4EYJA

Mapk13 complex with inhibitor
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
350
structure length
338
Chain Sequence
SLIRKKGFYKQDVNKTAWELPKTYVSPTHVGSGAYGSVCSAIDKRSGEKVAIKKLSRPFQSEIFAKRAYRELLLLKHMQHENVIGLLDVFTPASSLRNFYDFYLVMPFMQTDLQKIMGMEFSEEKIQYLVYQMLKGLKYIHSAGVVHRDLKPGNLAVNEDCELKILDFGLVTRWYRAPEVILSWMHYNQTVDIWSVGCIMAEMLTGKTLFKGKDYLDQLTQILKVTGVPGTEFVQKLNDKAAKSYIQSLPQTPRKDFTQLFPRASPQAADLLEKMLELDVDKRLTAAQALTHPFFEPFRDPEEETEAQQPFDDSLEHEKLTVDEWKQHIYKEIVNFSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Mitogen-activated protein kinase 13
publication title IL-13-induced airway mucus production is attenuated by MAPK13 inhibition.
pubmed doi rcsb
source organism Homo sapiens
total genus 100
structure length 338
sequence length 350
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2012-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4eyjA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4eyjA01
4JG7A 5AP1A 1REJA 2GQRA 2R3MA 5AM6A 3CXWA 3P79A 4XJ0A 4HGEA 5GNKA 2O63A 2J7TA 3GC7A 5K3YA 3CQWA 4ACGA 2HOGA 4EH9A 4FX3A 1HOWA 2ZV8A 4XG2A 5ANJA 4ACCA 2ETMA 5KBRA 3D15A 4WUNA 4RFMA 4FIFA 3ZDIA 4G31A 5E90A 4AT5A 4L9IA 4H36A 4BZNA 3C0GA 4BDBA 3CTHA 5A6OA 2VX0A 5CF8A 3O8PA 3GGFA 4F64A 5HORA 4O86A 3R9NA 3UOKA 3QC9A 3HRFA 2HZ0A 5JRQA 4TRLA 5A46A 3VF8A 1W0XC 3UGCA 5IUHA 1DI9A 1OUKA 3F3WA 3KXZA 4K77A 2Y8OA 4W4XA 4AOTA 3MJ1A 5IU2A 3Q2MA 4UYAA 4JX7A 5ANGA 3PXRA 4AW5A 2PULA 2BILB 3QTRA 2UW6A 3DQXA 5CEPA 3EH9A 4U43A 1H1QA 5HCXA 2A1AB 3FLYA 5AP0A 3ZU7A 3UVRA 4JNWA 5EI2A 5AUXA 3VNTA 4ZSEA 4Q5EA 4KIKA 5LARA 2ITNA 1KE9A 5EHOA 5HVJA 5IEVA 2XP2A 4WO5A 2PVNA 4CVAA 3ZEWA 5HKMA 2VTRA 4X2KA 4AT4A 3R7EA 5DA3A 4BCKA 1W8CA 4ACMA 1Q3WA 4BYIA 4QP9A 4BY9E 2I1MA 4GU9A 1KOAA 4IX4A 4L52A 3RPSA 5AAEA 3HMMA 3NR9A 2VWZA 5ETFA 4LV8A 3N4TA 3TWJA 2OIDA 5L2WA 4PV0A 3DNDA 1QCFA 4MCVA 4YC8A 5D7AA 1M52A 4FSYA 5BMMA 3WZEA 2ITYA 3ERKA 4ZTMA 4J1RA 3WIKA 5AJQA 3VHKA 3ZRLA 4AAAA 3K5VA 4Z16A 3U54A 3D5WA 3I0OA 2BHHA 2C6OA 3KMUA 4IZAA 1NA7A 2VTSA 2GNLA 4JG6A 3G90X 4Y46A 3LKMA 2FUMA 3DS6A 2RFSA 5H9BA 3AGMA 4DF3A 2Q0BA 4DH7A 3LMHA 1YOMA 2W7XA 4YJSA 4RX7A 4XV2A 3AC8A 2EU9A 4UY9A 3ZUTA 2WMVA 1XH8A 3FZTA 2JFMA 5TKDA 1H26A 4IANA 2OJGA 3PJ3A 3FQHA 3GXLA 2J90A 5CENA 2B0QA 3QD0A 4R77A 3TT0A 4BDCA 4HNFA 5ANDA 3RAHA 4L00A 4KAOA 2WTDA 2C68A 1SM2A 3FY0A 4RVTA 1DS5A 3W2RA 4FTNA 3DDQA 4BL1A 5HBJA 4C37A 4M69B 4AGUA 4XBUA 3EFJA 1YI3A 3BU3A 1LP4A 3KCFA 3SLSA 4F9CA 4M12A 4P2KA 2LAVA 3K3IA 4EYMA 5CQWA 3V8WA 4BIDA 4QP4A 5T3QA 2QLQA 4FTUA 5AP4A 3A61A 4R1YA 3OVVA 4W4YA 3ZUUA 4CQGA 5HTCA 4E4NA 4ORKA 4DFXE 4WNMA 5L8KA 2W1DA 4JDJA 5IUIA 1RJBA 2RF9A 3DKGA 4YTFA 2QG7A 4AA5A 3L8SA 5IQHA 2CKEA 2W1CA 3EL8A 3MTLA 4IQ6A 1SNXA 5AA8A 4ZTHA 4L7SA 3ZLSA 2J0LA 3KXGA 2C0IA 3OROA 5DH3A 4FG8A 4WUAA 1ZZ2A 1F0QA 2XKDA 3QRJA 5I9WA 5KMNA 3GCQA 3NYOA 4TW9A 4EKLA 4ZY5A 3PVWA 2IW9A 4NYEA 2OU7A 4EHVA 3D94A 4LL5A 4II5A 3OXIA 3EQHA 4MYGA 1GOLA 2R64A 3PIYA 4HCVA 4IM3A 4Q2AA 4TNDA 2GHGA 4QP2A 4OTDA 3GCPA 5HESA 4GK3A 2GNFA 1JKLA 3ANRA 4I93A 4JQEA 3LCDA 5EDRA 3Q96A 3HA8A 4OTGA 4OAUC 4PWNA 4ERWA 3R01A 3ORMA 1BI7A 3MY5A 4U7ZA 3KRRA 1ATPE 2F2CB 3BZ3A 5CSVA 4B9DA 2WPAA 3EZVA 4C33A 4ENYA 4YJPA 2XYUA 3KMMA 2ZB0A 4FV0A 5E91A 3JY0A 2WHBA 4YLJA 4I4FA 4UN0C 3SXFA 5KMKA 3CCNA 4MF0A 4W4WA 5FGKA 5HBEA 4HVDA 1G8SA 5FBNC 4CFNA 5CZIA 3GCUA 3DK7A 4WIHA 4ITIA 5JKGA 5M4FA 1H1WA 4ZY6A 4PTEA 2W99B 2JBOA 5CSWA 4MEDA 4TYJA 4PMSA 4O0VA 3ALNA 4PX6A 2JAVA 1W82A 3OD6X 2XIYA 5ACKA 4K0YA 3BLHA 3UQGA 4FEWA 4JDHA 4WNPA 3AMYA 4JR3A 5HE2A 5AUYA 4QNYA 3TKUA 2WEVA 4C4EA 4DEGA 5CTPA 5KMLA 4F08A 2XF0A 2EB3A 1VZOA 4HYSA 1QPEA 4JS8A 1P4FA 5BYZA 3QTQA 2JKOA 5HIBA 3E8NA 5KX8A 4S34A 4OTFA 3OBJA 4BDEA 3QCQA 5LWNA 2E9UA 4G3EA 4YJRA 4ZIMA 1ZYLA 3KCKA 2ERKA 3L9NA 3T3UA 1IR3A 2ONLA 3VUMA 3LMGA 3MBLA 4I94A 3I7CA 4DTAA 2QQ7A 4GIHA 1VR2A 4X6RA 5FTQA 5B0XA 3RALA 2ITQA 2QG5A 3RAKA 3GP0A 2BHEA 3OOGA 4K11A 4PMMA 1R78A 3KF4A 2W05A 2EXCX 1STCE 5IQFA 2X8EA 3CPBA 4I23A 2OIBA 4EOMA 1E1VA 4EOIA 4H39A 1H01A 3CJFA 1KV1A 2W1FA 1K3AA 3BEAA 1KE5A 3UC3A 3OC1A 2J0MB 1OKWA 3A2CA 3Q4ZA 2QR8A 3QZFA 5FQDC 3RK5A 3T9IA 1J1BA 4DLJA 3KKVA 4H05A 3QF9A 3SC1A 1PXNA 4DITA 5C4LA 5C27A 5L8LA 4BTJA 4F0FA 2YIQA 5KKRB 3FLZA 4ANQA 3MB6A 4YZNA 3A4PA 5KZ0A 4DBNA 1JSUA 3HL7A 4KBKA 3MW1A 2PZYA 2YM7A 2YM8A 3V5LA 4U9AA 5HX6A 4WRGA 5I4NA 2EWAA 3TZ7A 5DFPA 4N6ZA 4XS2A 2W17A 1AQ1A 4U40A 2BIYA 1ZMWA 2PWLA 3PA5A 4XOZA 5K0KA 5KKRC 3EN4A 3I81A 3E87A 2O0UA 1G5SA 2V55A 4FV5A 1B6CB 4QO9A 1SNUA 5D12A 3KREA 4C3PA 3EWHA 3ZM9A 2XIXA 1H1SA 4IAZA 4NJDA 4RPVA 4B99A 3FYJX 3G6GA 4OUCA 2FSLX 1PKGA 2IZTA 4YJNA 3P23A 3VUTA 4DA5A 2VTHA 2XEZA 2WO6A 3NW6A 4RWLA 4X7QA 4FVPA 1OIYA 3HP5A 4XG6A 3TCPA 3TZMA 3HVCA 4HGSA 2Y9QA 3PSBA 1VYWA 1ZARA 2R3PA 2J0JA 4O7SA 2CN5A 4RJ8A 5T68A 4AOIA 3PVUA 4DEEA 5E1EA 3FL5A 4B4LA 4QPMA 5HG5A 3LZBA 3NS9A 4TYHB 3MVJA 5AR7A 3FLSA 4A06A 3GQIA 4ZSJA 4PDPA 5CVFA 3LFDA 4NWMA 3V5QA 3F66A 5M09A 5CEIA 2Y6OA 4V0GB 3WBLA 4BDJA 3EL7A 4NH1A 2HCKA 2YAAA 4TT7A 2BDJA 1IAHA 4MBIA 2WMXA 5DBXA 5TR6A 4JBOA 4A9SA 2JDTA 2PVHA 4EJ7A 5CSHA 3TJDA 5HE1A 3NUSA 3KULA 4XNEA 4TL0A 