1F3MC

Crystal structure of human serine/threonine kinase pak1
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
294
structure length
287
Chain Sequence
SDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIRQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNGTPELQNPEKLSAIFRDFLNRCLDMDVEKRGSAKELLQHQFLKIAKPLSSLTPLIAAAKEATK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords SERINE/THREONINE-PROTEIN KINASE PAK-ALPHA
publication title Structure of PAK1 in an autoinhibited conformation reveals a multistage activation switch.
pubmed doi rcsb
source organism Homo sapiens
total genus 82
structure length 287
sequence length 294
chains with identical sequence D
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2000-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1f3mC02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1f3mC01
4BWPA 2C6MA 5LVNA 2VTPA 2ZVAA 4FV7A 3PG3A 1Q3WA 4JG8A 3WF7A 4F99A 2PY3A 2R0IA 2H34A 3ZTXA 5CALA 2ZB1A 4P5ZA 3HX4A 3II5A 5IDNA 4ASEA 3FMMA 3IDPA 4QMTA 3ZO3A 3FEGA 3ZSHA 4YZBA 2PSQA 4IB1A 2RFNA 3PY1A 3FKNA 2J7TA 3F5GA 4MX9A 3PA3A 4R3CA 2YDIA 4YO6A 4A4XA 3BHVA 2OICA 3ZM4A 4E93A 4D2RA 5M44A 2BAJA 2J6MA 2VU3A 3SW7A 3HA6A 4QTCA 3P08A 4TYIA 5AM7A 5CY3A 4F6WA 5BQ0A 4AF3A 1G8SA 3WYXA 3MY5A 4O81A 2CSNA 2WMRA 2YERA 3CTHA 3QRTA 4L6QA 4QRCA 3AC1A 4YJVA 3TKHA 4FKQA 1GIIA 4M13A 4O0WA 4TNDA 5IH6A 5J1VA 2BZKB 4FT9A 4DH5A 3NDMA 2X6EA 2HENA 4YO4A 3LFDA 2BRNA 1FGKA 3DDPA 3QGYA 1QPCA 1P4FA 4WNKA 1JKSA 2Z8CA 4XLVA 4F7SA 4IAYA 4JRNA 1MQBA 3FZ1A 4PUZA 1YI6A 4YHJA 5HCZA 1Y57A 3V6SA 4O7WA 3HMPA 3PXQA 2GNHA 1Q41A 1Z5MA 2BROA 2C6OA 3HMMA 4IX3A 4OTQA 4D5HA 2HYYA 2WELA 4MBLA 5GHVA 4CYIA 4K18A 4MBJA 4AZFA 3BLRA 3G90X 5L6WL 2CN8A 2OH0E 3TNPC 1ATPE 1ZXEA 3G51A 3PXKA 1QCFA 3UO4A 3WARA 4M68A 5LQFA 2XYNA 3SXSA 4J96A 4ERWA 3T8OA 4BGQA 3AMBA 3EN6A 3KRJA 2QURA 4E6QA 4GK4A 1I44A 4CT2A 4JIKA 4XNEA 3IDCA 3FLNC 3MH0A 4UZDA 3TUDA 4C62A 3IW8A 3A7JA 4U80A 3NNXA 4ACCA 5JT2A 3AC3A 4DITA 3IOKA 2B53A 2YCFA 3ORZA 3EN5A 4BB4A 1XH4A 4GMYA 4OGRA 5CVHA 3E62A 4BCJA 4EBWA 4Z3VA 4NEUA 5AP0A 3IW4A 1RDQE 3OT8A 5E9EA 5CAVA 3RAWA 5H3QA 3PVWA 2OIDA 3A62A 5IH5A 3A7FA 1F0QA 3ALOA 2NNWB 1DI9A 4W9XA 4J98A 4XP0A 3Q6UA 4AACA 2VNWA 4BTMA 2WZJA 4FUYA 3R7IA 3PE2A 1IAHA 5A46A 3DNDA 4L3PA 3PJ1A 4UB7A 5F9EA 5I4NA 4YZ9A 4FZDB 2EXCX 2GNFA 2QHMA 3F3ZA 1KOBA 4KKGA 4ZTHA 2YWVA 1G5SA 3GOKA 2ESMA 2VWBA 1OKZA 4FIFA 2WMBA 3QZIA 3SRVA 2HK5A 3R7OA 1XH7A 3NR9A 1YXVA 2GNJA 3PE1A 5ANEA 4FK3A 4PTEA 4O7ZA 3LFNA 4EONA 1FQ1B 4JIAA 5C4KA 4ZLOA 3UMXA 1NA7A 1M2QA 3ORLA 3ZEPA 3K54A 2OFVA 1ZWSA 2YWPA 4MAOA 4C33A 3R9OA 2E2BA 3ENMA 5CQUA 4GFMA 3DV3A 4DBXA 2WQEA 3M11A 1OGUA 4WBOA 2W4OA 3E64A 3HL7A 3V6RA 4E6DA 5KBRA 3I0QA 5FP5A 4EH6A 1KWPA 5BMMA 2XKEA 1NW1A 1B39A 4BRXA 2F2CB 3BQRA 3DNEA 2PTKA 4H58A 5CU3A 5E92A 3VS2A 3AOXA 4UYNA 4LRKA 1V1KA 4XRJA 5AR3A 4QO9A 5K9IA 1E1XA 5M4FA 5EM7A 3RWPA 5HD7A 2VTAA 2UV2A 4NW5A 3C4CA 4IZAA 4S32A 4XBUA 4FV5A 3U4WA 1OM1A 2WEVA 3EQDA 3KMWA 3PRIA 5IQEA 4RWLA 5H8GA 5F95A 5IEXA 1P14A 5CZIA 4CQGA 4PDYA 5AUYA 3PWDA 1SNUA 4JQ7A 3OY3A 4UWYA 5HOAA 2XKDA 3MIAA 5EKOA 1JAMA 5D12A 3QAME 5FTGA 1R78A 3OMVA 4ZSJA 1U46A 1V0BA 3GVUA 4ARKA 5AAGA 5BVEA 4L52A 3WIGA 4I41A 4FG7A 2VX1A 1I09A 3BYSA 2C69A 3MSSA 5AUWA 3ZHPC 4EH3A 1OIRA 1ZZLA 2WMSA 4MVFA 3QKLA 3GP0A 4UEUA 4EK8A 3IQ7A 2J5FA 4OAUC 3NMUF 1NY3A 1XBAA 2IZTA 4RVTA 3DY7A 2G01A 2XKFA 4LV8A 5AIRA 2GNLA 5AP1A 3PIXA 3F3TA 1YDRE 3DGKA 5FXSA 3V8WA 2J5EA 3QCYA 4L9IA 3SAYA 4P7EA 4IVCA 4RX5A 5AUUA 4DH8A 2A4LA 2WKMA 4OBPA 2YCRA 2RGPA 1E9HA 3QX4A 1WBSA 2V55A 4B8LA 4CV9A 4DCAA 4QTBA 2NP8A 5E8TA 4FKVA 3VQHA 4FNZA 4TRLA 3UP7A 2XA4A 4ZJVA 2C0TA 2PMOX 3QLGA 3R8UA 3V51A 1UWHA 2JFMA 2XF0A 4GFOA 4HGEA 4UXQA 5CEIA 3ZSIA 5I9VA 4ALWA 2I7QA 2YJRA 4L43A 3GCPA 1H07A 2ITPA 1O6LA 2UW3A 4ITHA 5FP6A 3PZEA 3RAKA 4GFGA 3UVQA 4EQUA 3FDNA 2QO7A 3PYYA 4UXLA 3KRWA 3WF8A 2BTSA 3ZO2A 2CKEA 4FZ7A 4YTCA 1MRVA 4Q5EA 3NYOA 4U41A 5DT4A 3KCKA 3QQHA 5CXHA 4QMQA 4KBCA 5M08A 2XRWA 3BX5A 1ND4A 3SXRA 4W4YA 2IVSA 5DR6A 4YC6A 3RI1A 3CGOA 1H1RA 4XV1A 3D4QA 3OF0A 4CZTA 1S9IA 4R3RA 1TQMA 4AE9A 4BDBA 2FYSA 1YHSA 3V5PA 3OS3A 5LMBA 1JSTA 3TL8A 1U54B 4LUDA 3WZJA 1H1QA 3QUEA 3GXLA 4NK9A 3C7QA 2BHEA 1YW2A 5T68A 2ITNA 3O8UA 2C5VA 4IM3A 3UOKA 5JSMA 3FE3A 3S95A 4R7HA 3DU8A 4HNFA 2DWBA 1F3MC 3E8CA 3HDNA 2ITXA 3KXZA 4YMJA 4WNPA 3U4UA 3MN3A 3RJCA 5FUTA 2C30A 5M07A 4K33A 2OJIA 4JX7A 4JBOA 1R0PA 4A4LA 3GBZA 5AX3A 3S3IA 3FHRA 4Y95A 3TNIA 4YU2A 4AP7A 3I81A 5A4EA 3EFJA 3RBWA 2UZTA 2Z7QA 3GOPA 3GC7A 4HCVA 3OEZA 5IUGA 2OLCA 4V01A 5LARA 3C4XA 3NVMB 3EFWA 1BLXA 2UW6A 4NTSA 3FQHA 1KSWA 3PA4A 2BFYA 4GEOA 4E7WA 3ZUTA 2PU8A 4L7FA 4CTBA 5BVNA 1JVPP 4GK3A 3DOGA 4JBPA 4LYNA 4U5JA 3C4ZA 3GB2A 3QUPA 2OXDA 4M97A 5EW9A 5AV2A 3GCUA 2G1TA 1IG1A 2OKRA 5C8KA 1T46A 3NCZA 1V0OA 4HGSA 4ZJJA 4OAVB 4QPMA 1XH8A 2QU5A 4XYFA 3PXRA 4QMYA 2JIVA 1Q8WA 3MIYA 4HGTA 4QYFA 2XIZA 3BCEA 4Y46A 4LGHA 3P4KA 3HGKA 4M8TA 2QQ7A 5CTPA 5ANGA 5CF8A 2HCKA 3TEIA 4FV2A 2R3PA 3OXZA 4AUAA 3LMIA 5J7HA 3KRLA 4X3FA 4I93A 4ZTLA 4I5HA 4YTHA 4G6NA 1M7NA 4DBNA 1OBGA 2X7GA 4ZTNA 4BCMA 