4AT3A

Crystal structure of trkb kinase domain in complex with cpd5n
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
299
structure length
289
Chain Sequence
GAMDTFVQHIKRHNIVLKRELGEGAFGKVFLAECYNLCKILVAVKTLASDNARKDFHREAELLTNLQHEHIVKFYGVCVEGDPLIMVFEYMKHGDLNKFLRAHGPDAVLMANPPTELTQSQMLHIAQQIAAGMVYLASQHFVHRDLATRNCLVGENLLVKIGDFGMSRYSTDYYRVGGHTMLPIRWMPPESIMYRKFTTESDVWSLGVVLWEIFTYGKQPWYQLSNNEVIECITQGRVLQRPRTCPQEVYELMLGCWQREPHMRKNIKGIHTLLQNLAKASPVYLDILG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structures of Trka and Trkb Suggest Key Regions for Achieving Selective Inhibition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords BDNF/NT-3 GROWTH FACTORS RECEPTOR
total genus 97
structure length 289
sequence length 299
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2012-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4at3A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4at3A01
4R8QA 3HZTA 4HVIA 2CHLA 3EQPA 4FT9A 4XYFA 5CVFA 4I5MA 2ZM1A 1H00A 5EI2A 5FXRA 5EG3A 2W1EA 3FPMA 2VD5A 4YUQA 2VTOA 2DYLA 3AMAA 3ODYX 2JDSA 3QQLA 4WHZA 4XV9A 3W8QA 4BCKA 5AAGA 2NP8A 2EU9A 2ITUA 2YM8A 3PIZA 4TPTA 4Y83A 5BVKA 3A4OX 2PVLA 4L3LA 2IW6A 2I0YA 2XIXA 5ANEA 5IQDA 3ZLSA 3ZCLA 5HIEA 2O64A 3QA0A 3ZM9A 4OBQA 5FDPA 2B9JA 1ZMVA 2PL0A 3IDPA 2R2PA 3OUKA 3P7BA 4HGTA 4C4EA 4FKJA 4XV1A 4DEIA 4DGMA 5DR6A 5HLPA 2QD9A 3OG7A 3C7QA 4EH2A 4U3ZA 2VO6A 4V01A 3A61A 3QUPA 3DBCA 2Z7QA 1FBNA 4EHEA 3EKNA 1PYXA 4RIWB 3U55A 2Y7JA 3A99A 5A4EA 5JKGA 1Y6BA 3DKCA 5ETCA 4I23A 3RAWA 3W10A 2XK9A 3PVGA 3FMEA 4RVKA 3W8LA 4BCHA 3OXTA 4DBNA 3MH0A 2RFNA 3S4QA 4RWIA 1K9AA 2GNFA 2VV9A 3PWDA 4LI5A 5AJQA 2EXCX 4CRLA 3UTOA 4BBMA 4F4PA 2BZJA 2G9XA 5LMAA 5C4KA 4FG7A 4UWYA 2J0KA 2RG5A 4YJTA 5KMKA 3A62A 3LM5A 4XS2A 2WIHA 2YDIA 3Q6WA 1WZYA 2W1DA 2C6DA 3S0OA 2BAQA 2Y8OA 3NAYA 2LGCA 5CEMA 5FBNC 2CNVA 4MD7E 2RSVA 3BGQA 3K2LA 3LFQA 2W1HA 1IEPA 1M2QA 2W1ZA 3C13A 5DHJA 4BYJA 4BDJA 5J5SA 5M57A 4BVUA 4M15A 1KE7A 4FKVA 3HL7A 1PF8A 2H8HA 4TYHA 1Q8ZA 2JKKA 2UW4A 3FQSA 4JDHA 2I0VA 3JUHA 3RWPA 5HQ0A 4ASXA 5CU4A 1OIYA 4F9CA 1H8FA 2GDOA 4IZ5A 4XG8A 4IX3A 3F88A 5ETIA 5IA2A 2C69A 3ORLA 4I0TA 4JQEA 4JT3A 4O7TA 3V3VA 1J1CA 4ZTLA 4AT3A 2KTYA 3U8WA 4MEDA 3IDCA 4GVJA 5LVMA 4WO5A 2WEVA 3IQ7A 3NNUA 3UNKA 5KZIA 4M0ZA 3TKHA 4ZSGA 2X9EA 2BZKB 1YXXA 2UZUE 5TT7A 1YWNA 3UVPA 4HVSA 3LLAA 5JGDA 4BR3A 1PJKA 3Q60A 3QA8A 5AP5A 2ONLA 3D5WA 2QOBA 4IAKA 3QWJA 4U6RA 1V1KA 2RFDA 5HU3A 5L6PA 4PTCA 3DNDA 2ITXA 2XNNA 4KSPA 4DH8A 4EOOA 3MB7A 3TEIA 4MTAA 4HW7A 1P5EA 3BLRA 3BYOA 2CGXA 3O2MA 4MWHA 4K0YA 1RW8A 3GT8A 3QXOA 4ERKA 3ZO4A 5A6NA 3QTXA 4TYEA 2YERA 3LMHA 3R2BA 1OKWA 1W8CA 2J0IA 2R3IA 3PUPA 5C9CA 3R9DA 2IG7A 2PE1A 3CY3A 4HGEA 3TL8A 5I9YA 3CCNA 2XJ1A 4MBIA 1OL7A 2C6LA 4F9AA 3ANRA 4E6DA 3G33A 5AR8A 5KUPA 5EQYA 3P08A 1IA8A 2XEYA 4F09A 4F65A 3IG7A 4RWJA 4O83A 3H30A 4IVDA 3ODZX 1H24A 2FB8A 3DXQA 5AP0A 2VO0A 4W4WA 1SVHA 3QD4A 2J50A 3ULZA 4O0XA 3E7VA 3LZBA 4CXAA 5A14A 2R7IA 5ACBC 5C26A 5AA8A 4RX9A 3R8VA 4BWKA 2OJFE 1PXMA 4YHTA 4YJPA 3OWLA 4Z7HA 1WBSA 1Y8GA 2JIUA 1XH8A 1FPUA 3HP2A 3HMIA 3QQFA 3K5VA 1R0EA 4J96A 5DH3A 4AS0A 4BCOA 5IA0A 5J1VA 4AGCA 2PVHA 3DQWA 3NUXA 4ALVA 4RRVA 3F61A 3UP2A 2PSQA 3FHIA 2C1BA 3BHTA 2BFYA 2DUVA 4H58A 5AA9A 2VO3A 2WOTA 4LG4A 4PV0A 1J7UA 2XBAA 5CENA 5KKRC 4LUEA 2ITPA 3PA4A 5CS6A 4MK0A 1JSVA 2PVFA 5JRSA 4K2RA 4FTUA 2C3IB 4BF2A 3I5NA 3S1HA 2VWVA 4YBKA 2J2IB 4ZSLA 5GNKA 4AE9A 4B9DA 3TNWA 3RALA 3OWKA 1ZY5A 5LARA 3W32A 1DS5A 2UW7A 2AUHA 4PTEA 2PWLA 1BYGA 3NUUA 4YNEA 4DG0E 4FIEA 3EZVA 5L8JA 5F95A 3L8SA 3L9NA 2PY3A 2RIOA 3FMKA 5B2KA 3II5A 5AV4A 3QUDA 3RM7A 5D10A 2W5BA 5BVNA 2H96A 5AV1A 3VBWA 2V7AA 4BFMA 4C36A 2JKOA 5M06A 2WZJA 3LCDA 4M68A 2QURA 5EH0A 4O96A 1T45A 2BRGA 2OFUA 2VO7A 4V0GA 1FGIA 5CEPA 5HIBA 5CF4A 3MFSA 1BL6A 4M84A 1XQZA 4GKHA 2QO7A 4BCFA 4CKIA 2CN8A 3FSKA 3RHXA 2WQNA 4P5QA 4PPAA 2JDTA 3FMNA 5IUIA 3TUDA 1A9UA 3F69A 3RNYA 1SM2A 1HCKA 4MH7A 3P86A 4YSJA 2CNQA 1NA7A 4FTRA 4R5SA 4XG4A 3UOHA 4ZZOA 2I7QA 2WB8A 3UC4A 4AZTA 3OCSA 3C4XA 4JBQA 3PXYA 1UKHA 4JR3A 4R1YA 5HG7A 3EQCA 3VW6A 2NPQA 4RX7A 3SC1A 1T46A 4ZLOA 3F3UA 3MVHA 2V5QA 2YIQA 4H05A 2YDKA 4HVHA 4GK4A 1OBGA 5DT3A 4D2RA 3DKGA 1SMHA 2W5AA 2P2IA 2P3GX 3QL8A 1ZLTA 1O6YA 3TNPC 4G3EA 3V01A 2XK3A 4M7IA 2BRHA 4OTHA 3DB6A 4RG0A 4H3QA 2OIBA 3Q9YA 5CQUA 3CTJA 4UY9A 3IGGA 4Y73A 5BYZA 3FV8A 2QNJA 5CEOA 3OY3A 3CE3A 3DU8A 3VIDA 3NYNA 3HMPA 2CMWA 4PF4A 2WMRA 4DH5A 5DRDA 2UZTA 3UIXA 3VF8A 5E90A 4BDFA 4XX9A 5I9ZA 1Q8WA 3ZFMA 4QTAA 3KCKA 4ZSEA 4D1ZA 5M07A 3DBEA 4GT3A 2XB7A 3OT3A 3TTIA 4E26A 4Z3VA 1NT2A 3DK3A 4WRSA 4WSYA 5KMLA 4F70A 4QTEA 3KRLA 3K3IA 3RK9A 3PXFA 2JAMA 3SOCA 4D5KA 5FDXA 5JQ5A 4DYMA 4BTFA 1G3NA 4IW0A 2GNHA 3KU2A 5IQAA 3DAEA 4WG3A 3FDNA 3P0MA 5DR9A 3LAUA 3AC8A 4HJOA 2X1NA 3TV7A 3BQRA 3OP5A 4IANA 2OI4X 3ZLXA 3SGCA 4FT3A 5JGAA 1ZY4A 1QMZA 5J7HA 3ZO2A 3NIZA 4KRCA 4YZNA 3LXPA 3VUMA 3S3IA 4ZTMA 1TKIA 3D14A 5HG8A 3UQGA 2R3RA 2ZOQA 3IW5A 4UWBA 3V8SA 2BDJA 4D2PA 3QF9A 2PPQA 3VVHA 1FQ1B 5K0KA 2QO9A 1YWVA 4I5HA 4AF3A 4FA2A 1BI8A 5I3OA 4I3ZA 3IW8A 4EBWA 4ACDA 4I0RA 4IVCA 4AZEA 4PDSA 2W06A 1O6KA 4L7SA 