3EKKA 3LLAA 3R8UA 2WELA 3QQUA 3WF9A 5E4HA 5I0BA 1TQIA 3UOLA 2ZM4A 1LR4A 2IZUA 3FV8A 4X21A 1XH6A 3ZXTA 3ZRKA 4PP9A 3LVPA 3QQLA 3QC4A 3RP9A 1P4OA 5AP2A 1H25A 3ZYAA 3U6HA 4G3GA 5IH4A 3Q9XA 1YOLA 4M14A 4O0UA 3RM7A 4EHZA 2VNWA 4FTRA 2R0IA 4IZ7A 3O7LD 4RFZA 3QTXA 4MKCA 2PVKA 2YDKA 3EOCA 2OLCA 4FTTA 4QP7A 4RT7A 3PLSA 2J0KA 3OTVA 4J95A 5GJDA 5C4KA 2WTIA 3FPMA 3KA0A 2OSCA 3WZDA 4CMTA 4EC8A 1LUFA 3P4KA 4NM3A 5B2MA 1W83A 5BNJA 4MH7A 5CF6A 4QYYA 5JMSA 4DFLA 4NW6A 4OTWA 4S33A 4YJQA 5H2UA 3VULA 4UWBA 4WG4A 5IKWA 4BCHA 5IMEA 5DT3A 4O0YA 1Q8TA 4UMQA 4JBPA 5CU4A 4PMTA 3FJQE 3GNIB 3O50A 4RX8A 3ZFXA 3E92A 2W5BA 4ARKA 3TNPC 4BDIA 3V5PA 4D2VA 1F3MC 4QMSA 2BFYA 2LGCA 2RFEA 1PKDA 3G0EA 2IWIA 2VTNA 1GNGA 3R63A 2I0EA 5CEQA 5TE0A 2B9FA 2CGXA 4PPCA 5C8MA 1R0EA 1JKTA 2UZOA 3IOPA 1FPUA 3QKKA 5A14A 1UU9A 5EYMA 5IUGA 4YZDA 3F5PA 3R9DA 5J9YA 4Z55A 3ZOSA 4X0MA 4BRXA 4PDOA 5ICPA 5D41A 3TN8A 2ITPA 3ZBFA 4H3PA 1R0PA 1NVSA 4YZBA 4FT9A 1NVQA 1ZY5A 5J7HA 4C4HA 3R8LA 4CGAA 4BN1A 1FQ1B 2W4KA 4YTIA 4MXCA 2W96B 3E88A 3ENMA 4D2WA 5HE3A 2OJJA 5EYDA 3VQUA 1MRUA 2YIRA 5M51A 3ZLYA 4NUSA 3R1QA 1TQPA 4G34A 2V5QA 4WSQA 2X9EA 2HELA 4EHGA 4JX3A 1OVEA 4CFUA 3W2SA 3FY2A 3FMHA 5E7RA 2OW3A 5M07A 3VS3A 5IG1A 5CI7A 5J9ZA 1SYKA 4C38A 2XK3A 4CSVA 4O82A 4TWCA 3PP0A 3FC2A 4FZFB 5KBQA 5EDPA 4ACDA 3IDCA 5HTBA 4R8QA 4LQMA 3CBLA 3IOKA 1WBSA 2E9OA 3DFCB 4EH6A 2HY0A 2QCSA 3E8DA 3HMPA 4EJNA 3KK8A 2BMCA 3R1YA 4NK9A 3HYHA 2OICA 4F9BA 2G2FA 2YIWA 2RKUA 3ZMMA 2WMUA 1SVHA 3C4FA 4DGLC 5J5SA 3W2CA 4J8MA 4OAVB 2VD5A 3EQGA 3Q04A 1YXTA 4ZZOA 1H4LA 3A99A 4FG9A 3PFQA 4ZLOA 1MRYA 3F2NA 3QGYA 2PYWA 2YZLA 3D9VA 1U54B 4F7NA 3EQBA 4RC4A 2F49A 2QOCA 4RFYA 2GFCA 5AUZA 3FMMA 3EQRA 5GZAA 3O8TA 3FI8A 3NIZA 4NZWB 2OG8A 3G33A 4BDFA 4LMUA 3ORIA 3U4UA 2B54A 3EQFA 3AMAA 4IAFA 5HIEA 2VWXA 3I4BA 4XV3A 2QOFA 3MA6A 3TM0A 2CNQA 4YZCA 5IQGA 5F1ZA 4E8AA 1YXUA 3DBEA 4EBWA 4KS8A 2GNJA 3LJ0A 4X2JA 4C36A 4F0GA 2XEYA 3PVBA 2OF4A 3BWFA 4YJTA 3UODA 3GC8A 2JIVA 4OBOA 4M67A 1JKSA 1KUTA 2CCIA 3OW4A 4MBLA 2VO6A 3O7LB 2IVTA 3SXSA 2F7XE 2O64A 5EW9A 5BQ0A 4NSTA 4O6LA 4E20A 4DFUA 4IX6A 5KZIA 4AN3A 4NL0A 4PL5A 4DEAA 4I6HA 4D2RA 5K4JA 5DEWA 3DXNA 2J51A 4EOJA 4PY1A 3QQGA 2UVYA 5E8XA 3C0IA 2YWPA 2JEDA 4GH2A 2QU6A 4LOOA 2WTVA 3ZRMA 2V7AA 4YNOA 2R5TA 3FKNA 3H30A 4RWKA 3UNKA 3DV3A 5EFQA 4HZRA 2JGZA 3KK9A 4RJ6A 1CSNA 4L68A 4CZTA 5K4IA 1WBVA 2BKKA 3VUIA 3W2PA 3H4JA 3HRBA 3L1SA 3RINA 4DFYA 4FKSA 4GVJA 3TI1A 1BL6A 2X2KA 4NTSA 3RM6A 1B39A 4W9WA 1ZXEA 4IX3A 3VS0A 4QMOA 3E62A 5DMZA 1KE8A 5AV0A 4YHJA 2YFXA 4GFOA 2ONLC 2XNOA 5EYCA 5LXMA 4QMXA 3BE9A 2YAKA 2O8YA 4DC2A 1XJDA 2WAJA 4AT3A 2HW6A 3ZUVA 2Y4PA 3R2YA 5EW3A 4FKJA 4ERKA 2C3IB 2XBJA 5LMAA 3OEFX 3SAYA 2VAGA 3A7JA 5CU2A 3W1FA 4YSMA 5HLNA 3HLLA 4YBJA 3ZSIA 4E26A 3HKOA 2G2HA 2QOOA 2CLQA 5FEEA 3DXQA 3DFAA 4YJOA 3KXHA 2YLEA 4YGAA 4I6QA 5DIAA 3SDJA 3MI9A 4FGBA 5AR4A 5LCKA 3TACA 3O96A 5KHWA 3QAME 2IN6A 1KV2A 4CKRA 4FUYA 5IH5A 2PL0A 2BRBA 4J99A 1OKVA 5HIDA 3R2BA 2HXQA 4CG9A 3RAIA 4XCUA 4ZJJA 4EQUA 1VYZA 2X2LA 2UZDA 3CS9A 3PG3A 3F3VA 4P7EA 3ZFYA 4HVIA 5A9UA 4IZYA 3COMA 4IBMA 4AZFA 3LFSA 3U9CA 4OLIA 4FT7A 3DZQA 3PXQA 2WD1A 4FMQA 3VUHA 4A9RA 5F95A 3ALOA 4AZEA 3IG7A 4UWCA 3E8EA 4EZ5A 5LOHA 2W5HA 5JK3A 5BVKA 1WBNA 3ITZA 2WTKB 2PMIA 2PVJA 4JQ7A 3CGOA 4B7TA 3KC3A 4QP1A 1OKYA 3DB8A 3PUPA 3QD4A 5C9CA 4C8BA 3SOAA 3PXYA 4EK6A 5GZ9A 3BBWA 2ETRA 4OR5A 1XBBA 3EYHA 4G5JA 1FMKA 1HCLA 2QONA 2JKMA 3AC1A 3RJCA 1M7QA 4UMUA 2UZWE 4B8MA 4C2WA 4RA5A 5CT7A 4FSMA 3VBWA 2RSVA 2B9JA 5FP5A 3VJOA 1JQHA 1ZYCA 2J0IA 2P55A 3RGFA 5EM5A 4NKSA 4YSJA 3R9RA 2C0OA 4RQKA 4BKZA 3E3PA 4KABA 2OH4A 2YN8A 2XK4A 3TNQB 1R1WA 3P7BA 4IVBA 4Y5HA 3DJ6A 1YOJA 1KWPA 4FZDB 2REIA 3GU8A 5HE0A 5KE0A 5ANOA 5HOAA 1BL7A 4X6QC 2YACA 4O0XA 4AS0A 2VWWA 3OW3A 4N70A 3IW6A 4BB4A 1YDSE 4CFXA 3S00A 3FI3A 3HECA 4O0TA 5EHLA 3GI3A 2PE2A 3O8UA 3PZEA 4I6FA 4IE9A 4ZOGA 3LFAA 1E1XA 5CNNA 4ZSLA 3KN5A 4CT1A 2A19B 5DRDA 3VBQA 4D9UA 1H0VA 3AGLA 3ZLWA 2UW9A 3QXPA 4HYUA 4QP8A 3KB7A 4JR7A 4NKAA 3TV4A 4ALUA 4FBXA 4AN9A 1H0WA 4IC8A 3HP2A 5FD2A 3UIXA 4I22A 4X2GA 4XX9A 2OXYA 5B2LA 3BI6A 4FSRA 4JRNA 3DJ7A 4DEIA 4AZWA 3JPVA 3D14A 5F4NA 1V0PA 2Z2WA 5H3QA 3GU6A 4IXPA 4QMPA 3DZOA 3VS2A 3EQPA 3LLTA 2IJMA 3QRTA 4O0WA 3RKBA 5HNGA 1J1CA 2OF2A 5HLWA 3QKLA 5HO6A 2Y0AA 3RHKA 2P4IA 4L42A 3Q9ZA 3OCBA 1NXKA 3AD4A 5JQ5A 2CKPA 2H6DA 4R6VA 5AP3A 5A4TA 3R30A 3DBCA 2CKQA 3UNJA 4D2SA 1IAJA 3CSVA 4DEHA 4FTJA 4HYIA 1CDKA 3AOXA 4JIKA 4V01A 2ZMCA 3AD5A 2WU7A 3LFQA 4IFCA 4MVFA 4I4EA 3IKAA 4EK5A 4DCAA 2BAJA 2GS6A 3KN6A 2YM3A 4J8NA 2W1EA 4LMNA 3HGKA 5I9UA 3UYTA 1Z57A 4BI1A 4D2TA 4OTIA 4V0GA 4XEYA 4FIGA 3S1HA 3MVMA 4GT4A 4XLVA 3BELA 1BLXA 4BWPA 3NSZA 4CV8A 4EH8A 2IW8A 3SXRA 2B9IA 5LCJA 2ZAZA 3R71A 2VTIA 5HD4A 3O17A 3LQ3A 4IADA 4ZZNA 3RWQA 2Y6MA 4QMUA 5GIPE 3MDYA 2F2UA 4GJ3A 4P5QA 2PZ5A 4ASEA 5E9EA 3ATSA 2UZBA 3ODYX 4O84A 1TQMA 1JWHA 3CGFA 5KCVA 1URWA 5ANEA 3ULZA 3R28A 4QYEA 3FBVA 4EOLA 4HOKA 3NVKI 4O7LA 3VW6A 2YJRA 5FEQA 4EQCA 4AA4A 4FKWA 3EKNA 1YQJA 5HNIX 3OMVA 4FKTA 3KRJA 2WTWA 2B9HA 4QD6A 3Q4CA 1WMKA 3NUXA 2PMNX 3R1SA 4NFNA 2JIUA 3BGZA 2C1AA 2WMAA 3FE3A 4NW5A 3OUNB 