4EH8A

Human p38 map kinase in complex with np-f7 and rl87
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
351
structure length
336
Chain Sequence
ERPTFYRQELNKTIWEVPERYQNLSPVGSYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 14
publication title Natural-product-derived fragments for fragment-based ligand discovery.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 105
structure length 336
sequence length 351
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2012-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4eh8A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4eh8A01
5FEQA 2F2CB 4GVJA 4QNYA 3Q04A 2XVDA 2H9VA 2ITVA 3VBWA 3ACJA 2OJJA 3GU4A 4FL1A 4D9UA 1M2PA 2GTMA 4I0TA 4N6ZA 4O1OA 4S31A 2BZKB 4CZYB 5FXRA 4W9WA 3QRIA 3PA4A 4HGSA 2H34A 3I7CA 5LMAA 4S32A 4BCJA 3JR1A 2HCKA 1ZMWA 3QWKA 4PUZA 5TE0A 4FZ6A 2GNFA 4APCA 1PYXA 4CMUA 3O0GA 3LHJA 4G31A 4O91A 4QOXA 4IVDA 4FKVA 3D94A 4R6VA 5AUTA 4LGGA 5B7VA 5GZ8A 4UWYA 5HIEA 3FZRA 3LLAA 3HRCA 2BFXA 4IANA 4QQJA 4KS8A 3R71A 4QD6A 2QHMA 4O0UA 2UZVA 2JIUA 1NXKA 5L2QA 3EOCA 2E9OA 3MB7A 4L3LA 4C57A 3KULA 2C47A 3PWDA 2F4JA 3IDCA 3NLBA 3DAJA 3QD2B 2RFSA 2OIBA 3CP9A 3KRRA 2C0TA 5KMJA 2P0CA 2UZOA 3DCVA 3HNGA 4H58A 4R5YA 5HIDA 4IWQA 3CC6A 4ZTHA 5KMNA 1YI4A 3V3VA 1M7NA 3PIYA 4TKSA 3TUDA 2A1AB 4FKRA 4MD7E 4GUEA 4F70A 2RIOA 3P0MA 4CV8A 3H0ZA 4HYUA 3DY7A 2O63A 3FE3A 3LFDA 1Y91A 3MS9A 4IWPA 4QP7A 1Q62A 4HPTE 3ZSGA 4E4XA 3FMDA 3BU5A 1STCE 3OROA 4X7QA 3D5WA 5L8KA 3CSVA 3E7VA 4O96A 4JBVA 2Z60A 1A48A 4GKIA 4F64A 4L3JA 4X2KA 5KMOA 3MH2A 3TCPA 5LMBA 5CS6A 3PJ1A 3FPMA 4FSQA 3CTHA 5I9YA 3D7TB 2OSCA 3GGFA 2R3QA 4CFVA 4G3EA 1ZYCA 3BYMA 4GU9A 4JRVA 2XNBA 3IO7A 4EONA 2XJ0A 3PIXA 4ONAA 2WTWA 5EYDA 3ZC5A 3TM0A 2VTHA 4OTPA 3P23A 5BMMA 3TTIA 5HLWA 1ND4A 4FIFA 4NFMA 4G3CA 3LM0A 2CGUA 4Y73A 4ANNA 3D4QA 4WRGA 1YHVA 2JIVA 2O3PA 1MUOA 3MI9A 2C3IB 3EQPA 4IIRA 5HCXA 3ZLWA 1ATPE 5ANKA 4O7ZA 3GENA 3FI8A 4BCFA 4FK3A 3D15A 3GU8A 3E63A 2YLFA 3SX9A 3PE2A 2BRGA 4DFBA 3CS9A 5AIRA 5D7AA 1ZAOA 4NU1A 3NIZA 5IQAA 2XS0A 2BDWA 4GUBA 4Z16A 4PDSA 4E3CA 5TR6A 5HLNA 2WQMA 4TWPA 4MNFA 3E3BX 4MKCA 3BHUA 4YBKA 2GNIA 3FMNA 4F0GA 4UMPA 3UVQA 5IPJA 4AGCA 5CU2A 2C5VA 4XJ0A 5CU3A 4JL9A 5JGAA 2ZMCA 3KU2A 3NUUA 3H0YA 3LAUA 4FKIA 4FKPA 4NTTA 3ZM4A 5F9EA 3ZSIA 1P14A 4FIJA 4J53A 1H08A 4RX7A 5AP7A 1PXPA 3LVPA 2Y4IC 2XYNA 3ACKA 4F6UA 2X0GA 3RI1A 2ONLA 2ITOA 5GNKA 3O7LB 5E8VA 3R9DA 4AXAA 1FGKA 4EUTA 4PMPA 2HZIA 1WVWA 3NNXA 1YXUA 2X7OA 3WILA 1KOBA 4PNIA 4IZYA 3R30A 1W84A 3RAWA 4ASZA 5JQ8A 5A9UA 2R0UA 1UU9A 3BKBA 4FBXA 4QPAA 5AWMA 3R7VA 4PDYA 5IDNA 2HIWA 1CKJA 4DA5A 4WOVA 5LVPA 1RE8A 5M4CA 5CZHA 4GSBA 1ZYSA 5KE0A 5EHOA 5LMKA 4JR7A 4M67A 4GT4A 5F94A 1TQIA 2B9FA 1GAGA 3R7UA 3SXFA 2CSNA 3LFCA 4RWLA 4BKYA 1KWPA 3EN9A 4FTNA 3C13A 2KTYA 5HE0A 3TL8A 4MWIA 4CVAA 4IAKA 1JWHA 3F7WA 3ORIA 3IW5A 3ZFYA 4M14A 4E6DA 2QOFA 3MDYA 4DFNA 2OH4A 3L8PA 3S95A 4IX4A 3PJ2A 1W98A 4TYJA 5EDPA 4YZDA 4ACCA 5LVNA 3BV3A 4BDCA 