5BYYA 3FI8A 4M3QA 3MYGA 4GT4A 2P33A 3Q4ZA 4BHZA 4XMOA 4KS8A 5FTOA 4AACA 4NK9A 1REKA 5BUIA 4C33A 4MAOA 5M4IA 3SRVB 3MY1A 1M14A 3OOGA 4KBAA 4IM3A 5EK7A 5JN2A 4NJ3A 3QTSA 1WBPA 3WF5A 2VU3A 2VWXA 3FC2A 5CNNA 3W2OA 5DG5A 4FICA 4EKLA 2YAKA 4XOZA 3HA6A 4S33A 4MX9A 4YJVA 3ORNA 3WOWA 4HNFA 2Y6MA 4TNDA 2GU8A 3CQEA 2UZDA 3NR9A 5ICPA 2G2HA 3BU6A 4Q9SA 3QRKA 4QQCA 4V05A 3ZS5A 1SVGA 3R1YA 4GRBA 2CNUA 2CKEA 2PZIA 4EOMA 1JWHA 4FZFB 2WGJA 4K9YA 5E4HA 2WTVA 2OW3A 4KNBA 3FC1X 2R4BA 2VX3A 3PIYA 3PIXA 4X3JA 3HX4A 5D7VA 2Y4PA 5EM6A 4Q9ZA 4YURA 5EM7A 3HAMA 1UKIA 5L3AA 4E4MA 4YSMA 4X0MA 3FSFA 3ZTXA 3L9PA 4UMPA 3CC6A 2YZLA 3N4VA 2YITA 3EQGA 4J71A 5E8XA 4UZDA 2YM4A 1CMKE 4MVFA 3FKOA 4EOIA 2CGUA 4IM0A 5AWMA 3GNIB 3RZBA 1L3RE 3KY2A 5KNJA 1TQMA 3PXQA 3UO4A 3PJ8A 4MD9E 4NKSA 5L8LA 4V0GB 4NWMA 1NVQA 4CQEA 4IX6A 2OXXA 2HXQA 1B6CB 1GZ8A 4O6EA 1WVYA 4XEYA 4AUAA 5AP1A 4K1BA 3OT8A 3LFFA 3MA3A 2ITNA 1ZWSA 3L9MA 1PXOA 2V22A 4E6QA 4JXFA 4J99A 5EDPA 3LJ1A 5L2QA 2IVTA 2YDJA 3LHJA 5G1XA 3NAXA 5KHWA 5CAOA 4CKRA 1YI4A 2CKQA 3DFAA 1H1QA 4M66A 2QLUA 3KXZA 5F20A 2WTWA 2QU5A 3COIA 3F5PA 3MB6A 1Y6AA 4L7FA 1I09A 2A0CX 3BWJA 2PVRA 4TN6A 3R9RA 3R71A 3HDMA 4H36A 2AYPA 4QO9A 5L2WA 2QU6A 3BYSA 4QP6A 4EZ7A 3QCSA 4I6FA 4Q2AA 2WMVA 5BVFA 2WMXA 4A7CA 1R0PA 2AC3A 4YNOA 5ANIA 4FTNA 4G9RA 3GVUA 3MN3A 4ITIA 1STCE 3VUHA 4DGOA 3VBTA 2G2IA 4P90A 4E6AA 4YTIA 3FL4A 4G9CA 3ZXTA 2W4OA 3ORMA 5CYIA 1HCLA 4WSQA 5HNIX 1CTPE 1OL5A 3QQJA 3PSDA 2HK5A 3WZJA 3O8PA 4IVAA 4EH9A 3BZ3A 3NIEA 4O0UA 3QTIA 4F0FA 3VN9A 1Q99A 5IF1A 4EBVA 3KA0A 3BEAA 4NW5A 3ITZA 3O8TA 4DEAA 3UIMA 3OS3A 3OUNB 2H6DA 4UMQA 1WBTA 5DOSA 5CEQA 2OJJA 4FIGA 2ITTA 4HGSA 5HLNA 3R21A 4G1WA 4JG7A 4ZTQA 2ITZA 1PMUA 2XK8A 2YIWA 4KD1A 5AUYA 3EFKA 4QP1A 5H2UA 4B99A 5GZ8A 4MXYA 2FH9A 1TQIA 4L44A 3LVPA 3ZZEA 3FJQE 3KKVA 3FI2A 3CS9A 4YPDA 4DFZE 2IWIA 1CDKA 2HY81 3A7HA 2Z02A 4D0XA 1BX6A 1VJYA 4YP8A 3W2PA 2R3HA 4ZY5A 4UALA 3UO5A 1REJA 4UXLA 2GS7A 3FLNC 4LUDA 1YI6A 4R3PA 3BYUA 2X6EA 3GQLA 4M14A 5M08A 3BRBA 4FKLA 1NVSA 2YZAA 2X0GA 2PMOX 3FAAA 4X6QC 4USFA 5GZAA 2G01A 5LVOA 3Q04A 5K5NA 3DAJA 2R3MA 3UGCA 2PTKA 4Y95A 1AD5A 3FI3A 3MPMA 3MVLA 4YJRA 4O84A 1CKIA 4PL4A 2PMIA 3FLQA 1KSWA 3ZDUA 2OXDA 4BL1A 2GPHA 2WD1A 5CNOA 1OBDA 4P2KA 4RIWA 4TNBA 3Q32A 3R04A 4WA9A 4D2SA 3Q53A 3VQHA 4U41A 2C5VA 1PMEA 4EOQA 2W1CA 3TM0A 4JBVA 3SW7A 5CU3A 3WI6A 4FNWA 2R3KA 3THBA 3SX9A 3TNIA 3IO7A 4TWPA 3DZOA 4NUSA 5AP2A 4NCTC 3ID6C 2OWBA 3BKBA 5L2TA 2OSCA 3F6XA 4AAAA 4DITA 3I0OA 5ETFA 5TF9A 4O38A 2OJGA 3CQWA 1ZOEA 3DY7A 4IWDA 4BDKA 3LFDA 2E9UA 3EFLA 1FMOE 3R7UA 4DFLA 4ZJIA 3C0GA 4RJ3A 4ASEA 4FV0A 4E4XA 2O63A 3CKWA 3QC9A 4RZWA 1XH4A 3KRWA 5CXHA 4FV4A 3QHRA 3DBDA 4O2PA 3OCTA 4MYGA 3G15A 5HBJA 2VWIA 4L68A 3MVJA 3UVQA 2ZV8A 4X2GA 4C58A 5B7VA 4O7WA 4JX3A 4IB1A 5EW8A 3VS3A 4EZ3A 5IUHA 3FY0A 4UMRA 5JZJA 5KMNA 4CLJA 5M56A 4U43A 4WNOA 2X81A 4U3YA 3OTUA 1BI7A 3GC7A 5FEQA 1WVXA 3ZM4A 1U59A 3F2NA 3EL8A 4YJNA 5K3YA 4X7QA 5D7AA 5IPJA 1ERKA 2Z7SA 4D9UA 2VNYA 5CSWA 4L67A 4GVAA 4WT6A 3MWUA 5E1EA 1WVWA 3EYGA 1UNLA 4EK6A 1Z57A 4EWQA 4XRLA 2X8DA 4FR4A 3UIUA 4JG8A 4YJSA 3ZUUA 4KAOA 2OF2A 4O21A 3OBJA 4RT7A 1XR1A 4LMUA 3V04A 2E2BA 5FBOA 3E3PA 3SLSA 3PE2A 1ZMUA 4BZNA 4D58A 3SKCA 4HPTE 2PZPA 2X2LA 3R1QA 5AUZA 2LAVA 4F7JA 3KQ7A 4XG2A 1U5QA 2C6OA 3I6UA 3UVRA 5LVPA 1PRYA 4FV8A 4U42A 3V6SA 3EB0A 4AW5A 3ETAA 1WAKA 2CGWA 3O71A 3U4UA 3RK5A 5IA4A 4RFMA 4NT4A 3TNQB 5IA5A 5BMSA 3GGFA 1KE8A 5HE2A 4UB7A 3KULB 5HORA 3CLYA 3QRJA 3CKXA 2EB2A 2QOOA 2R5TA 3KC3A 4IH8A 5I4NA 5JMSA 3NNXA 4EJNA 4I20A 1JNKA 2A27A 2IVVA 3CPCA 4KBKA 3SW4A 1G8AA 2YABA 5KKRB 3FUPA 3EFWA 4PUZA 5IQHA 3ANQA 3W2RA 5JFSA 2QKWB 4YC8A 2ZV9A 4YPSA 4O1PA 3R9HA 2JDVA 3MY5A 2JBPA 4RVTA 1JQHA 4Q5HA 3E63A 2X8IA 5IU2A 2OXYA 4FTJA 4BGGA 3QUEA 2QG5A 4BI2A 1M17A 4XP3A 1PKGA 5IMEA 4YGAA 3QGYA 4GUEA 3MS9A 4IEBA 2QOKA 2GQGA 3KN6A 3EQRA 1Q97A 2PYWA 4QTCA 3OWPA 3RJCA 3RK7A 4DGLC 2CCIA 3WIGA 2HYYA 1URWA 3FBVA 1OGUA 3PPZA 4EOLA 5EKNA 1KE5A 3H9FA 4FNZA 4NFMA 2XNBA 3FLZA 3EJ1A 4F7SA 3FMJA 3BX5A 4FUXA 5CSVA 4ALUA 4ASZA 4LM5A 1KOBA 3COHA 4ANLA 2PUUA 4BDAA 4F08A 4K6ZA 3A7JA 5K4JA 3UE4A 4RJ6A 5GJFA 2W9ZB 2QVSE 4EUUA 3CQUA 2YM6A 4KIOA 4EK4A 3QQHA 2WTKB 3R7EA 2BHHA 4FTAA 5M44A 4F9YA 1BMKA 4EHZA 1NVRA 2J6MA 4IJ9A 4ZK5A 4UN0C 2HIWA 2YCQA 4B0GA 5IH4A 3NNVA 4A07A 4A9YA 3DLZA 3K5UA 2ZM4A 5CWZA 3VHEA 5HVKA 3ZZWA 5DBXA 3VAPA 5CU0A 3RPOA 3DDPA 3FE3A 5EHLA 4AGWA 3ZHPC 4YJOA 5FRIA 5HEZA 5HCYA 4O81A 2W7XA 2X2MA 3E62A 4TWNA 2OBJA 4BCJA 4MXCA 5IQCA 3HLLA 4FK6A 2REIA 5A4CA 2ITYA 1JKKA 5HLWA 2XYUA 4RSSA 1Q62A 4BB4A 3PJCA 4CSVA 4RQVA 3V8TA 2HWPA 5FXQA 4DLIA 3TZMA 4YTCA 4IAIA 4ANNA 2ZDTA 5D11A 4NU1A 2B52A 2WMTA 4L9IA 4F1OA 3LIJA 1GZKA 3R8UA 5I5ZA 5AIRA 2XK4A 4G31A 4UYAA 4J52A 1UNHA 3F7ZA 4WD5A 4BC6A 4CTBA 4DINA 5HZNA 3VRZA 3IW6A 4C61A 2J0JA 3GU8A 4GK2A 2OK1A 4MD8E 4KSQA 3L1SA 2XMYA 1YDSE 2O5KA 4AA0A 2OJ9A 1QPCA 5BNJA 2NRUA 4I22A 2R3FA 3ALOA 1JSTA 2XRWA 3A4PA 3JVRA 2QOFA 3WZUA 4AFJA 5DT4A 3KMWA 4FKUA 3VQUA 2X7GA 2OJIA 3Q6UA 3V5WA 2OLCA 4GKIA 5AR5A 4DA5A 5B0XA 4I24A 4FTMA 3M11A 4QMMA 4BWPA 4EJ7A 5E8UA 3NX8A 3E64A 4QYYA 3UMXA 3BIZA 3HRBA 4H39A 4GYIA 