4AT3A

Crystal structure of trkb kinase domain in complex with cpd5n
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
299
structure length
289
Chain Sequence
GAMDTFVQHIKRHNIVLKRELGEGAFGKVFLAECYNLCKILVAVKTLASDNARKDFHREAELLTNLQHEHIVKFYGVCVEGDPLIMVFEYMKHGDLNKFLRAHGPDAVLMANPPTELTQSQMLHIAQQIAAGMVYLASQHFVHRDLATRNCLVGENLLVKIGDFGMSRYSTDYYRVGGHTMLPIRWMPPESIMYRKFTTESDVWSLGVVLWEIFTYGKQPWYQLSNNEVIECITQGRVLQRPRTCPQEVYELMLGCWQREPHMRKNIKGIHTLLQNLAKASPVYLDILG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords BDNF/NT-3 GROWTH FACTORS RECEPTOR
publication title The Crystal Structures of Trka and Trkb Suggest Key Regions for Achieving Selective Inhibition.
pubmed doi rcsb
source organism Homo sapiens
total genus 97
structure length 289
sequence length 299
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2012-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4at3A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4at3A01
2R3MA 4XG6A 4EJNA 1BKXA 4GRBA 5LARA 3HKOA 4DGGA 4FV2A 1P14A 4FNXA 4TYHB 2OWBA 2CN8A 2B54A 3W32A 4USFA 5AR2A 4MHAA 3TZ9A 4LL0A 3R7OA 4AACA 2DWBA 4F65A 3C5UA 3DK7A 3ANRA 4HCTA 4IIRA 2WEIA 5DEWA 4IWQA 4R78A 2X7OA 2O64A 4FTJA 3CC6A 4IX4A 5IPJA 2JIUA 2X1NA 3EH9A 2BHHA 5J9YA 4TYGA 2BZJA 4AW5A 2XNBA 2WFYA 3MW1A 3AOXA 4L43A 2BRBA 4AAAA 4MD8E 5DMZA 1XH5A 4RWKA 1J7UA 4U3YA 4LGGA 3MIAA 4O1PA 4Z7GA 5E92A 4FIGA 2CCIA 4HVGA 5KMOA 4U97A 1JVPP 2WKMA 4FV3A 4FC0A 2XNPA 5BX0A 1BYGA 3ZDUA 3JXWA 4X2JA 1XH7A 2QOOA 4M66A 2EB2A 4GG7A 5JFXA 4G31A 5CZHA 4ACMA 5J87A 5M56A 5EDQA 3QC4A 3Q4ZA 2QO9A 3O7LB 2O65A 3D2KA 3RAKA 3O71A 3UE4A 2J4ZA 4EORA 4XRLA 2CN5A 1QPDA 3DBCA 2B4SB 5F94A 5JEBA 4MAOA 4FT5A 3IDCA 4O7VA 3FSFA 5LXMA 5I3RA 5KMLA 4C4GA 2Y4PA 3FDNA 3H0YA 3R2BA 4RJ6A 3TN8A 3PXRA 3UYSA 2PVFA 5HCYA 4AGUA 1OPJA 3RM6A 3ZLSA 3DDQA 3F6XA 4RQKA 3MA3A 3GI3A 3DBEA 2QOCA 3LXNA 4FR4A 2JAMA 4FL3A 3A4PA 4MCVA 5EYKA 4BDBA 4L42A 4J52A 3ZDIA 3O8TA 3UMXA 2ITZA 2OICA 5L8KA 4M0ZA 1WBSA 2Y9QA 2FUMA 3VUGA 2WMSA 4RT7A 2C5XA 3VQHA 4FEXA 3VVHA 3PXQA 2OF4A 2X39A 3TI1A 4OTIA 3OWPA 3NIZA 5LMBA 4BCPA 2J5EA 3E93A 4RGJA 4LV8A 3P4KA 4O6EA 4WUNA 5HBEA 4RX8A 4DG3E 5E8SA 2R3LA 1X8BA 5C8MA 2VV9A 4YMJA 2XNMA 3EMGA 4GT5A 1H24A 3FHIA 1PXLA 2C1AA 2FGIA 3FY0A 3R7VA 3P08A 1Q3WA 2WMWA 5J7HA 4FIFA 2W1DA 1H4LA 4HYSA 2BZIB 1UNGA 2XA4A 3D4QA 4M14A 5AV3A 3NUAA 1JWHA 3P9JA 4GT3A 4FVQA 4C59A 2O3PA 1DAWA 5HE1A 4CFFA 5FEDA 4BDIA 3PWDA 4YR8A 2OW3A 2ZM3A 3RM7A 4YHTA 4ZJVA 4P2KA 3I1AA 3LFDA 3MVHA 1KE5A 3L8SA 3UVRA 1PMEA 2C6DA 3NPCA 2UZOA 4MBJA 2R3HA 4AE6A 3WIKA 3TKHA 1ZRZA 4KRCA 1XJDA 3Q9ZA 3KEXA 5AP6A 4BBFA 3G6GA 3QLGA 2OU7A 5FP5A 4FGBA 3UMWA 3BWFA 2B9FA 3PRFA 3MGYA 1GNGA 1TKIA 1W82A 4O7RA 4YC8A 4YJQA 1G5SA 4JG6A 5EDPA 3PJ8A 4XG9A 4F0FA 3CJFA 3UIMA 2ITQA 3MPMA 4C2VA 2F7ZE 2HAKA 3EB0A 1RE8A 5CU2A 5AP1A 2PL0A 2ITOA 2RSVA 3EQPA 3BYMA 3KMWA 4G6NA 4A9UA 1OIYA 5AEPA 1PW2A 5CEKA 3I0QA 4FNWA 3TUBA 2YCFA 3PYYA 4MEDA 4NW6A 5AV0A 1YI3A 4PTEA 4X6RA 3BWJA 5E1EA 3BU3A 3PSCA 4U8ZA 4MWIA 1QCFA 3F61A 2XKDA 4PUZA 3QQUA 4FIIA 4I0SA 4P90A 4FE2A 4D4YA 5IEXA 5LVOA 3ULIA 1ZZ2A 2YEXA 3Q5ZA 5E8TA 2A1AB 4BCIA 2VTNA 3P0MA 4ENYA 3Q52A 4OUCA 4CMOA 5EM6A 4KS7A 4QTAA 5DOSA 5EQPA 4EKKA 4QO9A 4YBJA 5L4QA 4CZYB 5KE0A 2UW5A 4FSYA 2QURA 2HK5A 2C6MA 3Q6WA 3Q53A 4R3CA 1FINA 1ZXEA 4PF4A 4Y72A 5FLFA 2X6DA 5DPVA 5I5ZA 3BHUA 3WZJA 1NW1A 4I0RA 5FG8A 3KCKA 4IVAA 3BV3A 3F7WA 4AFJA 5J79A 4CFUA 4U5JA 4XG3A 5DT0A 5D10A 4GSBA 3ZUVA 4UZDA 3RAWA 1XWSA 3PPZA 3FMHA 3O8UA 3RI1A 3HDMA 2YWVA 4YHFA 4BDCA 1LPUA 4YJRA 3GU4A 4TYHA 4WNPA 1OKZA 4RX5A 3OWJA 1IA9A 2YCQA 3KCFA 4EK5A 2FA2A 3GC7A 2WQEA 4YC3A 5H2UA 4EUTA 4X3JA 4GK4A 3BKBA 3DA6A 2WTKB 3F5PA 2NRYA 4C8BA 3VUKA 3EYHA 4FIJA 5IUGA 5JK3A 5AUUA 3CP9A 5TKDA 3VBYA 4X3FC 2HXQA 3LJ1A 3UVPA 5AV2A 3QTIA 2F49A 1PY5A 1RQQA 4MKCA 4QMXA 4X2NA 3R9HA 2XZSA 4IADA 4BFMA 4C4JA 4UB7A 5HGIA 3IW8A 4NW5A 3LXPA 3TNQB 2WZJA 3RPYA 3I7CA 4FKUA 4I4FA 4ZTSA 4ACDA 2QD9A 3R63A 4O83A 4BIDA 3GCPA 4C38A 4YO4A 2EU9A 3C51A 3E3PA 1FPUA 2UW6A 2VTOA 4FUYA 4ITIA 4IX5A 3WIGA 4CNHA 4D58A 5M4CA 4C34A 4MF1A 4AN9A 4BWPA 3P78A 3VW8A 3N9XA 3A8XA 4JVGA 2PMLX 3JS2A 5C8NA 4N6YA 2VWBA 1CKJA 3WZUA 1BL7A 4Z3VA 4RVMA 2X8IA 3B8RA 3ZOSA 4BVUA 4U45A 2VGPA 3PDTA 2BHEA 4RFYA 2GSFA 2DYLA 1PYEA 4V05A 3EN7A 2PY3A 3FXWA 4FKLA 5EDRA 1UA2A 3PXFA 5C03A 3OFMA 4CMUA 3ULZA 4BCQA 2W1FA 3D94A 4FTOA 5EI6A 3PWYA 4F0GA 3MTLA 4FNZA 2WMQA 2PMNX 2YJSA 3KXGA 4UZHA 3G5DA 4AZTA 4CYJA 4NJ3A 4RWJA 1PMVA 3OY3A 3W2QA 3ZTXA 4DH7A 4QP3A 4IACA 1YRPA 3HV4A 3PVGA 4A06A 3SLSA 5L3AA 2IWIA 3E87A 4GH2A 3RAHA 4ZZNA 5CAQA 4PMTA 4E5WA 4MK0A 1M7NA 5ANJA 3AXWA 2I6LA 1NVQA 1PXOA 2ETMA 3BZ3A 3FMDA 4AW0A 4LMUA 1ZY5A 4UWYA 3E64A 4ZIMA 3RINA 4J8MA 4AOTA 2KULA 2XCKA 3LFSA 3SW4A 1OIUA 2PVYA 3TL8A 4ZLZA 2ZAZA 5HNIX 3EZVA 3OCSA 2QNJA 2XKCA 1ZLTA 2HOGA 3U4UA 3EWHA 1ND4A 5IUHA 4KINA 3UBDA 3TEIA 3A4OX 4B4LA 2W1IA 3IW7A 4PY1A 4G3CA 5BVKA 1OL7A 2PPQA 2X9EA 1NVRA 3TIYA 4ANMA 4H05A 2JLDA 4FKVA 4APPA 2VD5A 4UN0C 3QTSA 2NPQA 1RW8A 1CKIA 4RIYB 3GP0A 3R8UA 2FVDA 5AADA 4M67A 4NL0A 2VTPA 4G3GA 4YJVA 4HYIA 2QO2A 3EN5A 4RC2A 3VBTA 3BYUA 3JR1A 4FKTA 3EQCA 3T9IA 