3FXXA 1XH6A 5H3QA 2IVVA 3DLSA 5E90A 5HLPA 2OZOA 4RFMA 4C3PA 4EH3A 2DWBA 2VU3A 3ORLA 3E87A 2WNTA 4FTIA 1XBCA 4YU2A 2I0YA 4HNFA 4J95A 1JAMA 4UALA 1EH4A 2YERA 4QP1A 3E8CA 5BX0A 1H0WA 4L00A 1QPCA 2I0HA 4YSMA 1UKHA 4EHVA 4BDDA 1Q3DA 2ETKA 5AR3A 3FBVA 3I5ZA 4OTIA 3UO6A 4E7WA 1YOMA 5CALA 1LR4A 4O7LA 4AA4A 3NYXA 1ZMVA 4I5CA 4OTFA 3NRMA 3HAMA 3WZKA 4DH3A 2RG5A 3COIA 4FKUA 4C61A 2XIZA 3Q4UA 3SD0A 3C4WA 3U6HA 3N9XA 4Q2AA 2BZHB 5GHVA 3ROYA 1FOTA 1JOWB 3L8XA 1T45A 4TPTA 4BI2A 3SGCA 1V0PA 2OBJA 4ZSGA 3D2KA 1Q8WA 3OUNB 4YZMA 4FV8A 3GQIA 4ANMA 1XJDA 3LFSA 4C3FA 4ZY5A 3KMUA 4EJ7A 1J7UA 3FY0A 4F0FA 4RX8A 3AQVA 4C34A 2ZYBA 3F5PA 3QXOA 3W8LA 4L7FA 1IASA 3RBWA 3W55A 5D11A 4EH4A 3HV4A 5EW9A 3UO5A 1J1BA 1XH4A 4ZZOA 3EQHA 1W8CA 2FO0A 5HTCA 5G6VA 3OOGA 4AT4A 1YXXA 4OTDA 4J8NA 4JG7A 4BZOA 4ACMA 4AZWA 3RTPA 3COKA 5D41A 4D2PA 1WBOA 3MB6A 1YI6A 5IA1A 4D4RA 2CPKE 3VQUA 5DMZA 3OS3A 5IH6A 1TQPA 4CKJA 2G2FA 3JXWA 4YURA 2QLUA 4FEXA 3GFEA 3W10A 3HMIA 2X7GA 4O82A 5KBRA 2A19B 3PE1A 2C4GA 3S00A 5M08A 5E8XA 3K3JA 3DLZA 3P7CA 3C1XA 1K9AA 4KBKA 3S1HA 3FWQA 4HOKA 4L8MA 5ACKA 5CVHA 4QMOA 4UX9A 2DQ7X 5LCJA 1S9JA 2Z7RA 1YOJA 4II5A 4EKKA 4WBBB 2J6MA 5DEYA 4G6NA 4PP9A 3POZA 4S30A 4KBCA 1MQBA 5AMNA 5AR8A 5T68A 3RPOA 4LMUA 4QYEA 4AP7A 5A3XA 5IKWA 1P4FA 3TWJA 2OIQA 1APME 3UVRA 2GPHA 2DUVA 3PJ8A 5TT7A 3ZFMA 4W9XA 3V04A 4LYNA 2PVNA 1YVJA 3I60A 2WIPA 5FUTA 3MFUA 4AN2A 5KMMA 3PUPA 5DBXA 5FDXA 4ORKA 3POOA 4YHFA 5IA5A 2BHHA 4X3FC 4NL0A 2GFSA 5FRIA 3TZMA 5EQPA 4X2JA 3GNIB 2Y4IB 2FA2A 3CCNA 3R02A 3HYHA 5HG9A 1SNXA 4RT7A 4XG2A 2VWVA 5EOBA 4L7SA 3QTZA 3L8VA 3PXYA 3COHA 2OLCA 4PL5A 3PY0A 4NKSA 4DEDA 2J0MB 2HK5A 4FR4A 4WNKA 5F1ZA 1FMKA 5IA2A 2BALA 2OF4A 4U6RA 4YJQA 3U8WA 3VF8A 2X39A 3DAEA 4MHAA 5J1VA 5FBOA 2BFYA 1YDTE 5JSMA 1FMOE 2IVTA 5HNGA 3FKOA 5FQDC 4EOMA 4DG0E 4U81A 3VS0A 2C6IA 2JKKA 1NW1A 4FI1A 2J50A 2O64A 3RNYA 3CPBA 4CFUA 2FUMA 4ZJJA 3FZ1A 2UW5A 2CCIA 2LGCA 4FL3A 4RFZA 3UZTA 4MXOA 4RIXA 3ZO1A 1KUTA 3R7GA 5LCKA 3V5QA 2BVAA 3KN5A 4RJ5A 3BU6A 3FDNA 1WZYA 5JZJA 3I6UA 3K5VA 4QTEA 3KA0A 4BC6A 4NM7A 3C4ZA 2YCSA 3DA6A 1H1PA 3RVGA 4GG7A 4BDGA 1UWJA 5EM8A 2X1NA 3I4BA 4ASEA 3UMWA 5CVFA 4BZNA 3QALE 3QBNA 2X2LA 4JDHA 3DBCA 3IK3A 4E73A 5KX8A 3NWWA 1DI9A 3RNIA 4AZFA 3DXNA 1KE9A 4BTKA 3C7QA 1UKIA 4FV4A 4RJ6A 4MXAA 4O6EA 2ONLC 1IAJA 5EFQA 2JDTA 3M2WA 3BWJA 1ZXEA 1H8FA 3RK5A 3NGAA 4FTJA 1PYEA 3GB2A 3QX2A 2QR7A 1OKVA 3A4PA 3C0GA 4I6FA 4KIQA 1FVRA 1PXKA 4MX9A 3OG7A 4WA9A 1FPUA 4DH7A 4DN5A 2RL5A 4FNXA 3S0OA 2B7AA 2UVZA 3D7TA 1YXTA 1YW2A 3QKMA 4Y83A 2ZM4A 2FSMX 5KZIA 4HW7A 2R3OA 4FEUA 2WOTA 4F1OA 1OPJA 3VJOA 3DJ7A 4E6QA 3ZRKA 4O0YA 4U41A 3TUBA 5J9LA 4FV0A 5C03A 2ZDTA 5AV4A 5LMKC 4IAIA 3HP5A 3KY2A 4OAUC 4YTHA 4YPDA 3PZEA 2IZTA 5HG7A 5C8MA 3FPQA 2OXDA 4B4LA 4EQCA 4YC6A 4KKGA 1YWVA 3FQHA 5CT7A 4FV1A 5CT0A 2W06A 5CX9A 5HI2A 1OL2A 3TNIA 4L52A 5CENA 3EFKA 4PNKA 4WKQA 4JBQA 3OCTA 4BB4A 3EQBA 2EB3A 3VO3A 5DT0A 3EJ1A 4TY1A 1CDKA 3C0HA 5AM7A 5ANIA 1P5EA 2XK4A 3GOPA 2OJFE 