3UQFA 4Z3VA 4BF2A 1GZ8A 1XR1A 4CRLA 3UP2A 5CAUA 5E1SA 3KQ7A 5DYJA 2XYNA 3DTCA 3CR0A 3CP9A 4IB3A 4GFGA 3RZFA 4CZUA 2GQSA 2X8IA 2QU5A 3QALE 2WMWA 3DAKA 5BUEA 2JD5A 3L9LA 4YNEA 4RX5A 1OBDA 2BDFA 4I5CA 3QD3A 3U87A 5FDPA 5HTIA 2R3FA 4DFZE 3G6HA 4NT4A 3QYZA 2VTMA 5IZFA 3DAJA 1RW8A 3FUPA 2Z02A 2V7OA 3ZFMA 5FXSA 5LVMA 1TVOA 2CCHA 2HWPA 3LM0A 3R73A 2BZIB 4MHAA 4F6SA 5HGIA 4DFBA 4FSUA 4YLKA 4IIRA 1CM8A 2H9VA 4IDVA 2ITZA 4U97A 5AV1A 5HG7A 4TY1A 1XO2B 2DS1A 2GCDA 2QLUA 3F3UA 5AR5A 5CU0A 4G17A 2PUIA 4O2ZA 3GCVA 3CTJA 1UU8A 3W2QA 4JAIA 3B2WA 2C47A 3PPZA 4JJRA 3N51A 3F2RA 3R0TA 3V8SA 3GC0A 4RIYB 3V8TA 4Z7HA 2ITXA 3ZXZA 3UO5A 4FV3A 2Z7LA 2R3KA 5F9EA 5AP6A 2C6TA 2PZPA 3NGAA 3ACJA 3AXWA 4RQVA 3FKLA 3QZIA 2PMOX 2R3JA 3TV6A 2AC5A 3ZCLA 5DOSA 1REKA 5HEZA 4A9YA 5A54A 5BVFA 4L3JA 4FOBA 4MXYA 3VO3A 4WHZA 3G0FA 3NWWA 3OEZA 5AP5A 4PL3A 2ITOA 2I0YA 3H0ZA 3FL4A 4D58A 3UZPA 4EZ3A 5EQYA 3GU4A 5E8UA 2X81A 5K0XA 4C02A 3FMKA 4H1MA 4O0SA 3FC1X 4I20A 4O7TA 3MH2A 1ZMVA 3SG9A 1QMZA 5M56A 3COKA 1G3NA 2BTRA 4QQ5A 3CEKA 3ORZA 4FE2A 5K9IA 3JUHA 5CY3A 5IQDA 4LL0A 1UWHA 3P7AA 4ITJA 1R39A 2VTJA 1U46A 2O5KA 1YI6A 5JRSA 4CV9A 3UG2A 5ITAA 1UU3A 4OTPA 2Z7SA 4IW0A 4YLLA 5BMSA 3UE4A 4C34A 3M2WA 3LFEA 1M7NA 3QUDA 4QTBA 1YHWA 4V05A 4EOPA 3VS6A 3NUYA 5FG8A 4BGQA 3BX5A 3V5JA 2XKCA 2ESMA 5EQEA 2R3LA 2UVZA 1PY5A 3U55A 4CD0A 4AZSA 3M42A 4I5PA 4BCMA 3BHVA 4C59A 4E5WA 4QYFA 5AUUA 3LJ2A 3AC4A 4D28A 1U54A 3E93A 4KRDA 3GC9A 5AIRA 2XMYA 3W10A 4YO4A 3P78A 4E6DA 1XQZA 3DA6A 1OB3A 4EOQA 4RIWB 4I3ZA 3OHTA 5EW8A 5CXZA 2JITA 3QTWA 4RVLA 2J4ZA 4ALVA 4M0YA 3ZEPA 5CANA 4FKIA 2FYSA 3FQEA 3R7OA 5GIOE 3KMWA 2QO2A 1UNGA 2F7EE 3SV0A 4C4JA 5J1VA 4M13A 3UYSA 2CDZA 2VWYA 1OIQA 4PTGA 3NX8A 2GHMA 4AW2A 3QQHA 4GCJA 3MYGA 4BIBA 2GNIA 3GBZA 2J9MA 3BYOA 4MD7E 4O7NA 3FZPA 5L6WL 2BZJA 3OTUA 3OS3A 4CKIA 3BPRA 3V5WA 3JR1A 5CAVA 3DCVA 5FLFA 5JFXA 2YEXA 2R7IA 4PF4A 2OWBA 3EYGA 2VTAA 4QTCA 4I21A 4WNOA 1YKRA 4O6EA 4F6WA 1Y8GA 3PJ8A 3FXXA 3FZRA 3F5GA 1EH4A 1DAWA 4L01A 4JLCA 3LAUA 4XV1A 2ZV9A 4CKJA 5J8IA 2F9GA 5D7VA 4CTBA 5B2KA 1FOTA 3I1AA 3ET7A 3QTSA 3HDNA 5DEYA 3VRYA 4DGOA 2UW7A 3A7IA 4D1ZA 4DH5A 4DGGA 4FVQA 3FSFA 2WIHA 5AR8A 3EFKA 4JOAA 2WQNA 3EQDA 1PXKA 5D9HA 3DTWA 4KBCA 4DN5A 4M15A 4UMPA 2PVMA 2J2IB 2BVAA 4M84A 3C4ZA 5DN3A 3V01A 4DG2E 4BZDA 4CCBA 3ORTA 4ZLYA 4C0TA 2C5YA 3ENHA 3GCSA 4FV6A 4TKSA 2W4JA 4A4XA 1G8AA 3FZOA 4EONA 2PU8A 4FTIA 3I6UA 2V0DA 3QHWA 2GFSA 4IWQA 3V6SA 4BDHA 3TDVA 4QQJA 1WZYA 2CLXA 4F0IA 4E3CA 3AC5A 4D9TA 4FGRA 4EH7A 5CASA 2Y7JA 2R3NA 3DU8A 4GL9A 4IJ9A 3D5VA 5CZHA 4Z9LA 1GAGA 3FMLA 1YW2A 5JSMA 3UMWA 2IPXA 4TWOA 3WE4A 3HAMA 4BR3A 4WT6A 4MF1A 3QUEA 4XV9A 3KRWA 2A2AA 3VN9A 3C1XA 3W8QA 2VN9A 4BICA 4BI0A 2QNJA 3EMGA 2JFLA 3QCXA 4ZS4A 4W8DA 3OXTA 2GS2A 5TOZA 4CFWA 2GHLA 1M2QA 1OPJA 4FTMA 3VUKA 2XNNA 5JGAA 3QHRA 4B0GA 2ETKA 4G3FA 4RC3A 3VF9A 1XH4A 1IASA 4O1PA 1H07A 3FMNA 3GU7A 4PTCA 5AX9A 3EJ1A 3VBYA 2OKRA 1PYXA 2XVDA 3ZBXA 2B4SB 3WF7A 1OL7A 4KSQA 3PTGA 1YXVA 4RZWA 4N0SA 4TWNA 1OIUA 1T45A 4FKPA 5L6OA 3HV5A 4UXLA 3C4EA 1PMUA 2QI8A 3VJNA 2GTNA 3JS2A 4G6NA 3Q6UA 2W1GA 3U6IA 4ONAA 5CYIA 1XH5A 5L8JA 2AYPA 3A7GA 3PE1A 1W84A 3ID6C 3G5DA 3K2LA 2JC6A 4IX5A 2RGPA 4FKQA 4LRKA 4YP8A 1WVWA 3S4QA 1MQ4A 4XG9A 5HCZA 2C5OA 2JDRA 4AWIA 2EUFB 5JGDA 1UVRA 3F2AA 3QZHA 3DK3A 4ACHA 5AP7A 4QMZA 5TF9A 5HVKA 2OBJA 3DDPA 2P3GX 3JVRA 4M8TA 4MAOA 5CALA 1U5QA 3THBA 4X3JA 5EI6A 1L3RE 3QX2A 4DTBA 4O22A 1JLUE 1H27A 4C61A 3MN3A 2OJFE 3Q2JA 5T6KA 5HU9A 1FGKA 3VRZA 3EQIA 3Q53A 2XNEA 3LIJA 1XH9A 1BKXA 4DT8A 2JAMA 3JYAA 4KD1A 3VBXA 5AUWA 1BX6A 3ZZWA 4GYGA 2XCKA 1X8BA 3E7VA 4IAYA 2G2IA 3POZA 2ITTA 3Q6WA 4FA2A 5HLPA 3P08A 1PHKA 4F65A 3TDWA 1YWNA 5M08A 3CLYA 2C0TA 2XKFA 2PUUA 2YLFA 4FOCA 2VUWA 4UWYA 5CU3A 5IQAA 3FWQA 2B53A 3ORNA 5L2SA 3QD2B 5ANIA 4EOSA 3RWPA 2XIZA 4BDGA 3FI2A 2OZAB 3GU5A 3UO4A 4K2RA 3LOKA 2VX3A 3PG1A 5C8KA 4C4GA 2C6KA 5D11A 1O9UA 2OI4X 1OECA 2W1IA 4LI5A 3C9WA 5LVLA 4FKRA 4IHPA 4PUZA 2WQOA 4GJ2A 1TKIA 4Q9SA 5AV2A 5AEPA 2J50A 2PVYA 3DKCA 3FXWA 5DWRA 3UOJA 4V04A 3C0HA 3K5UA 4FNXA 3QL8A 4O7VA 5H8BA 3LCTA 5ETIA 4NIFA 4Z7GA 3QXOA 3GUBA 1T46A 5IF1A 2CGVA 1BMKA 2YCFA 4FT0A 1NY3A 2DUVA 2XNPA 3DB6A 4APPA 4FTOA 4DH3A 4IEBA 4F70A 1XHAA 5CEMA 4QMLA 5I3RA 2V22A 2CNVA 4TXCA 1FVVA 3SHEA 3KU2A 4RA4A 4ZJIA 4ANMA 5KHXA 2VX1A 1PMEA 4JI9A 5EK7A 4D0XA 5M4UA 3CPCA 4FIEA 1PW2A 2YZAA 5DVRA 3UG1A 4WOVA 3GENA 3R8PA 4BI2A 4CG8A 4L46A 3A7HA 3TKHA 2UV2A 2XJ0A 3NAXA 1J3HA 1H24A 2PMLX 1V0OA 3N4UA 2XB7A 2XK7A 4MBJA 1GIHA 4USFA 3BLQA 1HCKA 4EH2A 3CJGA 4O96A 5GZ8A 3ETAA 4JIAA 3C13A 2BRMA 2FSOX 4JT3A 4BHZA 2WOTA 3PZHA 2BPMA 4QMWA 1RQQA 4E4LA 4EC9A 4IAAA 1J7IA 2B55A 3MA3A 4I0TA 4RLKA 3COHA 3L9PA 4K6ZA 2PZRA 3BU6A 2GNHA 5IEYA 3OY1A 4QRCA 3REPA 3H3CA 3R7UA 2GPHA 4GUEA 2H96A 4Q9ZA 3O71A 2XS0A 5E8VA 4ASZA 2W9ZB 3F9NA 1M2RA 4MXAA 4H3QA 3SX9A 3UP7A 1ZY4A 2C5XA 3P1AA 1JPAA 5L2TA 3ELJA 2YIXA 4FC0A 4G1WA 3ZTXA 2QURA 4YUQA 3VS4A 3DPKA 4PQNA 4BFMA 4J97A 4DG3E 5JZJA 2X2MA 3N4VA 5L3AA 2ZM1A 4F63A 3CD3A 4UXQA 1J7LA 3DOGA 3A7FA 1JAMA 3FMDA 3TIYA 5DHJA 3U8WA 4AFEA 4NEUA 4BKJA 1JVPP 2VZ6A 4TYIA 3NNXA 2XCHA 5CX9A 3UTOA 5AUTA 2YA9A 