0A 4UMUA 5M51A 2C3LA 3D7TA 4CV9A 4HYSA 5K5XA 1FMKA 3AC8A 4FIJA 4FTOA 3WI6A 2WOTA 4BTFA 3ATTA 4YJNA 4QMSA 3QX4A 4MHAA 4DN5A 2UW4A 4ZZMA 3OXTA 2PY3A 4DITA 4EZ3A 3VC4A 3Q4UA 4M69A 4CVAA 4Y73A 4U3YA 4L00A 2JIIA 4MEDA 4J95A 4XLVA 3O96A 2CNQA 3MB7A 4K1BA 5CQUA 2B55A 4AN2A 5CF4A 3U55A 4FEWA 4Y5HA 3BYMA 3WF7A 4ZLYA 3DK6A 3RALA 4BCHA 5CQWA 4AXEA 2NYAA 5I9ZA 5FXQA 2XKCA 5AFVA 1JBPE 3JXWA 4EOKA 3UQFA 2E9NA 4WRGA 4WOVA 4U79A 5KE0A 3PXYA 3TM0A 4USFA 1ZMUA 3LAUA 5EI6A 4BDIA 3W0NA 3HP2A 1H8FA 3OWPA 1IA8A 5HNGA 5A4EA 1MQ4A 5K4JA 2R64A 4XBUA 1YDSE 2QURA 1Q62A 5CEMA 3TUDA 4IE9A 2W1FA 2WHBA 4TYEA 3Q9ZA 3R7YA 1GAGA 5HICA 5L2WA 4XYFA 2ACXA 2WTKB 4PTGA 4YJPA 3R8UA 4A7CA 5KKRC 2HY81 3IG7A 3DOGA 3GENA 1YOLA 4ZS0A 3E62A 2A1AB 1IEPA 1YI3A 3UZTA 4O0UA 1W98A 5HG7A 4I6FA 2HAKA 3FQHA 5JT2A 4JVGA 4UMRA 1UU3A 2OH4A 3POOA 4EOJA 2P2IA 2Z7RA 3C51A 2YZLA 3PWDA 1OGUA 2G9XA 2WNTA 3O8TA 5IQHA 3OC1A 4WKQA 4AOTA 3BIZA 4E73A 4LUDA 4ZTRA 4MWIA 4CT2A 2C0IA 2C1BA 1OIUA 2WTIA 2X8EA 5D1JA 4RC4A 3IW4A 3R9NA 4CMTA 1H01A 2C47A 3COMA 3TNPC 4TW9A 3KXGA 5EM6A 1IG1A 3D14A 5J5SA 2PVLA 1AGWA 5B0XA 1GZOA 2UW3A 3O0GA 3MV5A 3PY1A 3EFLA 4H36A 3VBVA 5KBQA 3DNDA 4JRNA 3BV2A 4QT1A 4QTDA 4GU6A 4RLKA 3V5JA 1GZ8A 3SXRA 3DBEA 4F4PA 2QOHA 3BEGA 5EYCA 4DEEA 4EH8A 4AN9A 2PVKA 1UKIA 1NY3A 2EXCX 2QHMA 3P23A 4FTAA 4G6OA 3HVCA 4GT3A 3AXWA 4IX6A 3R7OA 4D2WA 4FG7A 1FGKA 2CMWA 2IF8A 4WNPA 2VTMA 4FV4A 2Y0AA 3KRLA 5EOLA 4ALUA 1FVRA 5H2UA 3TN8A 5IKWA 4AZFA 3DKFA 1AQ1A 4EOQA 3E93A 4ORKA 5I3OA 4YJUA 3OOGA 3QTQA 3DFCB 3UMXA 4O0WA 5C8NA 4M7IA 1SNUA 3MSSA 4GYIA 5AR8A 4GG7A 3LIJA 3OF0A 2Z8CA 2I1MA 2XZSA 3OMVA 2CCHA 4I23A 4F65A 2CNVA 2PPQA 3NZ0A 3W0MA 1BL6A 2X6EA 3Q2MA 4FRFA 5IA2A 5IUHA 5FM3A 3RK7A 2WGJA 4YHTA 4D2VA 4FR4A 1ZMWA 1NVRA 4FG9A 3DB6A 2CDZA 5HE0A 2B4SB 2XAOA 1FINA 2YEXA 4J52A 