1F3MC

Crystal structure of human serine/threonine kinase pak1
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
294
structure length
287
Chain Sequence
SDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIRQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNGTPELQNPEKLSAIFRDFLNRCLDMDVEKRGSAKELLQHQFLKIAKPLSSLTPLIAAAKEATK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SERINE/THREONINE-PROTEIN KINASE PAK-ALPHA
publication title Structure of PAK1 in an autoinhibited conformation reveals a multistage activation switch.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 82
structure length 287
sequence length 294
chains with identical sequence D
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2000-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1f3mC02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1f3mC01
2WTWA 4FKWA 4TY1A 5BQ0A 3VS5A 3QZIA 4YJSA 4FSWA 3FXWA 4NCTC 2NRUA 1WBTA 4IB1A 4H05A 2ITPA 3MGYA 3O96A 2VWYA 4IX3A 1MRUA 2RKUA 2BTRA 2P4IA 5LVLA 4RWKA 3BLHA 3MTFA 2CGUA 2PVHA 5C27A 3CC6A 3TWJA 3TTJA 5JQ5A 3R83A 5AM6A 4J99A 4O0SA 5CU3A 2PVNA 3PXRA 4I6BA 3CP9A 2JDVA 3G0FA 3HMPA 1WBNA 4WHZA 3NUYA 4ZY4A 4IZAA 4GFGA 4CRLA 3QTUA 5M4FA 3MVMA 4F4PA 1X8BA 4G9RA 3V51A 2BIKB 3PZEA 3ODZX 2R0UA 3RTPA 4NTSA 4F0GA 5DOSA 1VEBA 5KE0A 2X2KA 4ARKA 1YKRA 4RJ8A 4AP7A 4MD9E 3QRTA 4QP2A 3VHKA 3ZXTA 1MRYA 3E3PA 4IMYA 2HENA 4IFGA 4C4JA 4IM0A 5JN2A 2XM8A 5EM6A 4BCIA 4DEDA 4NT4A 2WAJA 5M51A 1A48A 5CENA 4BIDA 4DT8A 2QLUA 4PF4A 1OMWA 3UG2A 4MKCA 2UUEA 5FWKK 4CYIA 3QUDA 3K54A 4NU1A 1Q8YA 4PY1A 1Q62A 2QOFA 3E3BX 2C0IA 3IQ7A 3LW0A 3QYZA 3U51A 3SXFA 4W4XA 4E26A 1PMVA 2R3IA 5FEEA 3UO4A 4HVHA 3KXZA 3UIXA 5EW3A 3AT2A 3DQWA 2A4LA 3FLYA 1YOMA 5FG8A 4UY9A 3R8UA 3PXZA 5E8SA 1Z5MA 2BROA 5AAEA 3FV8A 2C3JA 4F0IA 3EQRA 4LOPA 4CFWA 3E88A 4U3YA 3R73A 2JIUA 2QOQA 4K2RA 2YJSA 5HLWA 5BVFA 3R30A 3V8TA 4BTKA 4II5A 2VTPA 1PXKA 3I6UA 4IC7A 1CM8A 3FXZA 3VAPA 3IONA 4EH2A 3KRLA 3C13A 3QFVA 3DXQA 1OBGA 2RFSA 3A61A 1Q4LA 3DPKA 3HRBA 2UZWE 4IHPA 3CQUA 4IAFA 5HICA 4UYNA 3VJNA 5T3QA 4O7YA 4RFZA 1IA8A 3BV3A 3OWLA 4M3QA 4DCEA 2B0QA 4O7VA 2XS0A 3LQ5A 3THBA 4EOSA 3HAMA 4PDPA 2W9ZB 3ZO1A 5EYMA 1OVEA 2E9UA 3BEGA 5IQGA 2W99B 5HBHA 4DLJA 4L6QA 2AC5A 4IH8A 4CG9A 2ZAZA 4N6ZA 1H0VA 4ZTNA 5AP2A 4CKIA 5CALA 2QO2A 4BY9E 3W2PA 3PDTA 3QTQA 4Z7GA 1Y57A 4QMOA 1PHKA 2JAMA 2W7XA 1L3RE 3NW5A 5L2IA 2UZUE 4BWPA 4MD7E 4MVFA 5ICPA 3K5VA 3DKGA 2QOOA 4CKRA 2VWZA 4ZMEA 4EHVA 4UB7A 5KX8A 3Q4UA 4F6UA 3VW8A 4N70A 1XQZA 4NSTA 4TWOA 3G6GA 2XMYA 2A1AB 2V62A 2JDRA 4B99A 2SRCA 3QZGA 2C3LA 4W9WA 5FP5A 3G9LX 4QQTA 3NVKI 4FNYA 2ITVA 2IN6A 5DBXA 1ZY5A 1UU7A 4USEA 2CNUA 4FEXA 4PUZA 1Q61A 3EN4A 2JKMA 2GQSA 2OKRA 3CY2A 2XIZA 2VTMA 3SRVB 2GHMA 2W5HA 3QWJA 4L68A 5CYIA 1PXPA 4ANQA 4DG3E 4JDKA 3RNIA 4KBKA 4I1ZA 4APPA 3DZOA 4FZDB 3LLAA 4YTHA 1UNGA 3O50A 3MYGA 4XH6A 2CDZA 3H30A 3VBXA 4ZJJA 3UVRA 4CFXA 2ZV2A 4IJ9A 3ZLWA 1WVWA 1JKSA 1T45A 4IZ7A 3KQ7A 3I7CA 4AW0A 4CT1A 4D2RA 4A9RA 5BVDA 5I3RA 5M56A 2FVDA 1OKZA 3RAKA 3BQRA 1GZ8A 3CIKA 5CSVA 4AW5A 3TZ8A 1J7UA 1IAJA 1ZYDA 4X3JA 3QRKA 1H1RA 3FMDA 2C3IB 4YJRA 4ZK5A 4OUCA 4FIJA 3NPCA 4U97A 4I21A 5CNOA 4R5YA 5I5ZA 4AZFA 3MY5A 4QMPA 1W0XC 3OXZA 5H9BA 4J8MA 3IO7A 4AA4A 4CCBA 4OR5A 1PY5A 4JDIA 3SQQA 2QKWB 3MJ1A 4C35A 3A4OX 3DFAA 3R9NA 4A9TA 3A62A 3HUBA 3OCTA 4IVCA 2LGCA 2WFYA 4JI9A 4XRLA 3EYGA 2BRBA 3LXKA 4HW7A 4UALA 4I23A 3PJCA 3ERKA 1XH5A 4Q2AA 4UYAA 3FKNA 3D7TB 4GYGA 1YW2A 4C7TA 4FG9A 1T46A 3C4WA 3OBGA 4YP8A 1BKXA 4L7SA 2A0CX 3TI1A 3F2AA 5AWMA 3ZSGA 4ZSAA 4EK6A 2XK9A 3OUNB 4L8MA 3KREA 3UODA 1JQHA 4OTFA 2WQOA 4XUFA 3F3VA 5AV3A 5GZAA 2ZB1A 4UX9A 1H01A 5KUPA 5BYLA 4PL4A 3F88A 3PG3A 4FL3A 5FXSA 3WZUA 5IQDA 1G5SA 4IADA 3HKOA 5BVOA 3CQEA 4GV1A 2JDTA 3PPZA 2PMLX 4RIWB 5CSWA 5DRDA 4BKJA 3GC8A 3FZ1A 4MXXA 4ZZMA 2O2UA 4YLLA 3PVUA 2OZAB 2WNTA 4RVTA 3DBQA 3ZFYA 4CSVA 3E87A 4EKKA 3R1SA 2Y8OA 5DG5A 3KRRA 4U80A 2X2LA 3DFCB 5JK3A 4EUUA 3OWPA 2XKDA 5HD4A 2WMUA 5M4UA 3PY1A 3IW7A 1EH4A 2UVYA 3UPXA 5E7RA 1XBAA 4KINA 3SRVA 2ZDUA 4FIFA 2R3LA 3OW3A 5CLPA 3TXOA 4F9BA 4D5HA 5KMOA 2XNMA 4FICA 3CEKA 3NX8A 1ZYSA 2WTKC 4C4HA 5CWZA 2W1FA 2QOKA 3LVPA 5HVJA 4R77A 4K8AA 4PRJA 5BVEA 2G2FA 3F3TA 2B9FA 1WZYA 3ZBFA 4LOOA 5E8VA 4FT5A 1ZYCA 4OT5A 1PMNA 3R9DA 4XV2A 3TJCA 4M84A 3PSBA 4O1OA 4CCUA 2G1TA 5A4LA 3L9PA 4WUAA 5E92A 1OIUA 1S9IA 2XRUA 3KU2A 4IB3A 2F2CB 3OZ6A 4R6VA 3BWFA 3SLSA 4D1ZA 4IM2A 5GZ8A 4DBXA 2YERA 2UVXA 4XLIA 1H1WA 2BVAA 2FSMX 3FJQE 2VX0A 2XNBA 4GT5A 3H9OA 5TF9A 3RM6A 4DH1A 3BEAA 3DNDA 5JRQA 4XNEA 2O65A 3JXWA 2Z2WA 4MWIA 3BI6A 4JBQA 4NM0A 3JVSA 5CQWA 2HXLA 2W96B 5FXQA 3JVRA 5J1VA 3R9OA 4N57A 4O7ZA 2YDIA 2X8IA 3MH2A 5HG9A 3RPRA 3AT3A 2CN8A 3MVHA 4YGAA 3UC3A 1KV2A 2R3KA 3AD5A 4BI2A 2EU9A 2QR8A 2P0CA 4EOMA 4ZSLA 3FYJX 3K2LA 5TOZA 3UP7A 4YJTA 3L9NA 3Q2JA 3EB0A 2XK6A 4IQ6A 2UZVA 4EZ7A 4BDKA 2R3HA 4IJPA 3BE9A 4NJ3A 3SV0A 2W0JA 3C4XA 2XP2A 4AZTA 4BDIA 1XBCA 4DAWA 3UZRA 4CG8A 3GQIA 5EW9A 3LFCA 3OUKA 5CSHA 4MNFA 3UYTA 4EH3A 4DTKA 4O7NA 3M1SA 3CE3A 4A9SA 4RIWA 3GCUA 5A54A 4A9YA 5HNGA 2OFUA 5EYKA 1ZOEA 3DK7A 3KVWA 5CY3A 4K77A 3R8ZA 2EB3A 