4HZRA 3QRJA 5AR5A 3ZMMA 2R9SA 3OXTA 5D12A 3ELJA 1H1QA 2PUUA 2XNPA 1BKXA 4IBMA 4J52A 1H27A 2YM8A 4FV9A 4E26A 4CZTA 1PMEA 3F5UA 3VS3A 2WB8A 1PXLA 5LVOA 4ANLA 3O23A 3QLFA 4NKAA 4XG9A 3BI6A 4EH9A 5K0KA 2VWXA 2XIRA 3DKGA 3U6JA 2J0IA 2ERZE 4LOOA 4BIBA 2C5XA 2C6MA 2UVYA 5EM7A 1Q4LA 4F08A 3BBWA 2UW4A 4C4JA 4QPSA 3KULB 5M06A 2R7IA 3CIKA 2JBOA 3RAKA 3ZYAA 2OJ9A 4OBOA 2C6DA 3OP5A 3EIDA 3HP2A 4IQ6A 3ZDUA 4DGGA 5KHWA 4FC0A 1WBVA 2WPAA 2VTLA 4L42A 4BTMA 4CTBA 4AE9A 4LQMA 3MH1A 2QOIA 3F5GA 4EEVA 1Q3WA 3ZXTA 3DZQA 1GJOA 3FMEA 4FVPA 4WUNA 3V8WA 3SG8A 2J5FA 3FL4A 4W4XA 5E1SA 5KMLA 4QNAA 3VBQA 4EHZA 3DNDA 3UYTA 4AOIA 4YR8A 3O96A 4H1MA 2VGOA 3AC3A 3QCYA 3EN6A 5E8YA 2WMSA 3SW7A 3C4CA 2R3KA 3NNVA 3KF4A 3D14A 4LOPA 3JVRA 1J1CA 3GVUA 2YHVA 5AP5A 5IUIA 1KV2A 5M55A 4C3RA 5HCZA 3RPVA 4EK3A 4UWCA 1ZZLA 3GBZA 4I41A 3CY3A 5C9CA 4U42A 4I20A 4XUFA 3W2RA 5JFXA 4RWKA 3NNUA 3ULIA 2Y6MA 2XIKA 4KD1A 4GG5A 2Y8OA 4O27B 4LM5A 3QQUA 2GQRA 4EQUA 2Z2WA 2IVSA 2Q0BA 2YCRA 4R3CA 4WRSA 5M07A 4ZS0A 1ERKA 3ZOSA 5BNJA 3DOGA 4JR3A 4KUJA 4C58A 2XNGA 3AMAA 3F69A 5GIPE 3EZVA 3AD4A 4AUAA 4HGEA 5A4EA 2UZDA 4RMZA 1R78A 5ANEA 5FEDA 5AV1A 4PPAA 2V0DA 2C3KA 4IFGA 3DFCB 4ASDA 4O7WA 5HQ0A 4TT7A 1Y6BA 4YJVA 4YUQA 2W4JA 3G2FA 4OBPA 3TZ9A 2XJ1A 4J71A 3VS5A 3CPCA 2J0JA 4F6SA 2YAAA 1V0OA 4XV1A 2YLEA 1R0EA 3FMJA 3Q60A 3L8SA 4RVLA 5FM2A 2JAMA 3LPBA 4D1ZA 2WMUA 5CEIA 1QCFA 5DR9A 3OY3A 2R3PA 4AQCA 1WBPA 4AW0A 3ZH8A 2VTAA 2WOUA 4R5SA 4XNEA 4FKGA 3VW6A 4ID7A 5IQCA 3C0IA 4BDKA 4BCQA 5AUYA 4CFFA 3KF7A 5EYMA 1OIYA 3R28A 3OT8A 2RFEA 4KBAA 1Z5MA 4RC4A 2WMQA 2ITQA 4MYGA 2PZIA 3HDMA 4I3ZA 3AT4A 4F9BA 5L8JA 4QYHA 2WGJA 4AT3A 4HJOA 3R1QA 4U0IA 1YQJA 3CTJA 3F3TA 3RMFA 3T9IA 5EKNA 3LCTA 1Q8TA 5EM6A 1DI8A 4FKTA 5HG5A 2YDJA 3B2TA 4TWCA 4FT5A 1JNKA 2VNWA 4CTCA 2WXVA 1V1KA 4IC8A 4IJ9A 4CFXA 1VR2A 3MIYA 2LAVA 3TDVA 4UZHA 4TYEA 4DFLA 4O6LA 1X8BA 1XQZA 3RPSA 5D1JA 3K54A 4EOIA 4O7VA 1S9IA 3D7ZA 4NUSA 5J8IA 3FV8A 4WNPA 1DAYA 3JYAA 4AW1A 3W2PA 3ITZA 4H1JA 2JBPA 3PYYA 3G5DA 4FEQA 4A9YA 4RIYA 4AS0A 5HORA 3EB0A 4O0VA 2ZOQA 4N0SA 3TDWA 3MN3A 4B8MA 5BVKA 3SOAA 3RPYA 4BHNA 4CT2A 2EXMA 1OUKA 2BKZA 2R3JA 3PP0A 4PP7A 4C2VA 2JDRA 4KWPA 2IZUA 2WEIA 4JRNA 5HBEA 4G3FA 2WTCA 3PA3A 4QMYA 4U79A 4U7ZA 3ID6C 4QMUA 2GS7A 1HOWA 4X3JA 4ERWA 2R2PA 3PSDA 2C6EA 4IDTA 1JSTA 2R0IA 4QQ5A 4XBUA 3OCGA 2YISA 5F20A 3FUPA 4LV5A 4FEVA 5LVLA 5I9XA 4QP2A 1YXSA 4A4OA 2OO8X 3MVMA 3TNQB 2UZNA 5CTPA 4UXLA 2ITPA 2VZ6A 1PW2A 3TI1A 5M56A 4K77A 4KIPA 4XV9A 3UOJA 2PVKA 1ZY5A 4I4EA 5E91A 2UV2A 4YJUA 4NJ3A 2F7ZE 3FAAA 4PPBA 3MESA 1PMNA 5AR7A 4LG4A 2UZBA 4Y46A 5DE2A 3UIXA 5I9UA 4ZMFA 5LWMA 4MEDA 4FT9A 4TWNA 4AZEA 3UQCA 2JFMA 3I81A 2H96A 5H2UA 4HVHA 1K2PA 3LOKA 5BMSA 2XRWA 5IA0A 3NUNA 2VD5A 4EOQA 2QOOA 4FYOA 5ANJA 4RZWA 3BZ3A 4O2ZA 3H30A 4DEGA 2BHEA 3C9WA 1H00A 3GC8A 3ZUVA 3ODYX 2VWIA 4IW0A 2CJMA 5EI2A 1PXJA 4KAOA 3Q9WA 5L6PA 2Y9QA 3QTWA 3EQIA 4FV5A 1PKGA 2B9HA 5EDRA 3SA0A 2BZIB 3QGWA 5AUZA 3R9HA 4IAAA 3HGKA 3ODZX 4KIOA 