3D15A 4Y83A 4DFXE 3QBNA 5KKRB 4QTDA 3MV5A 3PJCA 3S00A 4KS8A 4N6ZA 2OK1A 3PPJA 3D9VA 3ZFYA 2YDJA 5CF8A 3KXHA 4X6QC 4ZEGA 5ANDA 4XCUA 3SAYA 5G1XA 4O0UA 3GENA 1A06A 4NM5A 3A99A 4W9WA 4WIHA 5K3YA 3UODA 2ITWA 4AA0A 2JITA 2GS2A 3NUXA 2WQBA 3ELJA 5JGAA 1MRVA 3ZLXA 4CFVA 4F9AA 2UZUE 2RFDA 3DNDA 1HOWA 4IJ9A 4KKEA 2XIKA 2XIYA 3F5XA 1H0VA 2ZB0A 2PUNA 2REIA 3OWLA 5I9UA 3IDPA 4FSRA 4ASDA 4DFYA 4Q2AA 3CTHA 2PUIA 3MJ1A 2W9ZB 1MP8A 4K1BA 3FJQE 2RKUA 2C47A 3T3UA 2OIDA 2I0VA 2LGCA 2OGVA 3FZTA 3ZXZA 1W83A 5AM6A 2WD1A 5CXHA 3OG7A 3C4CA 5JH6A 4GW8A 3OVVA 5IH4A 5AR5A 3GXLA 3EQFA 1YHSA 3WI6A 4ANSA 4KIOA 1ERKA 5BVNA 4MXOA 2WXVA 3VRZA 5K0KA 2JFMA 4HNIA 4RJ7A 4FT9A 2ITVA 2ZJWA 2B9IA 3BV2A 4QPSA 4BN1A 2BCJA 2I0HA 2EB3A 1AD5A 4E6DA 4NEUA 3G9LX 3NUYA 4A7CA 4FT3A 4QMQA 4I6QA 1PF8A 3OXIA 1H1WA 2R3NA 3OZ6A 4HVIA 4OTGA 5KHXA 3VUDA 5AJQA 4AW2A 3GU7A 2W4JA 3OCBA 4IB5A 3FZSA 2NP8A 5BMSA 3UPZA 2A19B 4BKYA 5M09A 3UP2A 2HCKA 2WU6A 5GHVA 4ZAUA 2YCSA 1I09A 3A7IA 3OP5A 3Q3BA 4FG9A 2C6LA 5E8VA 2RFSA 2OIQA 3V5TA 4S34A 4U43A 2UZVA 5EOLA 4C61A 1UWHA 3DBQA 4XV9A 1G3NA 2OJJA 2R9SA 5KMMA 3BGQA 1IAHA 2J0IA 4WRSA 3NIEA 4C62A 3KN6A 4GKHA 1R1WA 3OW3A 2I1MA 4UALA 3LMGA 2JAVA 5DFPA 3Q96A 5CNOA 5FM2A 3NRMA 4YZCA 4YPDA 1TVOA 4ZMFA 3EL8A 4AZSA 4PL4A 3ZSGA 3G6HA 3VULA 1PJKA 3C1XA 4UMRA 4JNWA 3I81A 2GNGA 2J6MA 3C4WA 4GEOA 2UZWE 1XQZA 2ITPA 3TUCA 1JKSA 4MNFA 5CAUA 3ODYX 3QZFA 5C8KA 3Q04A 3PLSA 3GU8A 3ZCLA 4LFIA 2WTIA 4NKAA 3MY5A 3E7OA 2C5VA 3KK9A 2C6EA 2JIIA 4NJDA 2XKFA 3OTUA 4YLKA 3LCSA 1YWRA 3P1AA 2GHLA 2QKWB 1LEZA 3KB7A 5AUVA 3ROCA 4BL1A 5AWMA 4FGRA 3NNVA 3RBWA 4DT8A 3LM5A 5FTOA 3F9NA 4JQ8A 4ITHA 4G3DA 5I9WA 1OBDA 3OEZA 4B6LA 3R8PA 3AMYA 2QKRA 3JYAA 5CSVA 5AAEA 2J9MA 2GS6A 2QG7A 1Q8TA 3V6SA 4I1ZA 2YFXA 3LCDA 2G9XA 1YI4A 2W5BA 2YM6A 3DGKA 4S30A 4WG5A 3OXTA 2GNLA 1W8CA 3SRVB 4YZBA 4FUXA 2W5AA 2XB7A 4BGGA 3C4EA 2I40A 4GYGA 3MB6A 2VX0A 3QZHA 4EC9A 1E9HA 4S32A 4F1TA 4HVHA 3UOLA 5GIPE 3KF4A 4TT7A 2R3QA 2GQSA 4W8EA 4CRLA 3LKMA 3UZRA 5EG3A 3MTFA 1WCCA 1J1CA 2XIRA 5DR9A 3QWKA 5KX8A 4KRDA 1YWNA 2VTHA 3MYGA 4IAIA 5CANA 5FP6A 2PHKA 4J97A 5ANGA 2V55A 5TF9A 1SNXA 3QA8A 4FSZA 4ONAA 4AA5A 4PDYA 1APME 2OSCA 3QX4A 3VHKA 5FBOA 4WUAA 5BNJA 2VUWA 4K8AA 2YM3A 4CMTA 4RA4A 5AUXA 1GIIA 4J8NA 4D9UA 3AC3A 3FMJA 5LCKA 5KUPA 1T46A 4QMVA 4KA3A 1Q24A 4NU1A 4YNOA 4E6AA 2QODA 3KKVA 2ZM4A 3R8MA 4HZSA 2W1CA 2P33A 2YHVA 3DTWA 1OKVA 3H4JA 3Q4UA 4Z9LA 4NTSA 4H36A 1WBPA 2EUFB 4RIYA 5BYLA 1IEPA 4TNBA 1SM2A 4RX7A 4FSNA 4RZVA 5DH3A 4V04A 3FMNA 2QOFA 2GDOA 4GFMA 3RVGA 3VNTA 4UX9A 5IQGA 2E9UA 3HA8A 4ZSAA 1Q8WA 3A7JA 3IG7A 3EOCA 4IAAA 1BX6A 5CAVA 3LFBA 2HENA 1R3CA 1JPAA 1YVJA 3A60A 5IA2A 3K54A 3L9MA 3NDMA 3EL7A 4N70A 4XHKB 3VWAA 2UV2A 3G51A 4EH6A 3DBDA 4K33A 4TRLA 5EOBA 5CT0A 3FWQA 4HGTA 1JSTA 2AUHA 2CLQA 3FSKA 3UQFA 3QQLA 2CGXA 1JBPE 3K3JA 3RNYA 4M3QA 3FPMA 4LRKA 4DEAA 5CF6A 4R7BA 2JGZA 2JIVA 5HOAA 3RGFA 1WBNA 2R3JA 3U8WA 4EYJA 5ICPA 3G90X 5L8JA 3QXOA 4NIFB 2VZ6A 4CTCA 3DT1A 3MH0A 3FYKX 4QYHA 4WRGA 4FTMA 4XOZA 2ZB1A 2XJ2A 3IPHA 3KULB 2WMUA 5HCZA 4B7TA 4BZOA 3GOPA 3GCQA 4OGRA 5CVFA 4DEIA 4V01A 3UZTA 4N57A 5LVMA 1CM8A 1JLUE 3OT3A 4FTRA 2G01A 3IO7A 1CKPA 3RHXA 4OTFA 2R2PA 3LFFA 2XF0A 4EWQA 1OUKA 2BDFA 3F88A 3QCXA 4XV1A 4AA4A 4PMMA 5AUTA 2OJ9A 3G33A 5CYIA 4CEGA 5CSXA 4BYJA 5FTGA 1CDKA 4OLIA 4QMZA 4DYMA 2XIXA 3BQRA 4AT4A 4D4RA 4DTBA 3F3TA 2W0JA 2WQMA 3HMOA 3PE2A 3FMKA 3W2RA 3NYVA 2BMCA 3VBWA 2C69A 3TM0A 5AIKA 3AGMA 1JOWB 4YUQA 4HW7A 4J95A 5CWZA 3EFKA 2AYPA 2JD5A 1JKTA 3L8XA 4HPUE 3SX9A 4IDTA 4EC8A 3T8OA 3EFWA 3F3WA 3H9FA 3Q9WA 5JN2A 5HTBA 3ZLYA 1Y6BA 2YZLA 3NW7A 4GIIA 3DJ6A 4GUEA 4HOKA 4G5PA 2CNVA 3U4WA 4HNFA 1H07A 4S31A 3WE4A 2B53A 2LAVA 4A4XA 4EHVA 3RCJA 2PE1A 3POZA 4JX7A 3BHTA 3I7BA 2VAGA 4TTHB 3UC4A 4DH8A 5HORA 3FLWA 5DI1A 3LCTA 4IWOA 4OTDA 5HG7A 4YGAA 4NCTC 4G16A 2OH4A 4XG4A 3VS3A 1L8TA 5B2MA 2BRHA 2IZTA 2ITUA 1H28A 3W16A 4OTWA 4JDHA 3L9LA 5LMKA 2R4BA 2YACA 3R71A 3VS7A 1SNUA 1UKHA 5BVEA 2Z02A 1L3RE 2DQ7X 5CEPA 2GS7A 3GU5A 3OCTA 1M2RA 3EQGA 3Q32A 4IAKA 5CZIA 2XEYA 3HV7A 4R6VA 2C6OA 2WGJA 5C27A 3L8PA 4FKWA 4WD5A 1FBNA 3EIDA 4IFGA 2X7GA 4J71A 4FKGA 4C3RA 4EK6A 4EHZA 5M06A 5IMXA 4AQCA 5BVOA 4E5AX 4M97A 3LM0A 4I92A 4JI9A 4PDOA 4RVLA 4JBOA 2GMXA 2GQGA 5HG9A 1VZOA 4MX9A 3REPA 2HY0A 3A7HA 5EQEA 3WZEA 4LI5A 3ROYA 3ZEPA 2J2IB 1R39A 2BVAA 4PX6A 4EQMA 1YDSE 2CGVA 4X7QA 4U9AA 3DKCA 4L44A 4NZWB 3M42A 4LG4A 3T9TA 3SG8A 4DGLC 3QTUA 2V7OA 5DN3A 3U6HA 4G9RA 4H39A 4L68A 1YXXA 3Q4TA 4DN5A 5AR4A 1YXTA 4PDSA 4I5PA 5EM7A 4BI2A 1UNHA 2VWXA 2C3JA 4AW1A 3SRVA 2ZV8A 4WKQA 1ZOHA 4ZLOA 2WMRA 2E2BA 3C4FA 1GOLA 4JOAA 4CFWA 3NEWA 3BE2A 2ITXA 1WBVA 2VTAA 3ACJA 3AT3A 4M12A 4JBQA 4RLKA 3UNJA 5IQBA 3F82A 4XG8A 4I20A 5A4QA 2GNIA 5E8ZA 5JQ8A 1Y91A 3RJCA 3BYSA 3OBJA 3F2RA 3QWJA 4B99A 3B2TA 4FV9A 4UXLA 4IMYA 4FZFB 2EWAA 2HIWA 4NH1A 5CU4A 3R22A 4RFZA 1H1PA 2R3GA 4S33A 3DBFA 2WAJA 3DJ7A 2ZDUA 4CFNA 4X2GA 3WF5A 3ATSA 3VF9A 1OL5A 5G6VA 3DLZA 3D5XA 3GEQA 2WMXA 3I5NA 3DPKA 5B2LA 2O5KA 1GZ8A 2YABA 1S9IA 3PZHA 3QYWA 4JAJA 4RVTA 2FSOX 4XG2A 3RNIA 3QA0A 3O17A 1VEBA 4G34A 2J0KA 5DHJA 5IA5A 1RDQE 3FLQA 3QAME 4E4MA 3V3VA 5M55A 