4F6WA 3NYVA 3EFJA 3FI2A 3ORIA 2CKOA 4W9WA 3V04A 3TTJA 3PXFA 2G2HA 4FVRA 4ONAA 2WMAA 2BFXA 4KSPA 4RIXB 5KMKA 2CJMA 4O7NA 3H9OA 2YDJA 2OIDA 3ZLXA 4ZSLA 1PKDA 1U59A 4JIAA 2YN8A 4YC6A 3OTUA 1H08A 4AQCA 4CV8A 2UZEA 4ANNA 4FGRA 5H9BA 3G6GA 3Q9XA 4CKRA 5AIKA 3TDWA 5ANEA 4BGQA 2XA4A 4GIHA 5AAFA 2HYYA 4BCNA 2QO7A 4D0XA 4FEXA 5IA1A 2BAJA 4FSTA 4WIHA 2VTQA 3HMOA 1W82A 3KY2A 4EONA 4DG2E 3PY0A 3IGGA 3HV6A 2GS6A 3O50A 3W0SA 3HL7A 1KV2A 4USEA 4QOXA 3ORMA 4FT9A 2R3QA 4L52A 3UP7A 3UDTA 3QD2B 5HO8A 4MVFA 2QKWB 3E64A 4JG8A 5D12A 4HGSA 3BLHA 4RSSA 4AP7A 3H4JA 1UU7A 3PDTA 4FC0A 4YPDA 5AAGA 3W32A 4QMTA 1KV1A 3W10A 3UIBA 3F2AA 4ERWA 4QMYA 3KA0A 3DJ6A 2J50A 3GC9A 4HGEA 4RC3A 5E1EA 1OITA 4AACA 4D4YA 3FLNC 3WZUA 1BKXA 3CD3A 3MPTA 3A4PA 3TUCA 5BVOA 4QDVA 5EYMA 4M0ZA 4OTFA 4OAUC 1GOLA 2GHMA 5E8SA 2IW9A 1Y6AA 3B8RA 4QP8A 3BL9A 4GYGA 5IQCA 3R6XA 2R9SA 3PG1A 5HVYA 2C0TA 2QU6A 4H3QA 4QYHA 4WO5A 5DWRA 5FBOA 2XANA 3JUHA 3ORNA 2NPQA 4ANQA 4JNWA 1OI9A 5FUTA 2W1DA 3G0FA 2BDWA 4GV1A 4PRJA 4GK3A 4BCFA 4LDTA 4UV0A 4BZDA 3L9MA 5I5ZA 3VBTA 3DJ5A 3GU5A 2R3PA 3PXKA 3Q4TA 1WVYA 4EHZA 4CTBA 5AP6A 1V1KA 4GK4A 3V5WA 2ITYA 3BHHA 3RAWA 4C57A 2GDOA 4I20A 4JXFA 4BI1A 4EOLA 4C62A 4HVGA 4QMVA 3TCPA 4MBLA 1DI8A 3A7GA 4O4BB 2VNYA 3MA6A 4G3GA 2VWUA 2AYPA 2ZMCA 4AAYA 3F5PA 4MUQA 2PVMA 2FO0A 2ERZE 2PVRA 4A4OA 2B9FA 4NTSA 3PIXA 3N51A 4XG2A 2Y4IB 2YM8A 4DFLA 4OTHA 1WVWA 3RM7A 3SA0A 4S33A 3FV8A 3EQFA 4HCTA 2F7ZE 2VWZA 2GFCA 3QCQA 1Y91A 4RRVA 4WBBB 4D4SA 4BCOA 4I6BA 4MD8E 2KULA 3K5VA 4FGBA 4Y8DA 5IDNA 3F3TA 1ST0A 4USDA 5JKGA 2BRGA 4LL0A 5K3YA 5AP5A 4G2FA 2QVSE 3VUGA 2CNUA 3UGCA 3M2WA 3SRVB 4MXZA 3BI6A 5DT3A 4KRCA 5EW3A 4ANOA 2HCKA 4EI4A 2YIQA 4DDIA 2XK9A 2O63A 4BCQA 2XMYA 5IUGA 1H0WA 3GC0A 4CFFA 1WBWA 3RPRA 4IBMA 4JRVA 4QP9A 4Z55A 4HNIA 3L1SA 5E8TA 2YFXA 5IQFA 2EUFB 