4FI1A 3COKA 4RJ4A 3ZC5A 1H00A 3NX8A 3VF9A 3BU5A 2DQ7X 1TVOA 2C68A 1J7LA 5AR2A 1FVVA 5TT7A 4FKSA 2WU7A 4WUNA 3RK9A 4U43A 3KFAA 3UIUA 3BI6A 3OBGA 4EOLA 4TYHB 2PVKA 1H0WA 2V0DA 1PKDA 3KKVA 4Z55A 5BVFA 2UVXA 3QL8A 3D94A 4KBKA 1JLUE 2XMYA 3C4FA 3KMMA 4QQCA 3RAIA 4AZEA 5JH6A 1MRYA 4WG4A 4ACHA 3D7TB 3PY0A 1ZARA 3F61A 4M0YA 4MF0A 2ZB0A 3DZQA 3NCGA 2ONLA 5M55A 5FLFA 1G8AA 3QKMA 2OZOA 3LIJA 3NUAA 4RFYA 3UIBA 3CPBA 2B9JA 3M42A 4RZVA 4BIDA 4P2KA 3EOCA 3ENHA 3R71A 3CC6A 5F1ZA 5I3OA 4BZNA 5TKDA 1UNLA 4LGGA 1TQPA 2W5AA 4FMQA 2WMQA 5CI7A 1JQHA 5HVKA 4DTBA 1DAYA 4CMUA 5J9YA 5EHYA 4F63A 4CLJA 2Z2WA 3N4UA 2GHLA 4UWBA 1WMKA 4MQ2A 2YISA 4H1JA 5D1JA 5FTOA 2Z7LA 3HV3A 3RPVA 4ENYA 5K4JA 5IA2A 3A8XA 3O8PA 2VO6A 3ODYX 2J0JA 4U3ZA 3VC4A 3Q9YA 3AC4A 2HY0A 2PMNX 3K5UA 3Q52A 4I21A 4CTCA 2R3JA 5LJJA 3TTJA 5AAEA 5EQPA 2P4IA 3FC2A 5EW3A 2Q0NA 4IADA 5TE0A 4HJOA 1GAGA 1SMHA 4PF4A 5HLPA 3SD0A 5HTBA 5K5XA 3PWYA 4YJSA 3O0GA 2PMIA 2XJ2A 4IX6A 4EOMA 4D2PA 3GQLA 3W2OA 4CYJA 4OTIA 1W83A 2ITZA 1Q3DA 3NYVA 3NW6A 2F7XE 3T3VA 3D5WA 2E9VA 4U7ZA 4F7NA 3Q9WA 4E26A 1OI9A 3PVBA 4G2FA 1NT2A 3TJCA 4CZYB 2QLUA 3MVMA 4Q9SA 1U5RA 3EQHA 4JNWA 3JY0A 4RVMA 5L6OA 3FPMA 5D9HA 2WMVA 4U0IA 4FKRA 5CYIA 2BAQA 3TWJA 2RF9A 3KXMA 2WMWA 4KSQA 4ZMFA 1YXTA 4C59A 4KSPA 1SNXA 2FA2A 3TNWA 3QD0A 3FAAA 2H6DA 3DFAA 3HYHA 3NW5A 4AFJA 3H3CA 4D0XA 1UV5A 5AUVA 4PPCA 3PP1A 4ZP5A 3R83A 3EN7A 4RIXB 4BFMA 2LGCA 2W1IA 4ZY5A 4I6HA 1KE8A 1YWRA 3GU7A 3VS7A 3R2YA 4O84A 3DB6A 3DDQA 4E4NA 4JQ8A 3U6IA 2AC3A 5HIDA 5HE3A 4EL9A 2Y7JA 3MH2A 1KOAA 2Y4PA 3I6WA 3U9NA 4LI5A 3KMUA 4FIJA 1OBDA 1UWJA 3LMHA 2JKOA 3DB8A 4I1ZA 3HAVA 2QD9A 3GU8A 4HPTE 3KL8A 3JS2A 5LCJA 4F64A 4O6LA 4CCBA 4QP3A 4L01A 4NKAA 4F0GA 4ZLZA 4K1BA 3ERKA 3EYHA 4JT3A 4O21A 4TPTA 3OWJA 2QKWB 3R8MA 2HWOA 1PXIA 3FY0A 4KIOA 3ID6C 4FV0A 4IC8A 4A7CA 4C4FA 3RAHA 1LR4A 4RPVA 5CXZA 3S4QA 2G2FA 3I6UA 4JAIA 4CQEA 5HE1A 4DYMA 3QRIA 4IB0A 1VYWA 4QYEA 1B38A 3D83A 4JQEA 2KULA 4QMOA 2WPAA 5JRSA 4F0FA 1V0PA 2BRMA 3PPJA 4Y85A 4D1SA 4EOQA 4O86A 2B7AA 4H3BA 1WBVA 1PY5A 2W5HA 2C3LA 2OXXA 3VF8A 4RX9A 1HCLA 4AT3A 1GNGA 5L2IA 4EOJA 4OTDA 1JNKA 2IVTA 3K2LA 1JKLA 2UVYA 4KBAA 4EJNA 3MJ1A 5J5SA 4TT7A 4X2GA 5HX6A 5L4QA 4O7VA 5DVRA 2GDOA 3C4WA 2F2UA 2XK8A 4GW8A 3OCTA 5B2KA 1TKIA 4V0GB 4LM5A 4DEDA 5DOSA 4IFCA 5DR2A 5LWMA 3WYYA 5CU6A 2BKKA 3PJCA 4NM0A 4RJ7A 3TG1A 5KX8A 2OZAA 1PXPA 3F2AA 4DGLC 1OL1A 2YM7A 4F1OA 3MPAA 2ITYA 4FV4A 4GT3A 4E5AX 3WF6A 2PZRA 2CKOA 4L44A 4FTRA 5EK7A 5E4HA 3EMGA 4KKEA 4C2WA 3ANQA 5DWRA 2B9FA 3ULIA 4YLLA 3VBTA 4BDKA 1VZOA 4GL9A 3QBNA 4ACGA 4CD0A 3IONA 5HTIA 3MH1A 2R3KA 5KHWA 4HNIA 3EN4A 3M1SA 4MXCA 4YJTA 4C36A 4DINA 4QMWA 4M3QA 1VYZA 3UO5A 1GJOA 5JMSA 2X2KA 4FEQA 3VS3A 3POOA 3ZS5A 2CDZA 2WMUA 2Z02A 4OTRA 4O0SA 4QYHA 4YHTA 5AP4A 3A7GA 2R9SA 3FSFA 3LCDA 3ZLWA 5L6PA 2EUFB 3VBXA 5A4LA 4BYJA 5HKMA 1ZZ2A 2C6TA 4DLIA 4MXOA 3CKWA 4RFZA 4QP9A 5HGIA 4DG2E 5GIOE 4YZNA 5IMXA 4DH7A 1Q4LA 3FZTA 2I0HA 3RP9A 4C3RA 3DAJA 3FI3A 2CCHA 2UW4A 3PJ2A 3F88A 4FNWA 1BUHA 4HZSA 4IB3A 3MVJA 3UG1A 1QPEA 1OKVA 2LAVA 3HMIA 3E87A 4C2VA 2A1AB 4BDEA 5A54A 5ETAA 2VTOA 3ZO1A 4TNBA 3LM5A 2WIHA 4QP2A 5AUZA 5GZ9A 1J7IA 3TV7A 3E7OA 4BHNA 3AQVA 5K3YA 4WHZA 5A14A 3JUHA 3LM0A 4CKIA 4IVBA 3GI3A 4DEIA 3ZFXA 1H8FA 3E8DA 4G6LA 4PRJA 3C0IA 4PY1A 3BLQA 1YXSA 4M67A 2VO3A 3B8RA 4MNFA 4G1WA 3OUKA 1UA2A 4MXZA 2WFYA 3GU4A 4RGJA 2EU9A 4LRMA 4DG0E 4EOSA 5KO1A 1ZAOA 4GUBA 2JDOA 4LFIA 3DJ6A 2JEDA 2R3NA 3MVLA 4AFEA 3FPQA 4DC2A 4EH7A 5KMLA 3C5IA 3OBJA 2OFUA 5C03A 3VUIA 4FC0A 5T3QA 5IMEA 2PZPA 2HZNA 4DGOA 2X9EA 4NFNA 2RIOA 1SYKA 4M12A 3PPKA 4AW2A 4DA5A 2C6EA 3EQRA 4FODA 4ZSGA 4FTTA 4PDOA 4I24A 5G1XA 2W1ZA 4IWOA 2Z7RA 2R3GA 3CIKA 3G6HA 3R28A 5AP5A 3KCFA 5M09A 3M2WA 4I5MA 3SGCA 3KF4A 2QOBA 4UBAA 1WAKA 3TV4A 5KZ0A 5CU4A 5GJGA 4C4GA 1WBPA 4E4XA 4R7BA 3CXWA 3GEQA 4MEDA 4U3YA 3L1SA 2W1DA 5DLSA 5E8YA 2HZ4A 1CKIA 5LVPA 5CSVA 4ASDA 1B6CB 2JIIA 1H4LA 2FSTX 3LXPA 5D11A 3P5KA 5EOLA 3KQ7A 3JR1A 3ET7A 5E7RA 3FLYA 2I1MA 5J95A 3OUNB 3LXKA 1UU8A 4RZWA 4I6FA 4PL5A 3R7UA 3OHTA 5BYZA 3C50A 3ZYAA 3NS9A 3DZOA 5IUHA 4KA3A 4PP9A 2GFCA 2QOIA 5E8VA 2HIWA 2X0GA 5BUIA 2PUPA 5CF6A 3KXXA 2Y4IB 3IW7A 4AN3A 4BYIA 2GTNA 2GS2A 1LPUA 3OWKA 2QG5A 1AD5A 4XV3A 4F4PA 3TZ8A 5CENA 4DFNA 4ZTQA 4B99A 4NIFB 2BKZA 5HESA 2J0MB 2XEYA 4C57A 2ITOA 5J79A 2Y6OA 3V5LA 2X6DA 5JFWA 3U54A 4QNYA 2XIXA 5EYMA 2Z60A 1ERKA 4U6RA 3RINA 4J97A 1PHKA 2QCSA 2A19B 4RIWB 3VW8A 4PL4A 4ANMA 2IW6A 3Q9ZA 4ZTMA 4IAIA 2CNVA 1ZYLA 4ZSLA 4F6SA 1BI7A 1FMKA 2QKRA 3HUCA 5J1WA 3FKOA 3DS6A 3PIZA 4OBQA 4XHKB 4F08A 5BX0A 2PPQA 3V8TA 3QD3A 3R8PA 2XZSA 4F7JA 3EWHA 4C3PA 5KBQA 4JX3A 4AQCA 4RC2A 3PLAE 5CEQA 2QNJA 1IAJA 2P2IA 3TT0A 2X4ZA 2H9VA 3FMJA 4U97A 3DT1A 2CMWA 4NFMA 4QQJA 4N57A 4J7BA 5KMIA 5HG9A 3FXWA 5ANKA 2YAKA 5AP6A 4RJ5A 4W8EA 2GQSA 2NPQA 5HO7A 4WG3A 4XOYA 3OG7A 4F65A 1W8CA 3UZRA 4G3CA 3TIZA 1BKXA 4WT6A 3QF9A 2BIYA 4D28A 1GZKA 3BE2A 1Q24A 3NRMA 5AMNA 1WVWA 1OPKA 3EL8A 1GIHA 3MBLA 4ZS0A 3ITZA 3HEGA 4X3FC 3AGMA 4XG4A 4MWIA 1W0XC 4YBJA 1DI8A 5HNBA 1BI8A 2J9MA 4DGNA 3Q5ZA 3QQFA 4Y5HA 3LW0A 4WSYA 4MH7A 3AC8A 2R64A 3R1QA 2WTIA 4BICA 4GSBA 1OPLA 