2DQ7X 4GCJA 3UBDA 5HO7A 3RAIA 3GU5A 4XG3A 2G01A 5A46A 5CAPA 3OXTA 4FK6A 3VBQA 4M0YA 4CTCA 2QU5A 3MY1A 4QMVA 2JD5A 3HMIA 3ZBXA 4C4IA 4IZ5A 3U6IA 4FGRA 2J51A 3FKLA 2C3KA 2YCRA 4F09A 4RC2A 4DTBA 2XJ0A 3KF7A 4YJOA 3FZRA 4DLIA 3KXMA 5HNIX 3QTXA 2OSCA 3I4BA 1ZAOA 3QX4A 1SVGA 1NY3A 4DG2E 4RWIA 2JDSA 3LCTA 4RJ7A 4G2FA 3LJ1A 3C1XA 3W1FA 4Y95A 3TUBA 2ZDTA 4K9YA 3G6HA 1H26A 5CS6A 5F20A 2P2HA 4FZ7A 3PE2A 4L42A 4C37A 4OTDA 2QD9A 3SOAA 2X39A 3GVUA 3ZUVA 4PMPA 3Q9YA 4P2KA 2C6MA 2JIIA 1XH9A 3TZMA 2XIKA 4D4VA 1XKKA 2OWBA 4PL5A 5HE3A 5IUGA 3E7OA 3PRIA 4PV0A 3SVVA 4O0YA 4GJ2A 3ZFXA 3N9XA 5CX9A 3RALA 4F63A 3QX2A 1ZY4A 1BI7A 4ONAA 3G0EA 5CI6A 2F7ZE 2X9FA 3C4EA 3MS9A 5AV0A 2UZBA 3ZH8A 1YXTA 3FZOA 4DTAA 2GPHA 3W55A 3KK8A 4IB5A 3U87A 3GFEA 4QYEA 5LVMA 4AAAA 3G33A 2YIYA 1HOWA 4QO9A 3SX9A 4Y8DA 4D5KA 2HWOA 4ZOGA 5D11A 2ETRA 1OIYA 2NPQA 3UOJA 4QTAA 5JQ8A 3MW1A 2OJ9A 3OOMA 2QO7A 4DEAA 3KA0A 4CFVA 4AE6A 4FTUA 5EM5A 3TTIA 4FUXA 4MCVA 4JJRA 4U81A 3BHTA 4FZFB 4IAZA 1JBPE 2WMXA 3EFWA 4FT3A 4XV1A 3FLSA 4DEGA 2VTHA 4IBMA 1O6KA 5FM3A 2I0YA 2QOBA 4ITHA 4BWKA 2YIQA 2XNPA 3VHEA 3KL8A 4MXYA 4MQ1A 4BCOA 3NUUA 3TNHA 2PK9A 1IAHA 4EHEA 2WQEA 2IZSA 3FI2A 5BYYA 3PYYA 5LMKA 3GBZA 5LWMA 5CF5A 4XOYA 4I92A 3D83A 4TYGA 2V55A 2J0IA 2UW9A 3SHEA 5IMEA 3ZMMA 3QC4A 4I6QA 1H1SA 4D4YA 4YBJA 2GS7A 4XG4A 3S2PA 1Y6AA 2RFNA 3IGOA 4E6QA 4U6RA 1GZNA 2OO8X 3IW6A 3OMVA 3MFRA 3TKUA 3LLTA 4BCNA 4IAAA 2I7QA 5E9EA 3MB7A 1MUOA 4FTLA 4ZXTA 5IQCA 3FZTA 4YTIA 2OXXA 4GRBA 3V3VA 3ZO4A 4DGMA 2P55A 3HYHA 1FQ1B 3LXLA 1UVRA 2BILB 2HELA 3QCYA 4X6RA 4CV9A 2C5VA 1L8TA 4M68A 3TKIA 3QQJA 3N51A 4BL1A 4Y46A 4F1TA 4LRJA 4JL9A 3QA0A 5GJGA 3R7EA 3B2TA 3QYWA 3H0ZA 1H0WA 2C4GA 3G90X 2B53A 4IVBA 4QPMA 3VUIA 4BGQA 3FAAA 5HLNA 3VN9A 2OBJA 3FY0A 3LMGA 3H0YA 2I0HA 4IX5A 5HTIA 1E1XA 4U0IA 1NVSA 2GNHA 1PW2A 4QNYA 3GCVA 3I79A 3V5QA 3WIGA 5IH6A 3QUEA 5AUWA 5L2WA 4BIEA 3NVMB 2WIPA 4FC0A 1O9UA 3LM0A 3PZHA 2WTDA 1YRPA 3U8WA 1NA7A 4OTIA 4O2ZA 4W8EA 4ANSA 4YO6A 4G34A 4E5WA 3TACA 1Z57A 3QRUA 4GUEA 3LFQA 4I5PA 4QMXA 3R63A 4DFYA 4R7HA 4EUTA 3CD8A 3EQFA 4BI1A 4E6CA 2I40A 4L01A 2IW8A 3NGAA 3DS6A 4DH5A 4WO5A 5CEIA 3OD6X 4HYSA 2FB8A 2DS1A 2OIQA 3OP5A 4R8QA 2ETKA 4RJ4A 2C6TA 2QONA 1WAKA 1J1BA 1Q8TA 3CY3A 2IO6A 3F3WA 3F9NA 4E4LA 2ZV8A 3DZQA 3HDMA 4G9CA 4PNKA 3W2QA 1NVRA 4PTEA 5DN3A 3ZLYA 4BGGA 5LVOA 1XH4A 3QHWA 4UMTA 4TYEA 3VS1A 2ZV9A 3P86A 3LPBA 4G17A 4TNBA 4EOKA 3PXYA 4M7IA 3VS3A 3WE4A 4MBJA 5I3OA 4TL0A 5M06A 4R7IA 2CJMA 3SAYA 3AC1A 5EOLA 4G3DA 4L3JA 4ZZOA 2PULA 2HXQA 2WOTA 1JKLA 4FSRA 3F5XA 3UOLA 5LMKC 1Y8GA 4L9IA 5LJJA 2QG7A 3ZEWA 4QOXA 5BVKA 2CCIA 4NKSA 3VIDA 1FINA 4EOQA 4AT4A 1XJDA 3PJ1A 2OIDA 3MB6A 1IASA 5AUYA 4CQGA 2PVYA 4L3PA 2YZLA 4JDHA 4MF1A 5A4QA 3U54A 2CNQA 3EN9A 5C9CA 3C9WA 3NDMA 2Y4PA 4LUEA 5HCXA 4NKAA 2OICA 4I6HA 5ANIA 3UE4A 1BL6A 1WBVA 2PZIA 4FSMA 1H1PA 2VN9A 3DAKA 4X2NA 4XMOA 1XHAA 4PP9A 5DNRA 3TV4A 3ZLXA 2EUFB 2J50A 4QP7A 5I9XA 2YM6A 3P9JA 4U44A 3BYSA 4YJUA 4FV6A 4RIXB 4S31A 4WBBB 3LHJA 5J9LA 3RAHA 2F57A 5IEXA 5AP5A 4QP3A 2VX1A 3FI8A 3GEQA 4ANMA 3RVGA 4F9AA 4AGCA 1UKHA 1R78A 2R0IA 3H10A 5I9YA 4U79A 4A07A 3DJ7A 4JG8A 3B2WA 2PE0A 4AXAA 5B2MA 5CU0A 4FX3A 4QMUA 5IA5A 5GINE 2GS2A 3A8XA 4BR3A 3ANRA 4PQNA 4QMSA 5HU9A 1UWHA 4DFXE 3BGZA 4GU6A 5GNKA 4C61A 2BTSA 4IE9A 5HI2A 1M2PA 3DKOA 5CU4A 4FV7A 4EKLA 3S95A 5DGZA 2GMXA 4DFZE 1UWJA 1FMKA 1QPEA 4I5CA 4X2JA 2NO3A 4PTGA 4D2VA 5J95A 3RM7A 4FTOA 2VD5A 3KN5A 4YTFA 1YOLA 3W2RA 5J9YA 2QCSA 4NYEA 2XH5A 1LR4A 4RFYA 3ZC5A 4HNFA 3GC9A 5AR4A 3NNXA 4AZVA 3CSVA 2QHMA 3HRFA 4NWMA 1OL2A 4LOQA 5GIOE 1YWVA 2P2IA 2WXVA 1GOLA 2YA9A 2G2IA 5DT0A 3SOCA 2ITTA 3LCOA 3PXQA 3QBNA 4NW6A 4U8ZA 3EQPA 4XG8A 5F95A 3V6SA 3VNTA 3ZRLA 1YDSE 5BUJA 5C8KA 5HNBA 4FUYA 1V1KA 1PXMA 4ZSJA 3LMHA 2YEXA 5LCKA 1U5QA 4AT5A 3R7VA 3O8UA 5GIPE 2CMWA 2REIA 3OOGA 4PX6A 4XG7A 3KC3A 4O7WA 3QKMA 4MXOA 4BDDA 3OS3A 2JC6A 2AUHA 2FUMA 4FL1A 5IA4A 2BHEA 4EOJA 1UA2A 5HBEA 5EQYA 3U4WA 5L8KA 1P4FA 3CD3A 4M15A 1DAYA 3R8LA 2YLFA 4YZ9A 4BZOA 4RA5A 3FMLA 4HYUA 4H1MA 5AR7A 3IW4A 4QMLA 2WTCA 4OBOA 3VWAA 3AD4A 3V5TA 2XKFA 3P0MA 4NIFA 1IEPA 3FMHA 3DTCA 3L9LA 4GK3A 3VF8A 4BDEA 3BCEA 3PJ2A 4M8TA 3C0HA 3NR9A 2ACXA 3BHHA 3DBDA 3VS4A 4DC2A 3BZ3A 2WO6A 3EFLA 4P7EA 2C6OA 3PIXA 4NM5A 3GU4A 1H24A 1URCA 3OC1A 4FSUA 2YM5A 4GK2A 2GQGA 2LAVA 1CTPE 2JFLA 3UC4A 3WOWA 4O21A 5HE1A 3ZYAA 4CRSA 4UWBA 4Z9LA 3U9NA 4RIXA 3QZHA 4RX9A 2NRYA 4BFMA 1MP8A 3C5IA 4BCFA 1SM2A 1XH7A 5BUIA 3C4ZA 4JQEA 5AADA 4X2FA 2R5TA 1WVXA 2F7EE 1W8CA 5IQHA 2PHKA 4D4SA 3W8QA 5ETAA 4EH8A 2CNVA 3TZ7A 4UMRA 2J5EA 1TQIA 3KULA 4E3CA 2YM3A 4QP1A 3UQCA 2RIOA 4XX9A 5AUTA 4X6QC 4DGNA 3VQUA 3BYOA 5A14A 4GFOA 3MVJA 3VBYA 3MESA 3IDPA 4WSYA 4XG9A 3FPQA 3R00A 4FG7A 2HZNA 2W4JA 3TT0A 4BN1A 5BNJA 5IG1A 5LQFA 3MJ2A 3PVGA 2X0GA 4PPBA 5HG8A 5JSMA 2VTOA 1FVVA 3R22A 4L3LA 3RK7A 1V0PA 4IDTA 4EK8A 1PXLA 1REJA 4OTGA 4IWOA 4QYHA 4O86A 4LG4A 3M2WA 4E7WA 1YDTE 2ZM3A 3FZSA 3HMNA 4WKQA 2PY3A 2WTKB 1OPJA 4D2WA 1FPUA 1VYZA 3DXNA 4JLCA 3Q4TA 5DVRA 4D28A 3ZEPA 4FZ6A 4HNIA 4IAKA 2BAKA 2X81A 1UNHA 3NIEA 2ITWA 5GZ9A 3LKMA 2YIWA 3T3UA 3DTWA 3E92A 5AR8A 1ZZ2A 3TUDA 