5HBHA 2PMLX 3PJCA 3R63A 1LEZA 4AZVA 4D28A 3JVSA 5C1QB 5KMOA 4D1SA 4PL3A 3D5UA 5AR7A 1YWNA 2SRCA 1YDRE 3TV6A 2R3KA 3NPCA 4W4WA 4BGHA 4BCMA 4C4FA 3LQ3A 3EFKA 2A98A 3GUBA 3R30A 4PL5A 4O21A 4QMMA 4R78A 2UZNA 5LMAA 5CU2A 1FVVA 2W1ZA 3RHXA 4BGGA 3CTHA 5FXSA 4D58A 4AA5A 5JK3A 4M68A 3JPVA 3V5LA 4AOJA 2XNEA 3DZOA 4RJ8A 4UX9A 3FQSA 3UOKA 2B9JA 2PE0A 3I5ZA 3QTSA 3EL7A 5C26A 3W2PA 4E5WA 3DBCA 4F6UA 3KCKA 3MBLA 3WZKA 4FSYA 5LQFA 4QP3A 2LAVA 1J1CA 2G1TA 4L7FA 3SXFA 3UG2A 5I0BA 3FI3A 3CXWA 5ETIA 1XWSA 3VS0A 5IQGA 4A06A 2FB8A 4FZ6A 4G16A 2IW6A 3UIUA 3FZSA 3D7ZA 2AQXA 4AXFA 5KZ0A 4QMQA 2Q0BA 3FWQA 2DUVA 2UZTA 3NSZA 4G6LA 5HLPA 4IAFA 5CALA 4XHKB 4FKOA 4GFMA 4UWCA 4CFWA 3IQ7A 2X81A 2X2LA 3BLQA 4MBIA 4ANLA 4EH9A 4IM0A 5AM6A 4CFNA 3R1NA 3HRCA 2NRUA 5C8MA 2R3NA 3IW5A 5DA3A 2R3OA 5HCZA 4HOKA 5LMKA 2W7XA 4GVJA 4X21A 5JZNA 4NUSA 3KREA 3JVRA 4PQNA 3E5AA 2J0LA 2C68A 2BIYA 2GNIA 4FKGA 5AEPA 2QOQA 3H0YA 4FKUA 5C4KA 4RC2A 2XAMA 4QMWA 4U8ZA 4PMPA 2O2UA 3RAIA 3FI8A 3UZPA 4U81A 4IM3A 4Y95A 3TZ8A 2HZ0A 3KMUA 3I0OA 3EQHA 2YJRA 3VNTA 4CXAA 3CY3A 3OXIA 1TFFA 1KE7A 1Q24A 1UWHA 3MY1A 4EEVA 3UC3A 3KB7A 2IN6A 4J96A 2BILB 3LXKA 4I3ZA 5BV3A 2UZWE 5FEEA 4GK2A 4GH2A 3EN6A 3VQUA 4ZTLA 4ZSGA 4O86A 4IDVA 3UIXA 5HIDA 3FYJX 3LCSA 5I9XA 2UW5A 5AR2A 4AAAA 2XNGA 4CYIA 1ZZ2A 2OZAB 2XH5A 3I81A 3CJGA 4XG7A 2VWWA 2WMRA 3G51A 2PULA 1JVPP 3HKOA 3QTUA 4FZFB 4UYAA 3OWKA 3DKGA 2JKMA 2NO3A 4WA9A 2BHEA 3OCBA 2XBAA 3POZA 5HVJA 3QTXA 5AUWA 5IEVA 4CQGA 2YCFA 4FTIA 4KIQA 2QR8A 2OJFE 3R9RA 5AUUA 2BKKA 4ZP5A 3ZSGA 3PZEA 4KS7A 3TZMA 1ND4A 4YC3A 4RJ5A 2VN9A 3FMJA 4WRSA 2BCJA 4I93A 3HV5A 4DHFA 3HECA 4JBVA 4QD6A 4KSQA 5ANKA 2XIKA 5AV2A 3SAYA 3UOHA 4CCUA 3CP9A 4B99A 4NSTA 4NM5A 4C2VA 1MRYA 2PZRA 5IZFA 4QTAA 4L6QA 4WBOA 5JFXA 2XJ0A 2XNMA 2CGWA 4FKVA 2PYWA 3UQGA 4R3CA 2WQBA 5LVNA 