2BHHA 4P4CA 3LJ0A 4F1MA 4RJ3A 2QOQA 4X2JA 3UOJA 5L2SA 2BRGA 1STCE 2EWAA 2WTVA 4TY1A 4XBRA 4YSMA 1J1CA 1UNGA 3O51A 4FTKA 4N4SA 5EFQA 4BTKA 4D1XA 2ITUA 3ZDIA 2W06A 3ZH8A 5FTQA 3W1FA 5I9XA 4BF2A 4FA2A 3S00A 5IA3A 3L9LA 3DK6A 3DQWA 5IA5A 4DFXE 3NW7A 5CAOA 3F82A 3CQEA 4J1RA 4N70A 4JR7A 4AXAA 4KRDA 4QPAA 5D41A 2ONLC 2HW6A 3LJ2A 3ZM9A 2RG5A 3E5AA 4WUAA 2QI8A 2WEIA 3G9LX 3N51A 5FRIA 4D2WA 3VRZA 2QLQA 4HCUA 4O7RA 5L2QA 4IFGA 4KAOA 5AUXA 4BI2A 4G17A 5HNGA 4QMPA 4APCA 4DHFA 4A4OA 2WTKC 4IJPA 4BKYA 5BUEA 3KA0A 3LFSA 5FBOA 4UMPA 3PSCA 4DH1A 2WOTA 3AC5A 2YA9A 4XX9A 5DBXA 4CT1A 5IH4A 3DFCB 4H05A 2GPHA 3LFQA 2FVDA 3MV5A 4PNKA 3NAYA 3ULZA 3PUPA 3QD2B 5J9LA 2HY81 3KK8A 4ERKA 5JQ8A 4K2RA 4WKQA 4EQMA 2FGIA 4FR4A 4TYGA 4DFLA 3ORPA 3QYZA 4C4EA 2BCJA 3QTZA 5KKRB 3OCSA 4TN6A 4BTFA 4FSRA 2UW8A 5KHXA 3R21A 5M56A 4HGLA 3W32A 3Q4CA 1IA9A 2XP2A 3FXXA 2HOGA 3OWLA 5M4IA 4D2VA 3BU3A 3FLQA 3UPZA 3D2KA 2YFXA 4AAAA 2VO7A 2EB2A 3EQBA 3QCXA 2GFSA 2XNGA 4AG8A 1U4DA 4K11A 2O8YA 4AA0A 4A9UA 3KU2A 3MB6A 5FG8A 2B0QA 2VV9A 3LXNA 4ITIA 4YTIA 3WE8A 3MVHA 2YCSA 4LOPA 5HU9A 1H24A 1PXMA 5AR8A 3ZDUA 5HTCA 1PRYA 4XG9A 4GVJA 4U42A 4FV8A 2QO2A 2R3IA 5EHOA 3CQWA 1IASA 3MB7A 3PY3A 3VS4A 4EC9A 2CCIA 3L8PA 2QR8A 1OKWA 1YRPA 4U81A 4Y5QA 3RMFA 3DK7A 3O2MA 3PP0A 4EWHA 4GKHA 3SOCA 3ROCA 4HVIA 3HMOA 5EI6A 4M84A 5A4CA 5CF4A 1YQJA 1X8BA 1G3NA 2PVHA 3FLZA 3LKMA 1Z9XA 1PJKA 4ASXA 3AD6A 3R2BA 4O83A 3QHRA 3WOWA 4BGHA 4BKJA 4EJ7A 4N0SA 2C4GA 2XJ1A 2ETKA 2VWYA 3Q04A 3ZLSA 3D15A 2O63A 4O7LA 2CGXA 1M17A 1ZY5A 4I92A 1PYXA 3HV6A 4S2ZA 3R63A 4AGDA 1WVYA 5HX8A 3AXWA 2CNUA 4BBMA 5GJDA 4C38A 5DYJA 3ORIA 5KMKA 4C4IA 2UUEA 5DR9A 3QZFA 5HIBA 1XHAA 3RGFA 3AT3A 1XJDA 3EQFA 4ZZOA 2QVSE 3EB0A 2VX0A 3L9NA 3MWUA 3RK5A 4KNBA 1M2PA 4DTAA 4JDKA 3OY1A 4O0UA 4M14A 4X3JA 3OT3A 3WBLA 4MNEB 5IQGA 1PW2A 5DNRA 2VTHA 3VO3A 4TL0A 4F09A 2CJMA 3SKCA 3OOMA 3SG9A 4DT8A 3G0EA 3GCSA 5HBEA 3LFFA 4NJ3A 3VRYA 4RQVA 1R3CA 3U8WA 1H28A 4RIOA 5F20A 1SVEA 4FYNA 3ZO4A 4L67A 4LG4A 3TZ9A 4QMSA 2QOFA 3COIA 5FM3A 1XO2B 1FMOE 4CRLA 3CJFA 5AUTA 2FB8A 3TTIA 1PMVA 5GZAA 3F69A 2UZWE 2HZIA 4CZUA 4IM2A 2OIBA 2UZDA 5AV1A 4J99A 4BDHA 4FT7A 4TZRA 3KULB 5E8WA 5DE2A 2DYLA 4FL3A 1U54A 5IA0A 3FI4A 2NO3A 4G3GA 5J5TA 2CKPA 5DRDA 4K6ZA 3PXFA 3H30A 3BV2A 4MKCA 4AN9A 3MI9A 4A9RA 1GOLA 2OF2A 4BDFA 4S34A 2QO9A 2YITA 1JSUA 3K5VA 2GU8A 4FSUA 1OL2A 4E8AA 4HW7A 4ZY4A 3EQCA 4G5JA 4NW6A 4V05A 4B4LA 4JI9A 3R1SA 2XUUA 3CSVA 4M7IA 2X4FA 5E90A 1FPUA 1YXUA 3FSKA 3E8NA 4FOCA 5DHJA 3VQUA 4EZ7A 3ETAA 2XIKA 3FV8A 3BYOA 4D1ZA 2CPKE 3T3UA 2VRXA 3UVRA 2JITA 1VR2A 3HV5A 1Q8UA 4MQ1A 2VTJA 4TTHB 5IG1A 1R0EA 3NIZA 3R1YA 3OTVA 2WQOA 2C1AA 2FUMA 2R2PA 2R7IA 2WAJA 4YURA 3DXNA 3MFRA 4S30A 2IG7A 5AR7A 3Q4ZA 4PPBA 2ZDTA 2R3QA 4O0VA 3ZBFA 4NJDA 3D5UA 3COMA 3FUPA 2C5XA 4YGAA 4FKLA 5CF5A 5IQIA 5HIEA 4U45A 4RBLA 2NRYA 1UKIA 3QXPA 4DEBA 4D9TA 4I0SA 4L45A 4GRBA 5IA4A 3R7VA 3GC8A 2C3JA 2WU6A 3LFAA 5J9ZA 3RZBA 4U9AA 4DTKA 4E73A 4X2FA 2R5TA 4RA5A 3A7IA 3KXNA 1ZYSA 3FYKX 3HKOA 4XG3A 4PMMA 3BIZA 1YVJA 3ODZX 4ZY6A 4GT5A 3OZ6A 3LQ3A 1M2RA 4R5SA 4G9RA 2F49A 4H1MA 3OTUA 4MD8E 4ZZNA 3OC1A 2CN5A 2JDTA 2QOHA 1SZMA 4EYMA 4F9BA 1J3HA 3THBA 4Z16A 3PG1A 4FV6A 2CKQA 4WRSA 3P7AA 5DEWA 5DMZA 5CEMA 4JDJA 2ITTA 4F7LA 5FDXA 2OJ9A 4X0MA 4XCUA 4E4LA 3FLWA 4NH1A 4QOXA 3P7CA 3F7WA 4CRSA 3MPTA 3LQ8A 1Q8YA 3QTUA 4OUCA 1FINA 2YIWA 3ZRLA 3UQCA 3H9FA 3VUTA 4TWPA 2ZM1A 2YIXA 4ALUA 4ZOGA 4XJ0A 2X8EA 4GU6A 5DPVA 4BKZA 3QQJA 4GH2A 3R8ZA 5AA9A 5IDPA 1P5EA 1KE6A 4M15A 3MY1A 4QP4A 3WF5A 3NUPA 2WTCA 5AP7A 3Q4TA 5CANA 4JBVA 3CR0A 2I0EA 3QTSA 4V04A 3FLSA 3ACJA 5D7AA 3UYSA 3IKAA 5JFVA 4RA4A 3FYJX 4Q5HA 2WMXA 3QTRA 2QC6A 2X9FA 5HVJA 4ZK5A 3RM6A 2IN6A 4WG5A 3V5TA 4F6UA 5CS6A 4R77A 5IUIA 5BYYA 3PFQA 4RC4A 4QMXA 3A7HA 2I6LA 4E1ZA 2XK6A 5FQDC 4NCTC 5FGKA 4IDVA 3KRXA 3O17A 4Z7GA 3RKBA 5ANIA 3IGGA 5AR5A 4AZTA 3C4EA 4FE2A 2CGVA 4QQ5A 1BYGA 3O7LD 4DFYA 3GU5A 1QMZA 2WOUA 1AGWA 5IISA 4A9YA 3OCBA 2YABA 4IX4A 3DAEA 5B2LA 1YWVA 2VWXA 3K3JA 3BWJA 3RTPA 3VWAA 5FXRA 1Y91A 2J50A 4UMQA 5JZNA 2UZEA 2A27A 3KXGA 3UZTA 2B4SB 3RCDA 4OBOA 4J8NA 5ANOA 4C61A 3OXTA 1F5QA 5J7BA 4EK3A 4FEVA 4KABA 4W9WA 4X7QA 4GU9A 5E91A 4CFNA 4CG9A 3QA8A 3EIDA 3RPOA 3OP5A 3UNKA 3F3VA 3ORMA 1Q62A 3H0YA 2RFSA 5JKGA 4CKJA 1OL5A 4NSTA 3Q3BA 4BCPA 5D7VA 2IJMA 4LMUA 4CFUA 4DFZE 1GZNA 3EKKA 2XM9A 3E3PA 4XOZA 4KS7A 3AG9A 3VS0A 2C3IB 2QODA 1OPJA 3LMGA 3JVRA 2JGZA 3QC9A 3R01A 4IAFA 4UZHA 3HECA 5C01A 4QTAA 3BEAA 4U44A 2X1NA 2B55A 4XV2A 3E7VA 3SG8A 1SM2A 2BTRA 2ITVA 4FVRA 3LFCA 4KIKB 2QOLA 2Y0AA 2YM4A 2ZV8A 4S31A 3QX2A 4UALA 4BR3A 3ZUUA 2IWIA 2A0CX 4JVGA 4NKSA 1DS5A 5CSXA 3VHEA 2QHNA 4ZS4A 4CFFA 1R1WA 2W1HA 4FT0A 5CWZA 4BDGA 1Y8GA 2VD5A 1GIJA 3R9DA 5LCKA 4IEBA 4PTGA 3F66A 4JLCA 3SDJA 4IHPA 1H1SA 3ZONA 4G31A 4AOJA 1OIUA 3G5DA 2XBJA 2OBJA 4I3ZA 4EKKA 1APME 2BIKB 2ZAZA 2UZNA 3BEGA 5E8ZA 3Q32A 4IX5A 4QP6A 4AX8A 4BDAA 4C58A 3DBCA 3TIYA 2PUIA 3TM0A 3CTQA 3O23A 4BVUA 5AIKA 5CZHA 3QRUA 3O7LB 3HZTA 3ORXA 1RQQA 2UZBA 4LGDA 4FKOA 3DKCA 1XBBA 3VUHA 3W10A 2JKMA 5FBNC 4R3PA 2YHVA 4FG8A 3S1HA 3DKFA 5ACBC 2O0UA 2V7OA 3MYGA 4N6YA 3BKBA 4ZZMA 3R7YA 