1YDRE 4ZSEA 1PF8A 3JYAA 4EC9A 5CQUA 3QGWA 3C51A 4AN3A 1JKTA 3OG7A 2XB7A 3VUTA 5DMZA 2NNWB 3L8XA 2YIRA 2QOIA 2O64A 4YBKA 3H3CA 1K2PA 3EN5A 3OWKA 2J9MA 1A06A 4A4OA 1Z9XA 4CTBA 3IS5A 4DINA 1FOTA 2YCSA 4YZNA 4Y5QA 4CFUA 3R7GA 1NT2A 2BKKA 5CI7A 3NMUF 2IPXA 1OB3A 1W7HA 5C4LA 2XUUA 4BCJA 5I9ZA 5IH4A 3R6XA 2B54A 2HK5A 3EFKA 4IWQA 3ALNA 2HCKA 5EG3A 2GHLA 3BPRA 1H28A 4N4SA 4YC8A 2GCDA 5HTBA 3IW8A 4FV9A 4E5BA 1U54B 2W1ZA 1XH6A 2PVLA 3WZJA 4IVDA 5DI1A 3KK9A 1MQ4A 2X7GA 3Q04A 4FNXA 3TNQB 5HIEA 5IA0A 2HWPA 5DR2A 3ZDUA 2OFVA 3EMGA 4DEEA 2ITNA 5EKNA 1KE8A 3QL8A 2ITZA 4XV9A 5B0XA 4XG6A 4BIBA 5JMSA 4ZAUA 1LPUA 3QTZA 4F1OA 2YZAA 2R3GA 4NFMA 3IOPA 4GKHA 2IZTA 2CKOA 3CLYA 2JFMA 1ZXEA 4AT3A 3F6XA 2VTIA 3LCKA 3ORLA 1GAGA 2HYYA 4ITJA 1HCKA 3R9HA 3EOCA 3ZOSA 4XV3A 1Q41A 4QMWA 4EOOA 4XEYA 4AA0A 2A27A 3A7IA 5JZJA 2V7AA 4QP8A 3KXGA 2V5QA 4KBCA 4H39A 5AAFA 2Z7QA 5IDNA 2C69A 3AQVA 4FTTA 4G1WA 3GT8A 3Q5IA 3A7HA 4AGUA 2X8DA 4GW8A 4BDHA 4GVAA 3W10A 1YXVA 5KMJA 2RSVA 5HD7A 4JNWA 4FKTA 4JBVA 1M7NA 4EOPA 2RG6A 3HUCA 3AOXA 2VZ6A 4AF3A 2JBOA 4RRVA 2PPQA 4FKRA 4CMOA 3BBWA 4Q9ZA 4ZS4A 3PVBA 3KF4A 4IDVA 1OIQA 3F7WA 2ZM1A 3MH0A 2PZ5A 1BUHA 4YJQA 1BLXA 3TKHA 3U4UA 4AZEA 2GNLA 4U9AA 4BKYA 4K1BA 4Y83A 4BB4A 4C8BA 4IEBA 4AZWA 1VJYA 3C4CA 2F2UA 2PVMA 5GHVA 1Q3WA 4FTIA 2ZV7A 4O1PA 1YI6A 5AP4A 3TG1A 4X7QA 3M42A 2PE2A 3UNJA 4BHZA 3UOKA 4RX8A 4FK3A 1J1CA 2Z7LA 3DGKA 4FGBA 3HP5A 2WD1A 2OH0E 4L44A 1Q8UA 4X2KA 4ZSGA 4DN5A 4F08A 3FMKA 4C38A 3NUAA 2R3FA 3DBCA 4RQKA 4ACMA 3NUNA 3MIYA 3PTGA 3SXRA 3V04A 3V5JA 3W2CA 2PTKA 3B8RA 2ITYA 4LFIA 2CKEA 5DA3A 4DBNA 2H9VA 3IPHA 4BBMA 3RPOA 3OY3A 4O7LA 2Y9QA 2FSTX 3C5UA 3CKXA 1OKVA 4B9DA 4C2WA 3KY2A 3QHRA 5CNNA 4C3PA 4DFUA 3SDJA 4JIKA 1U54A 4U43A 3RMFA 4AA5A 4J98A 5H8GA 2HW6A 4FIGA 1I44A 4H3PA 2B9IA 3EYHA 4O0XA 3PWDA 5DYJA 3JUHA 5E1EA 3EL7A 4EH4A 3NUSA 1PYEA 4ZJIA 1TKIA 4BF2A 4PDOA 5CU2A 4RC4A 3AMBA 4P5QA 4TXCA 1AGWA 3Q9XA 2PE1A 2BKZA 2IVTA 1JSVA 2FSLX 2YHVA 4Q9SA 4UEUA 3AGLA 3POOA 4HYHA 4UZHA 5AUZA 3FLWA 1IR3A 3V01A 1OKYA 3AMAA 5L6OA 5HTCA 4KS7A 2HY81 1WBWA 4NZWB 2UZDA 5DRBA 4IXPA 4EQUA 4USDA 5JH6A 4QMTA 2FA2A 4KWPA 5J5TA 2CKPA 3FC2A 1NVQA 1H07A 5EQPA 1JSTA 2IW6A 4KIOA 3QCQA 4E93A 3OF0A 4YR8A 3QA8A 3HNGA 4W4WA 1OL1A 5CASA 5E90A 1JVPP 4NK9A 4UV0A 4AE9A 3MVLA 1RDQE 4ZIMA 5M09A 3LFNA 1OZ1A 2HIWA 1ZOGA 4Q5EA 4UWCA 3D0EA 1PKDA 4E5AX 3WZDA 4FKUA 3R71A 4UXLA 2C0OA 5J87A 5TKDA 3ZSHA 4QD6A 4D1SA 1CKJA 4ZTHA 4ANNA 5T68A 4IAIA 5EKOA 3Q32A 5FD2A 3F5PA 3IGGA 4S33A 3RPVA 4NM3A 1FBNA 2VTQA 3QUPA 3R8PA 2XF0A 4Y85A 5KHXA 5DT3A 2VTSA 2YIXA 4M0ZA 1ZMWA 2XJ1A 4IWPA 1UNLA 5CXHA 2EB2A 3EKKA 3I5NA 2QC6A 3O0GA 4AZSA 3DLZA 2YISA 1KOAA 3F5UA 3UIMA 3QQUA 2QG5A 2VWXA 4MNEB 4ERKA 3SKCA 3EJ1A 4ZTSA 2VWBA 2R3PA 4EJNA 5ACBC 1ZZLA 4WNMA 3BU5A 3KXXA 1Q24A 4FT7A 2OI4X 3RJCA 2C5NA 4JBPA 4YHJA 3UO6A 3EZVA 5CEMA 2CLXA 3Q6UA 2X2MA 1STCE 2BR1A 5IEYA 4BDJA 2WMSA 4AGWA 4WBOA 2BZKB 2GNFA 4O27B 4CFMA 3BRBA 4QRCA 3IK3A 4YSJA 2E9VA 3PA4A 4R5SA 5E8ZA 4P4CA 4GT4A 3COIA 4U40A 3IOKA 3P4KA 2W1DA 2XNOA 3F66A 3KKVA 2VO0A 3F3ZA 4K6ZA 4F1MA 4X3FB 5HCZA 2DWBA 3R8VA 4CYJA 5CEKA 4FYNA 4JT3A 4V04A 1JSUA 2PVKA 4L7FA 3UIBA 4HGTA 4CZTA 1BMKA 3TJDA 4ACDA 3ORXA 5AIRA 3NYOA 4I41A 2E9NA 2PMIA 3PSDA 4UBAA 4WRGA 4C36A 4TYIA 1G8SA 4JG6A 4M69B 1QPJA 4GG5A 5M4CA 2BRGA 1URWA 2O63A 4HJOA 4K11A 2ETMA 3II5A 1OL7A 3O2MA 4KIPA 3C0IA 3BV2A 3LQ8A 4O38A 3ZM4A 2HAKA 5A3XA 3R1QA 3ENHA 3LFBA 4MH7A 4U7ZA 4ASDA 2UVZA 4Z7HA 2VGPA 5IMXA 3U55A 3C7QA 4FTAA 2GFCA 4ASZA 5K4IA 4FKOA 4KKGA 3V8WA 5KMNA 2JKKA 3CPCA 2OXDA 5T6KA 4I20A 3HV7A 4KUJA 4MX9A 3EIDA 4OBPA 1GJOA 2B9HA 4S2ZA 4XRJA 3CGOA 3GCSA 2FO0A 2JBPA 2ITUA 4R3RA 4XYFA 3PA5A 2OW3A 2VO3A 4HYIA 4UZDA 3KEXA 3LCSA 3QCXA 3OCSA 3OT3A 3QGYA 3JS2A 2HZIA 3FUPA 4LRKA 4PPAA 4F9CA 4QMMA 4F70A 1P5EA 4ZZNA 4FVPA 3O8TA 3S00A 4E20A 4DYMA 4DFBA 3DK3A 3ATTA 4XP2A 1VYWA 5HG7A 3DAEA 3L8SA 3WYXA 2GTNA 3JY0A 1KE7A 3PXKA 4X0MA 4BDBA 3ENMA 4JAJA 3QTRA 2IW9A 3VRYA 4TZRA 4FVQA 3BU3A 3QRIA 4X2GA 4C4GA 5IQIA 3ORTA 3GOKA 1YWNA 4MD8E 5E8YA 5JGDA 1Q97A 3R7UA 2VO6A 3R7YA 3V6RA 1JWHA 5H8BA 2CCHA 4OAVB 3ULIA 3VUGA 2NP8A 2ZOQA 2B52A 3PE1A 4MNEA 2F7XE 2VWUA 2B55A 4R3CA 2HW7A 3P7CA 2RFEA 3BLRA 3QQFA 1JKKA 2C68A 3C0GA 3LE6A 5TE0A 3UMXA 3P1AA 5H3QA 1YXUA 5FBOA 1PYXA 4O84A 2WKMA 4TYHB 5EDPA 5HVYA 4FE2A 2BZHB 4YLKA 2YCQA 1GZKA 5ETCA 3WZKA 4C3RA 2RGPA 2GNJA 3UYSA 2G2HA 3MH1A 2I0VA 4ZTRA 5DE2A 4ERWA 3NWWA 4KNBA 5CEQA 5JFXA 1TQPA 3ZRKA 4BYJA 4D55A 2XYUA 4DGLC 2YM4A 2UW8A 3LM5A 4C02A 4J53A 4O0VA 3ALOA 3CKWA 2B4SB 3S3IA 1U46A 2Y4IB 4X3FA 5FGKA 2JLDA 2OXYA 5E8UA 4LMUA 2E9PA 2HZ4A 3FQEA 2BPMA 4EONA 4S32A 1UV5A 2BRHA 4M69A 4CFNA 2I1MA 4GIIA 3RHKA 4ASEA 1WMKA 5HQ0A 1KE9A 3ATSA 2B9JA 4ZTMA 2C6EA 1OUKA 4XP3A 2Q0BA 3OY1A 4I0RA 3LFDA 5AX3A 3KMWA 4LL5A 4BC6A 4O7RA 4ENYA 3HV6A 2X1NA 3DJ5A 4QQCA 1WBPA 3EQGA 3I6WA 4PMSA 3DJ6A 4S30A 1SMHA 4MAOA 2WIHA 3MPTA 3R04A 2XEZA 2OGVA 4I5MA 5DLSA 3A4PA 3MIAA 4NJDA 3FL5A 4FL2A 3F5GA 1R1WA 5HKMA 2C5YA 4Q5HA 3RAWA 5CT7A 4B6LA 2WZJA 4OTQA 5DIAA 4P5ZA 2DYLA 4C59A 3FY2A 3FQHA 3WE8A 4KA3A 1ZRZA 2R7IA 3W2OA 4RSSA 3LIJA 3D94A 4FIIA 5JZNA 1OUYA 