4N57A 4RX7A 2XK4A 3ITZA 3OCSA 3QQFA 3VS6A 4S2ZA 5GIPE 4QQTA 4OTDA 3ZLYA 5TR6A 1Q5KA 4F64A 2EXMA 2OIBA 4LGDA 5JFWA 1P2AA 3UP2A 3NVMB 4NJDA 4FEUA 1UA2A 3MYGA 4M3QA 3KMWA 4H58A 3PRIA 3EHAA 4F08A 5K9IA 2W17A 4BKZA 2CLQA 3ZEPA 5LWNA 3DTCA 3BZ3A 4HCVA 5A4TA 4O4EA 2XBJA 2BIKB 4L8MA 3OW4A 4NKSA 1WBVA 4C02A 1Q8WA 1XO2B 2P2HA 5C27A 4E8AA 5DNRA 4DFXE 5LWMA 4FIEA 3EN4A 2X2MA 1M17A 2Y6OA 3E8NA 3HX4A 2EXEA 2DYLA 1W83A 3QALE 4XG8A 5CZIA 3RPVA 3CCNA 4CFXA 5HU9A 2H34A 3R02A 4U44A 2XIZA 3SW4A 2YIRA 3ACKA 3EMGA 5E91A 3ZZEA 1V0PA 5M09A 3ZUVA 4WD5A 3QYWA 2J5EA 3RAHA 4DCEA 4EK6A 3AGMA 4XCUA 2BPMA 4FTTA 3ML1A 2BDFA 3FC2A 2E2BA 3HEGA 2PVFA 5CVFA 3QLGA 3NUAA 4MK0A 3O23A 5C01A 3ZC5A 4NU1A 2BZKB 2GU8A 4YLLA 4M14A 4E3CA 1YQJA 2OJ9A 3R0TA 1MP8A 1JKSA 3VS2A 2NP8A 4Q2AA 5BVWA 3FHRA 2BKZA 4CLIA 2XVDA 4R77A 3F3VA 1R0PA 4HJOA 4GS6A 4O82A 5DRDA 3GT8A 1ZLTA 3NVKI 1OUKA 5CSVA 4PDPA 3K3IA 1V0BA 4GVAA 3PPZA 4AGDA 2BZHB 2WQMA 3QZFA 4PP7A 3IDCA 3GEQA 4J99A 5ANIA 4F1OA 2C30A 5DVRA 2F49A 3F7WA 3FZOA 4EKKA 3FI4A 5IEYA 2AC5A 2C5XA 4FK6A 4FKPA 2QHNA 3DDPA 4FTNA 5BVEA 4CRSA 4RJ7A 3RMFA 3C50A 5FQDC 2OI4X 2CGXA 2YHVA 5CAVA 5HBJA 2W1IA 2ZV9A 3GU8A 4FNXA 4YTFA 4AZTA 4MF0A 3REPA 1F3MC 1ZXEA 4GFOA 3KN5A 3FEGA 4HW7A 4JQEA 3U4UA 2UW9A 3QA8A 2OW3A 1PF8A 2ZB0A 3EJ1A 5M57A 3JY0A 4L43A 3W0OA 5EKOA 2Q0NA 5IA4A 4ID7A 1J7IA 2VTHA 5BUIA 5DLSA 2W05A 3C5IA 3NNXA 5TO8A 4BDCA 2R2PA 3NUYA 2GS7A 2OLCA 4YJOA 1EH4A 3NNVA 5DRBA 3VQHA 3D2IA 1XHAA 2XRUA 3D7TB 2RFEA 4FIHA 5J95A 4G9CA 5I9UA 2J0MB 3OT3A 5ETAA 1YDTE 3BE2A 3L8XA 3VF8A 4K8AA 3EQRA 1UV5A 4JT3A 2E9UA 2YCRA 4TNDA 4M69B 4PY1A 1ZOEA 3MVLA 1GZKA 2QOLA 4HNFA 2PZIA 2R4BA 3DLZA 3SLSA 3P0MA 4ZTNA 1UNHA 3FKNA 2WU6A 1M2PA 4FOBA 1G8AA 3CY2A 3FAAA 5EI2A 4ZEGA 4BIBA 3VW8A 5BYYA 4NEUA 3IW6A 5JGDA 5CXHA 2R3JA 3LQ5A 5DHJA 2X7OA 