4ZTNA 3HAVA 3WZUA 1O6YA 2YM3A 4BGQA 4UXQA 2W7XA 5AX3A 3T8OA 4LFIA 2R4BA 3AXWA 3PTGA 4USDA 4JAJA 2VTRA 2VTNA 4IM3A 4QYFA 1ZOEA 3QQKA 4U8ZA 5EYCA 5AUUA 2VTSA 2O2UA 3PDTA 1H07A 3OUKA 4JVGA 3E62A 4MQ2A 5DR2A 3F3VA 3UIMA 2PMLX 3EQCA 4C4EA 4EHGA 3QHRA 3N4TA 4XG8A 3WBLA 4E5BA 4W4YA 4DEAA 5IEVA 3R9RA 4DCEA 4D2RA 3LFNA 1SYKA 5M44A 2PUNA 1UNLA 2QNJA 3OW3A 3PY3A 3QGYA 1JBPE 4X6QC 3D5XA 4O7YA 4W4VA 3TKUA 3V5JA 4BBEA 4O7TA 3UZPA 4U97A 4I0RA 2W99B 5ETIA 1UU3A 4RC3A 1OL7A 2VX0A 2NRUA 3A7IA 2PY3A 3BGZA 5BUEA 2FGIA 2YIQA 4M97A 4F9WA 2W96B 2X7FA 4P90A 3Q6WA 5FTGA 3IGGA 5LVMA 2I1MA 2ZJWA 5HVYA 5A4CA 2PMNX 4IADA 4CYIA 1YHWA 4BCMA 3LM5A 4GFOA 3K3IA 2UZEA 4XMOA 2C30A 3EQFA 1AQ1A 3MGYA 3MV5A 2PUPA 3NUYA 4QMMA 2V22A 2ZDUA 3UP7A 4C59A 3H9FA 1ZYLA 3BLHA 5AV0A 1MRUA 4FKOA 4MQ1A 4RIXB 3RAHA 4U3YA 3TZ8A 4FTAA 5CAVA 2C6TA 2CLQA 3PVUA 4TXCA 3QWJA 2IN6A 2YIWA 1R1WA 2RF9A 3TIYA 3R2BA 3RK7A 3SOCA 1OBGA 4W8EA 1LEZA 2E9VA 3CEKA 2QOLA 3P4KA 3LFBA 3HV6A 3UG2A 2GFCA 4F0IA 2HW7A 2Z7SA 4V05A 5C01A 3VC4A 5JK3A 1F0QA 4CNHA 3U6IA 3BX5A 2XEYA 5J9ZA 4PTCA 4I6BA 4WSYA 3ENMA 3KGAA 4CEGA 2OIDA 4BICA 5E9EA 4YZ9A 3BYVA 1ZY4A 4BYJA 4BWXA 5CAOA 1L3RE 4IWOA 3TT0A 2HXLA 3MH3A 4FL2A 4ZSLA 3KC3A 4IB0A 2B9IA 4C35A 2X8IA 3G6HA 4X3FA 4RWIA 1Q61A 1BMKA 4BTJA 2CKOA 2PZ5A 3KMMA 2QQ7A 4U3ZA 4YJRA 1ZMUA 2YZLA 3C50A 1A06A 2VWYA 3R8UA 4MBIA 2QG5A 3KK9A 4YGAA 1XH7A 2PMOX 1XHAA 4PQNA 5HCYA 4HVGA 1ZYJA 3VWAA 4CT1A 3PIZA 3NYNA 3QX4A 4EZ5A 5A6NA 4D5KA 3HRFA 3RHKA 2OI4X 4FSUA 1HCKA 1KE5A 3ULZA 3V8TA 4ANBA 2IWIA 5J1WA 2WQNA 2PUIA 4CV9A 4CG8A 1WCCA 5ETCA 4L46A 2FSOX 3MPTA 4FSRA 3HUBA 3H9RA 4H39A 1E9HA 5IQBA 3GC7A 3RWPA 4BGGA 4ZLZA 4YTCA 5L8LA 2JEDA 4YJTA 3WZEA 3CE3A 2YM7A 1PXNA 1T46A 4EC9A 4QMXA 3QC4A 2WTJA 4F7SA 5K9IA 3F9NA 3LIJA 5LXMA 3AT3A 4RJ7A 5GIOE 5CQUA 2O8YA 4FTKA 3VUDA 1E1XA 3BQCA 4ZMEA 3JPVA 1DAWA 4FTLA 4JNWA 5DWRA 4IAYA 2QOKA 5BYZA 4X21A 2YIXA 1DS5A 2YM4A 3P7AA 3OEZA 5GJFA 3QTUA 4ANSA 3VBVA 2V7OA 5J87A 2QODA 3GCQA 3ORKA 4X2NA 3KFAA 3NEWA 4R3PA 4QTAA 3TNWA 4EK6A 5IISA 3QLGA 3Q52A 2ITUA 4M7IA 5A4TA 2W9ZB 2XEZA 4FT3A 2GMXA 4HYSA 5LARA 3DJ5A 4K2RA 3WI6A 2J7TA 5L2WA 4QYYA 3SVVA 2PTKA 3NMUF 4FX3A 3HV5A 2PMIA 3TV7A 2WKMA 4DCAA 3ZO2A 2QD9A 4L6QA 5AEPA 5ACBC 3UC3A 2VX1A 3Q9ZA 4L3PA 4ZTMA 1WAKA 4XS2A 4AU8A 4BKJA 3DQWA 5K0XA 2W1DA 4PMMA 2A0CX 1DM2A 4FF8A 4U43A 4I5MA 1AD5A 4GT5A 3Q4TA 4A9UA 3DK6A 3MJ1A 4DGOA 2R3GA 4DTBA 4PX6A 2X2KA 2XBJA 3AD5A 4QT1A 4ANOA 4DH1A 2NNWB 4FNWA 4C7TA 3FYJX 4BCNA 3MVLA 4YZNA 5JGBA 3FLNC 1I44A 3C5IA 4PTEA 4J97A 3NS9A 3NUXA 4ZAUA 4WHZA 2W5AA 2OZAB 3C4XA 5IH4A 1ZWSA 2PVFA 3PJCA 3MSSA 2QU6A 3WF7A 2RFNA 4IH8A 3QKKA 3WE8A 3R0TA 4KNBA 3UOHA 4FTOA 3UG1A 3GFWA 2X81A 5IQEA 3RP9A 3A7JA 3EKKA 5I0BA 3H10A 2CMWA 5BVWA 4BRXA 2XIYA 4IX5A 2KULA 4IJPA 4I93A 4OT5A 1XBBA 3VW8A 4JI9A 3FZPA 5EM5A 1BLXA 3VS7A 1JPAA 4QMWA 1FVTA 1R39A 5DN3A 3DPKA 5AP2A 1IR3A 4GT3A 5TOZA 2J90A 3NVMB 4TNDA 3HMNA 2W05A 4YMJA 2ZB1A 4IAZA 4V0GA 4AZTA 3QTIA 4C36A 2XF0A 3HVCA 3PG1A 