5C1QB 3FUPA 5LVLA 3CJGA 4USDA 3FEGA 4NUSA 4I0TA 3NWWA 4DBXA 4FF8A 5E8WA 3TKIA 1ZYCA 2R0IA 2BAQA 4W8DA 3VRYA 3I4BA 3AD6A 3IOPA 3BLRA 4QP2A 5CSPA 2YCRA 3QCSA 2YDIA 1LP4A 4KIKB 4EOQA 5IMEA 2R5TA 2HY81 3BYOA 5HNGA 4KABA 1WVWA 3OD6X 5CS6A 4ACHA 4DLIA 5IQCA 2XK6A 2W9FB 5ANKA 3KL8A 1K9AA 1REJA 4D2VA 3A61A 4MD7E 5A3XA 4FX3A 3RPOA 3NS9A 3C0GA 3LQ8A 3QZIA 4RBLA 4XLIA 4ZSEA 4YZ9A 4DTAA 4DEGA 3WF6A 2QHMA 3VJNA 2A0CX 4NIFA 3KGAA 4WSYA 3TTIA 5M08A 4RZWA 4TY1A 4YSJA 1ZARA 4JBPA 5CU3A 4O82A 1J91A 3KULA 2DUVA 4BTKA 4E8AA 5JRQA 4MQ2A 5IA1A 1DAYA 2R0UA 5I4NA 2WNTA 5HNBA 4QYEA 4YU2A 3QFVA 1OZ1A 4FT7A 4UYAA 5H9BA 5EW9A 4BCKA 4BTMA 5E90A 4C4IA 3DDPA 2VTIA 2BILB 3CEKA 4PTGA 1NT2A 1E1VA 2Y4IC 1M52A 3C4ZA 2X8EA 4U41A 2YIQA 2VWWA 2ITTA 3RK9A 3W18A 4DINA 4QMUA 4RIWB 2WMBA 4FEUA 4FIEA 5BVFA 2W5HA 2VO0A 3O7LD 3M11A 4LUEA 3W2PA 4OBPA 4PWNA 2ZMDA 4JG7A 4AGDA 3PTGA 3ZEWA 4CXAA 4EI4A 4F09A 2ACXA 1A48A 2C5YA 3TV4A 3R01A 4DLJA 5JT2A 5C26A 1OM1A 3K3IA 3UIUA 2EXMA 3FPQA 1SMHA 4PMPA 4PL5A 3VS2A 4C57A 5IQDA 4FV0A 4EEVA 5CI7A 2OZAB 3O2MA 4ZSJA 4E93A 4EH9A 2WB8A 3UDBA 3THBA 4F64A 3UQCA 4TW9A 4A9TA 4L6QA 4FSMA 4ERKA 4IB3A 4JDJA 4BWXA 5F20A 4XG7A 3RZFA 4BDDA 4YJNA 2XP2A 4BC6A 5CVGA 4V0GA 5A46A 2ZVAA 3DQWA 2CKPA 3PE1A 4JDKA 3DS6A 4MXYA 4JDIA 1FOTA 5ACBC 4OAUC 2B1PA 3CQUA 3CR0A 3EHAA 4M68A 4PMSA 3RTPA 2QOLA 5HD4A 4EZ5A 3E7VA 3KXXA 1GJOA 2W1GA 3FL4A 3N4UA 4HVSA 2C3LA 3W33A 2VO7A 4NFNA 4B9DA 3V51A 4Y46A 2UZLA 2VGOA 4WBBB 2GFSA 2BZKB 4BRXA 2PWLA 4K18A 3CSVA 2PZRA 4F6WA 3IW5A 3NAYA 3ZM9A 2OKRA 3C4XA 2PUUA 3Q5IA 3RZBA 5A9UA 2NRUA 1K2PA 1G8AA 3DFCB 1IR3A 4D0XA 4LRJA 4XS2A 4C2WA 2XM9A 3TNPC 4RRVA 5LWMA 4PDPA 3DXQA 3ZH8A 3S3IA 3L9PA 2IVSA 4ASZA 1U54B 2QC6A 5BYZA 2C0OA 5AR3A 2YLFA 2HYYA 3ZONA 4C4EA 1FMKA 3CPBA 4QQCA 4OTHA 2GHMA 2GU8A 2QOIA 3BGPA 4L45A 2PZ5A 3OROA 2PMOX 3JY9A 4TZRA 3W2CA 4ZLYA 2UZNA 5CXZA 4J98A 5BMMA 2W1ZA 3WF7A 3CGOA 2CPKE 3FYJX 4C4FA 2PU8A 3V5LA 5A54A 3FC2A 3KRRA 4MXAA 3ORZA 3EN9A 4CLJA 3ZRKA 1GZNA 4RFMA 1H8FA 4YJPA 4O7YA 5GJDA 4W9XA 4TYEA 4ACCA 3GU6A 5IQAA 1PKGA 2BROA 3ERKA 4QP8A 3NW6A 4K11A 1BI8A 4IZYA 4MXXA 5HG8A 1TQIA 1URWA 1OKWA 5AP4A 3LXKA 2Q0NA 2OH0E 2OG8A 1FQ1B 3QHRA 4WT6A 5CNNA 2XKEA 2BRGA 3TG1A 4CGAA 3IOKA 1IRKA 2Q0BA 5DGZA 2Y7JA 5CALA 4I21A 4JIKA 4BDEA 1B6CB 1ATPE 5CTPA 2E9OA 2XK3A 1Q8UA 4C3FA 3TNHA 3FKLA 4F4PA 2VO3A 4CQEA 2ESMA 4IAZA 2Y8OA 3V8TA 5KO1A 3R7IA 4QD6A 5HICA 3F3ZA 4FSUA 4QYFA 5IU2A 3E8EA 4FOCA 4BDGA 5BQ0A 5EHOA 5H8BA 2OJGA 5F9EA 5TOZA 4EOMA 3V01A 1Z5MA 1HCKA 4QNAA 3LJ0A 1Q97A 3F3VA 4BCOA 1OITA 5JGBA 2I0YA 3QX2A 4YZDA 1ZOGA 2QOKA 3GFEA 4EL9A 4IDVA 2JBPA 3MSSA 3DTCA 2ZV9A 3VN9A 2XNGA 4EOPA 4IHPA 1OGUA 3NVKI 3VS0A 3RPVA 3GQIA 3Q60A 3VBQA 1KE7A 2J0JA 4KIKA 2Y6OA 4IZAA 5EI2A 2SRCA 4RIOA 2F7EE 1YOMA 4J96A 5TT7A 3U6IA 3BHYA 3SQQA 1WVXA 3C13A 2V62A 2WMAA 1OVEA 4EZ7A 4D2WA 3MVLA 3LFCA 2XRWA 1E1XA 1YDRE 3PY0A 4W4YA 5F4NA 3TJCA 3ZZEA 3ZO1A 4CRSA 2UVZA 3SG9A 3PVBA 4QQJA 4FKJA 3SC1A 4RJ3A 3WBLA 4D55A 3DKFA 1XH9A 3QKLA 4L67A 4O0SA 4AZWA 2JEDA 5BUJA 3R7YA 3A62A 1PXPA 5IQHA 5J95A 3ORKA 3HLLA 3BELA 2HZ0A 3PG1A 3WYXA 4JRVA 1ZMVA 1Y6AA 2PE2A 2WTDA 5FD2A 4ZJIA 4CV9A 4QPMA 3FKNA 1V1KA 3H30A 3D14A 2C1BA 2C5OA 2IW6A 2BIKB 3CY2A 4HJOA 2OXXA 5KZIA 3ZSHA 3GVUA 2XYNA 1B38A 3CQEA 2ZV2A 4IM3A 3R1NA 4KBAA 4RIWA 4X0MA 5D1JA 4D0WA 1LR4A 3ZM4A 5CAOA 5EM8A 2XS0A 2G2FA 1ZYDA 3E92A 3PP0A 4JQ7A 4QYGA 5J9LA 2YIXA 2NNWB 3NW5A 1O9UA 4QRCA 5CEIA 3DAJA 5CSWA 2O8YA 4DAWA 4R3RA 2ITYA 4KKGA 4O21A 4BCHA 1YW2A 2HZIA 3H9RA 3IKAA 3P7AA 2OZAA 4RA5A 3EQBA 4IAFA 1Q61A 3PVWA 3ZO2A 4AGCA 3LMIA 4IB1A 2J0LA 4PL3A 4IXPA 2WELA 2AC5A 3HECA 4D4VA 3MBLA 2QG5A 2BRNA 3I60A 1MRYA 3AMAA 1H26A 2FO0A 4P4CA 4ZJJA 1OIQA 3PXZA 2P4IA 4MD9E 4Y8DA 3CCNA 2C6KA 2WTJA 4GFOA 4D5KA 2PSQA 3Q6UA 1W84A 1KV1A 2H8HA 4G6LA 5DLSA 4CFMA 4I3ZA 5HEZA 4F9CA 4O38A 1H1SA 4YNEA 3MWUA 3HYHA 4Y95A 1Y8GA 2E9PA 2WIHA 3ZS5A 5AFVA 4DE4A 4WG3A 3AC8A 4QTCA 1XH8A 3SA0A 4PRJA 4E3CA 4O86A 4FKRA 2HELA 4U40A 1VYWA 4C3PA 4JS8A 2WPAA 1Q3DA 1GZKA 5EQYA 2VU3A 2XRUA 4E4LA 3VUTA 3N4TA 4F9YA 3U87A 5A4EA 3HAVA 1WMKA 3NLBA 3FHRA 4R5SA 4YZMA 3DJ5A 5IUIA 4DG2E 3ZXTA 4OW8A 1U54A 3QU0A 3H3CA 3ENHA 4YJTA 3WZKA 5IA3A 4O7LA 3CD3A 3LLAA 1B39A 5KHWA 5FEEA 2WOTA 4CYIA 3DB8A 4CLIA 3W1FA 2BAKA 4FZ7A 3LVPA 2XCHA 3R1QA 2HZ4A 4YSMA 3IW4A 5HCXA 5IDNA 2WO6A 5K0XA 3LHJA 4JRNA 2A27A 2IZRA 2ZOQA 4MNEB 5HKMA 3FC1X 2QR8A 5T6KA 2Y6MA 4P5QA 4E26A 5E7RA 2ZM1A 3I5ZA 5LMAA 3SOCA 2PVRA 1H01A 3LCOA 3UYTA 1M14A 5AUWA 1PXIA 4JAIA 4L7SA 1NY3A 2UW3A 4AWIA 4L3LA 5HO6A 4LL5A 3PIXA 3UVQA 3QKMA 4F9WA 3F2AA 2YZAA 3CKWA 3JPVA 3BE9A 3VW6A 1H0WA 5H8GA 5AP0A 3CXWA 2VTJA 5HESA 4G9CA 4L8MA 4XEYA 2CHLA 2W1EA 2YM4A 4EHGA 5A4TA 3AC4A 2OZOA 5IKWA 3NUSA 5HU3A 4YO6A 3DY7A 5EFQA 2IG7A 2UZEA 2R3PA 4MXZA 3RALA 2QQ7A 3ORNA 2ZYBA 3BCEA 3DNEA 2IVVA 4WOVA 3TNIA 3A7GA 1JSVA 4D4SA 4QMPA 3ZRMA 4EYMA 4ITJA 2UW8A 3ACKA 3EQDA 3L9NA 2O0UA 3OCGA 1ZMWA 2FSMX 5B0XA 3HV3A 3F5GA 1SYKA 3I0OA 4RJ4A 3B2WA 2QI8A 2Z7LA 3Q2JA 2VWIA 2PK9A 4F63A 4ZTLA 3NYXA 4ANBA 3PP1A 4XV3A 5AUZA 2RIOA 4MH7A 3ZMMA 4BGHA 1V0PA 4IZ5A 2EXCX 5CX9A 3TUDA 3MN3A 4IEBA 4DFNA 4NSTA 4QP7A 3R9RA 