3GU7A 3NCZA 4J1RA 4WA9A 2BIYA 4KIKB 1YHSA 1UU3A 2IZRA 4F7LA 4BWXA 2XKEA 3FSKA 2Q83A 4QP9A 5M07A 5M55A 3PG1A 2X6EA 3BWJA 5HZNA 4KS8A 1YI4A 4ANBA 3O7LB 4HCVA 4IIRA 4GH2A 5KNJA 2R3QA 5FEQA 4XP0A 4JQ8A 3WZEA 4CQEA 3ORZA 4RVKA 5A9UA 3KRXA 3ITZA 1J3HA 2XIYA 3ZFMA 1SVHA 2WU7A 4O83A 5IQFA 1PKGA 1RE8A 5CSPA 3Q53A 3NRMA 3E8CA 2VU3A 2A19B 5HO8A 4TYHA 4XLVA 4EEVA 3UQFA 1YWRA 3EKNA 4TN6A 5FM2A 2FYSA 3KCKA 3VF9A 5J5SA 5K4JA 3KVXA 5KMKA 4UWYA 4DH3A 5ANOA 4LM5A 4MBIA 4CXAA 5HO6A 5CU6A 5EHLA 5BVWA 5EHOA 4FIEA 3SD0A 4PTCA 5K9IA 3CTHA 4QTEA 5BPYA 2ITOA 3TM0A 4CD0A 2XIRA 4JBOA 3PPKA 4YZDA 3QQHA 2XZSA 3FYKX 3ULZA 3RK5A 3BU6A 1RQQA 3DQXA 4I6FA 1H00A 2ESMA 5HE2A 5A4EA 4QYFA 3FMNA 1S9JA 4RIYA 1XH8A 5J7BA 3KGAA 3Q9ZA 2WTIA 4HPUE 4O0UA 2Q0NA 1ZLTA 4H1JA 4X3FC 4E6AA 4H3BA 4FKVA 4DGOA 3REPA 4FTKA 4YC3A 4OAUC 3SW4A 1QMZA 3TEIA 3TUCA 2W17A 3NNVA 4FF8A 3R01A 3ZSIA 2O3PA 1J7IA 4DE4A 5ANGA 5AX9A 5HGIA 4D9TA 4RA4A 1SYKA 3Q96A 2UZLA 4GU9A 2WTVA 3D15A 3QTSA 2Y0AA 4BDGA 4DH7A 3ID6C 4EZ3A 4IZYA 4L45A 3RWPA 1OBDA 3PSCA 2PMNX 1J7LA 2EXEA 5FTOA 2F4JA 3LZBA 4KABA 2OU7A 3WARA 5L2TA 3CBLA 2PYWA 5D12A 4LRMA 1B38A 3PLAE 3NNUA 4KIKA 3MH3A 3OCGA 5TR6A 4NIFB 4FNWA 2QURA 3CGFA 3Q9WA 2QOHA 5FP6A 1IRKA 2J7TA 3D5WA 3OW4A 1Q99A 3NIZA 3PIYA 4OW8A 2C5XA 2Z02A 3CS9A 1CKPA 3ORNA 4IB0A 1APME 1K3AA 2PVFA 4IAYA 3ZLSA 2VTNA 2XVDA 4ZY5A 1B39A 4K0YA 2QNJA 1V0BA 3BHUA 3QF9A 3ZUTA 3UZTA 3C4FA 4YPSA 3VBVA 3KMMA 2BAQA 3R21A 4G6LA 2QI8A 1ATPE 4BI0A 3MWUA 3VS6A 5CZHA 3B8QA 3P08A 4KD1A 1GIJA 5DR6A 4EHGA 3EL8A 1YOJA 1PJKA 2UZNA 4AACA 5CF4A 3TDWA 2BFYA 2CGVA 3RP9A 3IG7A 3IW5A 4YC6A 4M13A 3MFTA 3KULB 3FBVA 3NW6A 3UNKA 3I60A 4QMYA 4F7SA 2CHLA 3F3UA 3NS9A 4WG3A 3QU0A 2W1EA 4O6EA 5IQBA 4YJVA 5FRIA 4WNKA 4GL9A 5CTPA 2PWLA 5C4KA 3AC8A 3C50A 4RWJA 5ANKA 5JGAA 2YM8A 3OEZA 4O2PA 3HGKA 4I93A 3UMWA 2YACA 3R02A 4MWHA 4NH1A 3CCNA 4I22A 3WF8A 2C6IA 3F2NA 5I0BA 4G31A 5C03A 3GUBA 3FLQA 5BUEA 1WBOA 4FEUA 2UW5A 2VWWA 3QD3A 4PDSA 4ZLZA 1WVYA 3EQCA 4BYIA 2B1PA 5H2UA 2Y4IC 4AW1A 4C62A 3HEGA 2WQBA 5D9HA 4YU2A 5EDQA 4TWCA 3QRJA 5FDXA 2IVSA 3I1AA 2Y6OA 2J4ZA 2WMVA 2XRWA 2BDJA 3WYYA 3R9RA 5HIDA 3R7OA 1YVJA 4E4NA 5KO1A 4RMZA 5JFSA 4QPAA 2OF2A 2R9SA 3L1SA 4JAIA 2OJIA 1YHWA 4EYMA 5JFVA 3N4UA 4FEWA 1ZARA 4GEOA 4QP6A 5C26A 2XK3A 2ZYBA 2FH9A 3UNZA 3RI1A 3R8MA 2UZEA 3MY0A 1W82A 2WHBA 4KKEA 2WMRA 3K3IA 4TTHB 5AR2A 2B7AA 5B2KA 3POZA 2X8EA 2BALA 1Y6BA 4CGAA 4USFA 4RGJA 4BTFA 4IACA 3ZO3A 1Q3DA 2J0LA 5DEYA 3LXNA 2GU8A 1ZMUA 3HP2A 4J7BA 2PZPA 4ASXA 1IA9A 3FQSA 3TNIA 4I4FA 4GFMA 4NUSA 2VNYA 3ORIA 2BCJA 3LXPA 3RKBA 3V5WA 4DFLA 3ZTXA 2FSOX 4MXCA 2HY0A 3NCGA 3L8VA 4QYYA 4JVGA 2BMCA 1JLUE 2RL5A 3F69A 4WIHA 1Y91A 3E8DA 4O82A 4GJ3A 5AMNA 3ZCLA 4JRNA 2BZJA 4TT7A 2IVUA 3WIKA 1P4OA 3PXFA 2BRNA 5EDRA 4BICA 1PXIA 3ZUUA 3IECA 4KRDA 4RQVA 1KOBA 5BYZA 1CKIA 4EOIA 2A2AA 5EFQA 4CFFA 4JRVA 2X7FA 1AD5A 4RT7A 4WD5A 3PJ8A 4JG7A 3P23A 3PY0A 1TVOA 2QQ7A 2ERKA 1BL7A 2JKOA 3FKOA 2QHNA 5HE0A 3VJOA 4ALVA 4TW9A 4D2SA 2GNGA 2XKCA 3A60A 4A4LA 4TNDA 1Q5KA 5HLPA 2EWAA 4PMTA 2J90A 1HCLA 5DH3A 5HHWA 4DEIA 5JGBA 4XOZA 2O8YA 3UTOA 5HBJA 3FXXA 4XS2A 4GIHA 3KCFA 3D2KA 2XYNA 3GU6A 5I9WA 1SNXA 2PMOX 3FMEA 3MV5A 5TT7A 3ROCA 3AC3A 5K0XA 1GZOA 2XNGA 2G9XA 3N4TA 3F82A 4RG0A 3A8WA 5DEWA 5JRSA 2ZVAA 3DLSA 4CKJA 1FVTA 3NSZA 4EH6A 4HZRA 1PXJA 3DXPA 5AAGA 3IDCA 3OXIA 3KRJA 1OPKA 5H8EA 3E8EA 1DAWA 1M52A 1Y8YA 1CMKE 5JKGA 1DM2A 4HZSA 3RPYA 2CGWA 2E2BA 2W4KA 5IQEA 1H27A 4QMZA 3LFAA 5M4IA 3VC4A 4C58A 3BHYA 5B7VA 5D7VA 3D14A 4UMUA 4RVLA 5AJQA 3VS7A 4JR3A 5L2SA 3VVHA 3LFEA 3WF6A 2ZMCA 3SC1A 4EI4A 4YNEA 3V5PA 5IA2A 4H3QA 3VUHA 1BX6A 5IKWA 4QTDA 5GJDA 3BYVA 4PWNA 4J71A 2QOLA 4V05A 5AV1A 5HCYA 5C8MA 3QD2B 4LGHA 3BBTB 4FIHA 4D2TA 4F64A 3I0OA 1WCCA 2XEYA 4APCA 4B0GA 4DF3A 4NW5A 3ZXZA 3MI9A 2W5AA 3HRCA 2Z8CA 4AUAA 5E4HA 2P33A 4F9YA 5FUTA 2YJRA 3FI4A 5F4NA 3CXWA 1YI3A 1OL6A 3O71A 5FTQA 5LVPA 4YZCA 3MFUA 3CTQA 3ETAA 4ITIA 4V0GB 3MA6A 4XHKB 1BYGA 1R39A 5ANEA 5C8NA 3FLNC 4MEDA 2ZM4A 4G6NA 3FPMA 4NEUA 4OTHA 4DEBA 4PP7A 4DG0E 4YZMA 4C33A 2W9FB 3HLLA 5JT2A 2WEIA 3H9FA 2WPAA 4BRXA 1NW1A 2H8HA 1ND4A 3QD4A 4ANLA 3VUMA 3NZ0A 2WMQA 2P3GX 4FMQA 1KSWA 5AP7A 3BKBA 4O6LA 3RCDA 3LMIA 3AMYA 3K5UA 4QNAA 4TRLA 5IA1A 2JGZA 4IC8A 3RGFA 1WFCA 3I5ZA 1LP4A 2ITQA 1YQJA 2QR7A 3P5KA 4O22A 5FLFA 2C47A 3VUDA 3ZO2A 4E4MA 3HDNA 4UXQA 4FSNA 1QCFA 4L46A 1ZOHA 3MPAA 4FKIA 3KN6A 3SA0A 2JDOA 2VUWA 4G3GA 2UZTA 3COHA 3E8NA 5C01A 3DKCA 4E8AA 4PDYA 3CR0A 4WNPA 4A7CA 4DFNA 3PWYA 5IU2A 4W9XA 2X7OA 5CF6A 4F6WA 2WMTA 2AYPA 2UZOA 3BLQA 4AX8A 5HX6A 4ZY6A 3SXSA 4NM7A 4HGLA 1GIHA 4W4YA 5CT0A 2I0EA 4GT3A 3F7ZA 4FV3A 3ORPA 4LGGA 2QVSE 2XNEA 2O5KA 5DHJA 5IA3A 5LXMA 4YTCA 2YWVA 4GG7A 3IDBA 1J91A 3ACJA 5HEZA 5F1ZA 4TKSA 4M97A 3A99A 3LJ0A 3BELA 5IQAA 3TIYA 4RWLA 3MFSA 2J6MA 2OJFE 2WMAA 2BDFA 3JPVA 1OITA 3P7AA 4RFMA 4DCAA 1A9UA 3Q3BA 2QODA 4HVIA 1H8FA 2H34A 4YNOA 5F94A 4Y73A 3TL8A 2EXMA 4EC8A 2PZRA 4F0FA 4BTJA 1M2QA 1O6YA 5DWRA 3DB6A 3VRZA 4U45A 2QOCA 4I3ZA 4LQMA 4N0SA 2PUNA 3EQBA 2C0TA 3BHVA 4ALUA 4CZUA 2Y7JA 3ZDIA 5I4NA 1M14A 2WOUA 3FWQA 1R3CA 2OLCA 4H58A 3Q4ZA 4W4VA 3LJ2A 3MBLA 