3LW0A 4FSYA 4O7NA 3B2WA 3RJCA 4DGNA 3FQEA 1NVSA 3NR9A 4FG8A 3ZLXA 4IC7A 4GK2A 3MFTA 3R01A 2OICA 3BIZA 4IDVA 3MW1A 4YNEA 3GCSA 3QUEA 2ZAZA 3ORZA 3IGOA 2GSFA 4APPA 2W1GA 4IAFA 1FGIA 3NPCA 3PPZA 1H25A 1PY5A 4LRKA 4XG7A 1G8AA 1GNGA 5H9BA 3T3VA 3N4UA 4Y8DA 5ETAA 1GIJA 4AW5A 2C0IA 2YZAA 4ZEGA 2JKOA 1FINA 3SV0A 4B7TA 3H4JA 4CMOA 3NUSA 1BYGA 5FDPA 5AV2A 3QF9A 5DHJA 1YWRA 2W9FB 2C3LA 2XJ2A 3BLRA 1U46A 3R9NA 1FBNA 4I94A 3R8LA 1WFCA 3OXZA 3QA0A 3A99A 1XH5A 2NRYA 3KB7A 3QU0A 4PMSA 5L4QA 4KIKA 2ZV7A 3OXIA 3NYOA 3COMA 4HZSA 5E4HA 1PHKA 5CVGA 3LFQA 4QMSA 3FI3A 3F3ZA 4HVIA 1GIHA 3KN6A 3DB6A 3DT1A 4BDAA 2VNYA 4E6CA 4L9IA 4W8DA 5IZFA 2XUUA 3PJ3A 4U80A 4Y5HA 5HESA 4GVAA 5HVJA 4BCOA 4JT3A 4BZDA 4DEHA 4GMYA 4D2TA 1GZKA 4B9DA 2VWWA 4BHZA 3VBTA 3AMBA 3L9MA 2QKWB 2XKEA 2ZMDA 1VYZA 2VX3A 4FTRA 3THBA 4DFUA 3LZBA 4PDOA 4L67A 4IZ7A 3Q4ZA 5CF8A 4GIHA 2WTKC 2X6DA 4JJRA 3MFSA 3HMMA 4QMQA 3NIEA 4RIYB 4JX3A 2YWPA 5CQWA 4WSQA 1XH9A 3ZRMA 4EQMA 2YN8A 3HA8A 2W5HA 4Y95A 3MTFA 5EHYA 5BVEA 4BCKA 4C33A 3LCSA 3Q2MA 3R8PA 3V01A 2W0JA 5J7HA 4ZK5A 5A46A 5L6OA 4RX9A 5GINE 3VN9A 1J91A 1CSNA 4XOYA 4F09A 5IUHA 4MXCA 4LL5A 4I6HA 4TWOA 5JT2A 3W18A 4PL4A 4DFYA 3BELA 4HCVA 3K5UA 3REPA 4XLIA 1IA8A 2ACXA 3LMHA 2W1CA 4C4GA 1H1RA 4RJ4A 4CXAA 4YLLA 3R21A 4DLJA 3WF9A 4ZSAA 2V7AA 3G51A 5KMIA 3MA3A 2GQGA 4ALWA 5HGIA 2WAJA 3ETAA 3T3UA 4MBLA 4QTDA 4AF3A 3BHYA 2UZUE 4EUUA 4OAVB 5IQDA 4EOKA 2Q83A 3CGFA 4MNEA 4RIWA 2BRBA 5DIAA 4KINA 4LGDA 1LEWA 3BRBA 3R1NA 5K4IA 2XCHA 1OGUA 2BRMA 4BFMA 5AFVA 2GS2A 3FI4A 5FTOA 3VUHA 1XBAA 5I3OA 3NW6A 4ACDA 2QOCA 3FMMA 5J79A 4M0ZA 4JG8A 2UZLA 4ZOGA 4JLCA 4MD9E 5BYYA 3QTXA 2YDIA 3EYHA 3R7EA 4MXYA 5IQHA 3E8NA 2QO7A 2YAKA 3R1SA 2OJIA 3D2IA 2PVRA 3W1FA 1RDQE 4GFMA 5GZAA 3OFMA 5CY3A 3V6SA 3FMKA 4AA5A 4E4LA 2BPMA 2JD5A 3E3PA 3KKVA 2BDJA 2R3MA 4TRLA 5HICA 4ZIMA 2YM5A 3I0QA 1H26A 1JLUE 3O8UA 4GJ2A 1OPLA 2XNNA 1ZLTA 3NVKI 2I6LA 3Q53A 5EYKA 2C6LA 2W17A 4QYGA 4NYEA 1UV5A 2C5YA 5JEBA 1SVEA 2YITA 4I22A 5B2LA 3E8EA 1YWNA 4R8QA 2VTMA 4YJSA 5IEXA 2VTIA 1H0VA 2JKMA 5H8GA 2Z7QA 3QCSA 2WMBA 5BUJA 4OW8A 1VEBA 4D4YA 1OPKA 4FICA 5HNIX 3BPRA 4WG4A 2EU9A 4X6RA 3QHWA 2W4KA 3CTQA 1REKA 4YHTA 5LOHA 5E1EA 4XYFA 3SQQA 4NJDA 3E93A 5DOSA 1Z9XA 4FIIA 4QTCA 4FZAB 3CQWA 5ANDA 2AC3A 3MWUA 2XMYA 3HL7A 4UBAA 4N57A 5J95A 5KZ0A 3SG9A 2J0KA 2R3HA 2R3RA 2CKQA 1TVOA 3A60A 4MH7A 4C4IA 2YJSA 3I0OA 5CEQA 5C4KA 3AC2A 5CF5A 2WQOA 2GHGA 4J96A 4O2PA 5ICPA 2Q0NA 4YTFA 4QPMA 3KRXA 1OMWA 2H6DA 3FLSA 3OBGA 2V62A 3BE2A 3QYWA 4CRSA 5C4LA 3O8PA 4FV7A 5HO7A 4OUCA 3GU6A 4ZTSA 3W2SA 5JRQA 1Q8YA 4CQGA 5HEZA 2C5OA 3GUBA 4L44A 1Q99A 1RJBA 4YLJA 3LCKA 3Q3BA 5CSWA 3VUTA 3IQ7A 4EOOA 2ETRA 3VS1A 5AADA 5DRBA 1CM8A 5AP1A 3F6XA 1W83A 1SM2A 5DNRA 3HZTA 3KREA 1BL6A 3VNTA 1K3AA 5CAQA 4PDPA 3MBLA 1W0XC 2JITA 2EUFB 3K2LA 5BPYA 2J51A 3TIZA 4I24A 3WIGA 4AACA 4CCUA 3N51A 1CTPE 1H4LA 2E9UA 3U51A 3R7OA 2EWAA 4QMLA 3GT8A 2R7BA 3AD6A 1JKKA 2XKDA 4EI4A 4PRJA 4BWKA 4DTKA 3G15A 1GY3A 4AZSA 4GYGA 4GU6A 