4YLKA 3LM0A 3P5KA 2J9MA 2UZWE 1IAJA 4XV2A 5BVDA 4PY1A 2BMCA 3HNGA 4ZOGA 1P4OA 3KCFA 5EDRA 3PRIA 4YZMA 4C3FA 4DH3A 1UWJA 3VF9A 3NUNA 5CSPA 3ORIA 5CAQA 5DYJA 1WBWA 4J97A 2P55A 1F0QA 2NRYA 4I21A 2F9GA 1SNXA 3AT4A 5CSHA 5C8NA 4ACMA 1W0XC 3OWJA 3I6WA 2H34A 4HVDA 4ZS4A 1OL6A 3DGKA 3GENA 3W2QA 1MRYA 4BDBA 4E4NA 4DTBA 4KIKA 5FXSA 3DLSA 4XG6A 3CGFA 3ZO3A 4AX8A 2B1PA 3VO3A 4F1MA 3BU5A 5CAPA 4QYEA 2GQSA 3ZONA 4FZ6A 1L8TA 3DTWA 4EQUA 1R39A 5FP6A 4E93A 4FTLA 4KIPA 1H08A 2XIKA 3KRXA 2C47A 3SG8A 5CI6A 4KB8A 5AUWA 2WNTA 4N70A 4FE2A 4MF1A 1BLXA 3KRJA 1LR4A 3NDMA 5HNGA 2IZUA 4C4FA 3KVXA 2CJMA 5C01A 4MXAA 1ZXEA 4EOKA 5KBRA 1U46A 4NIFB 2O8YA 3FMLA 3NW6A 3PZHA 4TYGA 2Z60A 5F1ZA 2BPMA 3VS1A 5H9BA 5LMKA 1YOMA 4M69A 3UDBA 4ZIMA 4BKJA 3P78A 3R22A 1OKZA 1RDQE 3TUBA 4HYSA 4QMWA 3U4WA 3QKKA 4ANQA 4BKZA 2W1GA 4J53A 2JKQA 3R02A 4FV1A 1WBOA 4C35A 3GXLA 5DI1A 1FMKA 2YIXA 1JKLA 3EMGA 4RJ7A 4FBXA 3GI3A 4ALWA 4C3RA 2E9OA 3JY9A 2V0DA 3MFRA 3R8ZA 5KX8A 1IASA 4NFNA 4R3RA 4IWOA 5C8KA 4XLVA 3EN4A 1H1RA 4APCA 5GIOE 1X8BA 4X21A 1GY3A 2YEXA 5HBEA 3R1NA 5M4CA 5HVJA 5CAUA 3DBQA 5ANOA 3UOKA 5CTPA 4G6LA 4CG9A 1GAGA 2W1FA 4IAYA 2HENA 1OUKA 2UW5A 3VUDA 2IPXA 2PZRA 5CANA 5LOHA 3FLWA 1EH4A 4GL9A 5LCKA 3VS4A 1VZOA 2W99B 3UNZA 5HIDA 4ZSAA 4C2VA 3I5ZA 3PVBA 3AD5A 5EI6A 5AX9A 2C5XA 1J7LA 4RJ8A 3N9XA 3ZMMA 3HV4A 4HZRA 2JDRA 4UV0A 5IKWA 4M69B 3O17A 2OIDA 4W4VA 2UVYA 3CPBA 5EW3A 4DHFA 3W16A 4Y5HA 3MJ1A 5E92A 4JAIA 4AGUA 5DFPA 3FEGA 4QMVA 4KWPA 3E8DA 3FQEA 3QZFA 5LCJA 1RE8A 2WU7A 2CPKE 3E8CA 2FYSA 4OW8A 2FA2A 3KFAA 5AUUA 1H4LA 4AFEA 4W4YA 4G5PA 3ZSIA 2I0HA 2XA4A 4FI1A 3OD6X 3PXRA 2C5NA 4Z9LA 4BIBA 4F63A 4GS6A 4MXZA 2XCHA 3AMYA 3GC8A 4BYIA 4DGNA 5CALA 1WBVA 5M4UA 5M4FA 4GG5A 1GOLA 1FVTA 4CMOA 1Q3DA 3G9NA 3IONA 4RA5A 4AA5A 4BIDA 1YXVA 1OIUA 4BDGA 1MRUA 3HMOA 3HECA 1XBAA 3I7CA 4NJDA 3QRTA 3VUTA 1E1VA 4QMQA 1GIIA 2R64A 1ZYLA 5FP5A 2VWBA 1DAYA 5D41A 2VWWA 3BQCA 4WRGA 3TT0A 1I44A 4L43A 3BLHA 5E8ZA 4O7SA 3ZH8A 2B0QA 2XEZA 3HEGA 4BCMA 1UNGA 4DT9A 4MQ1A 2XP2A 5IA1A 3KK8A 5CU2A 5DT0A 5IEVA 4YZ9A 3WE8A 3LPBA 3ACJA 4O82A 1Q41A 2BUJA 2XBJA 1TQPA 1S9IA 2YFXA 4YR8A 1CSNA 1ZOGA 3DS6A 1FGKA 3GFEA 1A06A 4EOJA 3A8XA 4EYMA 4F7NA 3F3TA 3A8WA 4RX8A 3MH1A 4BCIA 3E5AA 3SOAA 4C37A 2YIYA 4C38A 4NTTA 4JDKA 1TVOA 2C3JA 3JY0A 4EC8A 4Z55A 2J7TA 3LXNA 4D2VA 1M52A 3DXNA 3DK6A 4N4SA 2F2CB 2XF0A 3BYMA 4RVLA 5DVRA 2HWOA 4RX5A 4QMUA 4GIIA 3UJGA 3F82A 1OM1A 4R77A 1UA2A 3DOGA 3MTLA 4TWOA 4X2JA 1M7NA 2SRCA 4OAVB 1Q61A 3EZRA 2Y0AA 4O7NA 4TT7A 4QYHA 3FKNA 4JOAA 4WBBB 4FKTA 3PY0A 4PDPA 3GCQA 4DEEA 3FQHA 1Q5KA 4FV3A 4OTGA 3RAHA 2QOQA 3LFSA 4ZZNA 3AOXA 3G9LX 3WF9A 2JD5A 3AGMA 3S95A 4FSMA 4BIEA 2YN8A 4AWIA 2V7OA 3F66A 5CT7A 2PUNA 1WFCA 3R00A 4L45A 5LQFA 3KN5A 3ET7A 3R01A 3VS2A 4JG6A 4QMYA 3IGOA 4KKHA 4TXCA 4W8EA 5E91A 5J9ZA 5B2MA 4OAUC 3TKIA 4BTKA 3R7OA 5TOZA 3TIZA 5IQEA 3GCVA 1YHWA 2OU7A 4C4IA 4JRVA 3L8PA 4DC2A 4P4CA 4EH5A 3MVMA 2C6MA 3D5XA 4YZCA 4CV9A 2HOGA 4I4FA 4DT8A 3GEQA 4WG5A 3PWYA 3ZBFA 2YA9A 3O0GA 2HW6A 5ANJA 5AEPA 2OFVA 3VJOA 1H25A 3CR0A 3P23A 2XNEA 4FTQA 3SG9A 1WMKA 5BUJA 4ZTNA 3VBVA 2IO6A 3CIKA 4ONAA 4ANSA 2YHVA 4W4XA 3HVCA 1M2PA 4DEHA 3HUBA 2WELA 5BVWA 2GTMA 4G6NA 4FOBA 4JI9A 3Q3BA 4E20A 2CKPA 5EDQA 3FLYA 3ORXA 2UW6A 3HV3A 4BCNA 4J7BA 2XZSA 3QRIA 3GUBA 4YMJA 3SDJA 5M09A 1H07A 4FIHA 4LFIA 4EI4A 1JKTA 2PHKA 2ITQA 2QOHA 3RVGA 3SD0A 5GZ9A 3FHRA 3LOKA 4FKGA 4XUFA 3ZRKA 2YJSA 4Y46A 1UU7A 4GU9A 1QL6A 3TV4A 5J9LA 2VGOA 5EYMA 5K5XA 1K3AA 5BVOA 2NNWB 1K2PA 2DS1A 2WFYA 4QPMA 5IZFA 3UO6A 4OUCA 3DBFA 4G34A 4BY9E 3KF7A 3MJ2A 4FKOA 4D55A 5FUTA 2R3PA 2XRUA 4CT1A 3GCSA 3PE1A 2VAGA 2R3GA 3RPVA 2IN6A 3BBTB 3H0ZA 3FWQA 4ZTRA 4CD0A 1BUHA 3LFEA 3LQ8A 4YU2A 3VRYA 4CFXA 4EOPA 2BROA 3SVVA 3IS5A 4ZMEA 2WKMA 3HV6A 5AR2A 4DAWA 1PXNA 2UZEA 4LL5A 3LKMA 5HI2A 1XH5A 4X3FB 2CN5A 3AGLA 5IQIA 2BFXA 4IXPA 3PJ3A 5T68A 4O0WA 2FO0A 2UZLA 2HELA 4ZMFA 5A3XA 1HOWA 2GFCA 3KXHA 5AR7A 4BDHA 1CKPA 2WPAA 2YLFA 3PPKA 4BDIA 1H27A 4O7RA 1VEBA 2C6KA 4EH6A 3ZC5A 5FD2A 3B2TA 4X3FC 3A7IA 4RC3A 2VTPA 5C4LA 3ELJA 4I94A 4KS7A 3QTWA 3ENHA 1J91A 4R7IA 4QMNA 3COKA 3L8VA 4KRDA 1UU9A 3LW0A 3OY1A 2GQRA 2CDZA 2HCKA 5LVNA 3QYWA 4R7BA 4CGAA 4XG3A 5H8BA 4YHJA 4QOXA 5AX3A 5AM7A 1DAWA 3TV6A 4D1SA 4DLJA 1BL7A 2VN9A 3GQIA 2OF4A 3LXKA 4U9AA 4I5CA 2XNPA 4F0IA 4EQMA 5LMKC 3WZEA 2WAJA 4V04A 4CYIA 3S2PA 3HV7A 4MNEA 5HE0A 4QP4A 3D2IA 5C27A 2F7EE 3OBGA 4K8AA 5ETAA 3DXPA 4GK3A 4NH1A 3DAKA 3DJ7A 4O7LA 3TJCA 1XO2B 2QR8A 1Q8TA 3R7YA 5BX0A 4AOIA 2FGIA 2GHLA 3ZEWA 4MQ2A 3DTCA 4EONA 1H0WA 3AMBA 4ERWA 3MH3A 2C5YA 2HXLA 2Y4IC 3BEGA 5BMMA 3T3VA 5I9XA 4KIKB 3C4CA 3VBXA 3O7LB 1Z5MA 2BVAA 1M7QA 4O1OA 2A19B 3QAME 3QD2B 4FL3A 4FV9A 4LQMA 3EN5A 5FG8A 2XIZA 3G51A 2R9SA 3PYYA 5AV2A 1KV2A 4L01A 4C2WA 2ZV7A 1JVPP 4BDDA 5M55A 5HTBA 4OTPA 3D7ZA 4EORA 2PE0A 4A06A 2VTQA 4EK5A 4BDEA 3U6HA 1Q8YA 2PMLX 3FZTA 5DIAA 5JQ8A 1V0BA 1E9HA 3NUPA 1VYWA 2CKOA 4FEQA 3TNHA 3VS6A 2RGPA 3SA0A 3VNTA 4EH8A 4O91A 4QNYA 4L52A 3HMMA 4EUTA 4XNEA 2OZOA 2ONLC 4BGHA 2W4KA 4OTIA 2JBOA 3FXWA 4IB3A 4JBOA 1U54A 3PSBA 4EZ5A 3UZRA 2OGVA 2C1AA 1H0VA 1Q4LA 3U6IA 4GFOA 4X2NA 2VTHA 3W2SA 4FC0A 