4NL0A 4C0TA 3NEWA 3LAUA 4YSMA 4V0GA 4C3FA 4CNHA 3S0OA 3MA3A 1QL6A 4J95A 4BHNA 4WRSA 4MXAA 5D7AA 5M08A 2RFDA 1F5QA 3A2CA 5E8TA 4O91A 3HL7A 2VAGA 2WQMA 4AOJA 4O0RA 4OBQA 4J97A 3Q60A 2FGIA 1RJBA 3ROYA 2J5FA 3VW6A 3HAVA 2YAAA 3UG1A 1XWSA 5E1SA 2RG5A 3Q6WA 2Y6MA 1FMOE 4GK4A 2X9EA 4I0SA 4C4EA 2WTJA 4R3PA 4GKIA 3TCPA 3QQKA 3QLGA 3MPMA 4GUBA 4DH8A 3RWQA 4G3CA 5AP6A 3HV5A 3EQHA 5K0KA 3FLZA 3QQLA 3NNWA 2PUUA 3W16A 3D7ZA 4C4FA 4D1XA 2Z60A 2Z7SA 1KWPA 2XA4A 3DAJA 5AIKA 1G8AA 4EH5A 2IZUA 4ZTLA 3OWJA 5CXZA 2R64A 3GP0A 4WG4A 5HG5A 3E63A 3GXLA 3R2YA 4CMTA 5AA8A 2VO7A 2HOGA 2PUPA 2BZIB 2JAVA 4UMPA 4PPCA 2OH4A 4FEVA 4B8LA 5LMBA 3GENA 3HZTA 4BVUA 4Z3VA 3FEGA 2BAJA 2W06A 3GC0A 3V5LA 3W2SA 4KBAA 1ZWSA 4F7NA 4FTQA 4EK4A 5CVFA 4A4XA 3E93A 3TN8A 4MTAA 3S4QA 5F9EA 5CANA 3GC7A 3EQIA 2YDJA 4RC3A 5LMAA 2V7OA 4FOCA 2VTAA 4FTMA 4QMNA 1KV1A 4YUQA 5KKRB 4J52A 1V0OA 4FKGA 5EYDA 4AW2A 4O81A 3ORKA 4RJ3A 4MK0A 4YLJA 5CAVA 4AN2A 4FV1A 3OFMA 5ETIA 4DA5A 2H96A 3CJFA 4QQ5A 4F9WA 3W33A 5KZIA 4P90A 1YHVA 2OG8A 3D2IA 3PY3A 3QZFA 4EK3A 2OIBA 4RZWA 4FR4A 5E8WA 4AU8A 4U41A 2O0UA 5ETFA 3R0TA 3DDQA 3QWKA 4IX6A 4XG2A 4AGDA 4KIQA 4FV5A 4L43A 4ID7A 3TDVA 2GDOA 5FQDC 3O51A 3UOHA 2C6DA 4RJ5A 2XK8A 5AA9A 1FGKA 2VRXA 3U6JA 2OZOA 4B7TA 5CAUA 4EBWA 3PA3A 1M7QA 4G5PA 3UQGA 4UN0C 4FTJA 4EQCA 1RW8A 4FVRA 4XCUA 5A6OA 2W5BA 4QYGA 4JXFA 3WI6A 4K33A 4L67A 2KULA 2R3JA 2BDWA 2CSNA 5L2QA 4ANOA 3WF9A 4AFEA 4MQ2A 4FBXA 4FA2A 2R3RA 5GJFA 5FTGA 5AV2A 4AG8A 3QTIA 5KHWA 3AGMA 2XBAA 2PSQA 2PVRA 4CV8A 4E4XA 3R7IA 2X6DA 2PL0A 1ZYJA 5IZFA 3TV6A 2BHHA 4WT6A 2EVAA 1F0QA 2C1AA 4MXZA 4RX7A 4R1YA 3P79A 4F99A 4CLIA 5EYCA 4NFNA 5CVGA 4BTMA 3N4VA 1JPAA 2PU8A 4W8DA 2W1IA 4G3FA 2WGJA 5DR9A 3EZRA 4O0WA 5I9UA 4QP4A 3OTUA 4HOKA 5KBQA 1XBBA 2UW3A 2GFSA 2CN5A 4LUDA 2UV2A 4PMMA 2XCHA 3DA6A 4C2VA 5J1WA 4FV0A 2OK1A 3UGCA 3D5VA 5L6WL 3HECA 3ORMA 3T9IA 5AR3A 5ITAA 2IG7A 1GIIA 3HMMA 3OHTA 1TQMA 2XJ2A 2XK7A 3MDYA 4FSYA 5K5XA 3TNPC 4YZBA 4FEQA 5BMSA 5ANJA 3QTWA 4EYJA 1LEZA 2GTMA 5FEDA 5BMMA 4IM3A 3UO5A 3D7TA 5IPJA 4AFJA 3PFQA 4E6DA 2AC3A 5CF8A 1OI9A 3NAYA 2ITXA 3KXHA 4V01A 4I94A 4JX7A 3BIZA 3A7GA 1U4DA 2J0MB 2IWIA 2VTJA 4BDAA 4EQMA 1ERKA 2YFXA 4RBLA 4DT9A 3L9MA 3DDPA 5J8IA 5M53A 1U5RA 4QMQA 3FE3A 1KUTA 1OIRA 4AWIA 2V22A 4ACGA 3S1HA 1OKWA 3ZHPC 3K3JA 4KRCA 4D4RA 3NUXA 3DBEA 2OZAA 3KB7A 4JIAA 3UDBA 3ACKA 1Q8ZA 3D5XA 4H36A 3RINA 4CMUA 3NUPA 3ANQA 3DNEA 1OL5A 4G5JA 2CKQA 2YITA 4G3EA 1WBSA 3UPZA 3BGQA 3HV4A 3E62A 1CSNA 4FODA 2VNWA 4Z16A 5CZIA 4BZDA 3PRFA 3WBLA 3OROA 1BI8A 1W98A 2JIVA 3EN6A 2V0DA 1SVEA 3Q2MA 5A4TA 1PXNA 4QTBA 1CDKA 2YM7A 3PUPA 4S34A 1Q8WA 3EQDA 1I09A 4BCGA 5CAQA 2PZYA 3O8PA 4XJ0A 3RNYA 1YXXA 3QXPA 3HMOA 5L6PA 3DK6A 4FNZA 4HGEA 4J8NA 5EHYA 5HVKA 1DS5A 3DT1A 3T9TA 4KSPA 1R0EA 3GOPA 5AR5A 5AM7A 4YO4A 4FSZA 4QTCA 5AV4A 3GI3A 4M12A 3JY9A 4FOBA 2R3OA 4RIYB 2W1GA 4CEGA 1G3NA 4O96A 4TYJA 4BGHA 3WILA 4JS8A 5B2LA 3Q5ZA 5D1JA 5IISA 2J2IB 3E7VA 2YN8A 4LV8A 3ZC6A 2WU6A 3GCPA 2CGXA 3GB2A 3R1YA 1GNGA 5EK7A 4HVSA 1PRYA 3FHRA 4YHFA 3OT8A 2YAKA 4J96A 4YJNA 4RVMA 4PNIA 4D9UA 4EHZA 5I9VA 3KMUA 5HU3A 5LVNA 3OVVA 4TWNA 2GSFA 2VTRA 2UW0A 4WNOA 3FI3A 3MN3A 2R2PA 1W84A 2XNNA 4FKPA 4M14A 4BCPA 5JEBA 3PVWA 1UU9A 3CQWA 3A7FA 3QQGA 1OECA 4YHTA 3QALE 4D2PA 4AN9A 4OGRA 3SG8A 3GFWA 5L8JA 4ACCA 5AUVA 5HORA 1REKA 2UW7A 2F9GA 4AQCA 4EZ5A 2JITA 3DB8A 1YXSA 4JDJA 2WEVA 4YPDA 2Z7RA 3AC4A 3NYVA 2YWPA 4CLJA 5EW8A 2XCKA 3EH9A 2J0JA 3OCBA 3G2FA 3H9RA 4X21A 5AEPA 2YDKA 3GQLA 3QD0A 3IKAA 3D4QA 2JKQA 4ZLOA 2KTYA 3D9VA 4EK5A 2R4BA 4GS6A 3BYMA 1H08A 1QPDA 3RCJA 3ZS5A 4ALWA 1IG1A 3M11A 4M66A 1XO2B 2WMBA 3SGCA 2BRMA 5J79A 5KKRC 5IUHA 5A4CA 5G6VA 4RLKA 5L3AA 2QU6A 1PMUA 3G15A 4O7TA 5CEOA 5M44A 4CZYB 1PXOA 1H1QA 4FKJA 4OTRA 2ZB0A 2VTTA 4IW0A 5EOBA 5CEPA 4GSBA 3UZPA 5IH5A 5LCJA 4YMJA 3SW7A 3GCQA 3VBWA 3G51A 4DGGA 4TWPA 1P2AA 4ZLYA 3KXNA 1MRVA 3LCDA 3MTLA 3COKA 4BDCA 2WELA 3LQ3A 4MF0A 3JR1A 2ONLA 3AXWA 2OJJA 1R0PA 3FMMA 2CLQA 2VTLA 1KE5A 2X4FA 3D5UA 5HESA 5IUIA 1W83A 4G16A 3WF7A 4EH7A 3ELJA 4FTNA 3FHIA 4FV2A 3Q4CA 3FMJA 4YJPA 3I0QA 4ZJVA 2PUIA 2XK4A 1H4LA 3R2BA 4FV8A 4K18A 1GY3A 4Z55A 5K5NA 3OEFX 4M67A 4RX5A 4ORKA 4AOTA 2HZ0A 3PP0A 4FTCA 5ANDA 3OBJA 5L4QA 5HIBA 3A7JA 4FI1A 2YABA 1M2RA 4U5JA 2VGOA 2EXCX 5HOAA 3DKFA 3MSSA 3U9CA 5BVNA 3GNIB 4KSQA 3BE2A 1SNUA 2OF4A 3FDNA 3R28A 3VULA 4U42A 4DEHA 1OM1A 3LFFA 4QPSA 5HX8A 3LFSA 3VS2A 1FVRA 2J0KA 2VV9A 5AFVA 4HPTE 4LGDA 5CAOA 5DPVA 4F6SA 5G1XA 4JQ7A 5DT4A 3DV3A 4BBEA 3HV3A 4FKSA 4I4EA 3ZZWA 1U59A 4HCUA 1XR1A 4EOLA 4O0TA 4EH9A 1E1VA 4RPVA 5EI2A 3RK9A 4E1ZA 4FKLA 3VQHA 2C1BA 2QO9A 3T3VA 3BGPA 5IF1A 5FXRA 2F49A 5EI8A 5E91A 4WG5A 4R1VA 3AT4A 3EN7A 4O7SA 4G6OA 3UIUA 4MBLA 4CT2A 2WMWA 2XM9A 4EL9A 3F61A 5KCVA 3NAXA 1JAMA 3ODYX 3COMA 4Y5HA 3V8SA 3VO3A 4AOIA 3NYNA 5K3YA 4GMYA 4BKZA 2QKRA 4B4LA 2YLEA 5D10A 3RPSA 5AP0A 1F3MC 4FKQA 1AQ1A 4FTRA 4JOAA 4EJ7A 1FGIA 2IVVA 2XIXA 3O7LD 3P78A 3AG9A 4BZNA 4FSTA 3CTJA 3P7BA 4IX4A 3GU8A 4EWQA 4BCMA 2GQRA 3SG9A 5BX0A 4OTPA 4GYIA 4FT9A 4C57A 3PLSA 5KZ0A 1LEWA 3DY7A 4LL0A 3DOGA 3RHXA 5EQEA 4HVGA 3T8OA 3O17A 4MHAA 3G9NA 3PIZA 3QKKA 3WF5A 