3GC8A 1KE8A 5HBHA 4KAOA 4C7TA 3QF9A 2QR7A 4DA5A 3R73A 1PMNA 3R21A 1BUHA 1P5EA 2E9VA 1V0BA 4YLLA 2CCHA 4X3FB 4EOOA 3UGCA 5DYJA 1WVYA 1O6KA 2W06A 4KBCA 4YBKA 4BI0A 3RWQA 3SV0A 5DNRA 2OO8X 3SXRA 4F0IA 4L7FA 4UMQA 3ZBXA 4R8QA 4AN2A 2IJMA 5AV4A 1W0XC 4BCMA 3ATTA 4J1RA 3IW6A 1H25A 5GINE 3FZRA 2IW9A 1VJYA 4D2RA 5J7BA 1CMKE 1WBWA 4LV5A 5AA8A 2VNYA 3NSZA 4A9YA 3R7UA 3BI6A 4GYIA 2W4OA 4BCJA 1LEWA 2JDRA 4IH8A 2FYSA 3PSBA 4TKSA 5M4FA 4O0YA 3LJ2A 1UWJA 4JBVA 3PUPA 4PV0A 2UVXA 5HVJA 4F70A 3Q4CA 4FBXA 4UWCA 2OFVA 3R83A 1UU3A 5CSHA 4D9TA 4W4WA 5BUIA 5J1VA 3H10A 3UG1A 3UOKA 4P5ZA 4H1MA 4QP6A 4WNMA 3HUCA 4DGOA 4FIHA 4MTAA 4XNEA 2XBJA 5I3OA 2KTYA 3UO5A 3RKBA 1H08A 4BBMA 2XK4A 3ORPA 5JQ5A 4D28A 2PVHA 3W55A 5DBXA 3CTJA 3H0ZA 1WZYA 4D1XA 4QOXA 3QRUA 4TWCA 4B8MA 4BBEA 3NCZA 1VR2A 3NX8A 3MFTA 4E6QA 1MRUA 3AT2A 4YJSA 1LUFA 3KK8A 3TDWA 4FTTA 1NXKA 2CMWA 5AM7A 3ZLWA 4C4HA 1Q8ZA 4WHZA 4F7NA 3V6RA 4BTJA 4KB8A 2F4JA 4PPAA 2QCSA 4KD1A 5D7VA 4PTCA 1CTPE 1GIHA 1QMZA 2F7XE 2IZUA 2OIBA 5EKNA 4DHFA 1IG1A 2F2UA 2QLQA 4A4LA 2UW0A 4QT1A 4UYNA 1SVEA 2PULA 2CDZA 4AN3A 1QPCA 3NNUA 3V5PA 3WYYA 4PPBA 4FV8A 2GTMA 4DG0E 5ANIA 3BEAA 5J5TA 4FZDB 5CY3A 3FXXA 4GMYA 4O0VA 3LFQA 1YHVA 1TQPA 4EH5A 1KOBA 2J90A 3A7FA 1Q4LA 3NNWA 2W99B 4AT5A 5HZNA 1J3HA 5HD7A 3O50A 4ERWA 1TQMA 2UW7A 3KY2A 2ETKA 4LUDA 2B9HA 5A4LA 4F7LA 1M17A 1OPLA 1Q8YA 4UV0A 4PNIA 4O1OA 3IONA 3PPKA 1ZYJA 3T3VA 2X2MA 1ZOEA 3ENMA 3HRCA 3L8VA 4YLJA 5JKGA 2BFXA 2YIWA 4A07A 5LWNA 3G9NA 4OR5A 4IC7A 1Q41A 3CQWA 4I24A 3FZOA 2CGUA 4FT0A 4O91A 4I22A 4C33A 4C35A 4ZS0A 1KOAA 3FLNC 5CLPA 3VS4A 4ASEA 3U6JA 1KE9A 1OIRA 5ANEA 5AR7A 2OI4X 4AS0A 4GU6A 5EYCA 4E73A 3GQLA 3TNWA 4KSQA 2X81A 3KMMA 4IFCA 3F5UA 4P7EA 4XH6A 4YP8A 2W17A 5K9IA 2OFUA 2XNEA 2IVUA 2P0CA 3FLYA 3NCGA 5KBRA 3D7ZA 4NM7A 2WQOA 3SKCA 4QQTA 3LFAA 4ZOGA 2QLUA 4H58A 5FDXA 5H8EA 4CD0A 3O51A 4M15A 5HE3A 4CT2A 4MNEA 2HXLA 4EOJA 3MDYA 2WOUA 2A4LA 4IJPA 5KBQA 5EHLA 3PFQA 4UEUA 1XO2B 4BY9E 4G2FA 3VBXA 3QGWA 2YDKA 4X2KA 3TCPA 2HZNA 2V22A 4I6BA 2ZV7A 2AC3A 3OTVA 1MUOA 4I5HA 4O2PA 5TO8A 5JZJA 4NT4A 4EJ7A 1RJBA 3EN4A 5ACKA 3OXZA 5HG5A 5BVDA 2B55A 4RG0A 4CV8A 4MXCA 4CSVA 4F7JA 5BYYA 4FL1A 3A8WA 4LOPA 4NM3A 4DT9A 2BRMA 2QOQA 4AP7A 3QKKA 2C4GA 3TTJA 1P4OA 4MQ1A 4EK4A 5IA0A 4IX3A 5DIAA 5AP3A 3QL8A 5AX3A 2ONLA 4H3BA 4CVAA 2VTLA 5AA9A 3R7GA 3HZTA 5FEQA 3W8LA 1R78A 5A6OA 3NVMB 3GBZA 3OC1A 4XRJA 3ETAA 2Q83A 1XBAA 4Z7HA 1Y8YA 3POOA 5KZ0A 4BF2A 4CFXA 5E4HA 4O7ZA 2R7BA 1AQ1A 4O27B 2YIYA 4PPCA 2RFEA 2A2AA 3JUHA 3CS9A 4FSWA 3VIDA 4DH1A 3ANQA 1DS5A 3GNIB 4FV1A 2RF9A 4X3FA 3C7QA 3RPSA 4S2ZA 3VUIA 2F57A 4FV4A 3ID6C 2GFCA 4QP1A 5HBJA 3RK7A 1STCE 3RHKA 5CI6A 1KV2A 4FTAA 3E8CA 3D5UA 4MBIA 4KSPA 1Q5KA 4GVAA 5I9YA 5J9ZA 3QD0A 2B7AA 5CASA 4ZS4A 2GNFA 3EN6A 4GJ2A 2BUJA 4ZTNA 4FVRA 3R8LA 4EONA 5IF1A 3PA3A 5IQIA 2QOBA 2X4ZA 4FSQA 3KREA 3OF0A 4K2RA 5HX8A 4GL9A 4Y5HA 2GNJA 2W7XA 2YAKA 4R77A 2WTKC 3KXZA 5HX6A 1H00A 2XBAA 3HP2A 2XK8A 4FKOA 1ZYSA 3PG3A 2PVLA 4IM0A 4GS6A 3MFSA 2PUPA 5AIRA 3P7CA 4AZEA 4J53A 2YIRA 1MQBA 4U7ZA 4QNYA 3V5JA 4CT1A 4DGMA 4EOLA 4F1OA 2R64A 4LYNA 5BVWA 4ZTQA 4BZDA 4TL0A 4UWBA 4EK3A 3QCQA 3NUUA 4RVKA 4Z16A 4DH5A 4BDAA 4DEEA 4QPAA 4JR3A 4UY9A 2XK9A 3DFAA 3EJ1A 1R0EA 2BTSA 5I9XA 5JFWA 3NYNA 3MVMA 2YM5A 3FLSA 3HRFA 4GJ3A 4M69B 4QMOA 3TV7A 3UO6A 2CJMA 3F7ZA 3VS1A 3GT8A 1CSNA 4UMPA 4EH8A 3KU2A 4EWHA 2O2UA 4U3ZA 2XNNA 5CENA 3HVCA 3SD0A 5C9CA 4EH2A 2OXDA 3DCVA 4EOKA 3QCYA 2Y0AA 1H1QA 4R1VA 5AMNA 5JFSA 3OOMA 4WO5A 3EKKA 4D1ZA 1JQHA 2XM8A 4E1ZA 4RX9A 1OPKA 2HW7A 2VTSA 4BIBA 4E5BA 2X7FA 2GCDA 3DB6A 4G3EA 1FVRA 3FQHA 5ITAA 4E6CA 4QYYA 4IW0A 2GNHA 5J8IA 4JG8A 4FI1A 4FZAB 1ZZLA 4FTKA 5HIDA 2IN6A 3CY3A 4FKSA 1PXKA 1UU9A 1YI6A 5L6OA 1F0QA 5LOHA 4RJ5A 3NNXA 5M57A 4LRMA 1S9JA 2YISA 3PJ2A 5IG1A 4FEWA 4BCNA 2ERKA 2WTVA 1YQJA 2XNOA 3ITZA 4O7NA 3OHTA 3IQ7A 4XBRA 5E8XA 4ALVA 1OMWA 4GVJA 2YWPA 3O8PA 3FQEA 1REKA 3OW4A 4DFUA 2F9GA 4IE9A 3ZC6A 2VTQA 3QQKA 5BUEA 3AC5A 3I79A 4WG4A 3KXMA 3CTQA 5K5NA 5GIOE 4G1WA 5E1SA 3DK6A 3Q2MA 4U6RA 1WFCA 1WAKA 3VHEA 4Q5EA 2BDWA 2YN8A 3LQ3A 2IZSA 3ZSIA 1XBCA 2VX3A 3IS5A 4U80A 3IECA 5EYMA 2IPXA 2WMVA 3BGZA 2PVJA 2XEZA 3W8QA 4ZY5A 2P2IA 3TJDA 5TR6A 4I4EA 4UMUA 5E91A 3MB7A 5AAGA 3CLYA 4XP2A 2RGPA 3KC3A 4CKIA 4E20A 4HVDA 3RPRA 3CKXA 4GUBA 5ETFA 5FM3A 4ALUA 2R3FA 3UTOA 3DLSA 1ZYLA 3QUPA 3D83A 4ZTRA 4BIEA 4BKZA 3N4VA 4AG8A 2YITA 4B8LA 2ETRA 3D0EA 4RJ8A 4D2PA 5HIEA 4QMTA 2Z7SA 3VO3A 1J1BA 3SW7A 3QTWA 5L8LA 1IAJA 3ORIA 5KKRC 4CCUA 1SVHA 3HA6A 3MI9A 3CD8A 5ETIA 3F3UA 3O0GA 1I44A 4JX3A 5EKOA 3R28A 3LIJA 2PZPA 3TV6A 3ZU7A 4FYNA 5KCVA 5F1ZA 3QQHA 4LGHA 3QRIA 3AGLA 3FMLA 3ORMA 4NWMA 5K4IA 4OT5A 5JRSA 5D9HA 1UNLA 3DKOA 3GFWA 4RWIA 4MWHA 1Q62A 4BHNA 3UZPA 2C0IA 4A4OA 3KXNA 4MVFA 4ZXTA 3BPRA 1IASA 4M13A 4BKJA 1H1RA 1PMUA 3COMA 4FZ6A 4EOSA 5HE2A 4UMTA 2J5FA 3QRKA 4L53A 1M7QA 2XUUA 5CEMA 3ORXA 3PIYA 2X2LA 4KIQA 1DI9A 4QP9A 4HYUA 2VRXA 4W4VA 3FKOA 4RQVA 3VF8A 3W2SA 3QD2B 2YERA 5IA4A 4QTBA 4H1JA 3DU8A 4NM0A 2J50A 3II5A 3VQUA 5LVNA 3CE3A 3ORLA 2C6TA 3EFJA 3ZUTA 2H6DA 5CEOA 5EK7A 4FK3A 1P4FA 3QYZA 3R1SA 2G15A 4ZTHA 4DH3A 3RCDA 3U55A 5CEQA 4OTRA 4ZK5A 