3UP7A 1OVEA 4O2ZA 3HP5A 3R28A 1UU3A 4RJ4A 2J5FA 5HKMA 3RBWA 4BBFA 5J7BA 2HZ0A 3NPCA 4CFWA 1RQQA 3RPYA 2R3NA 4L3PA 5L8KA 3QX2A 5C8MA 4CG8A 2PMNX 3P4KA 2YM5A 2YJRA 5JRQA 2PUIA 3OTVA 3EH9A 1LP4A 4G16A 4DGGA 2G1TA 4WUAA 3UYTA 3U54A 5EYKA 5KHXA 4CZTA 1SVEA 4PDOA 3UC3A 3CY2A 4IE9A 4DG2E 4Z16A 4FEXA 1KE9A 4OR5A 4DFUA 3AC2A 2WHBA 2BZIB 3COMA 2YAAA 3TCPA 1W83A 4F0GA 4F1TA 3MY0A 3G90X 4RGJA 4DFNA 3ACKA 2OH4A 4A9UA 3NGAA 4RIOA 4HVGA 2I0EA 4QP8A 4GG7A 2XNOA 4A9RA 5TR6A 3ZFYA 1H26A 2Z2WA 4G5JA 3EYHA 4NZWB 4C4JA 4ITJA 5HTIA 3GU6A 5EM5A 1LUFA 3VBQA 4C3PA 4EK8A 3S00A 5E8SA 4LRJA 2OH0E 4L46A 4UXQA 2PU8A 3AC5A 4GT5A 4FIIA 3HYHA 2ZVAA 3V5JA 5CF8A 4IVBA 4D5HA 5IUGA 1KWPA 4LMNA 4QQTA 5A4QA 3ROYA 4D9TA 5L4QA 2ZYBA 2O2UA 3KGAA 3PP1A 5J5TA 3A60A 3GU7A 3GOKA 3E88A 4PQNA 4RA4A 4E5BA 3UOJA 1URCA 3BWFA 2C0IA 4BBEA 4ITHA 3RNIA 2XJ2A 4I5PA 4AXAA 5CXZA 5I9UA 5TO8A 3ZFXA 5JFWA 3WE4A 2VTSA 3UG1A 1VYZA 5JT2A 3OEFX 2QOLA 3V5LA 3C51A 1Z9XA 3C9WA 2QG7A 3F3WA 4ENXA 5FEDA 3HV5A 4MBLA 4CKJA 3FZRA 3I1AA 4N6YA 3QWKA 3AD6A 3AG9A 4FUYA 5JK3A 3D94A 3DKOA 3G0EA 3ROCA 3DJ5A 3QTZA 4RLLA 5EKOA 4C57A 2UW3A 1OIQA 3BU3A 2ITVA 4QP9A 4FTCA 3M42A 2ETKA 2WQOA 4GFGA 4HYIA 3MPTA 4XP2A 5IQFA 4UBAA 3UPZA 4LRMA 5JH6A 3RAIA 4WKQA 3H3CA 4AZSA 5K9IA 4IJPA 2JFLA 3SXRA 4DN5A 3NYVA 4ZEGA 4O7YA 5CZHA 4BI0A 3ULIA 3DA6A 4BI1A 3ORZA 4M67A 4TTHB 2W17A 3GB2A 5BVEA 5EHOA 4MHAA 1SYKA 2W96B 4C02A 3I60A 3OW4A 1IAHA 2YM7A 3GCUA 3O7LD 3ZBXA 3F3ZA 4XOYA 1XH6A 2QONA 5LVLA 4FKIA 3DDQA 5IDNA 3HAVA 3DNEA 5EM8A 3BV2A 2H9VA 4DEBA 4OTQA 3LJ2A 5DRBA 5TKDA 1E1XA 3ERKA 2IVUA 3O8UA 2OG8A 4P5ZA 2IW9A 3RWQA 3E87A 3OFMA 5HICA 3QD3A 1Y8YA 2RFEA 2XVDA 2UZNA 4FF8A 5A9UA 5EOLA 4O7VA 3UYSA 4EKKA 3RM6A 1B39A 2QI8A 4U40A 3AC3A 4FTOA 4ZJVA 3CGOA 4QMOA 3RCJA 1SZMA 4KA3A 1V0PA 4USDA 2JFMA 3TI1A 3P9JA 1OUYA 3LE6A 1IA9A 3MTFA 3T9TA 1U4DA 2EWAA 3F7WA 1LEWA 4TWCA 2VTTA 4AN2A 2WMUA 4IADA 5KMIA 2XNMA 3LFCA 2OZAB 2YWPA 4HCVA 2BCJA 2QODA 3E92A 2GHGA 3NYOA 2PVYA 3UG2A 4F6SA 2VX1A 3MSSA 3G0FA 3BYVA 4NTSA 1OPJA 3R8PA 4C7TA 4LGDA 3FL5A 4LV5A 2WMBA 3IOPA 4ORKA 2GTNA 3R9OA 4F9BA 1J7IA 1W82A 3NVMB 1H28A 2FUMA 3P7CA 3RCDA 3I4BA 3BPRA 3K54A 3WIKA 4S32A 4QMZA 1GJOA 3AT2A 2G15A 2OZAA 2AC5A 4I6QA 4R6VA 4I1ZA 3RAKA 5JFXA 5HX8A 4FSWA 3PG3A 4I0SA 2J90A 3KVWA 3R83A 1CM8A 3Q4UA 3SAYA 4BWXA 4E8AA 3H9OA 4ARKA 3TIYA 3NYXA 3C4FA 4RPVA 1ZYDA 3VUGA 5AUVA 4M12A 3ZRMA 2JAVA 1ZARA 4XV3A 2J0LA 3Q52A 1UU8A 2WEIA 3SQQA 2UW9A 3LFNA 2VTRA 5EW9A 3Q4TA 3FYJX 5DA3A 3DKFA 2YLEA 4OTWA 5AP3A 4ZJJA 4BCQA 3G6HA 4H3PA 2ZB1A 4NCTA 3CD8A 4A4LA 2B53A 4AGDA 2W4JA 2HAKA 1AGWA 5CEIA 2VWZA 5IEXA 3EN6A 2WMWA 4FSUA 3IKAA 3MI9A 1KE6A 4FV5A 4XH6A 4ENYA 1CKJA 4QP2A 4DF3A 4FKSA 3Q96A 4PMMA 2PVJA 4AA4A 4LGHA 3ATTA 4MNEB 3VJNA 4ZS0A 4B8LA 4MF0A 4GEOA 3QQKA 4FEUA 4FKWA 3U9NA 4UYNA 4FVQA 3QQUA 3GCPA 4YTFA 4EYJA 4M8TA 1P14A 4FL2A 5A54A 4R78A 4IMYA 3D9VA 3LQ5A 3UMWA 3D15A 2BAKA 2HZ4A 4BTJA 3OF0A 4APPA 4AOJA 3NVKI 3KL8A 2CLQA 4PRJA 3POZA 3POOA 3LQ3A 4I93A 4AZFA 1Y57A 1WCCA 2B9IA 4S30A 4H1MA 4TKSA 4B4LA 4TYIA 2GHMA 4ACHA 3U6JA 2XK7A 2ERZE 4FT5A 4G2FA 2HY0A 1NW1A 1FOTA 2YISA 1PXKA 2EB3A 3UOLA 1QCFA 3R30A 4AQCA 4UMUA 3IECA 5HD7A 3KMUA 1IR3A 4IAZA 4EC9A 5EQPA 2YWVA 3MFTA 5AAEA 1XBBA 3CBLA 5HD4A 4QMXA 5E8VA 3DPKA 1YVJA 3QALE 4ACGA 1P2AA 2W9FB 3FXXA 3LCTA 4FKRA 2ZMCA 2WTDA 2ACXA 3RKBA 4B8MA 3TACA 1WBNA 3D7TA 2ERKA 1YHVA 4S34A 3TXOA 4CYJA 4PMTA 4PP9A 4WNPA 3C50A 5AM6A 4OBPA 4QNAA 3IW7A 3BBWA 4YO6A 4XRJA 3KREA 2C3LA 3QTQA 3C0IA 4RC2A 2YM3A 4ACCA 2R3QA 2JEDA 4G3DA 5DEWA 5M51A 3KXMA 3NUSA 2VTIA 1OKVA 4FV6A 2FSTX 3BHHA 5AV3A 4PDYA 3FXZA 5J95A 3PXZA 4TRLA 4D4VA 4DG3E 1OI9A 3LCKA 4JIAA 1Q24A 4CFVA 2QKRA 5FWKK 3ZOSA 4X6RA 4XHKB 3HRCA 3NW7A 3ENMA 3T8OA 3HA8A 1UV5A 2QO2A 3T3UA 3I0QA 1GNGA 4IWQA 2IJMA 3QTRA 1OPLA 1ZZ2A 3BELA 4FTIA 4FGRA 5E7RA 4RIYA 4LGGA 3QFVA 4HCTA 4R1VA 3RMFA 2W0JA 4C4HA 3PVUA 3Q2MA 3WZDA 5CAVA 2UVZA 4GV1A 3QXPA 4N6ZA 1XJDA 3R2YA 4CFFA 1OPKA 3MBLA 5AUTA 2UZBA 2VWUA 3EQDA 4J8MA 1OL1A 3NZ0A 1FVVA 1S9JA 5AADA 4LOPA 3O50A 2QHMA 4HOKA 2QOIA 4FL1A 5A4LA 5L6OA 5LMBA 2RKUA 3OXIA 5FGKA 4G3FA 2WQBA 4K11A 2YCFA 3Q4CA 2F49A 4WOVA 4IZ7A 2Q0BA 1P4FA 3HRFA 3W2CA 4E5AX 5LXMA 4MXXA 1OL2A 1YWRA 3QRUA 4EL9A 4CQGA 4M0YA 4U45A 2ZJWA 3PPJA 2HW7A 4MKCA 1PMVA 3V51A 4UEUA 5EQEA 4G17A 1ZRZA 4Y8DA 2GFSA 4QTDA 4JIKA 4QP3A 5CVGA 3PY1A 3EHAA 5H8GA 3ZU7A 3MGYA 5HOAA 2IVSA 3IOKA 5C03A 4S2ZA 4XJ0A 4C62A 2WMAA 5IQGA 5HTCA 5IH5A 2FSMX 5H3QA 3C5UA 1ZMWA 5KMMA 1MP8A 4FX3A 5LWMA 5KO1A 3L8XA 4WUNA 4JAJA 4XG7A 5E8YA 4NM0A 4EWHA 5M53A 2IZRA 4IFCA 2BDFA 3NS9A 4XBUA 1ZYSA 4FKQA 1PY5A 2BZHB 4EEVA 3P1AA 3C1XA 2PUPA 3JXWA 2A2AA 2QHNA 2Z7RA 3SV0A 3M2WA 3WARA 4YJUA 5HX6A 1W98A 2WOUA 2VUWA 3BE2A 3TDWA 4IQ6A 4J8NA 2I40A 1GIJA 3E8NA 3R7VA 4TYJA 3E8EA 3MH2A 4PL5A 3LLTA 3VWAA 3WZKA 4BKYA 2XYNA 2A1AB 3UIBA 2UZVA 4ANMA 4C8BA 3VS0A 4AE6A 4U97A 4QMLA 4IWPA 4EH7A 3I79A 4KINA 1PHKA 4W9XA 3NUAA 2PVMA 3RZFA 3NEWA 2GNJA 4GH2A 3WILA 4QQ5A 3G6GA 3EFJA 2I6LA 3VHKA 2E9VA 5CEKA 4IACA 3FY2A 3DB8A 3W18A 2QOCA 4AU8A 3ZYAA 3FZSA 3N4UA 4FZAB 4JRNA 4ANOA 4O0SA 5EYCA 4H3BA 4PNIA 4C59A 1PXIA 2P0CA 3CP9A 4FVRA 