2C6LA 5ACKA 3W8LA 5D41A 3QCSA 1H25A 4WSQA 3FZPA 5J7HA 4KAOA 4WOVA 4AS0A 4F7JA 5KBRA 3QXOA 3PJ3A 1LUFA 3EHAA 4BCHA 4JX3A 3HA6A 4U3ZA 5L8LA 3QAME 4Y72A 3NW7A 5A6NA 5FBNC 4IWDA 3OTVA 4ZMFA 4KKHA 2YCFA 4NCTA 3AC5A 1ZYLA 3DBFA 4RLLA 3LOKA 5LWNA 2VWVA 3H4JA 2ONLC 3KFAA 5C1QB 1MQBA 2ERZE 2UW4A 4LYNA 3RZBA 4BDFA 4I0TA 5AUUA 2R3MA 4FSQA 5EM7A 3TNWA 3CJGA 3W32A 4F65A 4XBUA 2C6KA 2UW6A 1JOWB 5LARA 5KMLA 3TZ9A 4I24A 4HVDA 2H6DA 4R7BA 4UMQA 2ZJWA 4L00A 4EBVA 4TPTA 3HX4A 4EORA 4A9UA 4ACHA 2OJGA 4L52A 4BCQA 5EM8A 4EWHA 2JEDA 5AUXA 4IVAA 4ZS0A 3VUKA 3UVQA 2GS6A 3R1NA 2QLQA 1DI8A 1QPCA 1VZOA 4HCTA 4DITA 3BYUA 1OGUA 2C5OA 3AD6A 3G5DA 3NYXA 4RIOA 3VBTA 3ZRMA 4CVAA 3QLFA 5FDPA 3E64A 4D0WA 4KB8A 3E5AA 4B8MA 3UJGA 1ZMVA 1UU8A 3HA8A 4C34A 4ZP5A 5E8XA 1E9HA 3TV7A 3FC1X 2W1HA 3BX5A 2BFXA 4QT1A 3ZONA 2R7BA 4E73A 3FSFA 4LMNA 2R3NA 2VWIA 4LI5A 3ZZEA 3NLBA 3U6HA 5EI6A 4OT6A 2BUJA 2IJMA 4GVJA 3UVPA 3QKLA 2W05A 3DCVA 1JNKA 3ET7A 4PL3A 1PMEA 4FV4A 5IEVA 5LOHA 3EWHA 4QQJA 3W18A 3Q52A 5IDPA 5DFPA 3BQCA 5KMMA 2VX3A 3RBWA 4BCKA 4XBRA 1UKIA 4FG8A 3KRWA 2I6LA 2PVJA 3CPBA 3I81A 4FYOA 5CVHA 4I5HA 3GGFA 3HVCA 4IANA 1NXKA 3I7BA 3EFJA 1VR2A 3FL4A 1DI9A 3L8PA 4ENXA 5EH0A 4D58A 4OTWA 5AP1A 5CSXA 2G15A 4FZAB 3TIZA 3UP2A 4D0XA 3ZU7A 2GHGA 4RJ6A 3AC2A 4ZEGA 4R78A 4HGSA 2C30A 1KE6A 2W4OA 1O6LA 4DHFA 1OPLA 4LV5A 2CPKE 2E9OA 2ZMDA 2W1CA 3PP1A 4IFCA 2GNIA 2XBJA 4NTTA 5TO8A 2WQNA 3RZFA 3VS0A 4MYGA 2DUVA 2RF9A 4JR7A 4YURA 5J9ZA 5KMIA 5M57A 1K9AA 4FT0A 1P14A 4BBFA 2WB8A 3F2RA 4ZTQA 1M17A 5AP3A 3ZM9A 3DU8A 3QC9A 1B6CB 4N6YA 4A06A 4WUNA 3PPJA 4OLIA 4RZVA 4L53A 1SZMA 5JFWA 2X4ZA 3O23A
chains in the Genus database with same CATH superfamily
2WTWA 4FKWA 4TY1A 5BQ0A 3VS5A 3QZIA 4YJSA 4FSWA 3FXWA 4NCTC 2NRUA 1WBTA 4IB1A 4H05A 2ITPA 3MGYA 3O96A 2VWYA 4IX3A 1MRUA 2RKUA 2BTRA 2P4IA 5LVLA 4RWKA 3BLHA 3MTFA 2CGUA 2PVHA 5C27A 3CC6A 3TWJA 3TTJA 5JQ5A 3R83A 5AM6A 4J99A 4O0SA 5CU3A 2PVNA 3PXRA 4I6BA 3CP9A 2JDVA 3G0FA 3HMPA 1WBNA 4WHZA 3NUYA 4ZY4A 4IZAA 4GFGA 4CRLA 3QTUA 5M4FA 3MVMA 4F4PA 1X8BA 4G9RA 3V51A 2BIKB 3PZEA 3ODZX 2R0UA 3RTPA 4NTSA 4F0GA 5DOSA 1VEBA 5KE0A 2X2KA 4ARKA 1YKRA 4RJ8A 4AP7A 4MD9E 3QRTA 4QP2A 3VHKA 3ZXTA 1MRYA 3E3PA 4IMYA 2HENA 4IFGA 4C4JA 4IM0A 5JN2A 2XM8A 5EM6A 4BCIA 4DEDA 4NT4A 2WAJA 5M51A 1A48A 5CENA 4BIDA 4DT8A 2QLUA 4PF4A 1OMWA 3UG2A 4MKCA 2UUEA 5FWKK 4CYIA 3QUDA 3K54A 4NU1A 1Q8YA 4PY1A 1Q62A 2QOFA 3E3BX 2C0IA 3IQ7A 3LW0A 3QYZA 3U51A 3SXFA 4W4XA 4E26A 1PMVA 2R3IA 5FEEA 3UO4A 4HVHA 3KXZA 3UIXA 5EW3A 3AT2A 3DQWA 2A4LA 3FLYA 1YOMA 5FG8A 4UY9A 3R8UA 3PXZA 5E8SA 1Z5MA 2BROA 5AAEA 3FV8A 2C3JA 4F0IA 3EQRA 4LOPA 4CFWA 3E88A 4U3YA 3R73A 2JIUA 2QOQA 4K2RA 2YJSA 5HLWA 5BVFA 3R30A 3V8TA 4BTKA 4II5A 2VTPA 1PXKA 3I6UA 4IC7A 1CM8A 3FXZA 3VAPA 3IONA 4EH2A 3KRLA 3C13A 3QFVA 3DXQA 1OBGA 2RFSA 3A61A 1Q4LA 3DPKA 3HRBA 2UZWE 4IHPA 3CQUA 4IAFA 5HICA 4UYNA 3VJNA 5T3QA 4O7YA 4RFZA 1IA8A 3BV3A 3OWLA 4M3QA 4DCEA 2B0QA 4O7VA 2XS0A 3LQ5A 3THBA 4EOSA 3HAMA 4PDPA 2W9ZB 3ZO1A 1ST0A 5EYMA 1OVEA 2E9UA 3BEGA 5IQGA 2W99B 5HBHA 4DLJA 4L6QA 2AC5A 4IH8A 4CG9A 2ZAZA 4N6ZA 1H0VA 4ZTNA 5AP2A 4CKIA 5CALA 2QO2A 4BY9E 3W2PA 3PDTA 3QTQA 4Z7GA 1Y57A 4QMOA 1PHKA 2JAMA 2W7XA 1L3RE 3NW5A 5L2IA 2UZUE 4BWPA 4MD7E 4O4EA 4MVFA 5ICPA 3K5VA 3DKGA 2QOOA 4CKRA 2VWZA 4ZMEA 4EHVA 4UB7A 5KX8A 3Q4UA 4F6UA 3VW8A 4N70A 1XQZA 4NSTA 4TWOA 3G6GA 2XMYA 2A1AB 2V62A 2JDRA 4B99A 2SRCA 3QZGA 2C3LA 4W9WA 5FP5A 3G9LX 4QQTA 3NVKI 4FNYA 2ITVA 2IN6A 5DBXA 1ZY5A 1UU7A 4USEA 2CNUA 4FEXA 4PUZA 1Q61A 3EN4A 2JKMA 2GQSA 2OKRA 3CY2A 2XIZA 2VTMA 3SRVB 2GHMA 2W5HA 3QWJA 4L68A 5CYIA 1PXPA 4ANQA 4DG3E 4JDKA 3RNIA 4KBKA 4I1ZA 4APPA 3DZOA 4FZDB 3LLAA 4YTHA 1UNGA 3O50A 3MYGA 4XH6A 2CDZA 3H30A 3VBXA 4ZJJA 3UVRA 4CFXA 2ZV2A 4IJ9A 3ZLWA 1WVWA 1JKSA 1T45A 4MUQA 4IZ7A 3KQ7A 3I7CA 4AW0A 4CT1A 4D2RA 4A9RA 5BVDA 5I3RA 5M56A 2FVDA 1OKZA 3RAKA 3BQRA 1GZ8A 3CIKA 5CSVA 4AW5A 3TZ8A 1J7UA 1IAJA 1ZYDA 4X3JA 3QRKA 1H1RA 3FMDA 2C3IB 4YJRA 4ZK5A 4OUCA 4FIJA 3NPCA 4U97A 4I21A 5CNOA 4R5YA 5I5ZA 4AZFA 3MY5A 4QMPA 1W0XC 3OXZA 5H9BA 4J8MA 3IO7A 4AA4A 4CCBA 4OR5A 1PY5A 4JDIA 3SQQA 2QKWB 3MJ1A 4C35A 3A4OX 3DFAA 3R9NA 4A9TA 3A62A 3HUBA 3OCTA 4JMQA 4IVCA 2LGCA 3BL7A 2WFYA 4JI9A 4XRLA 3EYGA 2BRBA 3LXKA 4HW7A 4UALA 4I23A 3PJCA 3ERKA 1XH5A 4Q2AA 4UYAA 3FKNA 3D7TB 4GYGA 1YW2A 4C7TA 4FG9A 1T46A 3C4WA 3OBGA 4YP8A 1BKXA 4L7SA 2A0CX 3TI1A 3F2AA 5AWMA 3ZSGA 4ZSAA 4EK6A 2XK9A 3OUNB 4L8MA 3KREA 3UODA 1JQHA 4OTFA 2WQOA 4XUFA 3F3VA 5AV3A 5GZAA 2ZB1A 4UX9A 1H01A 5KUPA 5BYLA 4PL4A 3F88A 3PG3A 4FL3A 5FXSA 3WZUA 5IQDA 1G5SA 4IADA 3HKOA 5BVOA 3CQEA 3W0MA 4GV1A 2JDTA 3PPZA 2PMLX 4RIWB 5CSWA 5DRDA 4BKJA 3KIOC 3GC8A 3FZ1A 4MXXA 4ZZMA 2O2UA 4YLLA 3AKKA 3PVUA 2OZAB 2WNTA 4RVTA 3DBQA 3ZFYA 1G8KA 4CSVA 3E87A 4EKKA 3R1SA 2Y8OA 5DG5A 3KRRA 4U80A 2X2LA 3DFCB 5JK3A 4BJJB 4EUUA 3OWPA 2XKDA 5HD4A 2WMUA 5M4UA 3PY1A 3IW7A 1EH4A 2UVYA 3UPXA 5E7RA 1XBAA 4KINA 3SRVA 2ZDUA 4FIFA 2R3LA 3OW3A 5CLPA 3TXOA 4F9BA 4D5HA 5KMOA 2XNMA 4FICA 3CEKA 3NX8A 1ZYSA 2WTKC 4C4HA 5CWZA 2W1FA 2QOKA 3LVPA 5HVJA 4R77A 4K8AA 4PRJA 5BVEA 2G2FA 3F3TA 2B9FA 1WZYA 3ZBFA 4LOOA 5E8VA 