3F5UA 5LVOA 1XKKA 4PNIA 2IO6A 4U0IA 2FSTX 2UUEA 3NYNA 3R7YA 5IA1A 4HPUE 3ORXA 4U45A 2XIKA 3FEGA 3PRIA 3IW4A 1IA9A 1OL5A 3BWJA 2QO7A 4YJVA 5L4QA 3HA6A 4S31A 1APME 3MFRA 5J9LA 4C2VA 4AW1A 5AMNA 3BYSA 5AWMA 4GVAA 2EXEA 2X7GA 3RCDA 4F9YA 4AZTA 4O7RA 3SA0A 2EVAA 2H8HA 1U5RA 2Z7RA 4XHKB 3TIZA 1H28A 2PVFA 4OW8A 4AF3A 2GDOA 4I5MA 4EHEA 4HYHA 4BC6A 4L8MA 4AGWA 1JBPE 5BYYA 2WMSA 2VV9A 1AGWA 1Q24A 4BCNA 4EEVA 3T3VA 5CEOA 1OPKA 3L8VA 3OUKA 5HZNA 1ZMUA 3R9OA 3VBVA 4I0SA 4DLIA 3G9NA 1CKIA 3EN7A 4QMYA 1F5QA 4XP2A 5H8EA 1CKPA 2XM9A 3BU5A 3KVWA 4M69A 2DYLA 4BVUA 4YTCA 3AMBA 4F7JA 4FSWA 4UV0A 1KOBA 4FV9A 4CYIA 3FZ1A 2UZEA 3EN6A 1PXMA 4GT3A 3HZTA 3ZS5A 4FTCA 2RFNA 5IA5A 1ZAOA 3OT8A 4P5ZA 3VBTA 4K9YA 4U5JA 3NCZA 2YDJA 3LFCA 3GFWA 2YHVA 4QPSA 5C1QB 3MV5A 5BUJA 4DGMA 5JFVA 2XNGA 1VJYA 3D4QA 4FKUA 3KL8A 4MXZA 1OL2A 3VS5A 5FXRA 4PDSA 3E64A 2ZMDA 5DI1A 3ZC6A 2RIOA 3TEIA 2OZOA 4ANSA 1H08A 3R21A 5FBOA 3BEGA 3HUBA 4I41A 4JDKA 4RJ5A 3WYXA 5E8YA 3LXKA 3MIYA 1WBTA 1YDTE 3EB0A 4R78A 4XMOA 3NMUF 2ITWA 2Q0NA 4I92A 3V04A 2X4FA 4LGGA 4XOYA 3PY1A 5AIKA 3BHTA 4U80A 3FHRA 4QP6A 5JFWA 2ZYBA 2C3KA 5J87A 5J95A 3DKFA 4WBOA 4NJ3A 4Y73A 4ZTRA 3FYKX 4B6LA 3L8PA 4E6QA 3H9FA 2IZRA 5DT4A 2X0GA 2VTLA 3LHJA 4MD8E 1FBNA 4PRJA 4I0RA 5B7VA 4L45A 5AR3A 1P14A 4TYEA 4YPSA 4KRCA 2X6EA 3KEXA 5A3XA 3FI4A 3MPAA 5HO8A 3NCGA 4HNIA 5LVNA 5AM7A 4N57A 2GS7A 3AT2A 4R5YA 5IA3A 1O6LA 4IDTA 4XYFA 3DXPA 3UZTA 3UIMA 3SG8A 5HBHA 3POOA 2R9SA 3D83A 5FWKK 5HX8A 5DPVA 4J53A 3PPKA 4RSSA 4ZTLA 1ZOHA 5JT2A 3OOMA 5HQ0A 2VGOA 3BGQA 4N6YA 2IG7A 5DR2A 2I0VA 4FSNA 3KXXA 2WIPA 4JXFA 3R9HA 4YPDA 5KMOA 3UOHA 3LPBA 3BBTB 3F88A 4I6BA 3R8MA 1YHSA 1WCCA 4O38A 1PXLA 3VUGA 3TNIA 4LGDA 3PIZA 3F61A 4FODA 3R7IA 4ASDA 2YJSA 4MWHA 3OFMA 2WTCA 3S3IA 5HD7A 3NNUA 2FA2A 1RE8A 4MNEB 3R8VA 4BWXA 3C51A 4O1OA 1Q8UA 2ITVA 3G9LX 2ZM3A 4FT3A 1QPCA 3BV2A 3GQLA 3MFSA 5CT0A 4F1MA 1WVXA 2C5NA 3HDMA 3FLNC 4QMTA 2PTKA 5CNOA 2OFVA 3GVUA 4ZTSA 5HCYA 4OTQA 3KXNA 2WTKC 3TUBA 3LCKA 2QOHA 2W0JA 5F94A 3P5KA 4TN6A 5LJJA 3LJ1A 4CZYB 5EKNA 1A06A 3BHHA 4D5KA 3OWLA 4DAWA 4J52A 4JQ8A 3C7QA 2X4ZA 4HGLA 2CHLA 4W9XA 4R7BA 3OCGA 3W33A 4RG0A 3FZSA 4HPTE 4ANBA 3CC6A 5KMJA 2VTPA 4OBPA 3HNGA 4HVHA 2QHNA 3PP1A 4AZVA 4PPBA 1Q8ZA 3DBFA 4YO6A 4A9TA 2ZV7A 1V1KA 3CKWA 1Y8YA 3NEWA 2XA4A 1OL6A 4FYNA 4E1ZA 3D7TB 4F6UA 1V0BA 3BYMA 4MK0A 4ZP5A 5EYKA 3GOKA 4FKVA 3R6XA 4IWOA 4EK8A 4KS7A 3WOWA 3E3BX 4Y72A 5FRIA 2FSMX 1BUHA 3QTIA 4JDIA 2JKQA 3N9XA 4DEDA 2QKRA 1YHVA 4ZSGA 3COIA 3PXKA 4YZ9A 4YMJA 2BZKB 3C4CA 4YC6A 1OITA 4DH8A 3IS5A 1SZMA 4ITHA 1OKZA 4CT2A 2C6EA 2C1BA 5ETCA 3DAEA 5I3OA 3HAVA 2QVSE 4YC3A 3ZDUA 2XIRA 2QD9A 3LFBA 3LCOA 4LUDA 4FEQA 3L9MA 3F7WA 1OM1A 5K5NA 4IAIA 4BGGA 3QCYA 4UZDA 4QTEA 5CXHA 4FZ6A 3W16A 2P2HA 4QP3A 4RC2A 4KWPA 3FPQA 2QHMA 4GKHA 1H00A 3SOCA 3FSKA 2JDOA 2WQEA 1SVGA 2Y4IB 4GK4A 2X1NA 4BTFA 3T8OA 3D5XA 3VAPA 2R3IA 4CTCA 3D7ZA 3UIBA 1QPJA 5HU3A 1JKKA 4LUEA 4XP3A 2VGPA 1ZRZA 2C4GA 2Z8CA 1ZZLA 1S9IA 2UZLA 2E2BA 4IACA 4S30A 4BWKA 2BCJA 4GG7A 3BGPA 3VHEA 3Q32A 1Q41A 1O6YA 2C3JA 3TNWA 3PY0A 2WFYA 3CIKA 3S0OA 3QGWA 3VW8A 2W1HA 4AE9A 2I7QA 2X6DA 4TYHA 2G01A 4Q5HA 3SRVB 4FEVA 3R02A 1XBAA 2XM8A 3QUPA 3UBDA 3KF7A 5EI8A 3P0MA 4CLIA 3IPHA 2ZB1A 3PA4A 4H58A 4BDAA 3M1SA 3PSCA 5FXQA 2BTSA 3CQUA 2ERZE 3QRIA 1WAKA 3E5AA 3ZHPC 2UW3A 3DLSA 3QTUA 3D5UA 4FNZA 3RPOA 4L43A 1JSVA 3R83A 3FDNA 4IH8A 3V6RA 3AT4A 4FZ7A 4XG7A 4KINA 2VRXA 4LRMA 3RNYA 3ZH8A 2F4JA 2XK9A 2E9NA 4RWJA 3ZONA 3QWKA 4YTHA 2YISA 3H0YA 4BGHA 4M0ZA 3Q4UA 4EZ7A 4JG8A 3ZSGA 5KO1A 4TWPA 3C50A 5JEBA 2XRUA 4BCIA 3PXZA 4G3CA 1BI8A 1UWJA 3DJ5A 3MFUA 3PXFA 1PMNA 3EFWA 2KULA 2WQMA 4PDYA 4OBQA 5JN2A 3H9RA 2ZV2A 1W7HA 3HMOA 3RPYA 2R2PA 5AADA 3ANQA 4X3FB 4CNHA 1MUOA 4A07A 4E4XA 4ASXA 2OZAA 2G1TA 4RLLA 2VTOA 4ZTQA 3JY9A 4EYJA 2NPQA 2VNYA 3TV7A 1WVYA 3TTJA 4BBMA 3NUAA 2H34A 2QOLA 2FO0A 3OWPA 5EH0A 5C01A 2VO0A 4G9RA 2CJMA 3FKOA 2ITUA 5FP6A 3RTPA 4A4OA 4MX9A 1GZOA 4FTLA 4KA3A 4WSYA 4U44A 4EUTA 5BVDA 5I9ZA 1ZYSA 4X3FC 1I09A 2VWVA 4EH4A 3C5IA 1IA8A 4ANLA 5LWMA 1NVRA 3PWYA 4KIOA 2EXMA 2W06A 1IRKA 2J5EA 4RX9A 4BCOA 5TO8A 3UNZA 3NNVA 3VC4A 3WIGA 4DEBA 4ZY4A 3IONA 4QTAA 3MTFA 3DT1A 3PJCA 5EOLA 5K5XA 4RVMA 1RDQE 3ORLA 5TT7A 1UU7A 4AG8A 5LQFA 3CTQA 4G6OA 4FEXA 4BTKA 4IJPA 4F9WA 2PSQA 3RPVA 4UMRA 3WYYA 3UC4A 2A27A 4UBAA 4S32A 4FIIA 4AU8A 3ORKA 4NTTA 4B8LA 2XK6A 5E92A 1XH7A 3MY1A 3I6WA 2AUHA 2R4BA 3OG7A 5HG9A 5A4LA 3LFNA 3ZO2A 5GINE 4MXXA 5HG8A 3R00A 4E4MA 4PMPA 3IW8A 4FSQA 2VO3A 4DCEA 3CY3A 4C3RA 3FLWA 3MH3A 4LRJA 1KSWA 2JDVA 3Q9YA 2HXLA 4HCTA 4FNWA 3WZKA 1FINA 4MQ1A 4HJOA 4FTKA 2YM4A 5IDPA 3K3JA 4JAJA 2E9VA 2JKKA 3V5TA 3QRKA 4DFNA 4E6AA 3SQQA 2CKOA 3CE3A 3OBGA 4G16A 3DKOA 4QMMA 4BCPA 2W9FB 5AX3A 2CPKE 5IQBA 3KVXA 4ANNA 2BALA 4PL4A 1AD5A 2HZ4A 4N4SA 4IMYA 4L67A 2BZHB 5GJFA 4E93A 4FL2A 3T9TA 2QKWB 4U79A 2XH5A 3PY3A 4C3FA 2WZJA 3QQJA 4QTDA 2FVDA 4MQ2A 4U81A 3NDMA 5IDNA 4D55A 5AA9A 4IC7A 5J7BA 1OPLA 2OXXA 4G2FA 4RIXB 2IVVA 4UALA 5E8SA 2BAKA 4WKQA 2YERA 3DNEA 5BVOA 5A4EA 5LMKA 2QO9A 3IECA 4IFGA 4AFJA 2R0UA 2W5AA 2CN8A 3A8XA 3HEGA 3P7CA 3UMXA 4A9UA 3MESA 2PE0A 4QYGA 1Y57A 5AV3A 1J91A 3A8WA 