3TWJA 3D0EA 1JSUA 3MW1A 4FSYA 4O0YA 5ANDA 5K4IA 3U9CA 1YXSA 2VWYA 4IDVA 2DQ7X 5CF5A 3JR1A 2WQMA 3MDYA 2B4SB 4JDIA 5JSMA 1U5RA 4GIHA 4ZP5A 2X7OA 3TZ7A 3UZPA 5ITAA 3OMVA 2VTNA 2JC6A 3Q9WA 1UVRA 5EFQA 4AW0A 3QYZA 1OB3A 4RWLA 4XCUA 2BKKA 1XHAA 4UZHA 1SNUA 3WYYA 4FG9A 2GCDA 5H8EA 4DCAA 2XK6A 2VX0A 4MXOA 2UV2A 4RVMA 3N4TA 5DLSA 3QZHA 3CTQA 5L2SA 3KEXA 1ZYCA 2ZB0A 4L42A 1G8SA 4BN1A 1H1PA 2RL5A 1YDRE 3M1SA 1M2RA 4JS8A 4BGQA 4FTKA 4A9TA 1DM2A 2DWBA 4LOQA 4O0TA 2ESMA 4U5JA 4JQ7A 4BICA 4DFBA 4QMSA 1OKYA 3WF6A 2W05A 3FZOA 4FSQA 3V8WA 5J8IA 4MWIA 4X2FA 2XKDA 4PMPA 2ZDUA 3DJ6A 2GNGA 3LMIA 5JZNA 2PVNA 2W5HA 4FG8A 4PPBA 2FSOX 2WXVA 3IK3A 3O23A 4OBOA 3P79A 5HG9A 3TDVA 2JKMA 5DEYA 5DPVA 2J4ZA 2BRNA 5DNRA 3JYAA 4L6QA 4HGLA 2XKCA 1BKXA 2NO3A 4D2WA 4IAAA 4YBJA 4RLKA 4OT6A 3FI4A 4LL0A 1OECA 3MESA 1IRKA 2O65A 4D1XA 4DE4A 3UODA 4CT2A 3GC0A 3QCYA 3GC9A 3W55A 1J3HA 1OMWA 5IISA 1J1BA 2VRXA 4YHFA 2Q83A 2R3OA 2CGVA 3E3BX 4XP0A 4ZZMA 3FLSA 4EOSA 4AT4A 3CSVA 3HGKA 4RFZA 4DEDA 2BILB 3PTGA 4FODA 2X9FA 3ZDIA 4IZYA 3FPQA 3NNWA 3OXZA 1UWHA 4U81A 4AOTA 3V6RA 4JJRA 4USEA 4O22A 4IHPA 4A9SA 3UPXA 5J79A 5A4TA 4CZUA 3B2WA 4N0SA 4IM2A 2JLDA 1W7HA 4IC7A 3NWWA 4FNXA 4I6BA 4RJ5A 4F9WA 1PXLA 4NIFA 4GSBA 4QYGA 5KZ0A 5T6KA 4BCGA 4IAFA 3ZLYA 5JGBA 3BE9A 4GJ3A 4FGBA 4GW8A 2WO6A 4HYHA 4BZOA 3C4ZA 2QQ7A 5IG1A 1MQ4A 2XM8A 5CF6A 3W33A 1YHSA 3F5GA 1MQBA 5I3RA 5J87A 4R5YA 5HGIA 4CRSA 3SXFA 4CTCA 3IW4A 4YZBA 5F94A 4K77A 2BHEA 2BR1A 3EQFA 2YCSA 1YDTE 2EVAA 4KBCA 3CJFA 3QCXA 2J5EA 2GMXA 3ORPA 4DCEA 3C4EA 2HZNA 1YXUA 2CLXA 5DE2A 3OHTA 4FT0A 5LWNA 1H01A 2YCRA 4NYEA 2X8EA 3RINA 3R63A 2QC6A 3GOPA 5FM2A 4QT1A 4PL3A 2WTCA 3RHKA 4D2TA 5CI7A 1FINA 2C0TA 1KUTA 2X2KA 3D5UA 4EK3A 5CSXA 5HO6A 2BIKB 4K33A 3PJ2A 3REPA 4U0IA 2V55A 3H10A 4GCJA 5CQWA 3BHUA 4YO4A 4FZDB 5EHYA 2Q0NA 3C5IA 3EKKA 2X4ZA 3OC1A 2XNGA 3N51A 5DGZA 1ND4A 3OCBA 2EXEA 3DZQA 2C5OA 2R0UA 4L53A 3EWHA 2B9FA 2UVXA 4BDCA 2RF9A 2WIPA 4LOOA 4Y72A 2EXMA 4U8ZA 5KCVA 3FZ1A 5HG5A 1PXPA 1YQJA 3JPVA 3V5QA 3EOCA 3ZUTA 1F5QA 4FOCA 4J1RA 2FSLX 4KKGA 5CVHA 4D4RA 4FIFA 2O0UA 1GIHA 2ZMDA 3TUCA 4L8MA 4G3CA 1YKRA 3BHVA 5B2LA 3FKLA 4CMUA 5KMOA 4QTBA 4D0WA 3HKOA 3NW5A 5A46A 3RP9A 3L9LA 3NCZA 3NSZA 5I9VA 5TE0A 3P7AA 4OLIA 2ZV2A 1R78A 3LXLA 2F57A 2X6DA 2BKZA 4M13A 1VR2A 4GFMA 3ALNA 3ZXZA 3WF8A 2R3LA 3ZRLA 3QTUA 1DI8A 4ZAUA 4PP7A 4DTAA 4JQ8A 2JDOA 3G2FA 3MFUA 2J51A 5D1JA 5IH6A 3FZPA 4B6LA 2GS2A 3RTPA 1ZAOA 3NLBA 4CFUA 3QBNA 3KK9A 1H1SA 4RIXA 4CMTA 2UW8A 1QPEA 3AT3A 3DCVA 2ZM3A 1JKSA 4RZVA 3U51A 4JDJA 1PMNA 4DFXE 1PW2A 4U44A 2X39A 3GFWA 5HU9A 3F5XA 2FVDA 4FTTA 4W8DA 4YC3A 2R0IA 3GP0A 4WBOA 4QYFA 4YC6A 3O96A 3OW3A 3WYXA 1G5SA 3DK7A 2WTKC 3BGZA 5GJGA 3MPAA 2C6EA 3MIYA 3QC4A 2YACA 4IDTA 1ZOHA 2PE2A 4FSNA 5AIKA 4AW2A 4CEGA 4O6LA 3E7OA 4A4XA 4AG8A 2GSFA 1ZYJA 3D2KA 4ANBA 3EQHA 4MBJA 3TTJA 1B38A 2IZSA 4WNMA 2XKFA 3SHEA 3QHWA 5AFVA 1Y91A 5DWRA 3R73A 4BRXA 4F64A 4E1ZA 3KF4A 1O6LA 3EL7A 3QLFA 4P7EA 5CX9A 3F5UA 3JS2A 3PRFA 4AZWA 2Y4IB 5E9EA 4NM7A 5L2IA 5E8TA 2EUFB 5FLFA 4ZY4A 3VBYA 3WF7A 2VZ6A 3TN8A 4JLCA 4C34A 4QRCA 2XM9A 4W9WA 2XUUA 4A4OA 4CVAA 3BLQA 2XIRA 1OZ1A 4KABA 3LFAA 5CU6A 4E7WA 2KULA 5BQ0A 1KOAA 3LCOA 3H4JA 4K18A 5E8WA 2F7ZE 3GU4A 5IMXA 3IDBA 4J95A 2C3KA 4DEGA 3E93A 5FTQA 4M97A 3ORTA 4WNKA 4F99A 5I0BA 2VTMA 5LJJA 4N57A 4R3CA 4YLJA 1ZZLA 1OITA 3QKMA 3NCGA 3QZGA 1LEZA 2OICA 3NRMA 4JNWA 5GHVA 3C4WA 4IIRA 4AZVA 5E1SA 3FMDA 2B54A 2RG6A 4HYUA 4LYNA 2PZ5A 4U79A 4FYOA 4AN9A 3U87A 2C68A 4ZY6A 2VTJA 3DV3A 1YXTA 2UW0A 4LV8A 4QMTA 5KE0A 3R8MA 3VC4A 2BRMA 3GBZA 3R7GA 4PX6A 3BI6A 3RPSA 3ZC6A 1Q3WA 3BCEA 4NM3A 4YTHA 2PK9A 4IB0A 5AP7A 4JL9A 4NEUA 2IW8A 4L3JA 3TZ8A 4D4SA 3VW8A 3EQIA 5IA3A 2PZYA 3HDNA 4RFYA 3QZIA 4HPUE 3R7IA 3GU5A 4Y85A 4CFNA 2B55A 5D12A 3FMHA 1A48A 4HNIA 2JITA 4XLIA 3R6XA 4D4YA 4Q5EA 2OO8X 3OVVA 5DR2A 3I7BA 4AW1A 3W1FA 2C0OA 3B8RA 3CEKA 3OROA 3PZEA 4F7LA 4RC4A 4E73A 2JGZA 3ORKA 5G6VA 2BALA 3PFQA 4FV2A 2BTRA 4IFGA 4H1JA 2WQEA 4CNHA 4ZTHA 2GNIA 5KBQA 3HMNA 3OEZA 1V0OA 3EN9A 3PXKA 5FTGA 1RJBA 3WBLA 4UWCA 3R9NA 4C0TA 3DFCB 4ID7A 4FEWA 5ANKA 4YZDA 4EHGA 3DQXA 3CXWA 4FSZA 4B7TA 1PXJA 3ZSHA 3A7GA 3PVWA 4OTRA 1MRVA 5GIPE 5F9EA 4FV7A 5HESA 4IC8A 2B7AA 1QPJA 3A7FA 3PP0A 4FMQA 2C6IA 2X7FA 4NM5A 3KMMA 1NXKA 3MV5A 4ZSJA 2GS6A 1Q8UA 4IZAA 2F4JA 2ZAZA 4GYGA 3Q9ZA 3FYKX 5D9HA 3Q5ZA 4BTMA 2F7XE 4DH1A 5L6WL 4DFYA 2PULA 2F2UA 3LJ0A 3PJ1A 5IDPA 2OKRA 3EIDA 3SRVA 1XBCA 2UZOA 3H0YA 5HCZA 2ETRA 4OT5A 3NMUF 4R7HA 4FZ7A 1YOLA 2RFSA 4I6HA 4NKAA 1LPUA 3R1SA 3R0TA 5DN3A 4CZYB 2ETMA 4QMPA 4DTKA 2CSNA 4PMSA 2XKEA 2BDWA 4GU6A 2O3PA 4IBMA 2I1MA 3OCGA 4G6OA 4OTFA 3VS5A 5AMNA 4FEVA 2Z8CA 3JVSA 1F3MC 1XKKA 3QKLA 4L00A 4FSRA 4RQKA 3SXSA 2WMQA 5FEEA 1GZOA 4Y5QA 3Q2JA 4NL0A 3I81A 2G2FA 3O51A 4X2KA 5ACKA 5AR3A 3RI1A 2ITOA 3Q9XA 4TW9A 1JLUE 4KKEA 5ANGA 2BRBA 3TJDA 2B9HA 5CZIA 4IB5A 3F3VA 3LMGA 3PA3A 3TZ9A 3HUCA 4CFMA 2BTSA 1IG1A 4QPAA 2JIVA 2VTLA 1W84A 4DBXA 4IX5A 5FM3A 2Z7LA 3PY3A 3DT1A 5HE3A 4GMYA 3A2CA 4AT5A 4BHNA 2PVKA 3MA6A 5JEBA 3BHYA 1YRPA 5HHWA 2YIRA 3QX4A 3QCQA 3ZUVA 3OOMA 4FK3A 1JPAA 4NSTA 4QP7A 5F4NA 2QLQA 4Z7GA 5DMZA 1PYEA 3EQBA 