4FT5A 4DHJA 1ZYCA 4OT5A 1PMNA 3R9DA 4XV2A 3TJCA 4M84A 3PSBA 4O1OA 4CCUA 2G1TA 5A4LA 3L9PA 4WUAA 5E92A 1OIUA 1S9IA 2XRUA 3KU2A 4IB3A 2F2CB 3OZ6A 4R6VA 3BWFA 3SLSA 4D1ZA 4IM2A 5GZ8A 4DBXA 2YERA 2UVXA 4XLIA 1H1WA 2BVAA 2FSMX 3FJQE 2VX0A 2XNBA 4GT5A 3H9OA 5TF9A 3RM6A 4DH1A 3BEAA 3DNDA 5JRQA 4XNEA 2O65A 3JXWA 2Z2WA 4MWIA 3BI6A 4JBQA 3PUFC 4NM0A 3JVSA 5CQWA 2HXLA 2W96B 5FXQA 3JVRA 5J1VA 3R9OA 4N57A 4O7ZA 2YDIA 2X8IA 3MH2A 5HG9A 3RPRA 3AT3A 2CN8A 3MVHA 4YGAA 3UC3A 1KV2A 2R3KA 3AD5A 4BI2A 2EU9A 2QR8A 3W0PA 2P0CA 4EOMA 4ZSLA 3FYJX 3K2LA 5TOZA 3UP7A 4YJTA 3L9NA 3Q2JA 3EB0A 2XK6A 4IQ6A 2UZVA 4EZ7A 4BDKA 2R3HA 4IJPA 3BE9A 4NJ3A 3SV0A 2W0JA 3C4XA 2XP2A 4AZTA 4BDIA 1XBCA 4DAWA 3UZRA 4CG8A 3GQIA 5EW9A 3LFCA 3OUKA 5CSHA 4MNFA 3UYTA 4EH3A 4DTKA 4O7NA 3M1SA 3CE3A 4A9SA 4RIWA 3GCUA 5A54A 4A9YA 1G8JA 5HNGA 2OFUA 1XMLA 5EYKA 1ZOEA 3DK7A 3KVWA 5CY3A 4K77A 3R8ZA 2EB3A 2DQ7X 2IEWA 4GCJA 3UBDA 5HO7A 3RAIA 3GU5A 4XG3A 2G01A 5A46A 5CAPA 3OXTA 4FK6A 3VBQA 4M0YA 4CTCA 2QU5A 3MY1A 4QMVA 2JD5A 3HMIA 3ZBXA 4C4IA 4IZ5A 3U6IA 4FGRA 4BJJA 2J51A 3FKLA 2C3KA 2YCRA 4F09A 4RC2A 4DTBA 2XJ0A 3KF7A 4YJOA 3FZRA 4DLIA 3KXMA 5HNIX 3QTXA 2OSCA 3I4BA 1ZAOA 3QX4A 1SVGA 1NY3A 4DG2E 2X0PA 4RWIA 2JDSA 3LCTA 4RJ7A 4G2FA 4O4DA 3LJ1A 3C1XA 3W1FA 4Y95A 3TUBA 2ZDTA 4K9YA 3G6HA 1H26A 5CS6A 5F20A 2P2HA 4FZ7A 3PE2A 4L42A 4C37A 4OTDA 2QD9A 3SOAA 2X39A 3GVUA 3ZUVA 4PMPA 3Q9YA 4P2KA 2C6MA 2JIIA 1XH9A 3TZMA 2XIKA 4D4VA 1XKKA 2OWBA 4PL5A 5HE3A 5IUGA 4FRFA 3E7OA 3PRIA 4PV0A 3SVVA 4O0YA 4GJ2A 3ZFXA 3N9XA 5CX9A 3RALA 4F63A 3QX2A 1ZY4A 1BI7A 4ONAA 3G0EA 5CI6A 2F7ZE 2X9FA 3C4EA 3MS9A 5AV0A 2UZBA 3ZH8A 1YXTA 3FZOA 4DTAA 2GPHA 3W55A 3KK8A 4IB5A 3U87A 3GFEA 4QYEA 5LVMA 4AAAA 3G33A 2YIYA 1HOWA 4QO9A 3SX9A 4Y8DA 4D5KA 2HWOA 4ZOGA 5D11A 2ETRA 1OIYA 2NPQA 3UOJA 4QTAA 5JQ8A 3MW1A 2OJ9A 3OOMA 2QO7A 4DEAA 3KA0A 4CFVA 4AE6A 4FTUA 5EM5A 3TTIA 4FUXA 4MCVA 4JJRA 4U81A 3BHTA 4FZFB 4IAZA 1JBPE 2WMXA 3EFWA 4FT3A 4XV1A 3FLSA 4DEGA 2VTHA 4IBMA 1O6KA 5FM3A 2I0YA 2QOBA 4ITHA 4BWKA 2YIQA 2XNPA 3VHEA 3KL8A 4MXYA 4MQ1A 4BCOA 3NUUA 3TNHA 2PK9A 1IAHA 4EHEA 2WQEA 2IZSA 3FI2A 5BYYA 3PYYA 5LMKA 3GBZA 5LWMA 5CF5A 4XOYA 4I92A 3D83A 4TYGA 2V55A 2J0IA 2UW9A 3SHEA 5IMEA 3ZMMA 3QC4A 4I6QA 1H1SA 4D4YA 4YBJA 2GS7A 4XG4A 3S2PA 1Y6AA 2RFNA 3IGOA 4E6QA 4U6RA 1GZNA 2OO8X 3IW6A 3OMVA 3MFRA 3TKUA 3LLTA 4BCNA 4IAAA 2I7QA 5E9EA 4AAYA 3MB7A 1MUOA 4FTLA 4ZXTA 5IQCA 3FZTA 4YTIA 2OXXA 4GRBA 3V3VA 3ZO4A 4DGMA 2P55A 3HYHA 4DDIA 1FQ1B 3LXLA 1UVRA 2BILB 2HELA 3QCYA 4X6RA 4CV9A 2C5VA 1L8TA 4M68A 3TKIA 3QQJA 3N51A 4BL1A 4Y46A 4F1TA 4LRJA 4JL9A 3QA0A 5GJGA 3R7EA 3B2TA 3QYWA 3H0ZA 1H0WA 2C4GA 3G90X 2B53A 4IVBA 4QPMA 3VUIA 4BGQA 3FAAA 5HLNA 3VN9A 2OBJA 3FY0A 3LMGA 3H0YA 2I0HA 4IX5A 5HTIA 1E1XA 4U0IA 1NVSA 2GNHA 1PW2A 4QNYA 3GCVA 3I79A 3UDSA 3V5QA 3WIGA 5IH6A 3QUEA 5AUWA 5L2WA 4BIEA 3NVMB 2WIPA 4FC0A 1O9UA 3LM0A 3PZHA 2WTDA 1YRPA 3U8WA 1NA7A 4OTIA 4O2ZA 4W8EA 4ANSA 4YO6A 4G34A 4E5WA 3TACA 1Z57A 3QRUA 4GUEA 3LFQA 4I5PA 4QMXA 3R63A 4DFYA 4R7HA 4EUTA 3CD8A 3EQFA 4BI1A 4E6CA 2I40A 4L01A 2IW8A 3NGAA 3DS6A 4DH5A 4WO5A 5CEIA 3OD6X 4HYSA 2FB8A 2DS1A 2OIQA 3OP5A 4R8QA 2ETKA 4RJ4A 2C6TA 2QONA 1WAKA 1J1BA 1Q8TA 3CY3A 2IO6A 3F3WA 3F9NA 4E4LA 2ZV8A 3DZQA 3HDMA 4G9CA 4PNKA 3W2QA 1NVRA 4PTEA 5DN3A 3ZLYA 4BGGA 5LVOA 4LV7A 1XH4A 3QHWA 4UMTA 4TYEA 3VS1A 2ZV9A 3P86A 3LPBA 4G17A 4TNBA 4EOKA 3PXYA 4M7IA 3VS3A 3WE4A 4MBJA 5I3OA 4TL0A 5M06A 4R7IA 2CJMA 3SAYA 3AC1A 5EOLA 4G3DA 4L3JA 4ZZOA 2PULA 2HXQA 2WOTA 1JKLA 4FSRA 3F5XA 3UOLA 5LMKC 1Y8GA 4L9IA 5LJJA 2QG7A 3ZEWA 4QOXA 5BVKA 2CCIA 4NKSA 3VIDA 1FINA 4EOQA 4AT4A 1XJDA 3PJ1A 4QEBA 2OIDA 3MB6A 1IASA 5AUYA 4CQGA 2PVYA 4L3PA 2YZLA 4JDHA 4MF1A 5A4QA 3U54A 2CNQA 3EN9A 5C9CA 3C9WA 3NDMA 2Y4PA 4LUEA 5HCXA 3TMOA 4NKAA 2OICA 4I6HA 5ANIA 3UE4A 1BL6A 1WBVA 2PZIA 4FSMA 1H1PA 2VN9A 3DAKA 4X2NA 4XMOA 1XHAA 4PP9A 5DNRA 3TV4A 3ZLXA 2EUFB 2J50A 4QP7A 5I9XA 2YM6A 3P9JA 4U44A 3BYSA 4YJUA 4FV6A 4RIXB 4S31A 4WBBB 4AQKA 3LHJA 5J9LA 3RAHA 2F57A 5IEXA 5AP5A 4QP3A 2VX1A 3FI8A 3GEQA 4ANMA 3RVGA 4F9AA 4AGCA 1UKHA 1R78A 2R0IA 3H10A 5I9YA 4U79A 4A07A 3DJ7A 4JG8A 3B2WA 2PE0A 4AXAA 5B2MA 5CU0A 4FX3A 4QMUA 5IA5A 5GINE 2GS2A 3A8XA 4BR3A 3ANRA 4PQNA 4QMSA 5HU9A 1UWHA 4DFXE 3BGZA 4GU6A 5GNKA 4C61A 2BTSA 4IE9A 5HI2A 1M2PA 3DKOA 5CU4A 4FV7A 4EKLA 3S95A 5DGZA 2GMXA 4DFZE 1UWJA 1FMKA 1QPEA 4I5CA 4X2JA 2NO3A 4PTGA 4D2VA 5J95A 3RM7A 4FTOA 2VD5A 3KN5A 4YTFA 1YOLA 3W2RA 5J9YA 2QCSA 4NYEA 2XH5A 1LR4A 4RFYA 3ZC5A 4HNFA 3GC9A 5AR4A 3NNXA 4AZVA 3CSVA 2QHMA 3HRFA 4NWMA 1OL2A 4LOQA 5GIOE 1YWVA 2P2IA 2WXVA 1GOLA 2YA9A 2G2IA 5DT0A 3SOCA 2ITTA 3LCOA 3PXQA 3QBNA 4NW6A 4U8ZA 3EQPA 4XG8A 5F95A 3V6SA 3VNTA 3ZRLA 1YDSE 5BUJA 5C8KA 5HNBA 4FUYA 1V1KA 1PXMA 4ZSJA 3LMHA 2YEXA 5LCKA 1U5QA 4AT5A 3R7VA 3O8UA 5GIPE 2CMWA 2REIA 3OOGA 4PX6A 4XG7A 3KC3A 4O7WA 3QKMA 4MXOA 4BDDA 3OS3A 2JC6A 2AUHA 2FUMA 4FL1A 5IA4A 2BHEA 4EOJA 1UA2A 5HBEA 5EQYA 3U4WA 5L8KA 1P4FA 3CD3A 4M15A 1DAYA 3R8LA 2YLFA 4YZ9A 4BZOA 4RA5A 3FMLA 4HYUA 4H1MA 5AR7A 3IW4A 4QMLA 2WTCA 4OBOA 3VWAA 3AD4A 3V5TA 2XKFA 3P0MA 4NIFA 1IEPA 3FMHA 3DTCA 3L9LA 4GK3A 3VF8A 