4F9BA 2BDJA 4NK9A 1JSUA 1FMOE 2XMYA 3LCKA 3UP7A 4K0YA 2VTTA 4LOOA 4QMYA 3RAIA 1URCA 4F6UA 3FLZA 2FSTX 3S95A 2DS1A 3QRJA 2QONA 3EQHA 4YHJA 4AGWA 3ALOA 3AMBA 2UW4A 2V0DA 5DRBA 1PXMA 2WMTA 4I6HA 4QMLA 5DT4A 3VBVA 2BTRA 4IC8A 3QD4A 3FI4A 4RWLA 2X8DA 2XVDA 4XYFA 3LMHA 4O84A 2FB8A 2UVYA 1BLXA 1ZAOA 3OBGA 2BPMA 3QTQA 5EHYA 2VTMA 2VX1A 3FZPA 4EQCA 5JFVA 3R0TA 3VS5A 1H27A 5LMKC 4B0GA 3ZO3A 3V8WA 4FKQA 4UBAA 3ZZWA 4Z55A 4DFBA 4BDKA 5HIBA 4AT3A 3GB2A 4JL9A 4M69A 2QVSE 3KA0A 5CVHA 4YTHA 2QU6A 3NAXA 4MYGA 3WF8A 5CF5A 2ONLC 2XK7A 3K5VA 3R9DA 3ZFMA 4RIXB 3PSDA 3GCUA 4I23A 2C68A 3UPXA 2XIZA 1XH4A 5M07A 4EUUA 5FQDC 3R8ZA 1OECA 4ORKA 2PVKA 4AOIA 5HVKA 1KUTA 4BI1A 2I7QA 2C6IA 3HMMA 2XJ1A 4FTNA 4FA2A 2Z8CA 4IVCA 3LFNA 3CIKA 4HGLA 4D2SA 3QRTA 3EFLA 1P2AA 3K5UA 3JVSA 3W10A 1JKKA 3KRWA 1OBGA 1F3MC 3C5IA 4L3JA 2PTKA 1MQ4A 5IH5A 2XJ0A 5D7AA 4ARKA 3BBTB 2C3IB 3MPAA 3R30A 4Q9ZA 2OJIA 4LOQA 3OEFX 4R1YA 2Z7QA 3EYGA 3FI8A 4GCJA 3C0HA 3I6UA 4I93A 1R0PA 1XKKA 4FVPA 1OUYA 4F99A 4U0IA 1Q99A 3MIYA 3ODZX 3W2OA 4EH7A 4BWKA 3R8VA 1FVTA 1XR1A 4ZZMA 1UU8A 3WOWA 4OAVB 4FYOA 4A9RA 5GJFA 3P7BA 2YA9A 3FV8A 4K9YA 3UC3A 5I9VA 2PVNA 5D12A 1U46A 5A14A 4ID7A 1FGKA 3R2YA 5FGKA 2JDOA 3TACA 4TWOA 3U9CA 4BZNA 1PRYA 4X2FA 4HGEA 4I6FA 4Y5QA 3NYOA 3R7EA 1OB3A 3KMUA 4GU9A 2I0EA 5DR6A 4FTIA 5ETAA 3V5WA 1KE6A 2RL5A 4C02A 4O96A 2R3KA 4U79A 1QPEA 2JC6A 3BEGA 3QQFA 3KN5A 3RP9A 3R1YA 2C0TA 4D1SA 4IB0A 3RK5A 3E3BX 3LQ5A 1QPJA 5EW8A 5L2IA 3SXFA 2OXYA 3SXSA 4AXAA 1O6LA 4JIAA 3HAMA 3ET7A 4IQ6A 4AOJA 1W7HA 2P3GX 1IA8A 3BBWA 3OS3A 3KRJA 5GNKA 4AUAA 5FBNC 5FXQA 4JXFA 4QQ5A 2JDTA 3FMEA 2X9FA 1Y57A 3QGYA 4ZP5A 2WHBA 3LW0A 3GC0A 5FTQA 4ANOA 3P23A 4L3PA 3VC4A 5H3QA 4GT4A 5HLWA 4DCEA 5L2SA 3HX4A 4DITA 4GKIA 4RLLA 1U4DA 5L2QA 4FV6A 3BLQA 2R3IA 3D7TB 3HDNA 3L1SA 3P86A 1ZWSA 3R00A 3SVVA 3UIBA 4EH4A 4ZY4A 3TZ8A 4O7WA 4ANQA 5CU0A 4QMNA 5HI2A 3NMUF 3HP5A 4XBUA 4ENXA 2J0MB 3V5QA 3WARA 5L2TA 4XX9A 4CKRA 5CF4A 4TXCA 4KUJA 4HZRA 2Y4IB 4YTFA 3Q9XA 4RC3A 3RWPA 1XH6A 3GC9A 4QMSA 3R6XA 5T3QA 4CCBA 3VS6A 3UNZA 4IZ7A 2WU7A 4G5JA 4YURA 4O2ZA 5HU9A 1WBOA 5HLPA 3LAUA 3U54A 3KVXA 3HGKA 2VTRA 1DI8A 5K5XA 1JNKA 1PHKA 4DBNA 4TYIA 1BI7A 3BQCA 3ORTA 3MVJA 4FEVA 4E4NA 3GCSA 4YTIA 3WE8A 3R9OA 3VUHA 3A2CA 5LQFA 4CZTA 3AD5A 5DWRA 1K3AA 3QALE 5DR2A 4CG8A 3KRLA 4YTCA 4PP9A 4M8TA 3UQGA 2G2IA 4APCA 5JSMA 3D2IA 3ZYAA 5ETCA 5B2KA 3C50A 3UG2A 2CLXA 2X6EA 2C3KA 3ZFXA 3N51A 4DTKA 4FEQA 2YJRA 3K2LA 3PXKA 5D11A 3UJGA 3COIA 4FTQA 4NCTA 5FDPA 3BU5A 1PYXA 4K77A 4F1MA 5L6PA 5C01A 3PJ3A 4ZTMA 3QTRA 1G8SA 3G0EA 2Z7RA 3OMVA 3FI3A 3FMMA 4JQEA 2H96A 3E8NA 4FKPA 3NZ0A 1YKRA 4BB4A 1JKLA 2ITNA 5JZNA 4ASXA 1PXJA 3BHHA 1T45A 3O23A 4QP4A 3KRXA 5L6WL 4FTLA 4GIHA 5DG5A 5HLNA 4O0RA 5LCJA 3QTXA 2JDVA 1DM2A 3MESA 3QC9A 2Z2WA 4ZMEA 4WNOA 2YM7A 2BAJA 4CG9A 4I41A 3EKNA 4TYJA 5CQUA 1OL2A 3O96A 3AT4A 5AV1A 4ZSLA 5FRIA 2XH5A 4F08A 2UUEA 3BYVA 3TZMA 2JFLA 3HMPA 4BICA 4HCUA 4D5HA 2OF2A 3F2NA 4EZ3A 4E7WA 4FNYA 4DFZE 2H34A 4I5CA 4TNDA 4GK3A 5M51A 4C58A 4Y73A 4X21A 1UVRA 4R5YA 3MFRA 1A9UA 3NGAA 3MS9A 5EH0A 5IZFA 4AFEA 1SZMA 3FL5A 3R9NA 5FUTA 4XV2A 4XJ0A 3S1HA 4L52A 4ANNA 4FSTA 4FV5A 4ZSGA 3MH1A 3DXPA 5DE2A 3HMIA 2BIYA 4IBMA 3F69A 1YXVA 4G6OA 4FKIA 5DA3A 3PJ1A 3TT0A 3VJOA 4ACGA 4AZVA 3DZQA 2W1HA 4JJRA 2B52A 3FI2A 2R3RA 3PY3A 4RIXA 4U42A 4C37A 2GTNA 3RMFA 4E4XA 3LE6A 3MH2A 3SHEA 2UZTA 2RFNA 4BCGA 3TWJA 4ALWA 3NR9A 3KF7A 1KWPA 4W4XA 3COKA 5GZ8A 5KNJA 2CSNA 1SVGA 1UU7A 4OBQA 4GFGA 2VN9A 3E8DA 5L2WA 4I94A 2H9VA 5M4IA 5F95A 5EI8A 1BL6A 1W98A 4NFMA 2BKKA 2QU5A 4XUFA 3TXOA 5IEYA 3DXNA 4L9IA 3V04A 3TIZA 2VO6A 2CKEA 4YPSA 3BRBA 5J1WA 3P79A 4O81A 5KMKA 4FL2A 3BIZA 5EYDA 3WILA 1XHAA 1U5RA 4HPTE 2CNQA 3DAEA 3QTZA 4U81A 3E5AA 4DCAA 3OWKA 2P2HA 2JDSA 3OY1A 4O0XA 4Q5HA 4L01A 5EM5A 5LJJA 4M84A 3F66A 2HWPA 3E63A 3NUNA 4L00A 2JKMA 3CBLA 1YHWA 2O63A 3QUEA 2WTWA 5AAFA 3UO4A 4EHEA 3CGFA 4BGQA 4Q9SA 4QMMA 1NVSA 1NA7A 1OL6A 2J7TA 4O0TA 2Z60A 5LVPA 5E9EA 1VYZA 3MPTA 1GIJA 3QUDA 5KMNA 3GUBA 3PXYA 4M0YA 5TE0A 3PRIA 3HRBA 4N0SA 5FXSA 2X0GA 2PZIA 2VWUA 3HV5A 3C0IA 4KNBA 3S2PA 3S0OA 5GZAA 5IQEA 3UIXA 5JGDA 2EVAA 4AZFA 2BALA 5KMJA 5T68A 3FE3A 4R3PA 3OT8A 3HL7A 4IAYA 4FV7A 4XP3A 4U44A 4KKHA 4DEDA 5J5SA 3QD3A 4ZY6A 2C5NA 4BR3A 3IK3A 4II5A 2F2CB 4IWPA 3U51A 2OBJA 1GY3A 3OOGA 4HYHA 4UXQA 5IDPA 4H3QA 5CQWA 1M2QA 3S4QA 3QQGA 1ZMUA 4AX8A 5AR8A 4BDHA 3QQJA 5KMIA 1M2PA 3ZHPC 2BKZA 4IM2A 1ZY4A 2J51A 2PVMA 5DT3A 3G15A 3PVUA 5C4LA 1Z57A 1FVVA 3EQRA 3VUMA 1KSWA 4AF3A 4CKJA 4DF3A 3OUNB 2B9JA 5AUYA 4BHZA 4ZZOA 4USEA 3PY1A 4OBOA 4FTUA 4JT3A 4FG8A 5D41A 4N4SA 5HO8A 1YWVA 4FK6A 3LLTA 3D7TA 2YLEA 3IDBA 1V0OA 3QLFA 4AE9A 4F6SA 3EZRA 5CAPA 2GPHA 4A9SA 2HW6A 2QOHA 4WBOA 3LPBA 4YJOA 5IQFA 3SOAA 2E9NA 4BDJA 4IANA 5A6NA 4XOYA 4C0TA 4RMZA 3MH3A 3C9WA 4OTPA 2W4KA 3GOKA 2ZMCA 4AU8A 3B8QA 3UOJA 5C4KA 3KQ7A 4RC4A 5CT7A 3AQVA 3EQIA 2PZYA 4DGNA 4EOIA 1J7IA 3QHWA 3R02A 4ANLA 3TDVA 5HTIA 3D5VA 1EH4A 2RG5A 3NUPA 1AGWA 4BDFA 3U9NA 4Y85A 4PP7A 3MA6A 2UZBA 5GZ9A 3BX5A 1BMKA 3BLHA 5M44A 2WQNA 4O7TA 4C36A 1GAGA 1GZOA 2HWOA 2R7IA 3SDJA 5FWKK 2CKOA 4CQGA 5IH6A 3TZ7A 4OTQA 4WSQA 5AP7A 3PIZA 