4JR7A 4ZXTA 3VULA 4UX9A 3H9RA 4CCBA 4AP7A 4F6UA 3UQFA 5K0XA 1R3CA 2A4LA 4E4LA 3FMMA 3UZTA 3ZEPA 4OGRA 3QQGA 5IQBA 1JBPE 5KMJA 3UNJA 4O86A 2J0MB 4S31A 4O0RA 2WTIA 4AN3A 4TY1A 2WTJA 2XIYA 5CT0A 3Q5IA 4WG4A 2UUEA 5I9WA 2VNWA 1JOWB 4GUBA 2Y9QA 4D28A 3PG1A 5GJDA 3QU0A 2XH5A 1YOJA 4PTGA 4C4GA 4E6CA 5JFVA 3AC1A 4ZLYA 5EI8A 3PLAE 2E9NA 3D7TB 1XH9A 4FT7A 3TG1A 1U54B 4QD6A 4F6WA 2R7BA 1GZNA 5C1QB 1YI3A 4G3GA 1O9UA 3D5VA 4E5WA 4ASDA 1APME 2BAJA 2HZIA 2JIIA 2R3JA 4MCVA 1OIRA 3KRRA 1AQ1A 4RMZA 5AP4A 4YLLA 3QLGA 4EQCA 1NY3A 4TL0A 3LFBA 2WMSA 1JAMA 4U80A 3VUKA 5BUEA 1XH7A 5IEYA 2E9PA 4XBRA 5A6OA 3IPHA 4RBLA 4GJ2A 3F2RA 4BCPA 4II5A 3B8QA 3RGFA 4O0VA 4FVPA 3D83A 4MNFA 5AAFA 5CLPA 3D4QA 4X3FA 4RIXB 2WU6A 4JBPA 2OIQA 4EHVA 1YW2A 3G5DA 1FVRA 4ZTSA 3AXWA 2V62A 5HE1A 3UQCA 2C4GA 3KXXA 2BIYA 3C0HA 3KULA 3MIAA 4O7ZA 4CV8A 3PDTA 3QGWA 4FYNA 4LRKA 3BGPA 5HO7A 4BZDA 4CLIA 4EH4A 4FIJA 3ATSA 1QPDA 5J9YA 4RIYB 5AR4A 3BV3A 4I41A 4TYHB 3K3JA 5J1WA 2W1IA 3PLSA 3V5TA 4PNKA 3V5PA 4QQJA 2X4FA 1KV1A 2QR7A 2XJ0A 5T3QA 3RPRA 4JVGA 1R1WA 2P4IA 3AD4A 3ZLWA 1MUOA 2XCKA 5FQDC 2VTAA 4KUJA 5BYLA 5HBHA 3EN7A 4UMTA 1XWSA 4FNYA 4IX4A 4JX7A 4PWNA 4DH7A 4EH3A 5GINE 4YJQA 5HO8A 4WIHA 4TZRA 3VS7A 3KXNA 5HNBA 2VGPA 2CCHA 4PPCA 5EOBA 5BPYA 3F2AA 1PKDA 3UBDA 4HZSA 3LCSA 5CY3A 2Y6OA 3AQVA 3CD3A 5EYDA 5AV0A 3ZSGA 2ITWA 4I4EA 4I92A 4ZLZA 2C6TA 3T9IA 2GNLA 3KB7A 3KXGA 2XS0A 3F9NA 4XG9A 4CCUA 2C30A 2IZTA 3OZ6A 3QD0A 3PA5A 4HCUA 4NW6A 3CTHA 4FSTA 3TKUA 4FKPA 2QCSA 5HVYA 2P2HA 1H1WA 4O27B 5AUXA 3NUYA 4J98A 3ZO1A 3R8LA 3VUIA 4E3CA 3PSCA 4KIQA 4QPSA 1DI9A 4OTDA 4RWKA 5HCXA 4U7ZA 5CASA 3CJGA 3AC4A 5AP6A 1ATPE
chains in the Genus database with same CATH superfamily
4R8QA 3HZTA 4HVIA 2CHLA 3EQPA 4FT9A 4XYFA 3W0MA 5CVFA 4I5MA 2ZM1A 1H00A 5EI2A 5FXRA 5EG3A 2W1EA 3FPMA 2VD5A 4YUQA 2VTOA 2DYLA 3AMAA 3ODYX 2JDSA 3QQLA 4WHZA 4XV9A 3W8QA 4BCKA 5AAGA 2X0OA 2NP8A 2EU9A 2ITUA 2YM8A 3PIZA 4TPTA 4Y83A 5BVKA 3A4OX 2PVLA 4L3LA 2IW6A 2I0YA 2XIXA 5ANEA 5IQDA 3ZLSA 3ZCLA 5HIEA 2O64A 3QA0A 3ZM9A 4OBQA 5FDPA 2B9JA 1ZMVA 2PL0A 3IDPA 2R2PA 3OUKA 3P7BA 4HGTA 4C4EA 4FKJA 4XV1A 4DEIA 4DGMA 5DR6A 5HLPA 2QD9A 3OG7A 3C7QA 4EH2A 4U3ZA 2VO6A 4V01A 3A61A 3QUPA 3DBCA 2Z7QA 1FBNA 4EHEA 3EKNA 1PYXA 4RIWB 3U55A 2Y7JA 3A99A 5A4EA 5JKGA 1Y6BA 3DKCA 5ETCA 4I23A 3RAWA 3W10A 2XK9A 3PVGA 3FMEA 4RVKA 3W8LA 4BCHA 3OXTA 4DBNA 3MH0A 2RFNA 3S4QA 4RWIA 1K9AA 2GNFA 2VV9A 3PWDA 4LI5A 5AJQA 2EXCX 4CRLA 3UTOA 4BBMA 4F4PA 2BZJA 2G9XA 5LMAA 5C4KA 4FG7A 4UWYA 2J0KA 2RG5A 4YJTA 5KMKA 3A62A 3LM5A 4XS2A 2WIHA 2YDIA 3Q6WA 1WZYA 2W1DA 2C6DA 3S0OA 2BAQA 2Y8OA 3NAYA 2LGCA 5CEMA 5FBNC 2CNVA 4MD7E 2RSVA 3BGQA 3K2LA 3LFQA 2W1HA 1IEPA 1M2QA 2W1ZA 3C13A 5DHJA 4BYJA 4BDJA 5J5SA 5M57A 4BVUA 4M15A 1KE7A 4FKVA 3HL7A 1PF8A 2H8HA 4TYHA 1Q8ZA 2JKKA 2UW4A 3FQSA 4JDHA 2I0VA 3JUHA 3RWPA 5HQ0A 4ASXA 5CU4A 1OIYA 4F9CA 1H8FA 2GDOA 4IZ5A 4XG8A 4IX3A 3F88A 4QEBA 5ETIA 5IA2A 2C69A 3ORLA 4I0TA 4JQEA 4JT3A 4O7TA 3V3VA 1J1CA 4ZTLA 4AT3A 2KTYA 3U8WA 4MEDA 3IDCA 4GVJA 5LVMA 4WO5A 2WEVA 3IQ7A 3NNUA 3UNKA 3BL7A 5KZIA 4M0ZA 3TKHA 4ZSGA 2X9EA 2BZKB 1YXXA 2UZUE 5TT7A 1YWNA 3UVPA 4HVSA 3LLAA 5JGDA 4BR3A 1PJKA 3Q60A 3QA8A 5AP5A 2ONLA 3D5WA 2QOBA 4IAKA 3QWJA 4U6RA 1V1KA 2ZFYA 3UDZA 2RFDA 5HU3A 5L6PA 4PTCA 3DNDA 2ITXA 2XNNA 4KSPA 4DH8A 4EOOA 3MB7A 3TEIA 4MTAA 4HW7A 1P5EA 3BLRA 3BYOA 2CGXA 3O2MA 4MWHA 4K0YA 1RW8A 3GT8A 3QXOA 4ERKA 3ZO4A 5A6NA 3QTXA 4TYEA 2YERA 3LMHA 3R2BA 1OKWA 1W8CA 2J0IA 2R3IA 3PUPA 5C9CA 3R9DA 2IG7A 2PE1A 3CY3A 4HGEA 3TL8A 5I9YA 3CCNA 2XJ1A 4MBIA 1OL7A 2C6LA 4F9AA 3ANRA 4E6DA 3G33A 5AR8A 5KUPA 5EQYA 3P08A 1IA8A 2XEYA 4F09A 4FJVA 4F65A 3IG7A 4RWJA 4O83A 3H30A 4IVDA 3ODZX 1H24A 2FB8A 3DXQA 5AP0A 2VO0A 4W4WA 1SVHA 3QD4A 2J50A 3ULZA 4O0XA 3E7VA 3LZBA 4CXAA 5A14A 2R7IA 5ACBC 5C26A 5AA8A 4RX9A 3R8VA 4BWKA 2OJFE 1PXMA 4YHTA 4YJPA 3OWLA 4Z7HA 1WBSA 1Y8GA 2JIUA 1XH8A 1FPUA 3HP2A 3HMIA 3QQFA 3K5VA 1R0EA 4J96A 5DH3A 4AS0A 4BCOA 5IA0A 5J1VA 4AGCA 2PVHA 3DQWA 3NUXA 4ALVA 4RRVA 3F61A 3UP2A 2PSQA 3FHIA 2C1BA 3BHTA 2BFYA 2DUVA 4H58A 5AA9A 2VO3A 2WOTA 4LG4A 4PV0A 1J7UA 2XBAA 5CENA 5KKRC 4LUEA 2ITPA 3PA4A 5CS6A 4MK0A 1JSVA 2PVFA 5JRSA 4K2RA 4FTUA 2C3IB 4BF2A 3I5NA 3S1HA 2VWVA 4YBKA 2J2IB 4ZSLA 5GNKA 4AE9A 4B9DA 3TNWA 3RALA 3OWKA 1ZY5A 5LARA 3W32A 1DS5A 2UW7A 2AUHA 4PTEA 2PWLA 1BYGA 3NUUA 4YNEA 4DG0E 4FIEA 3EZVA 5L8JA 5F95A 3L8SA 3L9NA 2PY3A 2RIOA 3FMKA 5B2KA 3II5A 5AV4A 3QUDA 3RM7A 5D10A 2W5BA 5BVNA 2H96A 5AV1A 3VBWA 2V7AA 4BFMA 4C36A 2JKOA 5M06A 2WZJA 3LCDA 4M68A 2QURA 5EH0A 4O96A 1T45A 2BRGA 2OFUA 2VO7A 4V0GA 1FGIA 5CEPA 5HIBA 5CF4A 4FRFA 3MFSA 1BL6A 4M84A 1XQZA 4GKHA 2QO7A 4BCFA 4CKIA 2CN8A 3FSKA 3RHXA 2WQNA 4P5QA 4PPAA 2JDTA 3FMNA 5IUIA 3TUDA 1A9UA 3F69A 3RNYA 1SM2A 1HCKA 4MH7A 3P86A 4YSJA 2CNQA 1NA7A 4FTRA 4R5SA 4XG4A 3UOHA 4ZZOA 2I7QA 2WB8A 3UC4A 4AZTA 3OCSA 3C4XA 4JBQA 3PXYA 1UKHA 4JR3A 4R1YA 5HG7A 3EQCA 3VW6A 2NPQA 4RX7A 3SC1A 1T46A 4ZLOA 3F3UA 3MVHA 2V5QA 2YIQA 4H05A 2YDKA 4HVHA 4GK4A 1OBGA 5DT3A 4D2RA 3DKGA 1SMHA 2W5AA 2P2IA 2P3GX 3QL8A 1ZLTA 1O6YA 3TNPC 4G3EA 3V01A 2XK3A 4M7IA 2BRHA 4OTHA 3DB6A 4RG0A 4H3QA 2OIBA 3Q9YA 