4RZVA 3KK8A 4G5JA 3LJ0A 2O65A 3FZOA 3UMXA 3QZGA 4MF0A 4A07A 4EHEA 3QUPA 4AGDA 3UODA 2J2IB 3P5KA 1FQ1B 3QTRA 3ZBFA 5JGDA 4FKJA 3ZO4A 5FBNC 2WTKB 4EYMA 3Q2JA 2AYPA 2GHLA 2X9FA 2QKRA 3L9NA 2BZJA 3G0FA 4FSWA 4NCTA 5FEEA 1IA9A 3ZM9A 2WTIA 4ZZMA 3RCJA 4EL9A 1OB3A 3VVHA 3GU7A 5B0XA 3ZZWA 3BHVA 4Q5HA 3KEXA 4FOBA 4XOZA 5CNOA 2IPXA 3PXZA 3BYSA 4EH5A 4X3FB 5GJDA 4Z7GA 4ZZNA 2FSLX 3UYSA 4IB5A 4ZSEA 4DC2A 3DBDA 2OZAA 3ZLSA 4KRDA 3F82A 4H05A 4RVTA 4X2FA 4AFJA 2QU5A 2W1IA 4CYJA 4DH8A 1OKZA 5T6KA 2VTQA 3I1AA 4HPUE 3DBFA 3BWFA 4H3QA 2PVLA 2XP2A 2W1HA 2WMWA 4IX3A 3KL8A 3NAXA 1CKIA 3TXOA 4O83A 3QRKA 3PP1A 3DS6A 1YRPA 5BVDA 3DQXA 4QQCA 5JQ5A 4M68A 3O71A 3MPMA 2WQEA 4WNOA 4GS6A 3ERKA 5JRSA 3RM6A 2YA9A 1KE8A 4DLIA 2ETMA 4M13A 4ZP5A 4CZUA 1Z57A 4ZLOA 5DH3A 2EXCX 2RGPA 1XO2B 3SXRA 2BAQA 3SDJA 3PXRA 3AT2A 4XV2A 4A4LA 4FZ7A 5CAUA 3TZ7A 3PXKA 4FNZA 4DITA 4TYHA 3EQGA 4RRVA 5EI6A 5EKOA 4ZY6A 4OR5A 4G17A 3ATSA 4ALUA 5AP0A 4J7BA 2ITYA 4I5HA 5KKRC 5L2TA 4IZAA 4WG5A 2JDSA 3G0EA 4N4SA 4BYIA 3GU5A 5CI6A 4EK5A 3GCUA 1UU7A 3OF0A 3Q5IA 5IA4A 5HE1A 4O86A 3FZSA 4BBFA 1V0BA 4B8LA 3KVXA 5FWKK 3KXZA 3F5XA 4UZDA 2C6KA 4C0TA 4D28A 2CKEA 5T3QA 4YSJA 3DTCA 1A9UA 4A7CA 2HZ4A 3FMHA 3ZO3A 5KMKA 4AWIA 1OKWA 2P4IA 2CNUA 3OCSA 4R77A 5C26A 5IMXA 5JFVA 4EH2A 4XP3A 5E92A 3R8ZA 3UNZA 3V51A 4UB7A 4FKWA 1J3HA 4ZJVA 4S33A 2CHLA 4UYAA 5TO8A 1SVGA 3ZCLA 4D5HA 3RINA 2PZRA 3BYOA 1R3CA 4BDJA 3F66A 4AFEA 3G6GA 2P33A 4RSSA 1VZOA 3WF6A 4DAWA 4ZTRA 4D0XA 5KUPA 4TL0A 3BEAA 4TN6A 5AJQA 3II5A 4UMQA 3TJDA 4IHPA 4O0WA 4FKLA 2QONA 3C5UA 5AR4A 2WIHA 3FEGA 2P2IA 3MY5A 4GCJA 2X8EA 1B39A 1O6KA 3FSKA 4P2KA 4LL0A 3DBQA 3E88A 3KXMA 4FG7A 1GIIA 2QC6A 2W4OA 3UJGA 3NUAA 2IG7A 3SHEA 5M57A 4B6LA 3MTLA 3UP2A 1GZNA 3NCZA 4JDIA 2IZRA 5A6OA 3RHXA 3FSFA 3S3IA 2UW8A 2WU6A 3VUIA 4EBVA 3W8QA 3O17A 1R0PA 3FQSA 3KQ7A 2QLQA 1FVVA 1U4DA 4DE4A 3ZRLA 3IOKA 3PFQA 3WIKA 2WMRA 2IZSA 3A7GA 5HE2A 3VHEA 3FY2A 5HKMA 4YPSA 5EI8A 3TUCA 3O8TA 2J0LA 1BX6A 4O0TA 3S2PA 5I9ZA 3T9TA 5JN2A 3BBTB 3MY1A 5IF1A 2VWUA 4ZTQA 5HX8A 1WBSA 1IG1A 2EXEA 2XNMA 5AM6A 2CGVA 2F7XE 4RPVA 3WARA 5AUXA 4NIFA 3R1YA 4FGRA 4M15A 5CU4A 4V0GB 5AAFA 4Z3VA 3CLYA 3PVWA 3R6XA 4M69A 4OBQA 3BYUA 2VRXA 4GIIA 5EHLA 4FK6A 4Z55A 4ZLYA 1G8SA 4FZFB 3V5TA 2BAKA 4EOPA 1OITA 5I9VA 4GK3A 3TTJA 5HIBA 1U5QA 1W82A 4RG0A 4ZTLA 2G15A 3RCDA 3BLQA 1OIRA 2CN8A 2PVYA 5CLPA 3W2QA 4KB8A 5LWNA 4ENYA 3A8XA 1SZMA 4TNBA 4KSPA 4F65A 4ZSJA 4BR3A 2HWOA 3UC4A 4K1BA 4FV2A 4DT8A 3NNWA 5M4IA 2X8DA 4NFNA 3UE4A 2QHNA 3R73A 4PY1A 3WF8A 4WT6A 2YIYA 3QZIA 2QI8A 3P1AA 2PULA 4FYNA 3GOKA 4OTRA 1XR1A 2ZB0A 1UWHA 5IMEA 1JQHA 4JIKA 4IM2A 4MF1A 3KVWA 1YHSA 4RJ3A 2UW6A 4I92A 4CCBA 3LMGA 4K18A 3FLYA 2EVAA 5D9HA 5AAEA 5IU2A 3KMWA 3VJNA 3VF9A 4E1ZA 1YDRE 1YKRA 1OI9A 2BUJA 3TACA 2JAVA 4QQTA 2IW6A 4KIKB 4FIEA 2HAKA 2C0OA 4PL3A 1H1WA 2WTDA 4FT7A 2I0EA 3LFFA 3F3WA 4GK4A 4IVCA 4QRCA 4CFNA 4I21A 4RQVA 4P5QA 5AUVA 2V55A 3P78A 1NT2A 3NSZA 4JAIA 3PVGA 3GC9A 4LOQA 4NW5A 2PSQA 4DG3E 