3DOGA 3IGOA 3BHVA 3AC1A 1FGIA 3G2FA 3DV3A 1QL6A 3HNGA 5E8UA 2GQRA 5AX9A 2WIPA 3UOHA 4TWNA 2WTCA 4J7BA 1J7LA 4O7SA 4LGDA 4XLVA 2BR1A 2XYUA 3FY2A 3FAAA 4FODA 4R7IA 5AP5A 3DK3A 1YXSA 4YC6A 4O6LA 2OJFE 2V5QA 4EK8A 4BYIA 4FOBA 4WNKA 4MF0A 1UKIA 4FMQA 4DEBA 3QXPA 4DEHA 3LOKA 2BFYA 2JKOA 3FQSA 1XBBA 2ERZE 2V7AA 3FZ1A 4NTTA 3Q9YA 5BPYA 3KFAA 5IISA 2FH9A 2JKKA 3QZGA 3UNKA 5M53A 2VNWA 3PA4A 5FXRA 5B7VA 4QMWA 2W05A 2VWYA 3FXZA 2ZDTA 5AP2A 4LM5A 3AC2A 3HMNA 3VAPA 2JKQA 5GJGA 2B0QA 3M1SA 5DRDA 2UZDA 3WF9A 1O6YA 3DZOA 5HE0A 5HO7A 2CGWA 4LMNA 1PXNA 4F7SA 3PLAE 3G0FA 5DEYA 4G17A 4LQMA 4G3FA 1U5QA 4NYEA 1WBTA 3MY1A 4YZNA 4GG5A 4O22A 4HGSA 3GGFA 3ZC5A 1YOLA 2G1TA 4IX6A 4NKSA 2CNUA 3M2WA 2NO3A 3PZEA 4IVDA 5E8YA 3V8SA 5IEVA 2OLCA 1OKYA 3CPCA 4KWPA 1YDTE 2UW9A 4IVBA 3IGGA 4JR7A 3I6WA 2IO6A 4EQUA 4MBLA 1UV5A 3P5KA 5HVYA 4CTBA 3JY0A 4FG7A 2PYWA 3HUBA 1Z9XA 3DQXA 2X4FA 4PNKA 3ALNA 5K4JA 2PMIA 4PQNA 1PKDA 2VWVA 4XMOA 4TPTA 4GV1A 5CU6A 3DAKA 3SGCA 2IVTA 3DKGA 3MY0A 4TN6A 4RSSA 3FBVA 4KBKA 2C30A 4DFLA 3JVRA 5JMSA 2QO7A 2QHNA 5HQ0A 2YM8A 3KVWA 4V0GB 3OUKA 4K6ZA 3ZRLA 4EBWA 4BCFA 5A4CA 5ANOA 4QTEA 4EH3A 2P55A 5EW3A 1OI9A 3HV6A 4DC2A 3LXLA 4IWDA 5I0BA 3ZUUA 4J99A 4EBVA 4EKLA 5M4UA 4KIPA 2BZHB 3MJ2A 4FTCA 4XP0A 1YXUA 2FSLX 4YJUA 2CKQA 3GCVA 4FICA 5DVRA 4I5MA 5HTCA 2WEVA 5I9ZA 1F5QA 3MFUA 4H3PA 4HCVA 4R7HA 4CZUA 2W96B 2YAAA 4TWPA 2PE0A 3H9OA 3HEGA 3AD4A 1YOJA 3COHA 4L46A 1JAMA 2RG6A 3PA5A 4JLCA 2VWZA 4BTFA 2G2HA 4D2TA 2R3OA 3LZBA 3E88A 3D5WA 3BU6A 3WZDA 2JBOA 1U59A 1HCLA 2EXEA 4OT6A 3R04A 3ZBFA 2X2KA 4RPVA 4GK2A 1OL1A 4O0WA 3E62A 3ZO4A 2GHGA 2IW8A 3TKUA 4M7IA 3LFEA 3AG9A 4WA9A 5HHWA
chains in the Genus database with same CATH superfamily
2R3MA 4XG6A 4EJNA 1BKXA 4GRBA 5LARA 3HKOA 4DGGA 4FV2A 1P14A 4FNXA 4TYHB 2OWBA 2CN8A 2B54A 3W32A 4USFA 5AR2A 4MHAA 3TZ9A 4LL0A 3R7OA 4AACA 2DWBA 4F65A 3C5UA 3DK7A 3ANRA 4HCTA 4IIRA 2WEIA 5DEWA 4IWQA 4R78A 2X7OA 2O64A 4FTJA 3CC6A 4IX4A 5IPJA 2JIUA 2X1NA 3EH9A 2BHHA 5J9YA 4TYGA 2BZJA 4AW5A 2XNBA 2WFYA 3MW1A 3AOXA 4L43A 2BRBA 4AAAA 4MD8E 5DMZA 1XH5A 4RWKA 1J7UA 4U3YA 4LGGA 3MIAA 4O1PA 4Z7GA 5E92A 4FIGA 2CCIA 4HVGA 5KMOA 4U97A 1JVPP 2WKMA 4FV3A 4FC0A 2XNPA 5BX0A 1BYGA 3ZDUA 3JXWA 4X2JA 1XH7A 2QOOA 4M66A 2EB2A 4GG7A 5JFXA 4G31A 5CZHA 4ACMA 5J87A 5M56A 5EDQA 3QC4A 3Q4ZA 2QO9A 3O7LB 2O65A 3D2KA 3RAKA 3O71A 3UE4A 2J4ZA 4EORA 4XRLA 2CN5A 1QPDA 3DBCA 2B4SB 5F94A 5JEBA 4MAOA 4FT5A 3IDCA 4O7VA 3FSFA 2A98A 5I3RA 5KMLA 5LXMA 4C4GA 4MUQA 2Y4PA 3FDNA 3H0YA 3R2BA 4RJ6A 3TN8A 3PXRA 3UYSA 2PVFA 5HCYA 4AGUA 1OPJA 3RM6A 3ZLSA 3DDQA 3F6XA 4RQKA 3MA3A 3GI3A 3DBEA 2QOCA 3LXNA 4FR4A 2JAMA 4FL3A 3A4PA 4MCVA 5EYKA 4BDBA 4L42A 4J52A 3ZDIA 3O8TA 3UMXA 2ITZA 2OICA 5L8KA 4M0ZA 1WBSA 2Y9QA 2FUMA 3VUGA 2WMSA 4RT7A 2C5XA 3VQHA 4FEXA 3VVHA 3PXQA 2OF4A 2X39A 3TI1A 4OTIA 3OWPA 3NIZA 5LMBA 4BCPA 2J5EA 3E93A 4RGJA 4LV8A 3P4KA 4O6EA 4WUNA 5HBEA 4RX8A 4DG3E 5E8SA 2R3LA 1X8BA 5C8MA 2VV9A 4YMJA 2XNMA 3EMGA 4GT5A 1H24A 3FHIA 1PXLA 2C1AA 2FGIA 3FY0A 3R7VA 3P08A 1Q3WA 2WMWA 5J7HA 4FIFA 2W1DA 1H4LA 4HYSA 2BZIB 1UNGA 2XA4A 3D4QA 4M14A 5AV3A 3NUAA 4JMQA 1JWHA 3P9JA 4GT3A 4FVQA 4C59A 2O3PA 1DAWA 5HE1A 4CFFA 5FEDA 4BDIA 3PWDA 4YR8A 2OW3A 2ZM3A 3RM7A 4YHTA 4ZJVA 4P2KA 3I1AA 3LFDA 3MVHA 1KE5A 3L8SA 3UVRA 1PMEA 2C6DA 3NPCA 2UZOA 4MBJA 2R3HA 4AE6A 3WIKA 3TKHA 1ZRZA 4KRCA 1XJDA 3Q9ZA 3KEXA 5AP6A 4BBFA 3G6GA 3QLGA 2OU7A 5FP5A 4FGBA 3UMWA 3BWFA 2B9FA 3PRFA 3MGYA 1GNGA 1TKIA 1W82A 4O7RA 4YC8A 4YJQA 1G5SA 4JG6A 4BJJA 5EDPA 3PJ8A 4XG9A 4F0FA 3CJFA 3UIMA 2ITQA 3MPMA 4C2VA 2F7ZE 2HAKA 3EB0A 1RE8A 5CU2A 5AP1A 2PL0A 2ITOA 2RSVA 3EQPA 3BYMA 3KMWA 4G6NA 4A9UA 1OIYA 5AEPA 1PW2A 5CEKA 3I0QA 4FNWA 3TUBA 2YCFA 3PYYA 4MEDA 4NW6A 5AV0A 1YI3A 4PTEA 4X6RA 3BWJA 5E1EA 3BU3A 3PSCA 4U8ZA 4MWIA 1QCFA 3F61A 2XKDA 4PUZA 3QQUA 3AKLA 4FIIA 4I0SA 4P90A 4FE2A 4D4YA 5IEXA 5LVOA 1XMMA 3ULIA 1ZZ2A 2YEXA 3Q5ZA 5E8TA 2A1AB 4BCIA 2VTNA 3P0MA 4DHZA 4ENYA 3Q52A 4OUCA 4CMOA 5EM6A 4KS7A 4QTAA 2IEWA 5DOSA 5EQPA 4EKKA 4QO9A 4YBJA 5L4QA 4CZYB 5KE0A 2UW5A 4FSYA 2QURA 2HK5A 2C6MA 3Q6WA 3Q53A 4R3CA 1FINA 1ZXEA 4PF4A 4Y72A 5FLFA 2X6DA 5DPVA 5I5ZA 3BHUA 3WZJA 1NW1A 4I0RA 5FG8A 3KCKA 4IVAA 3BV3A 3F7WA 4AFJA 5J79A 4O4CA 4CFUA 4U5JA 4XG3A 5DT0A 5D10A 4GSBA 3ZUVA 4UZDA 2ZFYA 3RAWA 1XWSA 3PPZA 3FMHA 3O8UA 3RI1A 3HDMA 2YWVA 4YHFA 4BDCA 1LPUA 4YJRA 3GU4A 4TYHA 4WNPA 1OKZA 4RX5A 3OWJA 1IA9A 2YCQA 3KCFA 4EK5A 2FA2A 3GC7A 2WQEA 4YC3A 5H2UA 4EUTA 4X3JA 4GK4A 3BKBA 3DA6A 2WTKB 3F5PA 2NRYA 4C8BA 3VUKA 3EYHA 4FIJA 5IUGA 5JK3A 5AUUA 3CP9A 5TKDA 3VBYA 4X3FC 2HXQA 3LJ1A 3UVPA 5AV2A 3QTIA 2F49A 1PY5A 1RQQA 4MKCA 4QMXA 4X2NA 3R9HA 2XZSA 4IADA 4BFMA 4C4JA 4UB7A 5HGIA 3IW8A 4NW5A 3LXPA 3TNQB 2WZJA 3RPYA 3I7CA 4FKUA 4I4FA 4ZTSA 4ACDA 2QD9A 3R63A 4O83A 4BIDA 3GCPA 4C38A 4YO4A 2EU9A 3C51A 3E3PA 1FPUA 2UW6A 2VTOA 4FUYA 4ITIA 4IX5A 3WIGA 4CNHA 4D58A 5M4CA 4C34A 4MF1A 4AN9A 4BWPA 3P78A 3VW8A 3N9XA 3A8XA 4JVGA 2PMLX 3JS2A 5C8NA 4N6YA 2VWBA 1CKJA 3WZUA 1BL7A 4Z3VA 4RVMA 2X8IA 3B8RA 3ZOSA 4BVUA 4U45A 2VGPA 3PDTA 2BHEA 4RFYA 2GSFA 2DYLA 1PYEA 4V05A 3EN7A 2PY3A 3FXWA 4FKLA 5EDRA 1UA2A 3PXFA 5C03A 3OFMA 