2F7ZE 3GENA 3HMNA 2X7OA 4A9SA 4BWXA 5C26A 3R8VA 3LFEA 5BUJA 5L2TA 4XV9A 5C27A 1H26A 3I4BA 4ID7A 4JG7A 4NWMA 4Y72A 2AC5A 2W4KA 1H27A 3CY2A 4BDDA 3A61A 3F5UA 3BHTA 3G6GA 3P79A 3GNIB 5HBHA 5I3RA 4Q9ZA 4JBQA 3F3WA 4O7TA 5C8NA 3V5QA 3ZFMA 2O64A 3OCGA 3POZA 3MTFA 2HAKA 2JDRA 2P55A 5B7VA 4RRVA 3SVVA 4QP8A 3U51A 4GT4A 4MD9E 2RL5A 2PVYA 4L00A 4H39A 2B1PA 2PVRA 2O5KA 3ANRA 1Q8TA 4AZVA 4ANSA 4YLKA 5LXMA 1GZ8A 4KWPA 2BRHA 2O65A 4RFMA 2BRBA 3DK3A 1XQZA 3QQKA 5EYCA 4EH5A 1U59A 5KMJA 4IIRA 5J8IA 2EXMA 2ERKA 1UU7A 5EHLA 3FZRA 4LUEA 2JDVA 4O2PA 2H96A 2BILB 3O8TA 3DKOA 5CAQA 3Q4UA 4XP3A 4DGMA 5M4UA 4YPSA 2J0LA 3PJ8A 4RSSA 3V5WA 3I5NA 1O9UA 3C1XA 4D4YA 1FVRA 3CKXA 3NIEA 5HI2A 3QU0A 4TYJA 2W4JA 2BDJA 3NGAA 4DAWA 3KGAA 2XNOA 4F9CA 3OXIA 2C5OA 2R3FA 4FIIA 4QTDA 3KRRA 3VNTA 4QTEA 3QWJA 4FSYA 3DCVA 1WCCA 3V5JA 4PDSA 4PTCA 1H25A 2YEXA 3TACA 4PMPA 4I4EA 2W5BA 3DLSA 4G5PA 2W9ZB 4G3EA 4FVQA 5CX9A 5K0KA 3BHYA 3E63A 3OFMA 4FYOA 4OTPA 3SX9A 4AWIA 3F7ZA 1PXOA 4C37A 4YUQA 3DBDA 2ZMDA 2Z7SA 3C5UA 5CEOA 2OK1A 1T45A 2PL0A 4Y83A 1UU9A 5AR4A 2IVUA 5AA8A 3GC9A 1Q99A 2X2LA 2YLEA 5AV4A 4J71A 2WGJA 1JKTA 2YM5A 4O6EA 4I20A 2WHBA 3BPRA 3C51A 2Y6MA 5M57A 5IQDA 3JPVA 4YHFA 4FZ6A 5LVOA 4TXCA 5C8MA 4O91A 5LVMA 2JDSA 5HG7A 3CBLA 3TUCA 3UC4A 4AOIA 4BCOA 4BHZA 4CVAA 4DEHA 5L8LA 5DRBA 4O7NA 4IAZA 3UNZA 1PMNA 1OECA 4FV9A 4EHVA 4RIYA 3VVHA 5HU3A 1KE5A 2XNNA 2HXLA 4Y8DA 3RWQA 1PMEA 4RWKA 3UC3A 4EOOA 3FMNA 4EZ5A 4XG6A 5JK3A 5AFVA 2DUVA 4I6BA 1YKRA 2OZAB 3ZLYA 4ANQA 4O1OA 4D4SA 4EUUA 1FGIA 3DA6A 3NWWA 4GJ2A 2IO6A 4I5CA 4E6CA 4FTJA 5DT0A 4IE9A 1IR3A 2OXYA 3ROYA 4DN5A 3UPXA 4HVDA 5B2MA 2UZVA 3COHA 3OD6X 4BCKA 5E8SA 2UZUE 1PYEA 4O7YA 4RWJA 4DGGA 5CT0A 1M7QA 5A3XA 4FEUA 5ANDA 2R3RA 1FVTA 3D9VA 3IDBA 2PVMA 4YZMA 3VS5A 5IKWA 5JRQA 1EH4A 3MFTA 2C5NA 2OI4X 2WD1A 3BHHA 4BDIA 4CXAA 2HW7A 1REJA 1GZOA 4F1TA 4AGCA 1WZYA 1ZMWA 2J0IA 2WQMA 3B8QA 3FMHA 4IWPA 1KV2A 3R7GA 5EI8A 5ETCA 4AT5A 4BIBA 4YZDA 4F9YA 2WO6A 3AMYA 2WIPA 4JOAA 5CQWA 1S9JA 2UZLA 2VWZA 3PXZA 4RG0A 1JSVA 5EM8A 4ZTRA 3FXZA 2IZRA 3LE6A 2ETRA 2JC6A 3PXYA 2VTMA 3UIMA 4HVGA 3HA8A 4CFMA 4U79A 5LVLA 4AW0A 4TWOA 3QHWA 3R8LA 5JQ5A 5KUPA 1QL6A 2XH5A 3ZMMA 2ITWA 2E9UA 3ORNA 3K3IA 3QC4A 4FTAA 5A6NA 3MH3A 3NLBA 4NCTA 1XH9A 3QZHA 3AMAA 3EYGA 3DLZA 2JLDA 1OZ1A 1J7UA 5FEQA 2F4JA 4PP7A 5E8XA 1WBOA 4KRCA 4LOOA 1YXXA 4WSQA 3PLSA 3R9NA 3RM7A 1URCA 2BZIB 4HYSA 2ZV7A 4HPUE 4OTHA 4ZSEA 2OWBA 3R02A 1J91A 1WFCA 1KE9A 1L3RE 3KC3A 4HOKA 4M69A 4QYGA 2PE0A 2WTJA 5GJFA 2VGPA 3W2SA 2GNGA 4QQTA 4RX7A 3NPCA 4RMZA 3QQUA 4FTUA 4YBKA 1Q97A 2JD5A 3F3UA 4XH6A 5IQAA 5L8JA 5DGZA 4IXPA 4O0TA 4G9CA 4H3QA 5CVGA 4F9WA 4BBFA 3RK7A 3TUBA 1UNHA 5E8UA 3BU6A 4JL9A 4ANOA 5HBJA 4QMNA 1OIYA 3EJ1A 3FC1X 3MW1A 3O96A 3QGWA 2OH4A 5KNJA 2PHKA 3G15A 3ZFYA 3HRBA 4ALVA 5CEKA 3SC1A 4KUJA 3L8SA 1W84A 5HNIX 2PYWA 3VBQA 2RSVA 3W2QA 3F9NA 3HLLA 1YWNA 1A9UA 1PKGA 4AA5A 4YNOA 1FOTA 3ZRMA 4O7SA 4M66A 1OL6A 3HP2A 4TKSA 2Q83A 3RNYA 4FKJA 4L68A 4BL1A 5CSWA 3BGPA 3P7BA 4E3CA 3SXFA 4FKUA 5AV0A 4UX9A 2XCKA 2FSLX 5JFXA 3A4PA 2VNYA 1VEBA 3NNVA 3CE3A 1Y6BA 4PMSA 3IOPA 5FM2A 2W7XA 1VJYA 2GNIA 3MFUA 5IPJA 3W55A 2C47A 1JBPE 3KK9A 2B52A 4H36A 3EFLA 4X6RA 5CEPA 2W17A 4X2NA 2I0VA 5T6KA 4BC6A 5FDPA 1JPAA 2PZ5A 4JDIA 4KIPA 4UMTA 3FMDA 3O50A 2XIYA 4ANBA 1K9AA 3Q60A 4J8MA 3ATTA 4J95A 4KS8A 3LFBA 3G0FA 3R1NA 1GY3A 1R39A 4D4RA 4LRJA 2OW3A 1RJBA 3I7CA 3UNJA 5M06A 4BY9E 4DH3A 2C3KA 4QMVA 4EWQA 2R3HA 3BRBA 3D5VA 3HV7A 4Q2AA 5EYDA 3DXQA 5CSHA 3WILA 4USFA 3AC2A 1PXNA 4YSJA 2WQBA 4Z7HA 5L8KA 2V5QA 1CKJA 4L3JA 3KREA 3TCPA 2GS6A 4AW1A 1H01A 2G9XA 4B0GA 4YZCA 3KF7A 2C6LA 5FWKK 4FIEA 3LJ1A 3JY9A 4FBXA 3BYMA 2X7FA 4R7IA 3VBYA 5I9YA 2XM8A 3DQXA 3CTJA 3EQPA 3RCJA 3NNUA 4NL0A 3EQGA 4NYEA 3QQLA 3GGFA 2W1EA 2FSOX 2XKCA 3DAKA 3E8EA 3UP2A 5A6OA 4WA9A 3MTLA 4UMRA 2JIUA 4DFBA 4GIIA 3IG7A 1YDTE 4W4WA 4XLIA 5C1QB 5IQHA 4EH4A 4MBIA 5C9CA 2WQNA 4BN1A 4E5WA 5IEYA 3QLFA 3RHXA 2QR7A 1ZYJA 4N6ZA 3TI1A 3VIDA 3CY3A 1U5QA 3KB7A 2WTWA 4IM0A 4B7TA 3W2PA 2YIQA 4FNYA 3UJGA 2W05A 2A2AA 3V04A 5I0BA 5L3AA 5DT3A 3GCVA 4IWDA 2ACXA 5M51A 1QPDA 1ZLTA 4IVAA 2P0CA 2EXEA 3S0OA 3FL5A 4PV0A 1UVRA 3IGOA 4NU1A 3QQGA 3VS6A 2WNTA 4DCEA 3R04A 3E3BX 4IJ9A 4LQMA 4FUXA 2VTIA 4AW5A 4OLIA 2YIYA 4AGUA 4GV1A 2FH9A 3WF9A 3BV3A 3JVSA 4FKWA 2BZHB 4HYUA 5FEDA 2V7AA 2SRCA 2QONA 3D2IA 3UMWA 3HV4A 3OROA 3VBVA 2ZM4A 1QPJA 2AYPA 2PE1A 2QOKA 4EH8A 4C34A 4W4XA 3SV0A 2EVAA 2PVFA 4ASZA 3VJNA 4QPSA 5CNOA 1OUYA 2OSCA 4FSTA 2VAGA 4FTMA 3VN9A 3HAMA 3W18A 4MK0A 3DBQA 1ZMVA 1IA8A 2YZLA 4NTTA 5EQYA 3BYVA 4CFVA 4E4MA 4FT5A 2JFLA 4PNIA 5HE0A 1RW8A 2X81A 3R22A 3N4VA 3BHUA 4FTIA 1JOWB 4K0YA 5TO8A 3RPSA 4WD5A 3WI6A 3VHKA 1KV1A 1ZRZA 5AAFA 2B54A 4F9AA 3HRCA 5EYKA 1TQIA 4CMTA 2J90A 5CU2A 2VO0A 4LMNA 4ZLYA 3RZFA 2QU6A 3R73A 4EHEA 4TWCA 2ZM3A 3OOGA 3PPZA 4IDTA 2F57A 2VTSA 1BMKA 3FI8A 5IZFA 3DKGA 5AJQA 3MS9A 4GYIA 2XS0A 3QZGA 2YAAA 1P2AA 1ZMUA 4QD6A 4JR3A 4A07A 3UQGA 1CKPA 2VWWA 3ZXZA 1J1BA 3A60A 4FKPA 4I4FA 4XRLA 4O0RA 4NUSA 2IW8A 5IQFA 3KY2A 4DLJA 5I9ZA 3LCSA 2KTYA 3LPBA 3SRVB 2QOOA 3DJ7A 3PDTA 1PXLA 2PUUA 2Q0BA 3P9JA 4NM3A 2JAVA 3V8SA 