5CQUA 3W0OA 3CTJA 4UY9A 3IGGA 4Y73A 5BYZA 3FV8A 2QNJA 5CEOA 3OY3A 3CE3A 3DU8A 3VIDA 3NYNA 3HMPA 2CMWA 4PF4A 2WMRA 4DH5A 5DRDA 2UZTA 3UIXA 3VF8A 5E90A 4BDFA 4XX9A 5I9ZA 1Q8WA 3ZFMA 4QTAA 5BV3A 3KCKA 4ZSEA 4D1ZA 5M07A 3DBEA 4GT3A 2XB7A 3OT3A 3TTIA 4E26A 4Z3VA 1NT2A 3DK3A 4WRSA 4WSYA 5KMLA 4F70A 4QTEA 3KRLA 3K3IA 3RK9A 3PXFA 2JAMA 3SOCA 4D5KA 5FDXA 5JQ5A 4DYMA 4BTFA 1G3NA 4IW0A 2GNHA 3KU2A 5IQAA 3DAEA 4WG3A 3FDNA 3P0MA 5DR9A 3LAUA 3AC8A 4HJOA 2X1NA 3TV7A 3BQRA 3OP5A 4IANA 2OI4X 3ZLXA 3SGCA 4FT3A 5JGAA 1ZY4A 1QMZA 5J7HA 3ZO2A 3NIZA 4KRCA 4YZNA 3LXPA 3VUMA 3S3IA 4ZTMA 1TKIA 3D14A 5HG8A 3UQGA 2R3RA 2ZOQA 3IW5A 4UWBA 3V8SA 2BDJA 4D2PA 3QF9A 2PPQA 3VVHA 1FQ1B 5K0KA 2QO9A 1YWVA 4I5HA 4AF3A 4FA2A 1BI8A 5I3OA 4I3ZA 3IW8A 4EBWA 4ACDA 4I0RA 4IVCA 4AZEA 4PDSA 2W06A 1O6KA 4L7SA 5BYYA 3FI8A 4M3QA 3MYGA 4GT4A 2P33A 3Q4ZA 4BHZA 4XMOA 4KS8A 5FTOA 4AACA 4NK9A 1REKA 5BUIA 4AQKA 4C33A 4MAOA 5M4IA 3SRVB 3MY1A 1M14A 3OOGA 4KBAA 4IM3A 5EK7A 5JN2A 4NJ3A 3QTSA 1WBPA 3WF5A 2VU3A 2VWXA 3FC2A 5CNNA 3W2OA 5DG5A 4FICA 4EKLA 2YAKA 4XOZA 3HA6A 4S33A 4MX9A 4YJVA 3ORNA 3WOWA 4HNFA 2Y6MA 4TNDA 2GU8A 3CQEA 2UZDA 3NR9A 5ICPA 2G2HA 3BU6A 4Q9SA 3QRKA 4QQCA 4V05A 3ZS5A 1SVGA 3R1YA 4GRBA 2CNUA 2CKEA 2PZIA 4EOMA 1JWHA 4FZFB 2WGJA 4K9YA 5E4HA 2WTVA 2OW3A 4KNBA 3FC1X 2R4BA 2VX3A 3PIYA 3PIXA 4X3JA 3HX4A 5D7VA 2Y4PA 5EM6A 4Q9ZA 4YURA 5EM7A 3HAMA 1UKIA 5L3AA 4E4MA 4YSMA 4X0MA 3FSFA 3ZTXA 3L9PA 4UMPA 3CC6A 2YZLA 3N4VA 2YITA 3EQGA 4J71A 5E8XA 4UZDA 2YM4A 1CMKE 4MVFA 3FKOA 4EOIA 2CGUA 4IM0A 5AWMA 3GNIB 3RZBA 1L3RE 3KY2A 5KNJA 1TQMA 3PXQA 3UO4A 3PJ8A 4MD9E 4NKSA 5L8LA 4V0GB 4NWMA 1NVQA 4CQEA 4IX6A 2OXXA 2HXQA 1B6CB 1GZ8A 4O6EA 1WVYA 4XEYA 4AUAA 5AP1A 4K1BA 3OT8A 3LFFA 3MA3A 2ITNA 1ZWSA 3L9MA 1PXOA 2V22A 4E6QA 4JXFA 4J99A 5EDPA 3LJ1A 5L2QA 2IVTA 2YDJA 3LHJA 5G1XA 3NAXA 5KHWA 5CAOA 4CKRA 1YI4A 2CKQA 3DFAA 1H1QA 4M66A 2QLUA 3KXZA 5F20A 2WTWA 2QU5A 3COIA 3F5PA 3MB6A 1Y6AA 4L7FA 1I09A 2A0CX 3BWJA 2PVRA 4TN6A 3R9RA 3R71A 3HDMA 4H36A 2AYPA 4QO9A 5L2WA 2QU6A 3BYSA 4QP6A 4EZ7A 3QCSA 4I6FA 4Q2AA 2WMVA 5BVFA 2WMXA 4A7CA 1R0PA 2AC3A 4YNOA 5ANIA 4FTNA 4G9RA 2AEGA 3GVUA 3MN3A 4ITIA 1STCE 3VUHA 4DGOA 3VBTA 2G2IA 4P90A 4E6AA 4YTIA 3FL4A 4G9CA 3ZXTA 2W4OA 3ORMA 5CYIA 1HCLA 4WSQA 5HNIX 1CTPE 1OL5A 3QQJA 3PSDA 2HK5A 3WZJA 3O8PA 4IVAA 4EH9A 3BZ3A 3NIEA 4O0UA 3QTIA 4F0FA 3VN9A 1Q99A 5IF1A 4EBVA 3KA0A 3BEAA 4NW5A 3ITZA 3O8TA 4DEAA 3UIMA 3OS3A 3OUNB 2H6DA 4UMQA 1WBTA 5DOSA 5CEQA 2OJJA 4FIGA 2ITTA 4HGSA 5HLNA 3R21A 4G1WA 4JG7A 4ZTQA 2ITZA 1PMUA 2XK8A 2YIWA 4KD1A 5AUYA 3EFKA 4QP1A 5H2UA 4B99A 5GZ8A 4MXYA 2FH9A 4DDGA 1TQIA 4L44A 3LVPA 3ZZEA 3FJQE 3KKVA 3FI2A 3CS9A 4YPDA 4DFZE 2IWIA 1CDKA 2HY81 3A7HA 2Z02A 4D0XA 1BX6A 1VJYA 4YP8A 3W2PA 2R3HA 4ZY5A 4UALA 3UO5A 1REJA 4UXLA 2GS7A 3FLNC 4LUDA 1YI6A 4R3PA 3BYUA 2X6EA 3GQLA 4M14A 5M08A 3BRBA 4FKLA 1NVSA 2YZAA 2X0GA 2PMOX 3FAAA 4X6QC 4USFA 5GZAA 2G01A 5LVOA 3Q04A 5K5NA 3DAJA 2R3MA 3UGCA 2PTKA 4Y95A 1AD5A 3FI3A 3MPMA 3MVLA 4YJRA 4O84A 1CKIA 4PL4A 2PMIA 3FLQA 1KSWA 3ZDUA 2OXDA 4BL1A 2GPHA 2WD1A 5CNOA 1OBDA 4P2KA 4RIWA 4TNBA 3Q32A 3R04A 4WA9A 4D2SA 3Q53A 3VQHA 4U41A 2C5VA 1PMEA 4EOQA 2W1CA 3TM0A 4JBVA 3SW7A 5CU3A 3WI6A 4FNWA 2R3KA 3THBA 3SX9A 3TNIA 3IO7A 4TWPA 3DZOA 4NUSA 5AP2A 4NCTC 3ID6C 2OWBA 3BKBA 5L2TA 2OSCA 3F6XA 4AAAA 4DITA 3I0OA 5ETFA 5TF9A 4O38A 2OJGA 3CQWA 1ZOEA 3DY7A 4IWDA 4BDKA 3LFDA 2E9UA 3EFLA 1FMOE 3R7UA 4DFLA 4ZJIA 3C0GA 4RJ3A 4ASEA 4FV0A 4E4XA 2O63A 3CKWA 3QC9A 4RZWA 1XH4A 3KRWA 5CXHA 4FV4A 3QHRA 3DBDA 4O2PA 3OCTA 4MYGA 3G15A 5HBJA 2VWIA 4L68A 3MVJA 3UVQA 2ZV8A 4X2GA 4C58A 5B7VA 4O7WA 4JX3A 4IB1A 5EW8A 3VS3A 4EZ3A 5IUHA 3FY0A 4UMRA 5JZJA 5KMNA 4CLJA 5M56A 4U43A 4WNOA 2X81A 4U3YA 3OTUA 1BI7A 2X0PA 3GC7A 5FEQA 1WVXA 3ZM4A 1U59A 3F2NA 3EL8A 4YJNA 5K3YA 4X7QA 5D7AA 5IPJA 1ERKA 2Z7SA 4D9UA 2VNYA 5CSWA 4L67A 4GVAA 4WT6A 3MWUA 5E1EA 1WVWA 3EYGA 1UNLA 4EK6A 1Z57A 4EWQA 4XRLA 2X8DA 4FR4A 3UIUA 4JG8A 4YJSA 3ZUUA 4KAOA 2OF2A 4O21A 3OBJA 4RT7A 1XR1A 4LMUA 3V04A 2E2BA 5FBOA 2AQXA 3E3PA 3SLSA 3PE2A 1ZMUA 4BZNA 4D58A 3SKCA 4HPTE 2PZPA 2X2LA 3R1QA 5AUZA 2LAVA 1G8KA 4F7JA 3KQ7A 4XG2A 1U5QA 2C6OA 3I6UA 3UVRA 5LVPA 1PRYA 3W0SA 4FV8A 4U42A 3V6SA 3EB0A 4AW5A 3ETAA 1WAKA 2CGWA 3O71A 3U4UA 3RK5A 5IA4A 4RFMA 4NT4A 3TNQB 5IA5A 5BMSA 3GGFA 1KE8A 5HE2A 4AXCA 4UB7A 3KULB 5HORA 3CLYA 3QRJA 3CKXA 2EB2A 2QOOA 2R5TA 3KC3A 4IH8A 5I4NA 5JMSA 3NNXA 4EJNA 4I20A 1JNKA 2A27A 2IVVA 3CPCA 4KBKA 3SW4A 1G8AA 2YABA 5KKRB 3FUPA 3EFWA 4PUZA 5IQHA 3ANQA 3W2RA 5JFSA 2QKWB 4YC8A 2ZV9A 4YPSA 4O1PA 3PUFC 3R9HA 2JDVA 4DHIB 3MY5A 2JBPA 4RVTA 1JQHA 4Q5HA 3E63A 2X8IA 5IU2A 2OXYA 4FTJA 4BGGA 4LDTA 3QUEA 2QG5A 4BI2A 1M17A 4XP3A 1PKGA 5IMEA 4YGAA 3QGYA 4GUEA 3MS9A 4IEBA 2QOKA 2GQGA 3KN6A 3EQRA 1Q97A 2PYWA 4QTCA 3OWPA 3RJCA 3RK7A 4DGLC 2CCIA 3WIGA 2HYYA 1URWA 3FBVA 1OGUA 3PPZA 4EOLA 5EKNA 1KE5A 3H9FA 4FNZA 4NFMA 2XNBA 3FLZA 4O4FA 3EJ1A 4F7SA 3FMJA 3BX5A 4FUXA 5CSVA 4ALUA 4ASZA 4LM5A 1KOBA 3COHA 4ANLA 2PUUA 4BDAA 4F08A 4K6ZA 3A7JA 5K4JA 3UE4A 4RJ6A 5GJFA 2W9ZB 2QVSE 4EUUA 3CQUA 2XAOA 2YM6A 4KIOA 4EK4A 3QQHA 2WTKB 3R7EA 2BHHA 4FTAA 5M44A 4F9YA 1BMKA 4EHZA 