4TNBA 3GI3A 3O17A 2IZTA 2UZOA 4HPTE 4DEDA 1XH4A 3B2TA 3CE3A 4BI2A 2R3MA 3WARA 2RKUA 5IH5A 4H1MA 5HQ0A 5AA8A 2I0HA 5ICPA 5CTPA 3LFEA 3TUBA 3TACA 2QKRA 4XP3A 3W8QA 4AXCA 5DE2A 1PKGA 5FEQA 2C5OA 2WD1A 5HEZA 1AD5A 2YM7A 3OOMA 4O1OA 5EHYA 3EIDA 3VUKA 5E8VA 2WEVA 3EYHA 5CYIA 4AW1A 4ZSAA 2V5QA 2W99B 4YTCA 5FEDA 1YHVA 2OF2A 1BL7A 4HGTA 3BGPA 5E92A 4XLIA 4HVHA 5JFVA 2QO9A 3IW7A 2GMXA 3CGOA 4W9XA 1PMUA 2WQEA 4L3PA 3O5AA 3PJ2A 2XIRA 1E1VA 4FL1A 2JFLA 4W4VA 4IAIA 3V51A 3IOPA 2BAKA 4YBKA 1RW8A 5KMMA 3A2CA 5CNOA 4AUAA 4RFZA 5CU3A 4BL1A 5JSMA 3QGWA 1CKJA 4FOCA 4I5CA 4MCVA 4GJ3A 5CT7A 3ATSA 1WMKA 3QF9A 4K9YA 4FF8A 4DEHA 3AMBA 3LFBA 4O83A 3ETAA 3SQQA 3SHEA 2C6MA 5J1VA 4Q9SA 1FBNA 3MFTA 2XALA 3BQCA 3FBVA 4AN3A 3E92A 2XCHA 1ZYSA 5E8XA 4GT5A 3KF7A 4KNBA 5EDQA 2FUMA 1W7HA 3MH0A 2XK3A 1WBSA 3EOCA 3KRRA 2Y4IC 3PSBA 4IJ9A 4YSMA 5F4NA 3R7EA 1OL7A 3H0ZA 4ITHA 4Z7HA 2ITNA 3S3IA 4YNOA 3UVQA 2XNOA 4S30A 2HXLA 3QXPA 5A6NA 5CT0A 4NM7A 3T9IA 4F7JA 4WG3A 4DHZA 3GCPA 2YDIA 2J7TA 5KUPA 4R3PA 3LKMA 4YHJA 4Z7GA 3FY0A 4D2PA 3ZO2A 2PHKA 2F57A 4F63A 1I44A 3KQ7A 4DH7A 2P55A 4IMYA 5J79A 4EOOA 5EM7A 3QCSA 3R21A 3F9NA 3OWLA 1NVSA 3ZH8A 4CZTA 1OPJA 2I7QA 2QQ7A 4UBAA 5EQPA 4BFMA 3L9NA 3NCGA 2FSTX 4CG8A 1ZOGA 2C0OA 4K77A 2XYUA 4Q5HA 4Q5EA 3VJOA 4GRBA 4B6LA 1OIYA 2I40A 2WMVA 3UYSA 1S9JA 4G9RA 4KD1A 1YRPA 4MXOA 3F5UA 5EI8A 1DAWA 3ROYA 3W0RA 4OTIA 4Y46A 4NW6A 2F2UA 5CANA 3PVUA 4Y72A 5AP4A 2EVAA 4BDKA 3EKNA 5DN3A 3D0EA 4QP2A 5E8YA 3VUHA 4EZ7A 5M53A 3CKXA 4FTKA 5I3RA 3HNGA 2ZYBA 3OP5A 1H1QA 4RVLA 2HW7A 1H4LA 4TRLA 4NH1A 3BELA 1SVGA 4IZAA 2JAVA 2H8HA 3R2YA 2R7BA 3EQBA 3VWAA 2HZNA 4M13A 3SOCA 4MNFA 2BVAA 1YHWA 3O51A 1U5QA 3FMDA 4IXPA 3QGYA 3AQVA 2ZV8A 1DI9A 3P7AA 4QQJA 4J71A 4BCPA 5DT0A 4TWOA 1VYZA 4TKSA 5EFQA 2XUUA 3LLTA 4TYHA 3WIGA 4F9BA 4EUUA 3FC1X 5LCJA 