3CEKA 5M4CA 5DN3A 2R3MA 3PIYA 4ZSAA 3GUBA 3MFSA 4CCUA 4MNEA 3OWPA 3V3VA 3GFWA 5F94A 4JRVA 4C4JA 4EBVA 1XH6A 4GYGA 4TWNA 4R5YA 4G16A 4KD1A 4AU8A 2P2HA 4BCFA 4IC7A 4A06A 5HZNA 4D5KA 1XBCA 4MYGA 4UN0C 3AD5A 3BGQA 1NVQA 4TW9A 3LQ5A 5BVKA 3MA6A 3BQCA 4OTGA 3VJOA 4BZOA 5KMOA 1ZOEA 5HVYA 2YDJA 3I0OA 2GS7A 5BVOA 4BCNA 2VTTA 5K4IA 3FI2A 3IPHA 3NVKI 4I22A 1KUTA 4FIGA 3KULA 4PX6A 1FBNA 3DTCA 3B2TA 4IMYA 4AZWA 2PUNA 4EORA 1Z57A 2ERZE 3RNIA 3W2RA 4MF1A 4JS8A 3ALNA 3QTXA 3ZSGA 3PSDA 1XWSA 2JKKA 3EH9A 3DBEA 3OEFX 1IRKA 4FICA 4MXYA 2CGUA 3R6XA 3A2CA 3BBTB 3KN5A 4O0YA 4ONAA 2JAMA 2WMAA 3UO6A 4ANNA 4KIQA 4YTFA 5AWMA 3I60A 2PVJA 4QMMA 3TKUA 4DEAA 4QT1A 2RFEA 4ACDA 2YJSA 3ZC6A 2OIQA 4BIEA 2VWUA 4EOIA 4EC8A 2VWIA 5I5ZA 2YACA 5GINE 2IW9A 3QCSA 4EHZA 3VS1A 5ICPA 3MA3A 2VWVA 4S33A 2WB8A 3R7EA 3SOAA 5JGBA 4H3PA 1CMKE 2OJJA 1DM2A 3WZDA 1H1WA 3Q9XA 4B6LA 4FOBA 1H0VA 4IZ7A 1PF8A 4JDHA 4P90A 4EQCA 4Y73A 5CAPA 2GQGA 2RKUA 3QTWA 2GSFA 4FSWA 4CEGA 3QXOA 2R3OA 4RT7A 2ZV2A 4B8MA 2HELA 3KEXA 4GIHA 4E5BA 5EH0A 1BX6A 3R0TA 3PVGA 2CLQA 1OKYA 3GT8A 4G3FA 4YC3A 5DFPA 5H2UA 3UOLA 2W1FA 5BPYA 1LUFA 3L8VA 3DPKA 3FQSA 3P23A 1MUOA 3EL7A 4NZWB 4I0RA 3R00A 4E20A 2BUJA 3P0MA 4D58A 5KCVA 3ZZWA 3QTIA 1M52A 3RVGA 5GNKA 1UKHA 4FL1A 2I0YA 5CT7A 2GTMA 5DIAA 3REPA 1YDSE 4IAAA 4FEWA 1ZOHA 4OTWA 3VUMA 1K3AA 4F0IA 4D9UA 4FSQA 5IQBA 2X39A 3CCNA 4ANLA 5HLWA 2C0IA 4QMUA 3TKIA 2BZJA 2XJ0A 5E1SA 4FSMA 2ZOQA 4DFUA 4YJQA 3PSBA 3C9WA 5HG5A 5EDRA 2OO8X 1OMWA 4W4VA 3W16A 3H10A 2XK4A 4FTOA 5DH3A 2J2IB 2C6KA 3CD8A 3CQUA 2UW0A 4YJOA 1OIQA 3I1AA 1PXKA 1H1PA 3EFKA 1ZYCA 2W96B 3FZOA 3NYNA 3N9XA 4USDA 2ZYBA 3U55A 4DE4A 5IF1A 4GS6A 2IPXA 4GKIA 5FD2A 5DI1A 4HYHA 4IACA 5JZJA 4AGWA 5I9UA 2RG6A 3TZ7A 4ZMEA 2VTNA 1YHVA 3ZU7A 4TYHA 4FKGA 3FMEA 2X8IA 5L2WA 4IWQA 3TV6A 4FV3A 4XG7A 3EN9A 4L8MA 4FL2A 4HVHA 3R9RA 3EHAA 4QP1A 4I6QA 3VUDA 3LCOA 3D7TA 2BR1A 4GUEA 4NM7A 4R8QA 4CMOA 3PRFA 2CLXA 4KKHA 2Y8OA 5EG3A 4P5QA 3PA5A 3NUXA 3FL4A 3H4JA 3UBDA 2GMXA 5HORA 4L3LA 5ETFA 3ZLXA 4AT4A 5H9BA 4G6OA 4EEVA 3RHKA 4IW0A 1BL7A 5CSPA 3OW3A 5DA3A 1O6YA 2VTRA 4RX8A 4UWCA 4BCGA 3A4OX 2W99B 3L9PA 4D2TA 4D55A 1KE7A 3VAPA 4EH9A 5B0XA 5IEVA 4QMLA 5LOHA 4RJ8A 4WO5A 4TYEA 2DS1A 2CHLA 3D5XA 3QCQA 3R30A 3W2CA 1OVEA 4OT5A 4FVPA 4QP7A 3LXLA 4UMUA 4C8BA 3E92A 1JWHA 4X3FB 3U87A 1OUKA 3U6HA 3WIKA 4JJRA 4YPDA 4EK6A 2Y4IC 5J87A 3HUBA 3QRJA 4YJUA 4AA4A 3ZCLA 4J53A 4YC8A 3RALA 2G2HA 4C3FA 3PTGA 2GHGA 3H9OA 1CDKA 1A48A 5A4TA 4ZJIA 3TN8A 4EYJA 3SQQA 2VTQA 2XCHA 3SA0A 3MESA 3H0ZA 2UW5A 4R1VA 4JG6A 3WZUA 1W7HA 5KMNA 4D0WA 2GCDA 3RPYA 4KIKA 4MD7E 5F4NA 2OGVA 3FY2A 4AN2A 3FMKA 4O22A 4OW8A 2BVAA 2UZOA 2XYUA 4PMTA 3IW6A 4PWNA 1NVRA 3TNQB 3DJ5A 3OW4A 3FBVA 1WBWA 3TDWA 5HO6A 1Y6AA 2UVZA 3UZPA 1XKKA 3HVCA 4NM5A 3T9IA 4OT6A 4MHAA 1UU3A 2HXQA 3AT4A 3GU6A 4FTNA 1AQ1A 4ZIMA 3QYWA 4C4HA 4FF8A 4EK5A 5JN2A 5HQ0A 1NVSA 2WXVA 3BBWA 1E1VA 3SLSA 3I7BA 4D4VA 2WTKB 3NUYA 1O6KA 3W8LA 4AS0A 2YDKA 1SVHA 2XBAA 1P4OA 1PMUA 3CPCA 3VULA 4EUTA 4DEGA 4RIXA 3CJGA 4O0XA 4FGBA 3F6XA 5LWNA 5LMAA 2B9HA 4GVAA 3WE4A 4PL3A 1W82A 1SVGA 3NUUA 4RJ6A 4YJPA 5FEEA 4LL5A 3UDBA 3UODA 4IBMA 3CLYA 3QUDA 5ITAA 2ZDUA 1ZY4A 3LLTA 4GG7A 4HZRA 5M53A 5C4LA 2G2IA 2YM3A 2C1BA 1H08A 4YR8A 3W33A 5JGAA 3GQIA 5AX9A 2R3LA 3KN6A 4FTQA 5H8EA 4E6AA 1CSNA 5AADA 5EDPA 5LMKC 2FSMX 2XRUA 2XK3A 4PDPA 4QYYA 4XP2A 2E9PA 4FSNA 5AEPA 3BZ3A 1MQ4A 3LZBA 3UYTA 3VUGA 2C6IA 4YJRA 2J4ZA 4ITJA 4J52A 2CGWA 2BAKA 3WZKA 4BBEA 4CNHA 3FKLA 2B9IA 3V01A 3ELJA 4MXXA 3A99A 5HLNA 2JKQA 3CGFA 4BDJA 3F2RA 4FTCA 3CS9A 1PXJA 3EKNA 4X2KA 4XUFA 4FEXA 4FKIA 3FZSA 4KB8A 5BVWA 3U9CA 4K8AA 1OB3A 2OU7A 4DEEA 4II5A 2XK7A 5BYLA 2R0UA 1HCKA 2E9NA 3CP9A 4IVDA 2YZAA 4A9TA 3E93A 4MTAA 2YM8A 3MPMA 4PQNA 4BDCA 2XVDA 3UG2A 1LP4A 5AV3A 2O3PA 3TJDA 1DAWA 4XEYA 3FWQA 5I9WA 2YM6A 3MDYA 3QRKA 2Y9QA 3DXPA 3TDVA 5ACKA 4OR5A 4FKTA 4FK6A 4LOQA 3BLHA 3KXHA 3VBWA 2EB3A 3KVWA 3H9RA 2YN8A 3UTOA 4EOKA 2BPMA 3IO7A 4XG8A 4V0GA 3ORTA 4LV5A 5ANJA 2ZV9A 3EQIA 3HRFA 4R78A 4L42A 2OF4A 5TOZA 3NYXA 4IZ5A 5IA1A 3NUNA 2WMTA 4I0TA 4JAJA 4DT9A 4B9DA 5CU0A 1Q5KA 4WOVA 2HZ0A 2AUHA 1L8TA 1HOWA 5CI6A 1MRUA 4CKRA 1CTPE 1NXKA 5KKRC 2PMLX 3ORKA 2FO0A 2PZIA 4EHGA 3AT2A 2YIRA 4D2SA 4CFWA 3L9MA 3Q5IA 2YLFA 1WBTA 4YNEA 4ENXA 2G15A 2IZSA 2X8DA 2ZMCA 4GK2A 2X2MA 3E88A 4KINA 4O2ZA 3N4TA 4YP8A 3LLAA 4GJ3A 4U8ZA 2VUWA 2P33A 4CLIA 4HVSA 2XK9A 2W0JA 4IAKA 3GFEA 4MCVA 2C0OA 3Q2MA 4RLLA 4X21A 1JKKA 2GQRA 2XIRA 4RVKA 3UOHA 3ZXTA 4APPA 2UW9A 5GZ8A 4ORKA 4JXFA 4XS2A 2C6DA 1LEZA 2YCQA 3ZZEA 3DBFA 3FZPA 1ZOGA 4HCTA 4CFXA 4EK4A 1YI4A 2VGOA 5FXQA 5IU2A 5KMMA 4WBBB 3BWFA 4WIHA 4QNAA 5BMSA 3D7ZA 4BCHA 4WRGA 1WBNA 1XR1A 3Q53A 3ZRKA 1YI3A 3UIXA 4FZFB 3PZHA 4UY9A 5AP2A 3D0EA 2BFXA 5HEZA 3FQEA 4YLJA 4CG8A 3C13A 1Q8ZA 4R1YA 3UVPA 4FTLA 4ZEGA 4BI1A 4DF3A 3BE9A 4CSVA 2XNEA 4DG3E 3QALE 4AZSA 3UE4A 3BGZA 2XEZA 3C0GA 3G2FA 4RWIA 3LCTA 2ZJWA 3QTQA 5BVDA 2J0KA 3AD4A 4RLKA 3LAUA 3I5ZA 1Y8YA 3NEWA 2OJFE 2WTDA 3QKKA 3JXWA 4OTFA 5EM5A 3LCKA 4G3DA 5DEYA 3UQFA 2PK9A 2W9FB 2VTLA 2QOCA 3T9TA 4IB5A 3U6JA 1MP8A 5HICA 5G6VA 3LVPA 3KVXA 4PPAA 4Z9LA 1BL6A 5JEBA 3L8XA 4EZ3A 