3BQRA 4EH3A 5L2IA 1GZNA 2VU3A 1MQBA 2WQBA 3A60A 4FR4A 3FXZA 3PWDA 3QA8A 4BDDA 1DM2A 3EHAA 4WA9A 5EM7A 4USDA 3HRCA 4GU6A 2J6MA 4TPTA 4PNKA 5CF4A 3I5NA 3EFLA 4FV8A 1DI8A 3ZC5A 1L8TA 1UA2A 3OXZA 3ROCA 3NVMB 3BKBA 3S95A 3M11A 4D1XA 5EM8A 4YHTA 4W4VA 5ETAA 3DY7A 3QRUA 4O27B 5AR2A 1W98A 3DQWA 5IQIA 1OIRA 3OF0A 3PVGA 4QOXA 5DNRA 4KIPA 4A4LA 3FMJA 3LXLA 4PPAA 1M2PA 5J79A 3IDPA 4O81A 4L3LA 5CAPA 2ZDUA 3WZJA 4CCUA 2C3LA 5HNBA 5F20A 4QNAA 3VVHA 5G6VA 4Y8DA 2BKZA 2YCQA 5GJGA 4KBAA 1WBWA 2R3HA 1LEZA 3U51A 2WMTA 4C4IA 4R1VA 3RVGA 2BR1A 4ZMEA 3W18A 1K2PA 4L3PA 4LV5A 2VWIA 4GMYA 5JZNA 4NM0A 3F7ZA 3MY0A 3PSDA 4R3RA 3QKMA 2I6LA 3ORPA 4KSPA 3OCTA 1MRVA 4FSTA 3TG1A 3VS1A 4C57A 4KUJA 4QT1A 3TZ9A 2WB8A 1ZWSA 2UVXA 5BX0A 4UEUA 3QQKA 5L2QA 4OTRA 2BRGA 2XZSA 5C03A 4IB1A 3O23A 4L7FA 2HZNA 2YABA 3DLZA 4E7WA 4RBLA 4C58A 5IA0A 4LYNA 2OGVA 1JOWB 3Q4TA 2J5FA 2OO8X 2Z7QA 4NIFB 3TL8A 1IEPA 1IG1A 3G51A 3EIDA 4UX9A 1Q8WA 3RHXA 2F7ZE 3B8QA 5IISA 2I40A 3MSSA 3F82A 4LFIA 1NW1A 3WF6A 4CFFA 1ZLTA 3PJ1A 3B8RA 3HMIA 3W2OA 4IVAA 2XUUA 4IZ5A 2YWVA 4FK3A 1Q8YA 3NYVA 5CWZA 1U59A 4XH6A 4EQMA 3U9NA 2SRCA 1LPUA 4K18A 4YHFA 5LVPA 5M53A 4J96A 5M4IA 4TYGA 5EM6A 4YU2A 3H9OA 3MGYA 3D2IA 2YCSA 3U6JA 3NLBA 4KB8A 2ZVAA 3BHYA 2DWBA 5EDQA 3NUNA 4E6CA 3ACKA 4O7WA 1B38A 3AD6A 4TNBA 5G1XA 4ZLZA 5CU6A 4CMUA 4XG4A 4J71A 4EOKA 2B52A 4FV1A 3U4WA 1FGIA 3IGGA 4AUAA 4EH5A 4EWHA 5M4CA 2WEIA 2IZSA 3BCEA 3FLQA 4FNYA 4Y83A 4QQCA 1JNKA 4A7CA 3IO7A 4D0WA 4ZMFA 4F09A 3D2KA 1H8FA 3B2TA 3D0EA 2PUPA 4IVDA 1Y6BA 4LOPA 4L6QA 3EN9A 4YR8A 2CNUA 4D1SA 2G15A 3AT3A 5IQEA 2X9FA 2A0CX 2WU6A 2X7FA 1OGUA 4GS6A 4H1JA 4MNFA 2XJ2A 5HHWA 3SKCA 3QA0A 3TTIA 2P0CA 2QOIA 2O3PA 3ZO1A 4DYMA 5IQCA 5DRBA 4BCGA 4R5SA 4JL9A 4QYHA 4F1TA 1GIIA 4MNEA 1Q3DA 2GSFA 3W8LA 4QQTA 2E9PA 5DLSA 2UZVA 3P9JA 4XG3A 5DR6A 3MH1A 4FIJA 4YZMA 5CVGA 5L6PA 3HUCA 1CMKE 1YVJA 4AA0A 5AAFA 2RFDA 4HGTA 4X2FA 4RMZA 4LOQA 3QBNA 3WARA 3LE6A 3QLFA 2UZTA 3RZBA 4JBQA 5EG3A 4GV1A 3ZSHA 2OJ9A 5JGBA 4M3QA 1YXXA 4FT5A 1PXIA 4EUUA 1GIJA 5E8WA 4IVCA 4FTQA 2YIYA 3QU0A 4G5PA 3WE8A 1QPDA 3JXWA 4AN2A 4CLJA 4EWQA 3KRLA 5A6NA 4OTHA 1GJOA 3R1NA 2BRHA 5CAOA 2X8DA 5KMIA 2NNWB 4EORA 3G2FA 4PP7A 3UPZA 1QL6A 5FM2A 5ACBC 1J7UA 1GY3A 3UVPA 3KY2A 3BYUA 3D7TA 2NO3A 3PA3A 4NM7A 4U3ZA 1A48A 4KIQA 3OY3A 5DR9A 4LG4A 4GKIA 4BKYA 2RL5A 4WBBB 3BRBA 4WD5A 3Q9WA 2IVUA 1GZKA 3GEQA 3C4XA 4ZK5A 4WG5A 4AOJA 4EK3A 4KIKB 4CFMA 3BHUA 3LCSA 2WMBA 4E73A 5D10A 4ZAUA 5M44A 4O83A 2GU8A 4FUXA 2BDWA 4MXOA 3Q5ZA 3P86A 3ZO3A 5CEKA 2B1PA 4OT5A 4JVGA 2GMXA 4EK4A 5DGZA 3I79A 4FV7A 2HK5A 4RZVA 2W1ZA 3SD0A 2VWBA 2XRWA 3PDTA 4M7IA 3W32A 4BBEA 4F7LA 2O2UA 2W4OA 3DBQA 4R7HA 2VTTA 2VO7A 2CSNA 4G6LA 4MTAA 4E5AX 1M14A 1PXOA 4FG7A 4GW8A 4ENXA 2QR7A 4MD9E 3PE2A 4G3DA 4WG3A 3WF5A 4Y95A 2PHKA 3TNHA 3MH0A 4F99A 4EBVA 3R7VA 4FEUA 4NCTA 5JFSA 2WTJA 2PZIA 2R3OA 3IDBA 4IWPA 4UMTA 4BZOA 3WZUA 2UZNA 3JVSA 4H3BA 3TJCA 5EQPA 1OUYA 4F9AA 2R3GA 1P5EA 2YM6A 4EI4A 2CGUA 3F6XA 5I9XA 1FMOE 4P4CA 2ZOQA 2VWUA 4CXAA 3IQ7A 4GSBA 4IM0A 4X2NA 5BVWA 4FK6A 4C35A 3WI6A 4J7BA 2PVLA 2A4LA 4F1OA 1Y91A 2HZIA 2ACXA 4IAKA 4KKHA 3SRVA 4D4YA 2KTYA 2X39A 3CD8A 4GT5A 2R7BA 3VIDA 4DINA 4QMVA 2OFUA 5C8NA 1UV5A 1SMHA 3R04A 5KNJA 2P2IA 4C62A 2WOUA 4FL3A 4I24A 4RGJA 2WXVA 5FTOA 4FI1A 5J5TA 3RPRA 3CY2A 1WBOA 4FL1A 5EKOA 5CSXA 4DTKA 2C69A 3UZRA 3ZZEA 2RG5A 3AG9A 3SGCA 1Y6AA 4BDKA 1URCA 4R3CA 5KMMA 1CKJA 1PMVA 3KGAA 4M68A 2XBAA 4IWDA 2QOQA 3HV7A 4GYIA 3FQSA 4FTAA 5CVHA 5J1WA 5CI6A 4GG5A 3SW4A 3C4WA 1Q5KA 3PIXA 1ZYJA 2VTQA 4ZXTA 4BIEA 3AC3A 4R7IA 3EN5A 4WRSA 3PYYA 3A62A 1WBPA 2OIQA 2BRNA 3PJ2A 2OH0E 3TKIA 3LQ5A 1R3CA 4XLIA 4CFVA 2PPQA 3BV3A 3TZ8A 3V3VA 4DG0E 3BQCA 2FH9A 3NZ0A 1XBCA 4P90A 4X3FA 4CYJA 1UKIA 2ZJWA 3QQFA 4RWIA 2GNGA 1YXSA 4U3YA 4NU1A 4U6RA 4R3PA 4XP0A 4Y85A 3S2PA 4FV4A 3BYVA 4DBXA 5LMKC 4U8ZA 2UZUE 4O21A 4AP7A 2EB2A 4QMQA 3OP5A 3QX4A 1PF8A 4FKLA 4K8AA 3II5A 4LGHA 2OJIA 2R3QA 2CMWA 4TZRA 2IVSA 4WNKA 3MIAA 3QCSA 3O0GA 4FSZA 4M97A 5AFVA 3BIZA 2JLDA 2BROA 3NIEA 2YM5A 3LXNA 4ID7A 2HW7A 2Z60A 4OT6A 3R22A 1S9JA 4XG8A 5H8GA 3LXPA 1Q62A 4D2PA 5IA2A 3R8ZA 1YDRE 1OMWA 4ZS0A 5M55A 1Z9XA 1M17A 2NRYA 3LM5A 3MJ2A 4CQEA 4EL9A 5D1JA 4ZSAA 5CSPA 3O51A 3NAYA 3NNWA 2JBPA 3ZO4A 3W55A 4U42A 4FYOA 4RIYA 3HMNA 4XUFA 5FDXA 1K9AA 4XRLA 3I60A 2OK1A 1MP8A 1YWRA 1Q4LA 2JDSA 3E8CA 3CQEA 1E9HA 3MPMA 4FICA 4UB7A 5FM3A 4BHNA 4C7TA 5AAGA 4USEA 1PJKA 5IEXA 3TUDA 1ZOEA 5C26A 4IB5A 3QFVA 2NP8A 3IK3A 5CS6A 1H1RA 1P2AA 2QOKA 2HY81 5EHYA 3ULIA 2XKEA 4RJ4A 4GEOA 3PRFA 4HZSA 4QPAA 4O91A 5I9YA 3QYWA 5EOBA 2HWOA 1Q97A 4AGCA 3EZRA 5BVNA 2YITA 4BCQA 3UJGA 3RNIA 3AC2A 4FF8A 4GK2A 3UIUA 4FKOA 4D5HA 1DAYA 3TXOA 3OZ6A 3F69A 3L8XA 4L53A 5JH6A 2CGWA 3RBWA 3AQVA 1PXPA 2WGJA 4OGRA 4DH1A 1YI4A 2WKMA 4RIXA 2AC3A 5FTGA 4KKEA 2UW4A 4MWIA 4DT9A 3MB7A 4NM5A 3VUDA 5LMBA 3ROYA 3ODZX 2YDIA 3HV6A 4RIOA 3UQCA 1Q99A 4UZHA 3VS7A 3F3TA 3I7BA 2BAQA 3MFTA 3A4OX 1YWVA 3PPJA 4AGDA 1FVTA 1SVEA 3FMEA 1ZYDA 4KKGA 4NFMA 2BUJA 2V62A 3O2MA 3R7GA 5BVEA 2C30A 3GT8A 2Q83A 2C6MA 2QODA 5E8TA 4I5HA 3QTZA 3E63A 4BTMA 2WMQA 3GFEA 5HI2A 5KUPA 4HVGA 4RIWA 3PLAE 2C5VA 3F3ZA 1OI9A 