4CMUA 3ULZA 4BCQA 2W1FA 3D94A 4FTOA 5EI6A 3PWYA 4F0GA 3MTLA 4FNZA 2WMQA 2PMNX 2YJSA 3KXGA 4UZHA 3G5DA 4AZTA 1TFFA 2X0PA 4CYJA 4NJ3A 4RWJA 1PMVA 3OY3A 3W2QA 3BL9A 3ZTXA 4DH7A 4QP3A 4IACA 1YRPA 3HV4A 3PVGA 4A06A 3SLSA 5L3AA 2IWIA 3E87A 4GH2A 3RAHA 4ZZNA 5CAQA 4PMTA 4E5WA 4MK0A 1M7NA 5ANJA 3AXWA 2I6LA 1NVQA 1PXOA 2ETMA 3BZ3A 3FMDA 4AW0A 4LMUA 1ZY5A 4UWYA 3E64A 4ZIMA 3RINA 4J8MA 2IF8A 2KULA 2XCKA 3LFSA 3SW4A 1OIUA 2PVYA 3TL8A 4ZLZA 2ZAZA 5HNIX 3EZVA 3OCSA 2QNJA 2XKCA 1ZLTA 2HOGA 3U4UA 3EWHA 1ND4A 5IUHA 4KINA 3UBDA 3TEIA 3A4OX 4B4LA 2W1IA 3IW7A 4PY1A 4G3CA 5BVKA 1OL7A 2PPQA 2X9EA 1NVRA 4LDTA 3TIYA 4ANMA 4H05A 2JLDA 4FKVA 4APPA 2VD5A 4UN0C 3QTSA 2NPQA 1RW8A 1CKIA 4RIYB 3GP0A 3R8UA 2FVDA 5AADA 4M67A 4NL0A 2VTPA 4G3GA 4YJVA 4HYIA 2QO2A 3EN5A 4RC2A 3VBTA 3BYUA 3JR1A 4FKTA 3EQCA 3T9IA 3D15A 4Y83A 4DFXE 3QBNA 3W0PA 5KKRB 4QTDA 3MV5A 3PJCA 3S00A 4KS8A 4N6ZA 2OK1A 3PPJA 3D9VA 3ZFYA 2YDJA 5CF8A 3KXHA 4X6QC 4ZEGA 5ANDA 4XCUA 3SAYA 5G1XA 4O0UA 3GENA 1A06A 4NM5A 3A99A 4W9WA 4WIHA 5K3YA 3UODA 2ITWA 4AA0A 2JITA 2GS2A 3NUXA 2WQBA 3ELJA 5JGAA 1MRVA 3ZLXA 4CFVA 4F9AA 2UZUE 2RFDA 3DNDA 1HOWA 4IJ9A 4KKEA 2XIKA 2XIYA 3F5XA 1H0VA 2ZB0A 2PUNA 2REIA 3OWLA 5I9UA 3IDPA 4FSRA 4ASDA 4DFYA 4Q2AA 3CTHA 2PUIA 3MJ1A 2W9ZB 1MP8A 4K1BA 3FJQE 2RKUA 2C47A 3T3UA 2OIDA 2I0VA 2LGCA 2OGVA 3FZTA 3ZXZA 1W83A 5AM6A 2WD1A 5CXHA 3OG7A 3C4CA 5JH6A 4GW8A 3OVVA 5IH4A 5AR5A 3GXLA 3EQFA 1YHSA 3WI6A 4ANSA 4KIOA 1ERKA 5BVNA 4MXOA 2WXVA 3VRZA 5K0KA 2JFMA 4HNIA 4RJ7A 2XARA 4FT9A 2ITVA 2ZJWA 2B9IA 3BV2A 4QPSA 4BN1A 2BCJA 2I0HA 2EB3A 1AD5A 4E6DA 4NEUA 3G9LX 3NUYA 4A7CA 4FT3A 4QMQA 4I6QA 1PF8A 3OXIA 1H1WA 2R3NA 3OZ6A 4HVIA 4OTGA 5KHXA 3VUDA 5AJQA 4AW2A 3GU7A 2W4JA 3OCBA 4IB5A 3FZSA 2NP8A 5BMSA 3UPZA 2A19B 4BKYA 5M09A 3UP2A 2HCKA 2WU6A 5GHVA 4ZAUA 2YCSA 1I09A 3A7IA 3OP5A 3Q3BA 4FG9A 2C6LA 5E8VA 2RFSA 2OIQA 3V5TA 4S34A 4U43A 2UZVA 5EOLA 4C61A 1UWHA 3DBQA 4XV9A 1G3NA 2OJJA 2R9SA 5KMMA 3BGQA 1IAHA 2J0IA 4WRSA 3NIEA 4C62A 3KN6A 4GKHA 1R1WA 3OW3A 2I1MA 4UALA 3LMGA 3W0SA 4FJVA 2JAVA 5DFPA 3Q96A 5CNOA 5FM2A 3NRMA 4YZCA 4YPDA 1TVOA 3W0QA 4ZMFA 3EL8A 4AZSA 4PL4A 3ZSGA 3G6HA 3VULA 1PJKA 3C1XA 4UMRA 4JNWA 3I81A 2GNGA 2J6MA 3C4WA 4GEOA 2UZWE 1XQZA 2ITPA 3TUCA 1JKSA 4MNFA 5CAUA 3ODYX 3QZFA 5C8KA 3Q04A 3PLSA 3GU8A 3ZCLA 4LFIA 2WTIA 4NKAA 3MY5A 3E7OA 2C5VA 3KK9A 2C6EA 2JIIA 4NJDA 2XKFA 3OTUA 4YLKA 3LCSA 1YWRA 3P1AA 2GHLA 2QKWB 1LEZA 3KB7A 5AUVA 3ROCA 4BL1A 5AWMA 4FGRA 3NNVA 3RBWA 4DT8A 3LM5A 5FTOA 3F9NA 4JQ8A 4ITHA 4G3DA 5I9WA 1OBDA 3OEZA 4B6LA 3R8PA 3AMYA 3O5AA 2QKRA 3JYAA 5CSVA 5AAEA 2J9MA 2GS6A 2QG7A 1Q8TA 3V6SA 4I1ZA 2YFXA 3LCDA 2G9XA 1YI4A 2W5BA 2YM6A 3DGKA 4S30A 4WG5A 3OXTA 2GNLA 1W8CA 3SRVB 4YZBA 4FUXA 2W5AA 2XB7A 4BGGA 3C4EA 2I40A 4GYGA 3MB6A 2VX0A 3QZHA 4EC9A 1E9HA 4S32A 4F1TA 4HVHA 3UOLA 5GIPE 3KF4A 4TT7A 2R3QA 2GQSA 4W8EA 4CRLA 3LKMA 3UZRA 5EG3A 3MTFA 1WCCA 1J1CA 2XIRA 5DR9A 3QWKA 5KX8A 4KRDA 1YWNA 2VTHA 3MYGA 4IAIA 5CANA 5FP6A 2PHKA 4J97A 5ANGA 2V55A 5TF9A 1SNXA 3QA8A 4FSZA 4ONAA 4AA5A 4PDYA 1APME 2OSCA 3QX4A 3VHKA 5FBOA 4WUAA 5BNJA 2VUWA 4K8AA 2YM3A 4CMTA 4RA4A 5AUXA 1GIIA 4J8NA 4D9UA 3AC3A 3FMJA 5LCKA 5KUPA 1T46A 4QMVA 4KA3A 1Q24A 4NU1A 4YNOA 4E6AA 2QODA 3KKVA 2ZM4A 3R8MA 4HZSA 2W1CA 2P33A 2YHVA 3DTWA 1OKVA 3H4JA 3Q4UA 4Z9LA 4NTSA 4H36A 1WBPA 2EUFB 4RIYA 5BYLA 1IEPA 4TNBA 1SM2A 4RX7A 4FSNA 4RZVA 5DH3A 4V04A 3FMNA 2QOFA 2GDOA 4GFMA 3RVGA 3VNTA 4UX9A 5IQGA 2E9UA 3HA8A 4ZSAA 1Q8WA 3A7JA 3IG7A 3EOCA 4IAAA 1BX6A 5CAVA 3LFBA 2HENA 1R3CA 1JPAA 1YVJA 3A60A 5IA2A 3K54A 3L9MA 3NDMA 3EL7A 4N70A 4XHKB 3VWAA 2UV2A 3G51A 4EH6A 3DBDA 4K33A 4TRLA 5EOBA 5CT0A 3FWQA 4HGTA 1JSTA 4QDVA 2AUHA 2CLQA 3FSKA 3UQFA 3QQLA 2CGXA 1JBPE 3K3JA 4DHJA 3RNYA 4M3QA 3FPMA 4LRKA 4DEAA 5CF6A 4R7BA 2JGZA 2JIVA 5HOAA 3RGFA 1WBNA 2R3JA 3U8WA 4EYJA 5ICPA 3G90X 5L8JA 3QXOA 4NIFB 2VZ6A 4CTCA 3DT1A 3MH0A 3FYKX 4QYHA 4WRGA 4FTMA 4XOZA 2ZB1A 2X0OA 2XJ2A 3IPHA 3KULB 2WMUA 5HCZA 4B7TA 4BZOA 3GOPA 3GCQA 4DHIB 4OGRA 5CVFA 4DEIA 4V01A 3UZTA 4N57A 5LVMA 1CM8A 1JLUE 3OT3A 4FTRA 2G01A 3IO7A 1CKPA 3RHXA 4OTFA 2R2PA 3LFFA 2XF0A 4EWQA 1OUKA 2BDFA 3F88A 3QCXA 4XV1A 4AA4A 4PMMA 5AUTA 2OJ9A 3G33A 5CYIA 4CEGA 5CSXA 4BYJA 5FTGA 1CDKA 4OLIA 4QMZA 4DYMA 2XIXA 3BQRA 4AT4A 4D4RA 4DTBA 3F3TA 2W0JA 2WQMA 3HMOA 3PE2A 3FMKA 3W2RA 3NYVA 2BMCA 3VBWA 2C69A 3TM0A 5AIKA 3AGMA 1JOWB 4YUQA 4HW7A 4J95A 5CWZA 3EFKA 2AYPA 2JD5A 1JKTA 3L8XA 4HPUE 3SX9A 4IDTA 4EC8A 3T8OA 3EFWA 3F3WA 3H9FA 3Q9WA 5JN2A 5HTBA 3ZLYA 1Y6BA 2YZLA 3NW7A 4GIIA 3DJ6A 4GUEA 4HOKA 4G5PA 2CNVA 3U4WA 4HNFA 1H07A 4S31A 3WE4A 2B53A 2LAVA 4A4XA 4EHVA 3RCJA 2PE1A 3POZA 4JX7A 3BHTA 3I7BA 2VAGA 4TTHB 3UC4A 4DH8A 5HORA 3FLWA 5DI1A 3LCTA 4IWOA 4OTDA 5HG7A 4YGAA 4NCTC 4G16A 2OH4A 4XG4A 3VS3A 1L8TA 5B2MA 2BRHA 2IZTA 2ITUA 1H28A 3W16A 4OTWA 4JDHA 3L9LA 5LMKA 2R4BA 2YACA 3R71A 3VS7A 1SNUA 1UKHA 5BVEA 2Z02A 1L3RE 2DQ7X 5CEPA 2GS7A 3GU5A 3OCTA 1M2RA 3EQGA 3Q32A 4IAKA 5CZIA 2XEYA 3HV7A 4R6VA 2C6OA 2WGJA 5C27A 3L8PA 4FKWA 4WD5A 1FBNA 3EIDA 4IFGA 2X7GA 4J71A 4FKGA 4C3RA 4EK6A 4EHZA 5M06A 5IMXA 4AQCA 3W0NA 5BVOA 4E5AX 4M97A 3LM0A 4I92A 4JI9A 4PDOA 4RVLA 4JBOA 2GMXA 