3ZEWA 5A9UA 4FNXA 4M0ZA 3HDMA 5ETIA 5BNJA 2PULA 2IZUA 3BELA 2F9GA 4K9YA 3HNGA 2R7BA 4U40A 3G9NA 1YOLA 3GCQA 2BDWA 4O96A 4G34A 4I94A 3DTWA 4O27B 4O38A 3NUSA 4GG5A 4MXAA 4AE6A 3ATSA 4ACMA 3IK3A 3W8QA 2R4BA 4RVLA 5HD4A 3TNHA 2JBPA 5K0XA 3LOKA 5D10A 5HHWA 2VX3A 3F2NA 3NZ0A 2E9OA 4RIYB 2UW7A 3MJ2A 2PE2A 4USEA 2PVNA 4UYAA 2W1GA 5HE2A 5HCYA 2PZYA 5EQEA 4XMOA 5EW8A 4RQKA 5EI2A 3Q96A 5JGDA 4GCJA 4MWHA 1WVXA 3I79A 4L53A 4O1PA 2IVVA 4C35A 5CVFA 5A4QA 3G33A 3QFVA 2P3GX 3D14A 1OITA 5IQCA 3EZVA 4BCQA 2VZ6A 4WNOA 5KE0A 3F5XA 2XB7A 3IW5A 2W1CA 3QA0A 4IQ6A 4ZAUA 3R9HA 3NAXA 2V62A 4C02A 4F70A 3LHJA 5EM6A 1A06A 3AGLA 5EDQA 3ZOSA 2PVLA 3BYUA 4L7SA 5CAUA 2HWPA 4CGAA 2PWLA 3GC0A 5GIPE 3TZMA 3FMLA 3SHEA 4RC3A 2I40A 3A8WA 5HO8A 3IS5A 4BCIA 4IANA 3WZEA 4BGGA 4EOPA 5AM6A 4R6VA 4FX3A 4EI4A 1M14A 5AP3A 4BZDA 4NIFA 2H8HA 3UGCA 2OJGA 2ETMA 2NRUA 3F5PA 4IH8A 1RE8A 1Q61A 3RPRA 2XNPA 3SW4A 3ZBXA 3Q6WA 3Q2JA 2CNQA 4L46A 3O71A 3IECA 3MGYA 4QMZA 4RIWA 2GHMA 2REIA 4UV0A 3NSZA 3VUKA 1YOMA 3QWKA 1IEPA 4X6QC 3VW6A 4HYIA 4I5PA 1YHWA 5K5NA 1OL7A 3ZUVA 2XNBA 1ZYDA 2BMCA 4YJNA 2F7EE 5E1EA 4FG9A 4BTJA 3NNWA 3P86A 1URWA 3P78A 2OG8A 3P1AA 4FSZA 4FZAB 4BI0A 4W8DA 2QG7A 4BWKA 3FJQE 5EOBA 5KZIA 4EH2A 3CD3A 3OVVA 4IZYA 2RFDA 5H8BA 4XG2A 4EKLA 3B2WA 3FHIA 3PVUA 2O2UA 4K77A 2BDFA 5TF9A 1LEWA 5CASA 3S2PA 5EKNA 1YOJA 5HCXA 3HP5A 2JBOA 5CNNA 4LL0A 2XNMA 4NT4A 2ITQA 2V22A 4I23A 1W98A 3C0HA 3JYAA 4M69B 4WNMA 3TXOA 4CV8A 1K2PA 2J51A 4O82A 1REKA 1CM8A 5HG8A 4C0TA 4C7TA 3ACKA 1XH5A 2VN9A 4FGRA 4AOTA 4FT3A 3MY0A 5DG5A 3PJ3A 2BALA 5TR6A 5JFSA 4FV1A 5CLPA 4ZTSA 3EZRA 4ZXTA 3QD4A 5LMKA 4FIHA 2C5YA
chains in the Genus database with same CATH superfamily
4BWPA 2C6MA 5LVNA 2VTPA 2ZVAA 4FV7A 3PG3A 1Q3WA 4JG8A 3WF7A 4F99A 2PY3A 2R0IA 2H34A 3ZTXA 5CALA 2ZB1A 4P5ZA 3HX4A 3II5A 5IDNA 4ASEA 3FMMA 3IDPA 4QMTA 3ZO3A 3FEGA 3ZSHA 4YZBA 4QEBA 2PSQA 4IB1A 2RFNA 3PY1A 3FKNA 2J7TA 3F5GA 4MX9A 3PA3A 4R3CA 4MUQA 2YDIA 4YO6A 4A4XA 3BHVA 2OICA 3ZM4A 4E93A 4D2RA 5M44A 2BAJA 2J6MA 2VU3A 3SW7A 3HA6A 4QTCA 3P08A 4TYIA 5AM7A 5CY3A 4F6WA 5BQ0A 4AF3A 1G8SA 3WYXA 3MY5A 4O81A 2CSNA 2WMRA 2YERA 3CTHA 3QRTA 4L6QA 4QRCA 3AC1A 4YJVA 3TKHA 4FKQA 1GIIA 4M13A 4O0WA 4TNDA 5IH6A 5J1VA 2BZKB 4FT9A 4DH5A 3NDMA 2X6EA 2HENA 4YO4A 3LFDA 2BRNA 1FGKA 3DDPA 3QGYA 1QPCA 1P4FA 4WNKA 1JKSA 2Z8CA 4XLVA 4F7SA 4IAYA 4JRNA 1MQBA 3FZ1A 4PUZA 1YI6A 4YHJA 5HCZA 1Y57A 3V6SA 4O7WA 3HMPA 3PXQA 2GNHA 1Q41A 1Z5MA 2BROA 2C6OA 3HMMA 4IX3A 4OTQA 4D5HA 2HYYA 2WELA 4MBLA 5GHVA 4CYIA 4K18A 4MBJA 4AZFA 3BLRA 3G90X 5L6WL 2CN8A 2OH0E 3TNPC 1ATPE 1ZXEA 3G51A 3PXKA 1QCFA 3UO4A 1VLRA 3WARA 4M68A 5LQFA 2XYNA 3SXSA 4J96A 4ERWA 3T8OA 4BGQA 3AMBA 3EN6A 3KRJA 2QURA 4E6QA 4GK4A 1I44A 4CT2A 4JIKA 4XNEA 3IDCA 3FLNC 3MH0A 4UZDA 3TUDA 4C62A 3IW8A 3A7JA 4U80A 3NNXA 4ACCA 5JT2A 3AC3A 4DITA 3IOKA 2B53A 2YCFA 3ORZA 3EN5A 4BB4A 1XH4A 4GMYA 4OGRA 5CVHA 3E62A 4BCJA 4EBWA 4Z3VA 4NEUA 5AP0A 3IW4A 1RDQE 3OT8A 5E9EA 5CAVA 3RAWA 5H3QA 3PVWA 2OIDA 3A62A 5IH5A 3A7FA 1F0QA 3ALOA 2NNWB 1DI9A 4W9XA 4J98A 4XP0A 3Q6UA 4AACA 2VNWA 4BTMA 2WZJA 4FUYA 3R7IA 3PE2A 1IAHA 5A46A 3DNDA 4L3PA 3PJ1A 4UB7A 5F9EA 5I4NA 4YZ9A 4FZDB 2EXCX 2GNFA 2QHMA 3F3ZA 1KOBA 4KKGA 4ZTHA 2YWVA 1G5SA 3GOKA 2ESMA 2VWBA 1OKZA 4FIFA 2WMBA 3QZIA 3SRVA 2HK5A 3R7OA 1XH7A 3NR9A 1YXVA 2GNJA 3PE1A 5ANEA 4FK3A 4PTEA 4O7ZA 3LFNA 4EONA 1FQ1B 4JIAA 5C4KA 4ZLOA 3UMXA 1NA7A 1M2QA 3ORLA 3ZEPA 3K54A 2OFVA 1ZWSA 2YWPA 4MAOA 4C33A 3R9OA 2E2BA 3ENMA 5CQUA 4GFMA 3DV3A 4DBXA 2WQEA 3M11A 1OGUA 4WBOA 2W4OA 3E64A 3HL7A 3V6RA 4E6DA 5KBRA 3I0QA 5FP5A 2X0OA 4EH6A 1KWPA 5BMMA 2XKEA 1NW1A 1B39A 4BRXA 2F2CB 3BQRA 3DNEA 1ST0A 2PTKA 4H58A 5CU3A 5E92A 3VS2A 3AOXA 4DHIB 4UYNA 4LRKA 1V1KA 4XRJA 5AR3A 4QO9A 5K9IA 1E1XA 5M4FA 5EM7A 3RWPA 5HD7A 2VTAA 2UV2A 4NW5A 3C4CA 4IZAA 4S32A 4XBUA 4FV5A 3U4WA 1OM1A 2WEVA 3EQDA 3KMWA 3PRIA 5IQEA 4RWLA 5H8GA 5F95A 2AQXA 1P14A 5IEXA 5CZIA 4CQGA 4PDYA 5AUYA 3PWDA 1SNUA 4JQ7A 3OY3A 4UWYA 5HOAA 2XKDA 3MIAA 5EKOA 1JAMA 5D12A 4LDTA 3W0RA 3QAME 5FTGA 1R78A 3OMVA 4ZSJA 1U46A 1V0BA 3GVUA 4ARKA 5AAGA 3VONA 5BVEA 4L52A 3WIGA 4I41A 4FG7A 2VX1A 1I09A 3BYSA 2C69A 3MSSA 5AUWA 3ZHPC 4EH3A 1OIRA 1ZZLA 2WMSA 4MVFA 3QKLA 3GP0A 4UEUA 4EK8A 3IQ7A 2J5FA 4OAUC 3NMUF 1NY3A 1XBAA 2IZTA 4RVTA 3DY7A 2G01A 2XKFA 4LV8A 5AIRA 2GNLA 5AP1A 3PIXA 3F3TA 1YDRE 3DGKA 5FXSA 3V8WA 2J5EA 3QCYA 4L9IA 3SAYA 4P7EA 4IVCA 4RX5A 5AUUA 4DH8A 2A4LA 2WKMA 4OBPA 2YCRA 2RGPA 1E9HA 3QX4A 1WBSA 2V55A 4B8LA 4CV9A 4DCAA 4QTBA 2NP8A 5E8TA 4FKVA 3VQHA 4FNZA 4BJJA 4TRLA 3UP7A 2XA4A 4ZJVA 2C0TA 2PMOX 3QLGA 3R8UA 3V51A 1UWHA 2JFMA 2XF0A 4GFOA 4HGEA 4UXQA 5CEIA 3ZSIA 5I9VA 4ALWA 2I7QA 2YJRA 4L43A 3GCPA 1H07A 2ITPA 1O6LA 2UW3A 4ITHA 5FP6A 3PZEA 3RAKA 4GFGA 4AXEA 3UVQA 4EQUA 3FDNA 2QO7A 3PYYA 4UXLA 3KRWA 3WF8A 2BTSA 3ZO2A 2CKEA 4FZ7A 4YTCA 1MRVA 4Q5EA 3NYOA 4U41A 5DT4A 3KCKA 3QQHA 5CXHA 4QMQA 4KBCA 5M08A 2XRWA 3BX5A 1ND4A 3SXRA 4W4YA 2IVSA 5DR6A 4YC6A 3RI1A 3CGOA 1H1RA 4XV1A 3D4QA 3OF0A 4CZTA 1S9IA 4R3RA 1TQMA 4AE9A 4BDBA 2FYSA 1YHSA 3V5PA 3OS3A 5LMBA 1JSTA 3TL8A 1U54B 4LUDA 3WZJA 1H1QA 3QUEA 3GXLA 4NK9A 3C7QA 2BHEA 