2HY81 3Q4CA 4F4PA 4IACA 1JSUA 4HYIA 2HYYA 3OY1A 5CAPA 4DFZE 2OG8A 3IECA 3E92A 3PSCA 4OGRA 2PVMA 3LXNA 4HCUA 2XA4A 4IEBA 4LV8A 3HMPA 4BCIA 1M52A 2YM6A 3OWPA 5DRDA 3VRYA 4F9YA 5CF6A 3FC1X 2C5NA 4RLKA 1OIQA 2HENA 3L1SA 1Q5KA 4NCTC 3FKNA 3ZZEA 4JS8A 4I5PA 2C3JA 4R3RA 4AX8A 3U55A 4FGBA 4DG2E 4WBOA 2C68A 3AOXA 3BCEA 3FLQA 5BVFA 2PWLA 3CQEA 4GFGA 5AAGA 4TW9A 1M14A 2PVHA 2YCQA 2BRNA 2ZV8A 4GJ3A 1JSVA 4FG9A 4YZBA 5CWZA 3EH9A 2B0QA 2FB8A 2A4LA 2CLXA 3JVSA 4O38A 2XH5A 3ZU7A 4CG9A 3M1SA 3PLSA 5DEWA 2X6EA 4QTBA 3VULA 2OXYA 2RG6A 1TQMA 3DAKA 3ZXZA 2VN9A 2VO7A 5AR2A 4I0SA 5J5TA 1CMKE 2A2AA 4JDKA 3VS2A 1I09A 2FSTX 4B0GA 2WQBA 4EZ3A 1WVYA 1O9UA 2PU8A 4DF3A 3UOKA 4L53A 4FTCA 3OCBA 3Q32A 4RQKA 3UDBA 4XG4A 5D7VA 3WF5A 3HRBA 3KRWA 1MP8A 3I7BA 2HW6A 4MNEB 2XCKA 4RIWB 4FV3A 3SW4A 3LMIA 2OJGA 2B1PA 4BI1A 2X4ZA 3D9VA 4NTSA 4N6YA 4ZXTA 5ETFA 2V5QA 3QZHA 2WEVA 3ANRA 1U59A 4C37A 4IB1A 2GU8A 2ITWA 3BQRA 5A14A 2WELA 4GH2A 4YC8A 3WYYA 1MQ4A 4O1PA 1VJYA 3FMLA 5FG8A 1WBNA 3PA5A 4DH5A 4G1WA 4U9AA 3SLSA 3PZHA 4IX6A 4EH7A 2HELA 4EYJA 4JQ8A 3AMYA 2B4SB 4AOTA 4I6QA 2CKPA 2PE2A 4F1TA 2VTPA 4OT6A 4V01A 3SAYA 4EOLA 4NSTA 2OH0E 5DFPA 3U9CA 4IE9A 5BUIA 5CEOA 4O7RA 3SRVA 3PXQA 3HV3A 3JY0A 3QQHA 4G9CA 3AGLA 4RVKA 4ASXA 4EBWA 3CJFA 4F63A 1Q97A 4AW2A 4G2FA 3H9OA 5HE3A 4C62A 4UMRA 3DFAA 5BYLA 4RGJA 3F3UA 3RZFA 2GHMA 3MY0A 4NM5A 3TV4A 3QQJA 1MRYA 1B38A 4RA4A 2VV9A 3BV2A 3RWQA 2FH9A 4KSQA 5AP6A 4I4FA 3WE4A 3OC1A 2ITTA 4HCTA 4FSNA 2O0UA 4NZWB 2B9JA 2XM9A 3VS4A 4EOJA 2GNGA 2QR8A 2CCHA 3OWJA 4AAAA 3ZS5A 3D83A 5DA3A 2UVXA 4BWPA 4ENXA 2XK7A 4GEOA 4DBXA 2B54A 5AA9A 4JQ7A 4DT9A 3E8DA 3LXPA 3R7YA 4DINA 5CYIA 2WZJA 4K8AA 1H24A 5FXSA 2F7EE 4P7EA 1UNHA 4J98A 1OUYA 3A7FA 4AGUA 4E8AA 4UN0C 1U54A 3UVPA 3NZ0A 3V6RA 4BDHA 2IJMA 5CEMA 2ZV9A 5HVKA 2SRCA 5J5SA 5FP6A 4E5WA 2DYLA 3NW7A 4U5JA 3W33A 4ACGA 1OECA 2QVSE 4MCVA 2XBAA 2Y4PA 5HBJA 4RFYA 4DGLC 4GW8A 4Q9SA 2XK8A 2PZYA 4FA2A 2Z02A 2J5EA 3NYVA 4QMVA 4U44A 3EFWA 3F88A 2XK3A 5HO6A 3FKLA 5DYJA 4XP2A 2PVJA 3QD0A 1XH8A 1BUHA 2JFLA 1Y6AA 2UZWE 3EN5A 2QOHA 4FEWA 2F2UA 2YIRA 4DEBA 4R1YA 3QAME 2BIKB 3PPKA 4RIOA 4D9TA 5M4UA 4RA5A 4JX7A 3BE9A 4AT5A 4P5ZA 5M51A 2IO6A 4DHFA 4R78A 4G34A 4I1ZA 4USFA 1KSWA 4MD8E 4GYIA 4X2GA 3DKFA 3TJCA 2J4ZA 4JBOA 4FTUA 5DR6A 3V8SA 4OTGA 1NA7A 4AN3A 3TV6A 3QRUA 3DZOA 2PZPA 3EN7A 3LJ1A 3OT3A 4MBJA 3LXKA 3P79A 3IOPA 3MJ2A 4Z7HA 4DFXE 5IH5A 4R7BA 4P4CA 3ATTA 2B52A 3DXQA 4YTIA 4JDJA 4LRMA 3EWHA 3R83A 3FYKX 4YNOA 4B99A 3JUHA 2G9XA 4A4XA 3CD3A 4M84A 4XH6A 3DJ6A 3ZTXA 1Y8GA 3R7IA 2WTVA 4IMYA 3ZEWA 4EK8A 5IA3A 2XIXA 4ACHA 3R00A 4ARKA 3QQFA 1OL5A 4NK9A 4E6AA 4XG3A 3GCPA 3MVJA 5FLFA 3VUGA 3WYXA 2BTRA 4XCUA 5EQYA 3MFRA 4V04A 2ZV2A 3A7HA 3DGKA 2P55A 2B55A 5AUWA 2G01A 3HV7A 4RWJA 4EC8A 4KA3A 3OMVA 2YABA 5DI1A 4QMNA 1WBWA 4E20A 1OBDA 1P4OA 3PXFA 4IFCA 4KABA 1RW8A 3O2MA 2VWBA 5JH6A 5K5XA 4TYGA 3KXHA 5D10A 1JKSA 3EMGA 3L9LA 5FD2A 5HD7A 3BGQA 1J7IA 4E5AX 3NCGA 4JBPA 2P2HA 3DK7A 4G6OA 2UW0A 2OFUA 2PE1A 