2GQGA 5HG9A 1VZOA 4MX9A 3REPA 2HY0A 3A7HA 5EQEA 3WZEA 4LI5A 3ROYA 3ZEPA 2J2IB 1R39A 2BVAA 4PX6A 4EQMA 1YDSE 2CGVA 4X7QA 4U9AA 3DKCA 4L44A 4NZWB 3M42A 4LG4A 3T9TA 3SG8A 4DGLC 3QTUA 2V7OA 5DN3A 3U6HA 4G9RA 4H39A 4L68A 1YXXA 3Q4TA 4DN5A 5AR4A 1YXTA 4PDSA 4I5PA 5EM7A 4BI2A 1UNHA 2VWXA 2C3JA 4AW1A 3SRVA 2ZV8A 4WKQA 1ZOHA 4ZLOA 2WMRA 3KIOC 2E2BA 3C4FA 1GOLA 4JOAA 4CFWA 3NEWA 3BE2A 2ITXA 1WBVA 2VTAA 3ACJA 3AT3A 4M12A 4JBQA 4RLKA 3UNJA 5IQBA 3BLAA 3F82A 4XG8A 4I20A 5A4QA 2GNIA 5E8ZA 5JQ8A 1Y91A 3RJCA 3BYSA 3OBJA 3F2RA 3QWJA 4B99A 3B2TA 4FV9A 4UXLA 1VLRA 4IMYA 4DDGA 4FZFB 2EWAA 2HIWA 4I6LA 4NH1A 5CU4A 3R22A 4RFZA 1H1PA 2R3GA 4S33A 3DBFA 2WAJA 3DJ7A 2ZDUA 4CFNA 4X2GA 3WF5A 3ATSA 3VF9A 1OL5A 3TMOA 5G6VA 3DLZA 3D5XA 3GEQA 2WMXA 3I5NA 3DPKA 5B2LA 2O5KA 1GZ8A 2YABA 1S9IA 3PZHA 3QYWA 4JAJA 4RVTA 2FSOX 4XG2A 3RNIA 3QA0A 3O17A 1VEBA 4G34A 2J0KA 5DHJA 5IA5A 1RDQE 3FLQA 3QAME 4E4MA 3V3VA 5M55A 5C1QB 3FUPA 5LVLA 3CJGA 4USDA 3FEGA 4NUSA 4I0TA 3NWWA 4DBXA 4FF8A 5E8WA 3TKIA 1ZYCA 2R0IA 2BAQA 4W8DA 3VRYA 3I4BA 3AD6A 3IOPA 3BLRA 4QP2A 5CSPA 4AXCA 2YCRA 3QCSA 2YDIA 1LP4A 4KIKB 4EOQA 5IMEA 2R5TA 2HY81 3BYOA 5HNGA 4KABA 1WVWA 3OD6X 5CS6A 4ACHA 4DLIA 5IQCA 2XK6A 2W9FB 5ANKA 3KL8A 1K9AA 1REJA 4D2VA 3A61A 4MD7E 5A3XA 4FX3A 3RPOA 3NS9A 3C0GA 3LQ8A 3QZIA 4RBLA 4XLIA 4ZSEA 1W2CA 4YZ9A 4DTAA 4DEGA 3WF6A 2QHMA 3VJNA 2A0CX 4NIFA 3KGAA 4WSYA 3TTIA 5M08A 4RZWA 4TY1A 4YSJA 1ZARA 4JBPA 5CU3A 4O82A 1J91A 3KULA 2DUVA 4BTKA 4E8AA 5JRQA 4QDEA 3UDSA 4MQ2A 5IA1A 1DAYA 2R0UA 5I4NA 2WNTA 5HNBA 4QYEA 4YU2A 3QFVA 1OZ1A 4FT7A 4UYAA 5H9BA 5EW9A 4BCKA 4BTMA 5E90A 4C4IA 3DDPA 2VTIA 2BILB 3CEKA 4PTGA 1NT2A 1E1VA 1ST0A 2Y4IC 1M52A 3C4ZA 2X8EA 4U41A 2YIQA 2VWWA 2ITTA 3RK9A 3W18A 4DINA 4QMUA 4RIWB 2WMBA 4FEUA 4FIEA 5BVFA 2W5HA 2VO0A 3O7LD 3M11A 4LUEA 3W2PA 4OBPA 4PWNA 2ZMDA 4JG7A 4AGDA 3PTGA 3ZEWA 4CXAA 4EI4A 4F09A 2ACXA 1A48A 2C5YA 3TV4A 3R01A 4DLJA 5JT2A 5C26A 1OM1A 3K3IA 3UIUA 2EXMA 3FPQA 1SMHA 4PMPA 4PL5A 3VS2A 4C57A 5IQDA 4FV0A 4EEVA 5CI7A 2OZAB 3O2MA 4ZSJA 4E93A 4EH9A 2WB8A 3UDBA 3THBA 4F64A 3UQCA 4TW9A 4A9TA 4L6QA 4FSMA 4ERKA 4IB3A 4JDJA 4BWXA 5F20A 4XG7A 3RZFA 4BDDA 4YJNA 2XP2A 4BC6A 5CVGA 4V0GA 5A46A 2ZVAA 3DQWA 2CKPA 3PE1A 4JDKA 3DS6A 4MXYA 4JDIA 1FOTA 5ACBC 4OAUC 2B1PA 3CQUA 3CR0A 3EHAA 4M68A 4PMSA 3RTPA 2QOLA 5HD4A 4EZ5A 2XALA 3E7VA 3KXXA 1GJOA 2W1GA 3FL4A 3N4UA 4HVSA 2C3LA 3W33A 2VO7A 4NFNA 4B9DA 3V51A 4Y46A 2UZLA 2VGOA 4WBBB 2GFSA 2BZKB 4BRXA 2PWLA 4K18A 3CSVA 2PZRA 4F6WA 3IW5A 3NAYA 3ZM9A 2OKRA 3C4XA 2PUUA 3Q5IA 3RZBA 5A9UA 2NRUA 1K2PA 1G8AA 3DFCB 1IR3A 4D0XA 4LRJA 4XS2A 4C2WA 2XM9A 3TNPC 4RRVA 5LWMA 4PDPA 3DXQA 3ZH8A 3S3IA 3L9PA 2IVSA 4ASZA 1U54B 2QC6A 5BYZA 2C0OA 5AR3A 2YLFA 2HYYA 3ZONA 4C4EA 1FMKA 3CPBA 4QQCA 4OTHA 2GHMA 2GU8A 2QOIA 3BGPA 4L45A 2PZ5A 3OROA 2PMOX 3JY9A 4TZRA 3W2CA 4ZLYA 2UZNA 5CXZA 4J98A 5BMMA 2W1ZA 3WF7A 3CGOA 2CPKE 3FYJX 4C4FA 2PU8A 3V5LA 5A54A 3FC2A 3KRRA 4MXAA 3ORZA 3EN9A 4CLJA 3ZRKA 1GZNA 4RFMA 1H8FA 4YJPA 4O7YA 5GJDA 4W9XA 4TYEA 4ACCA 3GU6A 5IQAA 1PKGA 2BROA 3ERKA 4QP8A 3NW6A 4K11A 1BI8A 4IZYA 4MXXA 5HG8A 1TQIA 1URWA 1OKWA 5AP4A 3LXKA 2Q0NA 2OH0E 2OG8A 1FQ1B 3QHRA 4WT6A 5CNNA 2XKEA 2BRGA 3TG1A 4CGAA 3IOKA 1IRKA 2Q0BA 5DGZA 2Y7JA 5CALA 4I21A 4JIKA 4BDEA 1B6CB 1ATPE 5CTPA 2E9OA 2XK3A 1Q8UA 4C3FA 3TNHA 3FKLA 4F4PA 2VO3A 4CQEA 2ESMA 4IAZA 2Y8OA 3V8TA 5KO1A 3R7IA 3UDZA 4QD6A 5HICA 3F3ZA 4FSUA 4QYFA 5IU2A 3E8EA 4FOCA 4BDGA 5BQ0A 5EHOA 5H8BA 2OJGA 5F9EA 5TOZA 4EOMA 3V01A 1Z5MA 1HCKA 4QNAA 3LJ0A 1Q97A 3F3VA 4BCOA 1OITA 5JGBA 2I0YA 3QX2A 4YZDA 1ZOGA 2QOKA 3GFEA 4EL9A 4IDVA 2JBPA 3MSSA 3DTCA 2ZV9A 3VN9A 2XNGA 4EOPA 4IHPA 1OGUA 3NVKI 3VS0A 3RPVA 3GQIA 3Q60A 3VBQA 1KE7A 2J0JA 4KIKA 2Y6OA 4IZAA 5EI2A 2SRCA 4RIOA 2F7EE 1YOMA 4J96A 5TT7A 3U6IA 3BHYA 3SQQA 1WVXA 3C13A 2V62A 2WMAA 1OVEA 4EZ7A 4D2WA 3MVLA 3LFCA 2XRWA 1E1XA 1YDRE 3PY0A 4W4YA 5F4NA 3TJCA 3ZZEA 3ZO1A 4CRSA 2UVZA 3SG9A 3PVBA 4QQJA 4FKJA 3SC1A 4RJ3A 3WBLA 4D55A 3DKFA 1XH9A 3QKLA 4L67A 4O0SA 4AZWA 2JEDA 5BUJA 3R7YA 3A62A 1PXPA 5IQHA 5J95A 3ORKA 3HLLA 3BELA 2HZ0A 3PG1A 3WYXA 4JRVA 1ZMVA 1Y6AA 2PE2A 2WTDA 5FD2A 4ZJIA 4CV9A 4QPMA 3FKNA 1V1KA 3H30A 3D14A 2C1BA 2C5OA 2IW6A 2BIKB 3CY2A 4HJOA 2OXXA 5KZIA 3ZSHA 3GVUA 2XYNA 2AEGA 1B38A 3CQEA 2ZV2A 4IM3A 3R1NA 4KBAA 4RIWA 4X0MA 5D1JA 4D0WA 1LR4A 3ZM4A 5CAOA 5EM8A 2XS0A 2G2FA 1ZYDA 3E92A 3PP0A 4JQ7A 4QYGA 5J9LA 2YIXA 2NNWB 3NW5A 3P5JC 1O9UA 4QRCA 5CEIA 3DAJA 5CSWA 1TZDA 2O8YA 4DAWA 4R3RA 4AXEA 2ITYA 4KKGA 4O21A 4BCHA 1YW2A 2HZIA 3H9RA 3IKAA 3P7AA 2OZAA 4RA5A 3EQBA 4IAFA 1Q61A 3PVWA 3ZO2A 4AGCA 3LMIA 4IB1A 2J0LA 4PL3A 4LV7A 4IXPA 2WELA 2AC5A 3HECA 4D4VA 3MBLA 2QG5A 2BRNA 3I60A 1MRYA 3AMAA 3ML1A 1H26A 2FO0A 4P4CA 4ZJJA 1OIQA 3PXZA 2P4IA 4MD9E 4Y8DA 3CCNA 2C6KA 2WTJA 4GFOA 4D5KA 2PSQA 3Q6UA 1W84A 1KV1A 2NYAA 2H8HA 4G6LA 5DLSA 4CFMA 4I3ZA 5HEZA 4F9CA 4O38A 1H1SA 4YNEA 3MWUA 3HYHA 4Y95A 1Y8GA 2E9PA 2WIHA 3ZS5A 5AFVA 4DE4A 4WG3A 3AC8A 4QTCA 1XH8A 3SA0A 4PRJA 4E3CA 4O86A 4FKRA 2HELA 4U40A 1VYWA 4C3PA 4JS8A 2WPAA 1Q3DA 1GZKA 5EQYA 2VU3A 2XRUA 4E4LA 3VUTA 3N4TA 4F9YA 3U87A 5A4EA 3HAVA 1WMKA 3NLBA 3FHRA 4R5SA 4YZMA 3DJ5A