1YW2A 5T68A 2ITNA 3O8UA 2C5VA 4IM3A 3UOKA 5JSMA 3FE3A 3S95A 4R7HA 3DU8A 4HNFA 2DWBA 1F3MC 3E8CA 3HDNA 2ITXA 3KXZA 4YMJA 4WNPA 3U4UA 3MN3A 3RJCA 5FUTA 2C30A 5M07A 4K33A 2OJIA 4JX7A 4JBOA 1R0PA 4A4LA 3GBZA 5AX3A 3S3IA 3FHRA 4Y95A 3TNIA 4YU2A 4AP7A 3I81A 5A4EA 3EFJA 3RBWA 2UZTA 2Z7QA 3GOPA 3GC7A 4HCVA 3OEZA 5IUGA 2OLCA 4V01A 5LARA 3C4XA 3NVMB 3EFWA 1BLXA 2UW6A 4NTSA 3FQHA 1KSWA 3PA4A 2BFYA 4GEOA 4E7WA 3ZUTA 2PU8A 4L7FA 4CTBA 5BVNA 1JVPP 4GK3A 3DOGA 4JBPA 4LYNA 4U5JA 3C4ZA 3GB2A 3QUPA 2OXDA 4M97A 5EW9A 5AV2A 2ZFYA 3GCUA 2G1TA 1IG1A 2OKRA 5C8KA 1XMLA 1T46A 3NCZA 1V0OA 4HGSA 4ZJJA 4OAVB 4QPMA 1XH8A 2QU5A 4XYFA 3PXRA 4QMYA 2JIVA 1Q8WA 3MIYA 4HGTA 4QYFA 2XIZA 3BCEA 4Y46A 4LGHA 3P4KA 3HGKA 4M8TA 2QQ7A 5CTPA 5ANGA 5CF8A 2HCKA 3TEIA 4FV2A 2R3PA 3OXZA 4AUAA 3LMIA 5J7HA 3KRLA 4X3FA 4I93A 4ZTLA 4I5HA 4YTHA 4G6NA 1M7NA 4DBNA 1OBGA 2X7GA 4ZTNA 4BCMA 4FI1A 3COKA 4RJ4A 3ZC5A 1H00A 3NX8A 3VF9A 3BU5A 2DQ7X 1TVOA 2C68A 1J7LA 5AR2A 1FVVA 5TT7A 4FKSA 2WU7A 4WUNA 3RK9A 4U43A 3KFAA 3UIUA 3BI6A 3OBGA 4EOLA 4TYHB 2PVKA 1H0WA 2V0DA 1PKDA 3KKVA 4Z55A 5BVFA 2UVXA 3QL8A 3D94A 4KBKA 1JLUE 2XMYA 3C4FA 3KMMA 4QQCA 3RAIA 4AZEA 5JH6A 1MRYA 4WG4A 4ACHA 3D7TB 3PY0A 1ZARA 3F61A 4M0YA 4MF0A 2ZB0A 3DZQA 3NCGA 2ONLA 5M55A 5FLFA 1G8AA 3QKMA 2OZOA 3LIJA 3NUAA 4RFYA 3UIBA 3CPBA 2B9JA 3M42A 4RZVA 4BIDA 4P2KA 3EOCA 3ENHA 3R71A 3CC6A 5F1ZA 5I3OA 4BZNA 5TKDA 1UNLA 4LGGA 1TQPA 2W5AA 4FMQA 2WMQA 5CI7A 1JQHA 5HVKA 3TYKA 4DTBA 1DAYA 4CMUA 5J9YA 5EHYA 4F63A 4CLJA 2Z2WA 3N4UA 2GHLA 4UWBA 1WMKA 4MQ2A 2YISA 4H1JA 5D1JA 5FTOA 2Z7LA 3HV3A 3RPVA 4ENYA 5K4JA 5IA2A 3A8XA 3O8PA 2VO6A 3ODYX 2J0JA 4U3ZA 3VC4A 3Q9YA 3AC4A 2HY0A 2PMNX 3K5UA 3Q52A 4I21A 4CTCA 3O5AA 2R3JA 5LJJA 3TTJA 5AAEA 5EQPA 2P4IA 3FC2A 5EW3A 2Q0NA 4IADA 5TE0A 4HJOA 1GAGA 1SMHA 4PF4A 5HLPA 3SD0A 5HTBA 5K5XA 3PWYA 4YJSA 3O0GA 2PMIA 2XJ2A 4IX6A 4EOMA 4D2PA 3GQLA 3W2OA 4CYJA 4OTIA 1W83A 2ITZA 1Q3DA 3NYVA 3NW6A 2F7XE 3T3VA 3D5WA 2E9VA 4U7ZA 4F7NA 3Q9WA 4E26A 1OI9A 3PVBA 4G2FA 1NT2A 3TJCA 4CZYB 2QLUA 3MVMA 4Q9SA 1U5RA 3EQHA 4JNWA 3JY0A 4RVMA 5L6OA 3FPMA 5D9HA 2WMVA 4U0IA 4FKRA 5CYIA 2BAQA 3TWJA 2RF9A 3KXMA 2WMWA 4KSQA 4ZMFA 1YXTA 4C59A 4KSPA 1SNXA 2FA2A 3TNWA 3QD0A 3FAAA 2H6DA 3DFAA 3HYHA 3NW5A 4AFJA 3H3CA 4D0XA 1UV5A 5AUVA 4PPCA 3PP1A 4ZP5A 3R83A 3EN7A 4RIXB 4BFMA 2LGCA 2W1IA 4ZY5A 4I6HA 1KE8A 1YWRA 3GU7A 3VS7A 3R2YA 4O84A 3DB6A 3DDQA 4E4NA 4JQ8A 3U6IA 2AC3A 5HIDA 5HE3A 4EL9A 2Y7JA 3MH2A 1KOAA 2Y4PA 3I6WA 3U9NA 4LI5A 3KMUA 4FIJA 1OBDA 1UWJA 3LMHA 2JKOA 3DB8A 4I1ZA 3HAVA 2QD9A 3GU8A 4HPTE 1G8KA 3KL8A 3JS2A 5LCJA 4F64A 4O6LA 4CCBA 4QP3A 4L01A 4NKAA 4F0GA 4ZLZA 4K1BA 3ERKA 3EYHA 4JT3A 4O21A 4TPTA 3OWJA 2QKWB 3R8MA 2HWOA 1PXIA 3FY0A 4KIOA 3ID6C 4FV0A 4IC8A 4A7CA 4C4FA 3RAHA 1LR4A 4RPVA 5CXZA 3S4QA 2G2FA 3I6UA 4JAIA 4CQEA 5HE1A 4DYMA 3QRIA 4IB0A 1VYWA 4QYEA 1B38A 3D83A 4JQEA 2KULA 4QMOA 2WPAA 5JRSA 4F0FA 1V0PA 2BRMA 3PPJA 4Y85A 4D1SA 4EOQA 4O86A 2B7AA 4H3BA 1WBVA 1PY5A 2A98A 2W5HA 2C3LA 2OXXA 3VF8A 4RX9A 1HCLA 4AT3A 1GNGA 5L2IA 4EOJA 4OTDA 1JNKA 2IVTA 3K2LA 1JKLA 2UVYA 4KBAA 4EJNA 3MJ1A 5J5SA 4TT7A 4X2GA 5HX6A 5L4QA 4O7VA 5DVRA 2GDOA 3C4WA 2F2UA 2XK8A 4GW8A 3OCTA 5B2KA 1TKIA 4V0GB 4LM5A 4DEDA 5DOSA 4IFCA 5DR2A 5LWMA 3WYYA 5CU6A 2BKKA 3PJCA 4NM0A 4RJ7A 3TG1A 5KX8A 2OZAA 1PXPA 3F2AA 4DGLC 1OL1A 2YM7A 4F1OA 3MPAA 2ITYA 4FV4A 4GT3A 4E5AX 3WF6A 2PZRA 2CKOA 4L44A 4FTRA 5EK7A 5E4HA 3EMGA 4KKEA 4C2WA 3ANQA 5DWRA 2B9FA 3ULIA 4YLLA 3VBTA 4BDKA 1VZOA 4GL9A 3QBNA 4ACGA 4CD0A 3IONA 5HTIA 3MH1A 2R3KA 5KHWA 4HNIA 3EN4A 3M1SA 4MXCA 4YJTA 4C36A 4DINA 4QMWA 4M3QA 1VYZA 3UO5A 1GJOA 5JMSA 2X2KA 4FEQA 3VS3A 3POOA 3ZS5A 2AEGA 2CDZA 2WMUA 2Z02A 4OTRA 4O0SA 4QYHA 4YHTA 5AP4A 3A7GA 2R9SA 3FSFA 3LCDA 3ZLWA 5L6PA 2EUFB 3VBXA 5A4LA 4BYJA 5HKMA 1ZZ2A 2C6TA 3W0MA 4DLIA 4MXOA 3BLAA 3CKWA 4RFZA 4QP9A 5HGIA 4DG2E 5GIOE 4YZNA 5IMXA 4DH7A 1Q4LA 3FZTA 2I0HA 3RP9A 4C3RA 3DAJA 3FI3A 2CCHA 2UW4A 3PJ2A 3F88A 4FNWA 1BUHA 4HZSA 4IB3A 3MVJA 3UG1A 1QPEA 1OKVA 2LAVA 3HMIA 3E87A 4C2VA 2A1AB 4BDEA 5A54A 5ETAA 2VTOA 3ZO1A 4TNBA 3LM5A 2WIHA 4QP2A 5AUZA 5GZ9A 1J7IA 3TV7A 3E7OA 4BHNA 3AQVA 5K3YA 4WHZA 5A14A 3JUHA 3LM0A 4CKIA 4IVBA 3GI3A 4DEIA 3ZFXA 1H8FA 3E8DA 4G6LA 4PRJA 3C0IA 4PY1A 3BLQA 1YXSA 4M67A 2VO3A 3B8RA 4MNFA 4G1WA 3OUKA 1UA2A 4MXZA 2WFYA 3GU4A 4RGJA 2EU9A 4LRMA 4DG0E 4EOSA 5KO1A 1ZAOA 4GUBA 2JDOA 4LFIA 3DJ6A 2JEDA 2R3NA 3MVLA 4AFEA 3FPQA 4DC2A 4EH7A 5KMLA 3C5IA 3OBJA 2OFUA 5C03A 3VUIA 4FC0A 5T3QA 5IMEA 2PZPA 2HZNA 4DGOA 2X9EA 1XMMA 4NFNA 2RIOA 1SYKA 4M12A 3PPKA 4AW2A 4DA5A 2C6EA 3EQRA 4FODA 4ZSGA 4FTTA 4PDOA 4I24A 5G1XA 2W1ZA 4IWOA 2Z7RA 2R3GA 3CIKA 3G6HA 3R28A 5AP5A 3KCFA 5M09A 3M2WA 4I5MA 3SGCA 3KF4A 2QOBA 4UBAA 1WAKA 3TV4A 5KZ0A 5CU4A 5GJGA 4C4GA 1WBPA 4E4XA 4R7BA 3CXWA 3GEQA 4MEDA 4U3YA 3L1SA 2W1DA 5DLSA 5E8YA 2HZ4A 1CKIA 5LVPA 5CSVA 4ASDA 1OGYA 1B6CB 2JIIA 1H4LA 2FSTX 3LXPA 5D11A 3P5KA 5EOLA 3KQ7A 3JR1A 3ET7A 5E7RA 3FLYA 2I1MA 5J95A 3OUNB 3LXKA 1UU8A 4RZWA 4I6FA 4PL5A 3R7UA 3OHTA 5BYZA 3C50A 3ZYAA 3NS9A 3DZOA 5IUHA 4KA3A 4PP9A 2GFCA 2QOIA 5E8VA 2HIWA 2X0GA 5BUIA 2PUPA 5CF6A 3KXXA 2Y4IB 3IW7A 4AN3A 4BYIA 