4MX9A 2JDVA 3QQHA 5BMMA 4O81A 2PSQA 1OKWA 2ONLC 2OBJA 3MA3A 2RG5A 3ORPA 3NAXA 4FIIA 2C6OA 4OLIA 4O96A 2QO2A 4FKTA 4OTPA 2IPXA 4J7BA 4F0IA 3UYTA 4FTMA 1OMWA 5HX6A 1GIJA 5AWMA 3R04A 3COIA 1VR2A 5ANJA 3NS9A 4O0TA 4FYOA 2ITZA 1MRVA 4CFUA 4AS0A 4YZNA 5GJGA 1LPUA 3EWHA 4HGLA 4PX6A 3DLSA 3NLBA 4E5BA 3SG8A 1ZWSA 4KBKA 4YTHA 2WXVA 4EHGA 3FMEA 1MRUA 2YCQA 5AUVA 4ZZNA 5M4CA 3SVVA 5HD4A 4C38A 4C36A 2FVDA 3CD8A 3QRIA 4FZAB 2OXXA 3OWJA 3F82A 4QPAA 4WNMA 4K6ZA 4HVIA 3G15A 4IAKA 1S9IA 1RQQA 2CKEA 5M08A 2O0UA 3R71A 2C69A 4KA3A 3EQIA 3HP5A 3L8VA 3T9TA 1OL6A 3GP0A 3QRKA 5F94A 4EQMA 2BRMA 2XK6A 3UMWA 4TY1A 4AF3A 2QOBA 3OEZA 4D5KA 2CKPA 1O9UA 1G8KA 5GIOE 2YM4A 3TKUA 2VGOA 3DB8A 1LEWA 3QC9A 5B2LA 2PE2A 4MKCA 3VUMA 1W2FA 1B39A 4K33A 3ZOSA 2LGCA 2WU7A 4IZ5A 3V01A 2QNJA 5LVMA 2WMQA 2BHHA 1XH5A 1K3AA 3MFRA 3MJ2A 1Q3WA 2JKOA 3OCTA 5CEKA 5KMLA 2WIPA 4YLKA 4MXYA 4ZJIA 3QUEA 3AC5A 3Q6UA 4DC2A 2QOCA 4C3FA 5H8GA 4FKLA 3R8ZA 2VNWA 3QTIA 3H3CA 2ZOQA 2WAJA 3R00A 4H39A 3WYXA 5IQDA 2ITUA 1VEBA 2IVTA 5DOSA 4IB0A 1KWPA 4XV3A 5CENA 2YZAA 3WF8A 2RSVA 3W0PA 2Z2WA 4RWLA 3LMHA 4A9RA 4UMTA 3LCTA 4EH5A 2QLQA 3FLQA 5GZ9A 4AOIA 3KXZA 4YZCA 1YHSA 5FGKA 3NYXA 4AW0A 3C4FA 3ANQA 4QPMA 4BBEA 2YA9A 2JAMA 4G3FA 3VBQA 3ZDUA 3ZFYA 4ZY5A 1Q97A 3D5XA 4BN1A 4BB4A 5CF5A 3MH2A 4YO4A 4DA5A 1F5QA 2YJSA 3MWUA 3AD5A 3TV7A 3N4VA 3E63A 5M44A 2VTOA 3D2KA 1RJBA 1Y8YA 4QMNA 1ZMVA 2X4ZA 2YCSA 4RIYA 4RVKA 5JH6A 2YWPA 3ZBXA 2XKDA 3UZRA 2A4LA 4RIWA 4LV7A 5AP0A 1XMLA 2X8DA 3OTVA 3KU2A 4TT7A 2B7AA 4BWPA 4E5AX 2QOOA 4PNIA 3LHJA 3HAMA 3KK9A 4ARKA 3D4QA 3F7ZA 3HRBA 4S34A 4C0TA 2PUIA 4AFEA 5JZJA 3UDBA 2BALA 2XEZA 3NUSA 4QMOA 5DH3A 5J8IA 3GQLA 2C6TA 4P5ZA 4FL2A 4RJ3A 1CDKA 3PWYA 3R7VA 3RI1A 5LARA 4QP1A 2PTKA 2J0KA 3A99A 4BCKA 3U87A 3R1SA 5IA5A 1XBBA 4TYIA 3Q4CA 4P7EA 3RAKA 4BDDA 3H9FA 