4TTHB 4AQCA 4HW7A 4ZJVA 1OZ1A 2YCRA 3ZLXA 2O65A 4S2ZA 5CAQA 3RMFA 2FGIA 4XBRA 4HVSA 3MS9A 2HAKA 4RJ3A 4D4RA 3NUPA 3UPXA 3ATTA 4ZTNA 3Q52A 2JIIA 4FKGA 5ANKA 3ZM4A 2WMRA 4RVKA 5M57A 1A9UA 3HV3A 4JBVA 4GRBA 2C6IA 3OT3A 3SVVA 4RJ7A 2ZDTA 5DT0A 2XNBA 3LQ8A 1KE7A 4ALWA 3LFFA 3V51A 1KE6A 1UKHA 1ZOGA 1WFCA 1ERKA 3MPTA 4ZZMA 5IH6A 4GUBA 2P33A 4BCFA 2PY3A 4FZAB 1UNLA 4YURA 3Q60A 1BYGA 3SW7A 2RG6A 3Q3BA 4DHFA 3VWAA 4LM5A 3BLRA 3RK7A 4AACA 3NW5A 3FAAA 2OXDA 5HICA 2I0HA 4O0RA 1LEWA 5AV4A 3UO6A 3G15A 3LW0A 2C6DA 3VQHA 3MVHA 4KNBA 3OWKA 5I9VA 3UVQA 5BYLA 2G9XA 3DGKA 4XRJA 3LMIA 4GFMA 4O7YA 4AW0A 1OBGA 1Q61A 2XJ1A 4CMOA 4G9CA 5A4QA 4FV2A 5IPJA 4APCA 3QZGA 1H1PA 3I0QA 4DGNA 3KRXA 4YBKA 3H10A 3FHIA 4IM2A 2PE1A 2QC6A 1ND4A 5A4CA 4EOOA 1U4DA 3OWJA 4AE6A 2HYYA 4C4FA 2HIWA 3IW7A 3NRMA 1OL1A 3OCSA 5DG5A 1Z5MA 2B7AA 4QMNA 1FVRA 2DQ7X 5GHVA 4Y5QA 5IMXA 4BYJA 4FVRA 3C5UA 3K54A 4HCUA 4FIHA 2UW0A 3EQCA 4M66A 1YRPA 2NRUA 3IW5A 4BBFA 5HVYA 2BFXA 4YJUA 5M06A 3MWUA 3KFAA 5FUTA 3RAWA 3KULB 5JQ8A 3F5XA 3NW7A 3BE2A 4O7ZA 4E5BA 4CRSA 3Q5IA 5CQUA 3TUCA 5BPYA 2UW5A 3DK6A 3NYXA 1XWSA 3E7OA 1CTPE 3HV4A 5DE2A 1PYEA 3RI1A 4F7SA 4AX8A 2PUNA 1O6KA 4U41A 2R3RA 2GQGA 4AXAA 4I1ZA 3IGOA 5AUVA 3WILA 5BUIA 3HX4A 1PRYA 3MVLA 4IB0A 2PK9A 2BIKB 4D4VA 5HO7A 2PVRA 4D4SA 2UW8A 3NPCA 3NUUA 2XNMA 3QLGA 4L44A 2FB8A 5FEDA 4ZEGA 3RCJA 4RRVA 4K33A 2X7OA 4JRVA 4ANOA 4BCJA 5IA4A 4GIIA 2HENA 3KXMA 2QOBA 4O2PA 1NT2A 4DE4A 3CKXA 4CEGA 5CLPA 5I5ZA 3DBDA 3GB2A 3QWJA 4W8EA 3RK9A 3I5ZA 4J98A 2IW6A 1I44A 4EKKA 1JSTA 1VEBA 1PXJA 2F57A 5E8ZA 2Y4IC 4UYNA 4K1BA 5CF5A 1UNHA 3GOPA 4NCTC 2C6LA 3WF8A 2XK8A 2GTMA 2WNTA 3UDBA 4F4PA
chains in the Genus database with same CATH superfamily
4JG7A 5AP1A 1REJA 2GQRA 2R3MA 5AM6A 3CXWA 3P79A 4XJ0A 4HGEA 5GNKA 2O63A 2J7TA 3GC7A 5K3YA 3CQWA 4ACGA 2HOGA 4EH9A 3UDZA 4FX3A 1HOWA 2ZV8A 4XG2A 5ANJA 4ACCA 2ETMA 5KBRA 3D15A 4WUNA 4RFMA 4FIFA 3ZDIA 4G31A 5E90A 4AT5A 4L9IA 4H36A 4BZNA 3C0GA 4BDBA 3CTHA 5A6OA 2VX0A 5CF8A 3O8PA 3GGFA 4F64A 5HORA 4O86A 3R9NA 3UOKA 3QC9A 3HRFA 2HZ0A 5JRQA 4TRLA 5A46A 3VF8A 1W0XC 3UGCA 5IUHA 1DI9A 1OUKA 3F3WA 3KXZA 4K77A 2Y8OA 4W4XA 4AOTA 3MJ1A 5IU2A 3Q2MA 4UYAA 4JX7A 5ANGA 3PXRA 4AW5A 2PULA 2BILB 3QTRA 2UW6A 3DQXA 5CEPA 3EH9A 4U43A 1H1QA 5HCXA 2A1AB 3FLYA 5AP0A 3ZU7A 3UVRA 4JNWA 5EI2A 5AUXA 3VNTA 4ZSEA 4Q5EA 4KIKA 2AEGA 5LARA 2ITNA 1KE9A 5EHOA 5HVJA 5IEVA 2XP2A 4WO5A 2PVNA 4CVAA 3ZEWA 5HKMA 2VTRA 4X2KA 4AT4A 3R7EA 5DA3A 4BCKA 1W8CA 4ACMA 1Q3WA 4BYIA 4F78A 4QP9A 4BY9E 2I1MA 4GU9A 1KOAA 4IX4A 4L52A 3RPSA 5AAEA 3HMMA 3NR9A 2VWZA 5ETFA 4LV8A 3N4TA 3TWJA 2OIDA 5L2WA 4PV0A 3DNDA 1QCFA 4MCVA 4YC8A 5D7AA 1M52A 4FSYA 5BMMA 3WZEA 2ITYA 3ERKA 4ZTMA 4J1RA 3WIKA 5AJQA 3VHKA 3ZRLA 4AAAA 3K5VA 4Z16A 3U54A 3D5WA 3I0OA 2BHHA 2C6OA 3KMUA 4IZAA 1NA7A 2VTSA 2GNLA 4JG6A 3G90X 4Y46A 3LKMA 2FUMA 3DS6A 2RFSA 5H9BA 3AGMA 4DF3A 2Q0BA 4DH7A 3LMHA 1YOMA 2W7XA 4YJSA 4RX7A 4XV2A 3AC8A 2EU9A 4UY9A 3ZUTA 2WMVA 1XH8A 3FZTA 2JFMA 5TKDA 1H26A 4IANA 2OJGA 3PJ3A 3FQHA 3GXLA 2J90A 5CENA 2B0QA 3QD0A 4R77A 3TT0A 4BDCA 4HNFA 5ANDA 3RAHA 4L00A 4KAOA 2WTDA 2C68A 1SM2A 3FY0A 4RVTA 1DS5A 3W2RA 4FTNA 3DDQA 4BL1A 5HBJA 4C37A 4M69B 4AGUA 4XBUA 3EFJA 1YI3A 3BU3A 1LP4A 3KCFA 3SLSA 4F9CA 4M12A 4P2KA 2LAVA 3K3IA 4EYMA 5CQWA 3V8WA 4BIDA 4QP4A 5T3QA 2QLQA 4FTUA 5AP4A 3A61A 4R1YA 3OVVA 4W4YA 3ZUUA 4CQGA 5HTCA 4E4NA 4ORKA 4DFXE 4WNMA 5L8KA 2W1DA 4JDJA 5IUIA 1RJBA 2RF9A 3DKGA 4YTFA 2QG7A 4AA5A 3L8SA 5IQHA 2CKEA 2W1CA 3EL8A 3MTLA 4IQ6A 1SNXA 5AA8A 4ZTHA 4L7SA 3ZLSA 2J0LA 3KXGA 2C0IA 3OROA 5DH3A 4FG8A 4WUAA 1ZZ2A 1F0QA 2XKDA 3QRJA 5I9WA 5KMNA 3GCQA 3NYOA 4TW9A 4EKLA 4ZY5A 3PVWA 2IW9A 4NYEA 2OU7A 4EHVA 3D94A 4LL5A 4II5A 3OXIA 3EQHA 4MYGA 1GOLA 2R64A 3PIYA 4HCVA 4IM3A 4Q2AA 4TNDA 2GHGA 4QP2A 4OTDA 3GCPA 5HESA 4GK3A 2GNFA 1JKLA 3ANRA 4I93A 4JQEA 3LCDA 5EDRA 3Q96A 3HA8A 4OTGA 4OAUC 4PWNA 4ERWA 3R01A 3ORMA 1BI7A 3MY5A 4U7ZA 3KRRA 1ATPE 2F2CB 3BZ3A 5CSVA 4B9DA 2WPAA 3EZVA 4C33A 4ENYA 4YJPA 2XYUA 3KMMA 2ZB0A 4FV0A 5E91A 3JY0A 2WHBA 4YLJA 4I4FA 4UN0C 3SXFA 5KMKA 1TFFA 3CCNA 4MF0A 4W4WA 5FGKA 5HBEA 4HVDA 1G8SA 5FBNC 4CFNA 5CZIA 3GCUA 3DK7A 4WIHA 4ITIA 5JKGA 4AXEA 5M4FA 1H1WA 4ZY6A 4PTEA 2W99B 2JBOA 5CSWA 4MEDA 4TYJA 4PMSA 4O0VA 3ALNA 4PX6A 2JAVA 1W82A 3OD6X 2XIYA 5ACKA 4K0YA 3BLHA 3UQGA 4FEWA 4JDHA 4WNPA 3AMYA 4JR3A 3NFFB 5HE2A 5AUYA 4QNYA 3TKUA 2WEVA 4C4EA 4DEGA 5CTPA 5KMLA 4F08A 2XF0A 2EB3A 1VZOA 4HYSA 1QPEA 4JS8A 1P4FA 5BYZA 3QTQA 2JKOA 5HIBA 3E8NA 5KX8A 4S34A 4OTFA 3OBJA 4BDEA 3QCQA 5LWNA 2E9UA 4G3EA 4YJRA 4ZIMA 1ZYLA 3KCKA 2ERKA 3L9NA 3T3UA 2A98A 1IR3A 2ONLA 3VUMA 3LMGA 3MBLA 4I94A 3I7CA 4DTAA 2QQ7A 4GIHA 1VR2A 4X6RA 5FTQA 5B0XA 3RALA 2ITQA 2QG5A 3RAKA 3GP0A 2BHEA 3OOGA 4K11A 4PMMA 1R78A 3KF4A 2W05A 2EXCX 1STCE 5IQFA 2X8EA 3CPBA 4I23A 2OIBA 4EOMA 1E1VA 4EOIA 4H39A 1H01A 3CJFA 1KV1A 2W1FA 1K3AA 3BEAA 1KE5A 3UC3A 3OC1A 2J0MB 1OKWA 3A2CA 3Q4ZA 2QR8A 3QZFA 5FQDC 3RK5A 3T9IA 1J1BA 4DLJA 3KKVA 4H05A 3QF9A 3SC1A 1PXNA 4DITA 5C4LA 5C27A 5L8LA 4BTJA 4F0FA 2YIQA 5KKRB 3FLZA 4ANQA 3MB6A 4YZNA 3A4PA 5KZ0A 4DBNA 1JSUA 3HL7A 4KBKA 3MW1A 2PZYA 2YM7A 2YM8A 3V5LA 4U9AA 