2GTNA 2GS2A 1LPUA 3OWKA 2QG5A 1AD5A 4XV3A 4F4PA 3TZ8A 5CENA 4DFNA 4ZTQA 4B99A 4NIFB 2BKZA 5HESA 2J0MB 2XEYA 4C57A 2ITOA 5J79A 2Y6OA 3V5LA 2X6DA 5JFWA 3U54A 4QNYA 2XIXA 5EYMA 2Z60A 1ERKA 4U6RA 3RINA 4J97A 1PHKA 2QCSA 2A19B 4RIWB 3VW8A 4PL4A 4ANMA 2IW6A 3Q9ZA 4ZTMA 4IAIA 2CNVA 1ZYLA 4ZSLA 4F6SA 1BI7A 1FMKA 2QKRA 3HUCA 5J1WA 3FKOA 3DS6A 3PIZA 4OBQA 4XHKB 4F08A 5BX0A 2PPQA 3V8TA 3QD3A 3R8PA 4O4BB 2XZSA 4F7JA 3EWHA 4C3PA 5KBQA 4JX3A 4AQCA 4RC2A 3PLAE 5CEQA 2QNJA 1IAJA 2P2IA 3TT0A 2X4ZA 2H9VA 3FMJA 4U97A 3DT1A 2CMWA 4NFMA 4QQJA 4N57A 4J7BA 5KMIA 5HG9A 3FXWA 5ANKA 2YAKA 5AP6A 4O4DA 4RJ5A 4W8EA 2GQSA 2NPQA 5HO7A 4WG3A 4XOYA 3OG7A 4F65A 1W8CA 3UZRA 4G3CA 3TIZA 1BKXA 4WT6A 3QF9A 2BIYA 4D28A 1GZKA 3BE2A 1Q24A 3NRMA 5AMNA 1WVWA 1OPKA 3EL8A 1GIHA 3MBLA 4ZS0A 3ITZA 3HEGA 4X3FC 3AGMA 4XG4A 4MWIA 1W0XC 3NFFB 4YBJA 1DI8A 5HNBA 1BI8A 2J9MA 4DGNA 3Q5ZA 3QQFA 4Y5HA 3LW0A 4WSYA 4MH7A 3AC8A 2R64A 3R1QA 2WTIA 4BICA 4GSBA 1OPLA 1TZDA 2BHHA 3LJ0A 4P4CA 4F1MA 4RJ3A 2QOQA 4X2JA 3UOJA 5L2SA 2BRGA 1STCE 2EWAA 2WTVA 4TY1A 4XBRA 4YSMA 1J1CA 1UNGA 3O51A 4FTKA 4N4SA 5EFQA 4BTKA 4D1XA 2ITUA 3ZDIA 2W06A 3ZH8A 5FTQA 3W1FA 5I9XA 4BF2A 4FA2A 3S00A 5IA3A 3L9LA 3DK6A 3DQWA 5IA5A 4DFXE 4JMQA 3NW7A 5CAOA 3F82A 3CQEA 4J1RA 4N70A 4JR7A 4AXAA 4KRDA 4QPAA 5D41A 2ONLC 2HW6A 3LJ2A 3ZM9A 2RG5A 3E5AA 4WUAA 2QI8A 2WEIA 3G9LX 3N51A 5FRIA 4D2WA 3VRZA 2QLQA 4HCUA 4O7RA 5L2QA 4IFGA 4KAOA 5AUXA 4BI2A 4G17A 5HNGA 4QMPA 4APCA 4DHFA 4A4OA 2WTKC 4IJPA 4BKYA 5BUEA 3KA0A 3LFSA 5FBOA 4UMPA 3PSCA 4DH1A 2WOTA 3AC5A 2YA9A 4XX9A 5DBXA 4CT1A 5IH4A 3DFCB 4H05A 2GPHA 3LFQA 2FVDA 3MV5A 4PNKA 3NAYA 3ULZA 3PUPA 3QD2B 5J9LA 2HY81 3KK8A 4ERKA 5JQ8A 4K2RA 4WKQA 4EQMA 2FGIA 4FR4A 4TYGA 4DFLA 3ORPA 3QYZA 4C4EA 2BCJA 3QTZA 5KKRB 3OCSA 4TN6A 4BTFA 4FSRA 2UW8A 4DDIA 5KHXA 3R21A 5M56A 4HGLA 3W32A 3Q4CA 1IA9A 2XP2A 3FXXA 2HOGA 3OWLA 5M4IA 4D2VA 3BU3A 3FLQA 3UPZA 3D2KA 2YFXA 4AAAA 2VO7A 2EB2A 3EQBA 3QCXA 2GFSA 2XNGA 4AG8A 1U4DA 4K11A 2O8YA 4AA0A 4A9UA 3KU2A 3MB6A 5FG8A 3AKKA 2B0QA 2VV9A 3LXNA 4ITIA 4YTIA 3WE8A 3MVHA 2YCSA 4LOPA 5HU9A 1H24A 1PXMA 5AR8A 3ZDUA 5HTCA 1PRYA 4XG9A 4GVJA 4U42A 4FV8A 2QO2A 2R3IA 5EHOA 3CQWA 1IASA 3MB7A 3PY3A 3VS4A 4EC9A 2CCIA 3L8PA 2QR8A 1OKWA 1YRPA 4U81A 4Y5QA 3RMFA 3DK7A 3O2MA 3PP0A 4EWHA 4GKHA 3SOCA 3ROCA 4HVIA 3HMOA 5EI6A 4M84A 5A4CA 5CF4A 1YQJA 1X8BA 1G3NA 2PVHA 3FLZA 3LKMA 1Z9XA 1PJKA 4ASXA 3AD6A 3R2BA 4O83A 3QHRA 3WOWA 4BGHA 4BKJA 4EJ7A 4N0SA 2C4GA 2XJ1A 2ETKA 2VWYA 3Q04A 3ZLSA 3D15A 2O63A 4O7LA 2CGXA 1M17A 1ZY5A 4I92A 1PYXA 3HV6A 4S2ZA 3R63A 4AGDA 1WVYA 5HX8A 3AXWA 2CNUA 4BBMA 5GJDA 4C38A 5DYJA 3ORIA 5KMKA 4C4IA 2UUEA 5DR9A 3QZFA 4QDVA 5HIBA 1XHAA 3RGFA 3AT3A 1XJDA 3EQFA 4ZZOA 2QVSE 3EB0A 2VX0A 3L9NA 3MWUA 3RK5A 4KNBA 1M2PA 4DTAA 4JDKA 3OY1A 4O0UA 4M14A 4X3JA 3OT3A 3WBLA 4MNEB 5IQGA 1PW2A 5DNRA 2VTHA 3VO3A 4TL0A 4F09A 2CJMA 3SKCA 3OOMA 3SG9A 4DT8A 3G0EA 3GCSA 5HBEA 3LFFA 4NJ3A 3VRYA 4RQVA 1R3CA 3U8WA 1H28A 4RIOA 5F20A 1SVEA 4FYNA 3ZO4A 4L67A 4LG4A 3TZ9A 4QMSA 2QOFA 3COIA 5FM3A 1XO2B 1FMOE 4CRLA 3CJFA 5AUTA 2FB8A 3TTIA 1PMVA 5GZAA 3F69A 2UZWE 2HZIA 4CZUA 4IM2A 2OIBA 2UZDA 5AV1A 4J99A 4BDHA 4FT7A 4TZRA 3KULB 5E8WA 5DE2A 2DYLA 4FL3A 1U54A 5IA0A 3FI4A 2NO3A 4G3GA 5J5TA 2CKPA 5DRDA 4K6ZA 3PXFA 3H30A 3BV2A 4MKCA 4AN9A 3MI9A 4A9RA 1GOLA 2OF2A 4BDFA 4S34A 2QO9A 2YITA 1JSUA 3K5VA 2GU8A 4FSUA 1OL2A 4E8AA 4HW7A 4ZY4A 3EQCA 4G5JA 4NW6A 4V05A 4B4LA 4JI9A 3R1SA 2XUUA 3CSVA 4M7IA 2X4FA 5E90A 1FPUA 1YXUA 3FSKA 3E8NA 4FOCA 5DHJA 3VQUA 4EZ7A 3ETAA 2XIKA 3FV8A 3BYOA 4D1ZA 2CPKE 3T3UA 2XAOA 2VRXA 3UVRA 2JITA 1VR2A 3HV5A 1Q8UA 4MQ1A 2VTJA 4TTHB 5IG1A 1R0EA 3NIZA 3R1YA 3OTVA 2WQOA 2C1AA 2FUMA 2R2PA 2R7IA 2WAJA 4YURA 3DXNA 3MFRA 4S30A 2IG7A 5AR7A 3Q4ZA 4PPBA 2ZDTA 2R3QA 4O0VA 3ZBFA 4NJDA 3D5UA 3COMA 3FUPA 2C5XA 4YGAA 4FKLA 5CF5A 5IQIA 5HIEA 4U45A 4RBLA 2NRYA 1UKIA 3QXPA 4DEBA 4D9TA 4I0SA 4L45A 4AXFA 4GRBA 5IA4A 3R7VA 3GC8A 2C3JA 2WU6A 3LFAA 5J9ZA 3RZBA 4U9AA 4DTKA 4E73A 4X2FA 2R5TA 4RA5A 3A7IA 3KXNA 1ZYSA 3FYKX 3HKOA 4XG3A 4PMMA 3BIZA 1YVJA 3ODZX 4ZY6A 4GT5A 3OZ6A 3LQ3A 1M2RA 4R5SA 4G9RA 2F49A 4H1MA 3OTUA 4MD8E 4ZZNA 3OC1A 2CN5A 2JDTA 2QOHA 1SZMA 4EYMA 4F9BA 1J3HA 3THBA 4Z16A 3PG1A 4FV6A 2CKQA 3UDZA 4WRSA 3P7AA 5DEWA 5DMZA 5CEMA 4JDJA 2ITTA 4F7LA 5FDXA 2OJ9A 4X0MA 4XCUA 4E4LA 3FLWA 4NH1A 4QOXA 3P7CA 3F7WA 4CRSA 3MPTA 3LQ8A 1Q8YA 3QTUA 4OUCA 1FINA 2YIWA 3ZRLA 3UQCA 3H9FA 3VUTA 4TWPA 2ZM1A 2YIXA 4ALUA 5BV3A 4ZOGA 4XJ0A 2X8EA 4GU6A 5DPVA 4BKZA 3QQJA 4GH2A 3R8ZA 5AA9A 5IDPA 1P5EA 1KE6A 4M15A 3MY1A 4QP4A 3WF5A 3NUPA 2WTCA 5AP7A 3Q4TA 5CANA 4JBVA 3CR0A 2I0EA 3QTSA 4V04A 3FLSA 3ACJA 5D7AA 1W2FA 3UYSA 3IKAA 5JFVA 4RA4A 3FYJX 4Q5HA 2WMXA 3QTRA 2QC6A 2X9FA 5HVJA 4ZK5A 3RM6A 2IN6A 4WG5A 3V5TA 4F6UA 5CS6A 4R77A 5IUIA 5BYYA 3PFQA 4RC4A 4QMXA 3A7HA 2I6LA 4E1ZA 2XK6A 5FQDC 4NCTC 5FGKA 4IDVA 3UDSA 1TFFA 3KRXA 3O17A 4Z7GA 3RKBA 5ANIA 3IGGA 5AR5A 4AZTA 3C4EA 4FE2A 2CGVA 4QQ5A 1BYGA 3O7LD 4DFYA 3GU5A 1QMZA 2WOUA 1AGWA 5IISA 4A9YA 3OCBA 2YABA 4IX4A 3DAEA 5B2LA 1YWVA 2VWXA 3K3JA 3BWJA 3RTPA 3VWAA 5FXRA 1Y91A 2J50A 4UMQA 5JZNA 2UZEA 2A27A 3KXGA 3UZTA 2B4SB