5HIBA 3UC4A 2PMNX 3EH9A 3SKCA 4Z16A 1XH7A 2RF9A 3OCGA 2JGZA 4KKEA 2IW8A 3U9CA 2H9VA 4AXAA 4LGHA 2W4KA 3V8TA 4DH1A 3LM0A 3OEFX 4XV1A 5IEXA 2WQNA 2IZUA 5JEBA 4NT4A 4ANBA 4AZWA 2ZJWA 3NEWA 3QXOA 5EG3A 1H0VA 3F2RA 4DBNA 4YO6A 1CMKE 5M55A 4F70A 5FLFA 3C4CA 3ZSHA 3VW6A 4HZSA 4C4JA 4ZTQA 4FV5A 4NJ3A 5HOAA 5CY3A 3U4WA 2VTAA 3PA5A 3BYVA 4IX5A 4F9YA 4ANMA 5DIAA 3KRJA 5LOHA 2IVSA 2YIWA 3GB2A 3HAVA 3FL5A 4U7ZA 3P4KA 5DBXA 5HZNA 3HRFA 2NRYA 3QKKA 3R9DA 4QP4A 2XJ1A 2YERA 4FK3A 3FMNA 5DR9A 4L67A 3BYUA 4GIIA 4F9CA 4DH3A 1ZAOA 3C4ZA 5LXMA 3AT4A 4FV3A 2OK1A 4N70A 3ID6C 3NNUA 3IDPA 4UWYA 3BWFA 3NUPA 2UUEA 4X2FA 5J7HA 4J8MA 3CS9A 3R73A 5I9YA 3PY3A 3P86A 4J97A 4OBOA 5EK7A 4D55A 4EKLA 4GUBA 1REJA 5D7VA 3VHEA 4CTCA 4PNKA 4O7RA 1DM2A 1YXVA 4EH4A 1Q99A 3TMOA 4AG8A 3A62A 4JX3A 2V7AA 3QRJA 4IQ6A 2O65A 4LMNA 5ACBC 4HVSA 5C8KA 4JS8A 2ITXA 3RCDA 2ZDTA 1RDQE 2WMXA 3Q4ZA 3RJCA 2UZLA 3P7CA 2Y6MA 2R7IA 3RWPA 3ENHA 4UMPA 4MF1A 4X7QA 3RK5A 1UU9A 1Q8UA 4WG5A 3AOXA 4E4MA 3G9NA 1VYWA 3I1AA 4XOYA 5E90A 4RX5A 1FMOE 1F0QA 4FSZA 4R1VA 5HIEA 5IH4A 2W1HA 2W1CA 3BPRA 4BHNA 1FOTA 1UU8A 1YI6A 2J0JA 4LRMA 4KB8A 5HG5A 5CWZA 4XNEA 2B1PA 1Q41A 3ORKA 4YJSA 4BZNA 5A14A 2XM9A 3RNIA 4J53A 1OGYA 2ITTA 2PVYA 1PXOA 3OD6X 3VUIA 3E3PA 5F20A 4D2SA 1ST4A 1UVRA 3IONA 4GEOA 5EYDA 4RGJA 4XG3A 4X2NA 3S2PA 2JDRA 5D11A 4PDSA 5IQBA 4DTAA 5CSWA 4O0SA 1ZYDA 3QWKA 4FI1A 4MQ1A 3U6HA 5C4LA 1M52A 4YGAA 4FTQA 5HI2A 3N4TA 3QQKA 2EB3A 3NUNA 2ZDUA 3P5JC 4QEBA 3AMYA 2UW6A 3MFUA 2QONA 3VF9A 3LXLA 2WFYA 4L01A 3QD3A 3ZU7A 3BHVA 3C5UA 4KKHA 5BUEA 2OJIA 5IH6A 5J9ZA 4O7ZA 2UZUE 5KHXA 3DAKA 3W55A 3QU0A 3NYNA 2C3IB 2WMTA 3R1YA 4I0SA 5IU2A 2UZDA 5EDRA 3F69A 4DBXA 3QHWA 2G01A 5IG1A 2FYSA 4O4CA 5HTBA 2VV9A 5D10A 3M42A 3VBYA 3WF9A 5AV0A 3L9LA 5G1XA 5L4QA 3C1XA 5L2TA 4DGMA 3ZO1A 4FNZA 3ZYAA </