5HX6A 4WRGA 5I4NA 4QDVA 2EWAA 3TZ7A 5DFPA 4N6ZA 4XS2A 2W17A 1AQ1A 4U40A 2BIYA 1ZMWA 2PWLA 3PA5A 4XOZA 5K0KA 5KKRC 3EN4A 3I81A 3E87A 2O0UA 1G5SA 2V55A 4FV5A 1B6CB 4QO9A 1SNUA 5D12A 3KREA 4C3PA 3EWHA 3ZM9A 2XIXA 1H1SA 4IAZA 4NJDA 4RPVA 4B99A 3FYJX 3G6GA 4OUCA 2FSLX 1PKGA 2IZTA 4YJNA 3P23A 3VUTA 4DA5A 2VTHA 2XEZA 2WO6A 3NW6A 4RWLA 4X7QA 4FVPA 1OIYA 3HP5A 4XG6A 3TCPA 3TZMA 3HVCA 4HGSA 2Y9QA 3PSBA 1VYWA 1ZARA 2R3PA 2J0JA 4O7SA 2CN5A 4RJ8A 5T68A 4AOIA 3PVUA 4DEEA 5E1EA 3FL5A 4B4LA 4QPMA 5HG5A 3LZBA 3NS9A 4TYHB 3MVJA 5AR7A 3FLSA 4A06A 3GQIA 4ZSJA 4PDPA 5CVFA 3LFDA 4NWMA 3V5QA 3F66A 5M09A 5CEIA 2Y6OA 4V0GB 3WBLA 4BDJA 3EL7A 4NH1A 2HCKA 2YAAA 4TT7A 2BDJA 1IAHA 4MBIA 2WMXA 5DBXA 5TR6A 4JBOA 4A9SA 3AKKA 2JDTA 2PVHA 4EJ7A 5CSHA 3TJDA 5HE1A 3NUSA 3KULA 4XNEA 4TL0A 3EKKA 3LLAA 3R8UA 2WELA 3QQUA 3WF9A 5E4HA 5I0BA 1TQIA 3UOLA 2ZM4A 1LR4A 2IZUA 3FV8A 4X21A 1XH6A 3ZXTA 3ZRKA 4PP9A 3LVPA 3QQLA 3QC4A 3RP9A 1P4OA 5AP2A 1H25A 3ZYAA 3U6HA 4G3GA 5IH4A 3Q9XA 1YOLA 4M14A 4O0UA 3RM7A 4EHZA 2VNWA 4FTRA 2R0IA 4IZ7A 3O7LD 4RFZA 3QTXA 4MKCA 2PVKA 2YDKA 3EOCA 2OLCA 4FTTA 4QP7A 4RT7A 3PLSA 2J0KA 3OTVA 4J95A 5GJDA 3AKJA 5C4KA 2WTIA 3FPMA 3KA0A 2OSCA 3WZDA 4CMTA 4EC8A 1LUFA 3P4KA 4NM3A 5B2MA 1W83A 5BNJA 3ML1A 4MH7A 5CF6A 4QYYA 5JMSA 4DFLA 4NW6A 4OTWA 4S33A 4YJQA 5H2UA 3VULA 4UWBA 4WG4A 5IKWA 4BCHA 5IMEA 5DT3A 4O0YA 1Q8TA 4UMQA 4JBPA 5CU4A 4PMTA 3FJQE 3GNIB 3O50A 4RX8A 3ZFXA 3E92A 2W5BA 4ARKA 3TNPC 4BDIA 3V5PA 4D2VA 1F3MC 4QMSA 2BFYA 2LGCA 2RFEA 1PKDA 3G0EA 2IWIA 2VTNA 1GNGA 3R63A 2I0EA 5CEQA 5TE0A 2B9FA 2CGXA 4PPCA 5C8MA 1R0EA 1JKTA 2UZOA 3IOPA 1FPUA 3QKKA 5A14A 1UU9A 5EYMA 5IUGA 4YZDA 3F5PA 3R9DA 5J9YA 4Z55A 3ZOSA 1OGYA 4X0MA 4BRXA 4PDOA 5ICPA 5D41A 3TN8A 2ITPA 3ZBFA 4H3PA 1R0PA 1NVSA 4YZBA 4FT9A 1NVQA 1ZY5A 5J7HA 4C4HA 3R8LA 4CGAA 4BN1A 1FQ1B 2W4KA 4YTIA 4MXCA 2W96B 3E88A 3ENMA 4D2WA 5HE3A 2OJJA 5EYDA 3VQUA 1MRUA 2YIRA 5M51A 3ZLYA 4NUSA 3R1QA 1TQPA 4G34A 2V5QA 4WSQA 2X9EA 2HELA 4EHGA 4JX3A 1OVEA 4O4EA 4CFUA 3W2SA 3FY2A 3FMHA 5E7RA 2OW3A 5M07A 3VS3A 5IG1A 5CI7A 5J9ZA 1SYKA 4C38A 2XK3A 4CSVA 4O82A 4TWCA 3PP0A 3FC2A 4FZFB 5KBQA 5EDPA 4ACDA 3IDCA 5HTBA 4R8QA 4LQMA 3CBLA 4FJVA 4AQKA 3IOKA 1WBSA 2E9OA 3DFCB 4EH6A 2HY0A 2QCSA 3E8DA 3HMPA 4EJNA 3KK8A 2BMCA 3R1YA 4NK9A 3HYHA 2OICA 4F9BA 2G2FA 2YIWA 2RKUA 3ZMMA 2WMUA 1SVHA 3C4FA 4DGLC 5J5SA 3W2CA 4J8MA 4OAVB 2VD5A 3EQGA 3Q04A 1YXTA 4ZZOA 1H4LA 3A99A 4FG9A 3PFQA 4ZLOA 1MRYA 3F2NA 3QGYA 2PYWA 2YZLA 3D9VA 1U54B 4F7NA 3EQBA 4RC4A 2F49A 2QOCA 4RFYA 2GFCA 5AUZA 3FMMA 3EQRA 5GZAA 3O8TA 3FI8A 3NIZA 4NZWB 2OG8A 3G33A 4BDFA 4LMUA 3ORIA 3U4UA 2B54A 3EQFA 3AMAA 4IAFA 5HIEA 4BJJB 2VWXA 3I4BA 4XV3A 2QOFA 3MA6A 3TM0A 2CNQA 4YZCA 5IQGA 5F1ZA 4E8AA 1YXUA 3DBEA 4EBWA 4KS8A 2GNJA 3LJ0A 4X2JA 4C36A 4F0GA 2XEYA 3BLAA 3PVBA 2OF4A 3BWFA 4YJTA 3UODA 3GC8A 2JIVA 4OBOA 3W0SA 4M67A 1JKSA 1KUTA 2CCIA 3OW4A 4MBLA 2VO6A 3O7LB 2IVTA 3SXSA 2F7XE 2O64A 5EW9A 5BQ0A 4NSTA 4O6LA 4E20A 4DFUA 4IX6A 5KZIA 4AN3A 4NL0A 4PL5A 4DEAA 4I6HA 4D2RA 5K4JA 5DEWA 3DXNA 2J51A 4EOJA 4PY1A 3QQGA 2UVYA 5E8XA 3C0IA 2YWPA 2JEDA 4GH2A 2QU6A 4LOOA 2WTVA 3ZRMA 2V7AA 4YNOA 2R5TA 3FKNA 3H30A 4RWKA 3UNKA 3DV3A 5EFQA 4HZRA 2JGZA 3KK9A 4RJ6A 1CSNA 4L68A 4CZTA 5K4IA 1WBVA 2BKKA 3VUIA 3W2PA 3H4JA 3HRBA 3L1SA 3RINA 4DFYA 2X0OA 4FKSA 4GVJA 3TI1A 1BL6A 2X2KA 4NTSA 3RM6A 1B39A 4W9WA 1ZXEA 4IX3A 3VS0A 4QMOA 3E62A 5DMZA 1KE8A 5AV0A 4YHJA 2YFXA 4GFOA 2ONLC 2XNOA 5EYCA 5LXMA 4QMXA 3BE9A 2YAKA 4JMQA 2O8YA 4DC2A 1XJDA 2WAJA 4AT3A 2HW6A 3ZUVA 2Y4PA 3R2YA 5EW3A 4FKJA 4ERKA 2C3IB 2XBJA 3W0NA 5LMAA 3OEFX 3SAYA 2VAGA 3A7JA 5CU2A 3W1FA 4YSMA 5HLNA 3HLLA 4YBJA 3ZSIA 4E26A 3HKOA 2G2HA 2QOOA 2CLQA 5FEEA 3DXQA 3DFAA 4YJOA 3KXHA 2YLEA 4YGAA 4I6QA 5DIAA 3SDJA 3MI9A 4FGBA 5AR4A 5LCKA 3TACA 3O96A 5KHWA 3QAME 2IN6A 1KV2A 4CKRA 4FUYA 5IH5A 2PL0A 2BRBA 4J99A 2XANA 1OKVA 5HIDA 3R2BA 2HXQA 4CG9A 3RAIA 4XCUA 4ZJJA 4EQUA 1VYZA 2X2LA 2UZDA 3CS9A 3PG3A 3F3VA 4P7EA 3ZFYA 4HVIA 5A9UA 4IZYA 3COMA 4IBMA 4AZFA 3LFSA 3U9CA 4OLIA 4FT7A 3DZQA 3PXQA 2WD1A 4FMQA 3VUHA 4A9RA 5F95A 3ALOA 4AZEA 3IG7A 4UWCA 3E8EA 4EZ5A 5LOHA 2W5HA 5JK3A 5BVKA 1WBNA 3ITZA 2WTKB 2PMIA 2PVJA 4JQ7A 3CGOA 4B7TA 3KC3A 4QP1A 1OKYA 3DB8A 3PUPA 3QD4A 5C9CA 4C8BA 3SOAA 3PXYA 4EK6A 5GZ9A 3BBWA 2ETRA 4OR5A 1XBBA 3EYHA 4G5JA 1FMKA 1HCLA 2QONA 2JKMA 3AC1A 3RJCA 1M7QA 4UMUA 2UZWE 4B8MA 4C2WA 4RA5A 5CT7A 4FSMA 3VBWA 1W2CA 2RSVA 2B9JA 5FP5A 3VJOA 1JQHA 1ZYCA 2J0IA 2P55A 3RGFA 5EM5A 4NKSA 4YSJA 3R9RA 2C0OA 4RQKA 4BKZA 3E3PA 4KABA 2OH4A 2YN8A 2XK4A 3TNQB 3O5AA 1R1WA 3P7BA 4IVBA 4Y5HA 3DJ6A 1YOJA 1KWPA 4FZDB 2REIA 3GU8A 5HE0A 5KE0A 5ANOA 5HOAA 1BL7A 4X6QC 2YACA 4O0XA 4AS0A 2VWWA 3OW3A 4N70A 3IW6A 4BB4A 1YDSE 4CFXA 3S00A 3FI3A 3HECA 4O0TA 5EHLA 3GI3A 2PE2A 3O8UA 3PZEA 4I6FA 4IE9A 4ZOGA 3LFAA 1E1XA 5CNNA 4ZSLA 3KN5A 4CT1A 2A19B 5DRDA 3VBQA 4D9UA 1H0VA 3AGLA 3ZLWA 2UW9A 3QXPA 4HYUA 4QP8A 3KB7A 4JR7A 5BV3A 4NKAA 3TV4A 4ALUA 4FBXA 4AN9A 1H0WA 4IC8A 3HP2A 5FD2A 3UIXA 4I22A 4X2GA 4XX9A 2OXYA 5B2LA 3BI6A 3UDTA 4FSRA 4JRNA 3DJ7A 4DEIA 4AZWA 3JPVA 3D14A 5F4NA 1V0PA 2Z2WA 5H3QA 3GU6A 4IXPA 4QMPA 3DZOA 3VS2A 4AXFA 3EQPA 3LLTA 