4BDEA 3BCEA 3PJ2A 4M8TA 3C0HA 3NR9A 2ACXA 3BHHA 3DBDA 3VS4A 4DC2A 3BZ3A 2WO6A 3EFLA 4P7EA 2C6OA 3PIXA 4NM5A 3GU4A 1H24A 1URCA 3W0NA 3OC1A 4FSUA 2YM5A 4GK2A 2GQGA 2LAVA 1CTPE 2JFLA 3UC4A 3WOWA 4O21A 5HE1A 3ZYAA 4CRSA 4UWBA 4Z9LA 3U9NA 4RIXA 3QZHA 4RX9A 2NRYA 4BFMA 1MP8A 3C5IA 4BCFA 1SM2A 1XH7A 5BUIA 3C4ZA 4JQEA 5AADA 4X2FA 2R5TA 1WVXA 2F7EE 1W8CA 5IQHA 2PHKA 4D4SA 3W8QA 5ETAA 4EH8A 2CNVA 3TZ7A 4UMRA 2J5EA 2A98A 1TQIA 3KULA 4E3CA 2YM3A 4QP1A 3UQCA 2RIOA 4XX9A 5AUTA 4X6QC 4DGNA 3VQUA 3BYOA 5A14A 3PFYA 4GFOA 3MVJA 3VBYA 3MESA 3IDPA 4WSYA 4XG9A 3FPQA 3R00A 4FG7A 2HZNA 2W4JA 3TT0A 4BN1A 5BNJA 5IG1A 5LQFA 3MJ2A 2X0QA 3PVGA 2X0GA 4PPBA 5HG8A 5JSMA 2VTOA 1FVVA 3R22A 4L3LA 3RK7A 1V0PA 4IDTA 4EK8A 1PXLA 1REJA 4OTGA 4IWOA 4QYHA 4O86A 4LG4A 3M2WA 4E7WA 1YDTE 2ZM3A 3FZSA 3HMNA 4WKQA 2PY3A 2WTKB 1OPJA 4D2WA 1FPUA 1VYZA 3DXNA 4JLCA 3Q4TA 5DVRA 4D28A 3ZEPA 4FZ6A 4HNIA 4IAKA 2BAKA 2X81A 1UNHA 3NIEA 2ITWA 5GZ9A 3LKMA 2YIWA 3T3UA 3DTWA 3E92A 5AR8A 1ZZ2A 3TUDA 1YDRE 4ZSEA 1PF8A 3JYAA 4EC9A 5CQUA 3QGWA 3C51A 4AN3A 1JKTA 3OG7A 2XB7A 3VUTA 5DMZA 2NNWB 3L8XA 4QDEA 2YIRA 2QOIA 2O64A 4YBKA 3H3CA 1K2PA 3EN5A 3OWKA 2J9MA 1A06A 4A4OA 1Z9XA 4CTBA 3IS5A 4DINA 1FOTA 2YCSA 4YZNA 4Y5QA 4CFUA 3R7GA 1NT2A 2BKKA 5CI7A 3NMUF 2IPXA 1OB3A 1W7HA 5C4LA 2XUUA 4BCJA 5I9ZA 5IH4A 3R6XA 2B54A 2HK5A 3EFKA 3ML1A 4IWQA 3ALNA 2HCKA 5EG3A 2GHLA 3BPRA 1H28A 4N4SA 4YC8A 2GCDA 5HTBA 3IW8A 4FV9A 4E5BA 1U54B 2W1ZA 1XH6A 2PVLA 3WZJA 4IVDA 5DI1A 3KK9A 1MQ4A 2X7GA 3Q04A 4FNXA 3TNQB 5HIEA 5IA0A 2HWPA 5DR2A 3ZDUA 2OFVA 3EMGA 4DEEA 2ITNA 5EKNA 1KE8A 3QL8A 2ITZA 4XV9A 5B0XA 4XG6A 4BIBA 5JMSA 4ZAUA 1LPUA 3QTZA 4F1OA 2YZAA 2R3GA 4NFMA 3IOPA 4GKHA 2IZTA 2CKOA 3CLYA 2JFMA 1ZXEA 4AT3A 3F6XA 2VTIA 3LCKA 3ORLA 1GAGA 2HYYA 4ITJA 1HCKA 3R9HA 3EOCA 3ZOSA 4XV3A 1Q41A 4QMWA 4EOOA 4XEYA 4AA0A 2A27A 3A7IA 5JZJA 2V7AA 4QP8A 3KXGA 2V5QA 4KBCA 4H39A 5AAFA 2Z7QA 5IDNA 2C69A 3AQVA 4FTTA 4G1WA 3GT8A 3Q5IA 3A7HA 4AGUA 2X8DA 4GW8A 4BDHA 4GVAA 3W10A 1YXVA 5KMJA 2RSVA 5HD7A 4JNWA 4FKTA 4JBVA 1M7NA 4EOPA 3NFFB 2RG6A 3HUCA 3AOXA 2VZ6A 4AF3A 2JBOA 4RRVA 2PPQA 4FKRA 4CMOA 3BBWA 4Q9ZA 4ZS4A 3PVBA 3KF4A 4IDVA 1OIQA 3F7WA 2ZM1A 3MH0A 2PZ5A 1BUHA 4YJQA 1BLXA 3TKHA 3U4UA 4AZEA 2GNLA 4U9AA 4BKYA 4K1BA 4Y83A 4BB4A 4C8BA 4IEBA 4AZWA 1VJYA 3C4CA 2F2UA 2PVMA 5GHVA 1Q3WA 4FTIA 2ZV7A 4O1PA 1YI6A 5AP4A 3TG1A 4X7QA 3M42A 2PE2A 3UNJA 4BHZA 3VONA 3UOKA 4RX8A 4FK3A 1J1CA 2Z7LA 3DGKA 4FGBA 3HP5A 2WD1A 2OH0E 3W0SA 4L44A 1Q8UA 4X2KA 4ZSGA 4DN5A 4F08A 3FMKA 4C38A 3NUAA 2R3FA 3DBCA 4RQKA 4ACMA 4QDVA 3NUNA 3MIYA 3PTGA 3SXRA 3V04A 3V5JA 3W2CA 2PTKA 4O4FA 3B8RA 2ITYA 4LFIA 2CKEA 5DA3A 4DBNA 2H9VA 3IPHA 4BBMA 3RPOA 3OY3A 4O7LA 2Y9QA 2FSTX 3C5UA 3CKXA 1OKVA 4B9DA 4C2WA 3KY2A 3QHRA 5CNNA 4C3PA 4DFUA 3SDJA 4JIKA 1U54A 4U43A 3RMFA 4AA5A 4J98A 5H8GA 2HW6A 4FIGA 1I44A 4H3PA 2B9IA 3EYHA 4O0XA 3PWDA 5DYJA 3JUHA 5E1EA 3EL7A 4EH4A 3NUSA 1PYEA 4ZJIA 1TKIA 4BF2A 4PDOA 5CU2A 4RC4A 3AMBA 4P5QA 4TXCA 1AGWA 3Q9XA 2PE1A 2BKZA 2IVTA 1JSVA 2FSLX 2YHVA 4Q9SA 4UEUA 3AGLA 3POOA 4HYHA 4UZHA 5AUZA 3FLWA 1IR3A 3V01A 1OKYA 3AMAA 5L6OA 5HTCA 4KS7A 2HY81 1WBWA 4NZWB 2UZDA 5DRBA 4IXPA 4EQUA 4USDA 5JH6A 4QMTA 2FA2A 4KWPA 5J5TA 2CKPA 3FC2A 1NVQA 1H07A 5EQPA 1JSTA 2IW6A 4KIOA 3QCQA 4E93A 3OF0A 4YR8A 3QA8A 3HNGA 4W4WA 1OL1A 5CASA 5E90A 1JVPP 4NK9A 4UV0A 4AE9A 3MVLA 1RDQE 4ZIMA 5M09A 3LFNA 1OZ1A 2HIWA 1ZOGA 4Q5EA 4UWCA 3D0EA 1PKDA 4E5AX 3WZDA 4FKUA 3R71A 4UXLA 2C0OA 5J87A 5TKDA 3ZSHA 4QD6A 4D1SA 1CKJA 4ZTHA 4ANNA 5T68A 4IAIA 5EKOA 3Q32A 5FD2A 3F5PA 3IGGA 4S33A 3RPVA 4NM3A 1FBNA 2VTQA 3QUPA 3R8PA 2XF0A 4Y85A 5KHXA 5DT3A 2VTSA 2YIXA 4M0ZA 1ZMWA 2XJ1A 4IWPA 1UNLA 5CXHA 2EB2A 3EKKA 3I5NA 2QC6A 3O0GA 4AZSA 3DLZA 2YISA 1KOAA 3F5UA 3UIMA 3QQUA 2QG5A 2VWXA 4MNEB 4ERKA 3SKCA 3EJ1A 4ZTSA 2VWBA 2R3PA 4EJNA 5ACBC 1ZZLA 4WNMA 3BU5A 3KXXA 1Q24A 4FT7A 4O4BB 2OI4X 3RJCA 2C5NA 4JBPA 4YHJA 3UO6A 3EZVA 5CEMA 2CLXA 3Q6UA 2X2MA 1STCE 2BR1A 5IEYA 4BDJA 2WMSA 4AGWA 4WBOA 2BZKB 2GNFA 4O27B 4CFMA 3BRBA 4QRCA 3IK3A 4YSJA 2E9VA 3PA4A 4R5SA 5E8ZA 4P4CA 4GT4A 3COIA 4U40A 3IOKA 3P4KA 2W1DA 2XNOA 3F66A 3KKVA 2VO0A 3F3ZA 4K6ZA 4F1MA 4X3FB 5HCZA 2DWBA 3R8VA 4CYJA 5CEKA 4FYNA 4JT3A 4V04A 1JSUA 2PVKA 4L7FA 3UIBA 4HGTA 4CZTA 1BMKA 3TJDA 4ACDA 3ORXA 5AIRA 3NYOA 4I41A 2E9NA 2PMIA 3PSDA 4UBAA 4WRGA 4C36A 4TYIA 1G8SA 4JG6A 4M69B 1QPJA 4GG5A 5M4CA 2BRGA 1URWA 2O63A 4HJOA 4K11A 2ETMA 3II5A 1OL7A 3O2MA 4KIPA 3C0IA 3BV2A 3LQ8A 4O38A 3ZM4A 2HAKA 5A3XA 3R1QA 3ENHA 3LFBA 4MH7A 4U7ZA 4ASDA 2UVZA 4Z7HA 2VGPA 5IMXA 3U55A 3C7QA 4FTAA 2GFCA 4ASZA 5K4IA 4FKOA 4KKGA 3V8WA 5KMNA 2JKKA 3CPCA 2OXDA 5T6KA 4I20A 3HV7A 4KUJA 4MX9A 3EIDA 4OBPA 1GJOA 2B9HA 4S2ZA 4XRJA 3CGOA 3GCSA 2FO0A 2JBPA 2ITUA 4R3RA 4XYFA 3PA5A 2OW3A 2VO3A 4HYIA 4UZDA 3KEXA 3LCSA 3QCXA 3OCSA 3OT3A 3QGYA 3JS2A 2HZIA 3FUPA 4LRKA 4PPAA 4F9CA 4QMMA 4F70A 1P5EA 4ZZNA 4FVPA 3O8TA 3S00A 4E20A 4DYMA 4DFBA 3DK3A 3ATTA 4XP2A 1VYWA 5HG7A 3DAEA 3L8SA 3WYXA 2GTNA 3JY0A 1KE7A 3PXKA 4X0MA 4BDBA 3ENMA 4JAJA 3QTRA 2IW9A 3VRYA 4TZRA 4FVQA 3BU3A 3QRIA 4X2GA 4C4GA 5IQIA 3ORTA 3GOKA 1YWNA 4MD8E 5E8YA 5JGDA 1Q97A 3R7UA 2VO6A