1NVRA 2J6MA 4IJ9A 4ZK5A 4UN0C 2HIWA 2YCQA 4B0GA 5IH4A 3NNVA 4A07A 4A9YA 3DLZA 3K5UA 2ZM4A 5CWZA 3VHEA 5HVKA 3ZZWA 5DBXA 3VAPA 5CU0A 3RPOA 3DDPA 3FE3A 5EHLA 4AGWA 3ZHPC 4YJOA 5FRIA 5HEZA 5HCYA 4O81A 2W7XA 2X2MA 3E62A 4TWNA 2OBJA 4BCJA 1ST4A 4MXCA 5IQCA 3HLLA 4FK6A 2REIA 5A4CA 2ITYA 1JKKA 5HLWA 2XYUA 4RSSA 1Q62A 4BB4A 3PJCA 4CSVA 4RQVA 3V8TA 2HWPA 5FXQA 4DLIA 3TZMA 4YTCA 4IAIA 4ANNA 2ZDTA 5D11A 4NU1A 2B52A 2WMTA 4L9IA 4F1OA 3LIJA 1GZKA 3R8UA 5I5ZA 5AIRA 2XK4A 4G31A 4UYAA 4J52A 1UNHA 3F7ZA 4WD5A 4BC6A 4CTBA 4DINA 5HZNA 3VRZA 3IW6A 4C61A 2J0JA 3GU8A 4GK2A 3BL9A 2OK1A 4MD8E 4KSQA 3L1SA 2XMYA 1YDSE 2O5KA 4AA0A 2OJ9A 1QPCA 5BNJA 2NRUA 4I22A 2R3FA 3ALOA 1JSTA 2A98A 2XRWA 3A4PA 3JVRA 2QOFA 3WZUA 4AFJA 5DT4A 3KMWA 4FKUA 3VQUA 2X7GA 2OJIA 3Q6UA 3V5WA 2OLCA 4GKIA 5AR5A 4DA5A 5B0XA 4I24A 4FTMA 3M11A 4QMMA 4BWPA 4EJ7A 5E8UA 3NX8A 3E64A 4QYYA 3UMXA 3BIZA 3HRBA 4H39A 4GYIA 4YLKA 3LM0A 3P5KA 2J9MA 2UZWE 1IAJA 4O4EA 4XV2A 4PY1A 5BVDA 2BMCA 3HNGA 4ZOGA 1P4OA 3KCFA 5EDRA 3PRIA 4YZMA 4C3FA 4DH3A 1UWJA 3VF9A 3NUNA 5CSPA 3ORIA 5CAQA 5DYJA 1WBWA 4J97A 2P55A 1F0QA 2NRYA 4I21A 2F9GA 1SNXA 3AT4A 5CSHA 5C8NA 4ACMA 1W0XC 3OWJA 3I6WA 2H34A 4HVDA 4ZS4A 1OL6A 3DGKA 3GENA 3W2QA 1MRYA 4BDBA 4E4NA 4DTBA 4KIKA 5FXSA 3DLSA 4XG6A 3CGFA 3ZO3A 4AX8A 2B1PA 3VO3A 4F1MA 3BU5A 5CAPA 4QYEA 2GQSA 3ZONA 4FZ6A 1L8TA 3DTWA 4EQUA 1R39A 5FP6A 4E93A 4FTLA 3W0NA 4KIPA 1H08A 2XIKA 1XMMA 3KRXA 2C47A 3SG8A 5CI6A 4KB8A 5AUWA 2WNTA 4N70A 4FE2A 4MF1A 1BLXA 3KRJA 3UDTA 1LR4A 3NDMA 5HNGA 2IZUA 4C4FA 3KVXA 2CJMA 5C01A 4MXAA 1ZXEA 4EOKA 5KBRA 1U46A 4NIFB 2O8YA 3FMLA 3NW6A 3PZHA 4TYGA 2Z60A 5F1ZA 2BPMA 3VS1A 5H9BA 5LMKA 1YOMA 4M69A 3UDBA 4ZIMA 4BKJA 3P78A 3R22A 1OKZA 1RDQE 3TUBA 4HYSA 4QMWA 3U4WA 3QKKA 4ANQA 4BKZA 2W1GA 4J53A 2JKQA 3R02A 4FV1A 1WBOA 4C35A 3GXLA 5DI1A 1FMKA 2YIXA 1JKLA 3EMGA 4RJ7A 3W0RA 4FBXA 3GI3A 4ALWA 4C3RA 2E9OA 3JY9A 2V0DA 3MFRA 3R8ZA 5KX8A 1IASA 4NFNA 4R3RA 4IWOA 5C8KA 4XLVA 3EN4A 1H1RA 4APCA 5GIOE 1X8BA 4X21A 1GY3A 2YEXA 5HBEA 3R1NA 5M4CA 5HVJA 5CAUA 3DBQA 5ANOA 3UOKA 5CTPA 4G6LA 4CG9A 1GAGA 2W1FA 4IAYA 2HENA 1OUKA 2UW5A 3VUDA 2IPXA 2PZRA 5CANA 5LOHA 3FLWA 1EH4A 4GL9A 5LCKA 3VS4A 1VZOA 2W99B 3UNZA 5HIDA 4ZSAA 4C2VA 3I5ZA 3PVBA 3AD5A 5EI6A 5AX9A 2C5XA 1J7LA 4RJ8A 3N9XA 3ZMMA 3HV4A 4HZRA 2JDRA 4UV0A 5IKWA 4M69B 3O17A 2OIDA 4W4VA 2UVYA 3CPBA 5EW3A 4DHFA 3W16A 4Y5HA 3MJ1A 5E92A 3UDSA 4JAIA 4AGUA 5DFPA 3FEGA 4QMVA 4KWPA 3E8DA 3FQEA 3QZFA 5LCJA 1RE8A 2WU7A 2CPKE 3E8CA 2FYSA 4OW8A 2FA2A 3KFAA 5AUUA 3TYKA 1H4LA 4AFEA 4W4YA 4G5PA 3ZSIA 2I0HA 2XA4A 4FI1A 3OD6X 3PXRA 2C5NA 4Z9LA 4BIBA 4F63A 4GS6A 4MXZA 2XCHA 3AMYA 3GC8A 4BYIA 4DGNA 5CALA 1WBVA 5M4UA 5M4FA 4QDVA 4GG5A 1GOLA 1FVTA 4CMOA 1Q3DA 3G9NA 4JMQA 3IONA 4RA5A 4AA5A 4BIDA 1YXVA 1OIUA 4BDGA 1MRUA 3HMOA 3HECA 1XBAA 3I7CA 4NJDA 3QRTA 3VUTA 1E1VA 4QMQA 1GIIA 2R64A 1ZYLA 5FP5A 2VWBA 1DAYA 5D41A 2VWWA 3BQCA 4WRGA 3TT0A 1I44A 4L43A 3P5JC 3BLHA 5E8ZA 4O7SA 3ZH8A 2B0QA 2XEZA 3HEGA 4BCMA 1UNGA 4DT9A 4MQ1A 2XP2A 5IA1A 3KK8A 5CU2A 5DT0A 5IEVA 4YZ9A 3WE8A 1G8JA 3LPBA 3ACJA 4O82A 1Q41A 2BUJA 2XBJA 1TQPA 1S9IA 2YFXA 4YR8A 1CSNA 1ZOGA 3DS6A 1FGKA 3GFEA 1A06A 4EOJA 3A8XA 4EYMA 4F7NA 3F3TA 3A8WA 4RX8A 3MH1A 4BCIA 3E5AA 3SOAA 4C37A 2YIYA 4C38A 4NTTA 2XANA 4JDKA 1TVOA 2C3JA 3JY0A 4EC8A 4Z55A 2J7TA 3LXNA 4D2VA 1M52A 3DXNA 3DK6A 4N4SA 2F2CB 2XF0A 3BYMA 4RVLA 5DVRA 2HWOA 4RX5A 4QMUA 3NFGB 4GIIA 3UJGA 1OM1A 3F82A 4R77A 1UA2A 3DOGA 3MTLA 4TWOA 4X2JA 1M7NA 2SRCA 4OAVB 1Q61A 3EZRA 2Y0AA 4O7NA 4TT7A 4QYHA 3FKNA 4JOAA 4WBBB 4FKTA 3PY0A 4PDPA 3GCQA 4DEEA 3FQHA 1Q5KA 4FV3A 4OTGA 3RAHA 2QOQA 3LFSA 4ZZNA 3AOXA 3G9LX 3WF9A 3AKLA 2JD5A 3AGMA 3S95A 4FSMA 4BIEA 2YN8A 4AWIA 2V7OA 3F66A 5CT7A 2PUNA 1WFCA 3R00A 4L45A 5LQFA 3KN5A 3ET7A 3R01A 3VS2A 4JG6A 4QMYA 3IGOA 4KKHA 4TXCA 4W8EA 5E91A 5J9ZA 5B2MA 4OAUC 2XALA 3TKIA 4BTKA 3R7OA 5TOZA 3TIZA 3VONA 3GCVA 1YHWA 2OU7A 5IQEA 4C4IA 4JRVA 3L8PA 4DC2A 4P4CA 4LV7A 4EH5A 3MVMA 2C6MA 3D5XA 4YZCA 4CV9A 2HOGA 4I4FA 4DT8A 3GEQA 4WG5A 3PWYA 3ZBFA 2YA9A 3O0GA 2HW6A 5ANJA 5AEPA 2OFVA 3VJOA 1H25A 3CR0A 3P23A 2XNEA 4FTQA 3SG9A 1WMKA 5BUJA 4ZTNA 3VBVA 2IO6A 3CIKA 4ONAA 4ANSA 2YHVA 4W4XA 3HVCA 1M2PA 4DEHA 3HUBA 2WELA 5BVWA 2GTMA 4G6NA 4FOBA 4JI9A 3Q3BA 4E20A 2CKPA 5EDQA 3FLYA 3ORXA 2UW6A 3HV3A 4BCNA 4J7BA 2XZSA 3QRIA 3GUBA 4YMJA 2XAMA 3SDJA 5M09A 1H07A 4FIHA 4LFIA 4EI4A 4MUQA 1JKTA 2PHKA 2ITQA 2QOHA 3RVGA 3SD0A 5GZ9A 3FHRA 3LOKA 4FKGA 4XUFA 3ZRKA 2YJSA 4Y46A 1UU7A 4GU9A 1QL6A 3TV4A 5J9LA 2VGOA 5EYMA 5K5XA 1K3AA 5BVOA 2NNWB 1K2PA 2DS1A 2WFYA 4QPMA 5IZFA 3UO6A 4OUCA 3DBFA 4G34A 4BY9E 3KF7A 3MJ2A 4FKOA 4D55A 5FUTA 2R3PA 2XRUA 4CT1A 3GCSA 3PE1A 2VAGA 4O4BB 2R3GA 3RPVA 2IN6A 3BBTB 3H0ZA 3FWQA 4ZTRA 4CD0A 1BUHA 3LFEA 3LQ8A 4YU2A 3VRYA 4CFXA 4EOPA 2BROA 3SVVA 3IS5A 4ZMEA 2WKMA 3HV6A 5AR2A 4DAWA 1PXNA 2UZEA 4LL5A 3LKMA 5HI2A 1XH5A 4X3FB 2CN5A 3AGLA 5IQIA 2BFXA 4IXPA 3PJ3A 5T68A 4O0WA 2FO0A 2UZLA 2HELA 4ZMFA 5A3XA 1HOWA 2GFCA 3KXHA 5AR7A 4BDHA 1CKPA 2WPAA 2YLFA 3PPKA 4BDIA 1H27A 4O7RA 1VEBA 2C6KA 4EH6A 3ZC5A 5FD2A 3B2TA 4X3FC 3A7IA 4RC3A 2VTPA 5C4LA 3ELJA 4I94A 4KS7A 4DHJA 3QTWA 3ENHA