2IJMA 3QRTA 4O0WA 3RKBA 5HNGA 1J1CA 2OF2A 5HLWA 3QKLA 5HO6A 2Y0AA 3RHKA 2P4IA 4L42A 3Q9ZA 3OCBA 1NXKA 3AD4A 5JQ5A 2CKPA 2H6DA 4R6VA 5AP3A 5A4TA 3R30A 3DBCA 2CKQA 3UNJA 4DDGA 4D2SA 1IAJA 3CSVA 4DEHA 4FTJA 4HYIA 1CDKA 3AOXA 4JIKA 4V01A 2ZMCA 3AD5A 2WU7A 3LFQA 4IFCA 4MVFA 4I4EA 3IKAA 4EK5A 4DCAA 2BAJA 2GS6A 3KN6A 2YM3A 4J8NA 2W1EA 4LMNA 3HGKA 5I9UA 3UYTA 1Z57A 4BI1A 4D2TA 4OTIA 4V0GA 4XEYA 4FIGA 3S1HA 3MVMA 4GT4A 4XLVA 3BELA 1BLXA 4BWPA 3NSZA 4CV8A 4EH8A 2IW8A 3SXRA 2B9IA 5LCJA 2ZAZA 3R71A 2VTIA 5HD4A 3O17A 3LQ3A 4IADA 4ZZNA 3RWQA 2Y6MA 4QMUA 5GIPE 3MDYA 2F2UA 4GJ3A 4P5QA 2PZ5A 4ASEA 5E9EA 3ATSA 2UZBA 3ODYX 4O84A 1TQMA 1JWHA 3CGFA 5KCVA 1URWA 5ANEA 3ULZA 3R28A 4QYEA 3FBVA 4EOLA 4HOKA 3NVKI 4O7LA 3VW6A 2YJRA 5FEQA 4EQCA 4AA4A 4FKWA 1XMLA 3EKNA 1YQJA 5HNIX 3OMVA 4FKTA 3KRJA 2WTWA 2B9HA 4QD6A 3Q4CA 1WMKA 2AQXA 2PMNX 3NUXA 3R1SA 4NFNA 2JIUA 1W2FA 3BGZA 2C1AA 2WMAA 3FE3A 4NW5A 3OUNB 3UQFA 4Z3VA 4BF2A 1GZ8A 1XR1A 4CRLA 3UP2A 5CAUA 5E1SA 3KQ7A 5DYJA 2XYNA 3DTCA 3CR0A 3CP9A 4IB3A 4GFGA 3RZFA 4CZUA 2GQSA 2X8IA 2QU5A 3QALE 2WMWA 3DAKA 5BUEA 2JD5A 3L9LA 4YNEA 4RX5A 1OBDA 2BDFA 4I5CA 3QD3A 3U87A 5FDPA 5HTIA 2R3FA 4DFZE 3G6HA 4NT4A 3QYZA 2VTMA 5IZFA 3DAJA 1RW8A 3FUPA 2Z02A 2V7OA 3ZFMA 5FXSA 5LVMA 1TVOA 2CCHA 2HWPA 3LM0A 3R73A 2BZIB 4MHAA 4F6SA 5HGIA 4DFBA 4FSUA 4YLKA 4IIRA 1CM8A 2H9VA 4IDVA 2ITZA 4U97A 5AV1A 5HG7A 4TY1A 1XO2B 2DS1A 2GCDA 2QLUA 3F3UA 5AR5A 5CU0A 4G17A 2PUIA 4O2ZA 2XARA 3UDSA 3GCVA 3CTJA 1UU8A 3W2QA 4JAIA 3B2WA 2C47A 3PPZA 4JJRA 3N51A 3F2RA 3R0TA 3V8SA 3GC0A 4RIYB 3V8TA 4Z7HA 2ITXA 3ZXZA 3UO5A 4LV7A 4FV3A 2Z7LA 2R3KA 5F9EA 5AP6A 2C6TA 2PZPA 3NGAA 3ACJA 3AXWA 4RQVA 3FKLA 3QZIA 2PMOX 2R3JA 3TV6A 2AC5A 3ZCLA 5DOSA 1REKA 5HEZA 4A9YA 5A54A 5BVFA 4L3JA 4FOBA 4MXYA 3VO3A 4WHZA 3G0FA 3NWWA 3OEZA 5AP5A 4PL3A 2ITOA 2I0YA 3H0ZA 3FL4A 4D58A 3UZPA 4EZ3A 5EQYA 3GU4A 5E8UA 2X81A 5K0XA 4C02A 3FMKA 4H1MA 4O0SA 3FC1X 4I20A 4O7TA 3MH2A 1ZMVA 3SG9A 1QMZA 5M56A 3COKA 1G3NA 2BTRA 4QQ5A 3CEKA 3ORZA 4FE2A 5K9IA 3JUHA 5CY3A 5IQDA 4LL0A 1UWHA 3P7AA 4ITJA 1R39A 2VTJA 1U46A 2O5KA 1YI6A 5JRSA 4CV9A 3UG2A 5ITAA 1UU3A 4OTPA 2Z7SA 4IW0A 4YLLA 5BMSA 3UE4A 4C34A 3M2WA 3LFEA 1M7NA 3QUDA 4O4CA 4QTBA 1YHWA 4V05A 4EOPA 3VS6A 3NUYA 5FG8A 4BGQA 3BX5A 3V5JA 2XKCA 2ESMA 5EQEA 2R3LA 2UVZA 1PY5A 3U55A 4CD0A 4AZSA 3M42A 4I5PA 4BCMA 3BHVA 4C59A 4E5WA 4QYFA 5AUUA 3LJ2A 3AC4A 1ST0A 4D28A 1U54A 3E93A 4KRDA 3GC9A 5AIRA 2XMYA 3W10A 4YO4A 3P78A 4E6DA 1XQZA 3DA6A 1OB3A 4EOQA 4RIWB 4I3ZA 3OHTA 5EW8A 5CXZA 2JITA 3QTWA 4RVLA 2J4ZA 4ALVA 4M0YA 3ZEPA 5CANA 4BJJA 4FKIA 2FYSA 3FQEA 3R7OA 3W0RA 3KMWA 2QO2A 1UNGA 2F7EE 3SV0A 4C4JA 5GIOE 5J1VA 4M13A 3UYSA 2CDZA 2VWYA 1OIQA 4PTGA 3NX8A 2GHMA 4AW2A 3QQHA 4GCJA 3MYGA 4BIBA 2GNIA 3GBZA 2J9MA 3BYOA 4MD7E 4O7NA 3FZPA 5L6WL 2BZJA 3OTUA 3OS3A 4CKIA 3BPRA 3V5WA 3JR1A 5CAVA 3DCVA 5FLFA 5JFXA 2YEXA 2R7IA 4PF4A 2OWBA 3EYGA 2VTAA 4QTCA 4I21A 4WNOA 1YKRA 4O6EA 4F6WA 1Y8GA 3PJ8A 3FXXA 3FZRA 3F5GA 1EH4A 1DAWA 4L01A 4JLCA 3LAUA 4XV1A 2ZV9A 4CKJA 5J8IA 2F9GA 5D7VA 4CTBA 5B2KA 1FOTA 3I1AA 3ET7A 3QTSA 3HDNA 5DEYA 3VRYA 4DGOA 2UW7A 3A7IA 4D1ZA 2IEWA 4DH5A 4DGGA 4FVQA 3FSFA 2WIHA 5AR8A 3EFKA 4JOAA 2WQNA 3EQDA 1PXKA 5D9HA 3DTWA 4KBCA 4DN5A 4M15A 4UMPA 2PVMA 2J2IB 2BVAA 4M84A 3C4ZA 5DN3A 3V01A 4DG2E 4BZDA 4CCBA 3ORTA 4ZLYA 4C0TA 2C5YA 3ENHA 3GCSA 4FV6A 4TKSA 2W4JA 4A4XA 1G8AA 3FZOA 4EONA 2PU8A 4FTIA 3I6UA 2V0DA 3QHWA 2GFSA 4IWQA 3V6SA 4BDHA 3TDVA 4QQJA 1WZYA 2CLXA 4F0IA 4E3CA 3AC5A 4D9TA 4FGRA 4EH7A 5CASA 2Y7JA 2R3NA 3DU8A 4GL9A 4IJ9A 3D5VA 5CZHA 4Z9LA 1GAGA 3FMLA 1YW2A 5JSMA 3UMWA 2IPXA 4TWOA 3WE4A 3HAMA 4BR3A 4WT6A 4MF1A 4O4DA 3QUEA 4XV9A 3KRWA 2A2AA 3VN9A 3C1XA 3W8QA 2VN9A 4BICA 4BI0A 2QNJA 3EMGA 2JFLA 3QCXA 3W0MA 4W8DA 4ZS4A 3OXTA 2GS2A 5TOZA 4CFWA 2GHLA 1M2QA 1OPJA 4FTMA 3VUKA 2XNNA 5JGAA 3QHRA 4B0GA 2ETKA 4G3FA 4RC3A 3VF9A 4AXCA 1XH4A 1IASA 4O1PA 1H07A 3FMNA 3GU7A 4PTCA 5AX9A 3EJ1A 3VBYA 2OKRA 1PYXA 2XVDA 3ZBXA 2B4SB 3WF7A 1OL7A 4KSQA 3PTGA 1YXVA 4RZWA 4N0SA 4TWNA 1OIUA 1T45A 4FKPA 5L6OA 3HV5A 4UXLA 3C4EA 1PMUA 2QI8A 3VJNA 2GTNA 3JS2A 4G6NA 3Q6UA 2W1GA 3U6IA 4ONAA 5CYIA 1XH5A 5L8JA 2AYPA 3A7GA 3PE1A 1W84A 3ID6C 3G5DA 3K2LA 1G8JA 2JC6A 4IX5A 3W0PA 2RGPA 4FKQA 4LRKA 4YP8A 4I6LA 1WVWA 3S4QA 1MQ4A 4XG9A 5HCZA 2C5OA 2JDRA 4AWIA 2EUFB 5JGDA 1UVRA 3F2AA 3QZHA 3DK3A 4ACHA 5AP7A 4QMZA 5TF9A 5HVKA 2OBJA 3DDPA 2P3GX 3JVRA 4M8TA 4MAOA 5CALA 1U5QA 3THBA 4X3JA 5EI6A 1L3RE 3QX2A 4DTBA 4O22A 1JLUE 1H27A 4C61A 3MN3A 2OJFE 3Q2JA 5T6KA 5HU9A 1FGKA 3VRZA 3EQIA 3Q53A 2XNEA 3LIJA 1XH9A 1BKXA 4DT8A 2JAMA 3JYAA 4KD1A 3VBXA 5AUWA 1BX6A 3ZZWA 4GYGA 2XCKA 1X8BA 3E7VA 4IAYA 2G2IA 3POZA 2ITTA 3Q6WA 4FA2A 5HLPA 3P08A 1PHKA 4F65A 3TDWA 1YWNA 5M08A 3CLYA 2C0TA 2XKFA 2PUUA 2YLFA 4FOCA 2VUWA 4UWYA 5CU3A 5IQAA 3FWQA 2B53A 3ORNA 3KIOC 5L2SA 3QD2B 5ANIA 4EOSA 3RWPA 2XIZA 4BDGA 3FI2A 2OZAB 3GU5A 3UO4A 4K2RA 3LOKA 2VX3A 3PG1A 5C8KA 4C4GA 2C6KA 5D11A 1O9UA 1VLRA 2OI4X 1OECA 2W1IA 4LI5A 3C9WA 5LVLA 4FKRA 4IHPA 4PUZA 2WQOA 4GJ2A 1TKIA 4Q9SA 5AV2A 5AEPA 2J50A 2PVYA 3DKCA 3FXWA 5DWRA 3UOJA 4V04A 3C0HA 3K5UA 4FNXA 3QL8A 4O7VA 5H8BA 3LCTA 5ETIA 4NIF