5FTQA 4A06A 2RKUA 3KCFA 4A9RA 3EFJA 1GOLA 3CGOA 2I40A 3HDNA 3R8VA 4MWHA 4C38A 5CXHA 1ZARA 2F49A 4M66A 4GKHA 4O7SA 4PMTA 5CASA 4FKQA 2UW3A 3QL8A 4XRLA 3OVVA 4ITIA 3QYZA 1Q8UA 4TYHB 1Y8YA 2YCFA 2OKRA 3A2CA 3I5NA 4YLKA 4Z9LA 5JZNA 3R9OA 5CEKA 5IEYA 3B8RA 5CNNA 3P7BA 2G1TA 3QD3A 1QPJA 5CU6A 1LPUA 4FVQA 1QPDA 2HOGA 2QURA 3EZRA 3FHRA 4FE2A 4R7HA 3V5PA 5JFWA 5LJJA 2W1EA 2Y7JA 3M11A 3Q5ZA 4CRLA 4FUYA 5EK7A 2ERKA 3OOMA 3VHKA 1LUFA 2OK1A 4M3QA 3W2OA 3BEGA 4UWBA 4QP9A 2XK9A 4ITHA 5CI7A 3PSBA 4BDEA 4CQEA 4EORA 2VO0A 4AZVA 3FZTA 3V5WA 2WO6A 2QO9A 2ZM1A 4BBMA 1KV1A 4C8BA 5CSPA 3IS5A 3AC5A 4K6ZA 5HO8A 1AGWA 4FSMA 4Y72A 3FXWA 4M0YA 2E9NA 5ANOA 2IVUA 3VRZA 5EH0A 4A9TA 3HA6A 5TKDA 3TKHA 5DGZA 1MRVA 1O6LA 4D1XA 1SMHA 4CLJA 4S34A 2XZSA 3C4EA 4I23A 4NH1A 4E93A 4FTTA 5AX9A 4O0RA 4WD5A 5DT4A 5FGKA 3PLAE 5HU3A 3KXNA 5HTIA 4EK4A 5HZNA 2VO3A 3ROCA 2Y6OA 2WMAA 1GZOA 4NM0A 1M7QA 4UMTA 3KXGA 4L68A 3DTWA 4C2WA 2AC5A 3C51A 3FC2A 3I6WA 3OD6X 1YXVA 4YP8A 4AOJA 2WMTA 4YJPA 4MXZA 5F4NA 5CXZA 5K3YA 2BRHA 5J9YA 3LXLA 4JOAA 4EOSA 2REIA 5HOAA 1G5SA 3CR0A 4BDFA 4CFWA 5KNJA 2XRUA 2QG7A 1IRKA 1QL6A 2NPQA 3DBEA 3MA6A 4H3BA 2VGPA 4K11A 4NM3A 4LMNA 4WO5A 3RK9A 5IUGA 3E5AA 5AP4A 3HX4A 4XHKB 3OZ6A 3UGCA 2ZM3A 4ZY4A 5E8SA 3UNJA 2WMXA 5K5NA 1IEPA 3QRTA 3MH0A 4JIAA 4S2ZA 1F3MC 4NIFB 4AE6A 4H3PA 4BN1A 5CZIA 5A4QA 3U4UA 4F7LA 4NWMA 1OL1A 4M69B 5K4JA 3TNPC 1ZYDA 1BI7A 1QMZA 1BL7A 3IKAA 3G33A 3LLTA 1OM1A 4D0WA 2GS6A 4C02A 4GRBA 3A4OX 5H8BA 5I5ZA 3S4QA 4G5PA 3P08A 2YFXA 4HGLA 3KRJA 5FP5A 3JY9A 5L2SA 4IXPA 4C4FA 5JFSA 4ALVA 1NVRA 3ZONA 4MK0A 2H8HA 4MXXA 3RGFA 5HG8A 4F9AA 4AA0A 4FNYA 4G9RA 3HLLA 4BIEA 1PXOA 1UU8A 2EB2A 3JS2A 2I0VA 5L6WL 3EYGA 3R63A 3UQGA 1P2AA 3DV3A 5A4LA 3UNKA 3VS6A 2VTTA 4FKSA 2YJRA 5EW8A 2RFDA 2IW9A 3ZLYA 1NVQA 2WFYA 3QFVA 5GJGA 3ZEPA 2XNEA 3CD8A 2RSVA 1RQQA 4FMQA 2C1AA 2Y0AA 3GI3A 2FVDA 3DXPA 3I79A 2ITNA 3MPAA 2VTOA 5HBHA 3EQDA 3FJQE 4XLVA 2R5TA 3QTSA 4PF4A 2GCDA 4ERKA 4BDIA 2Z7LA 3WZDA 3UQFA 1L8TA 5E8UA 4FT0A 3QKLA 4JQEA 3L9PA 3AC1A 3DU8A 5DLSA 3MVHA 4QMTA 4YZCA 4OTWA 3F2NA 4MAOA 3QC9A 3Q96A 4BGHA 3ET7A 4BF2A 3TN8A 3EHAA 5CSHA 3ZDIA 1YOLA 3AC4A 5C8NA 2HZ0A 3TNHA 3A8WA 3OEFX 1J7LA 4FUXA 2YEXA 3KCKA 2R3NA 3D0EA 4UMUA 5I9WA 3HEGA 2BR1A 4BDBA 3QQGA 4O81A 4KRCA 3NX8A 2YDKA 4K33A 4BCGA 1UVRA 3OTUA 4JXFA 4KKEA 4KKHA 1KE7A 4XEYA 4CD0A 3CY2A 2XKFA 4DTAA 2XNOA 4RLLA 5TF9A 2R64A 4OTHA 3UPXA 1PF8A 3GCVA 3KXXA 3UPZA 2I7QA 3ALNA 3ZC6A 4YC3A 5AIKA 3DK3A 1WVXA 2OFVA 2YWVA 3TKIA 1PXMA 3IONA 4D2SA 3BHTA 4A9SA 3SXSA 3TG1A 4BCPA 5IQIA 2WHBA 3LQ5A 4CKIA 4QP4A 4R1VA 1LP4A 3V5LA 1PJKA 3F61A 1JKTA 1PRYA 4LUEA 1G3NA 2VTJA 1ZRZA 3PY1A 3QTQA 4D2VA 3BHHA 4ZJIA 3LFAA 5EG3A 3IW8A 3EQRA 4IM0A 3GQLA 3VUKA 3UO4A 2AUHA 4LI5A 3LFEA 2CDZA 2GNHA 3B8QA 4YJNA 3EFLA 4BKZA 1KE6A 3ZBXA 4PWNA 3HUCA 4XBRA 4MVFA 1PXIA 4F7JA 5L3AA 4BCHA 3ORPA 3ORXA 1PMUA 3QXPA 4WNMA 3W32A 4WIHA 3VUMA 3RKBA 5J7BA 2GQSA 3A62A 5HNBA 4EKLA 2UZTA 4G3DA 1ZOGA 3GXLA 3G90X 3CXWA 4EH6A 3DKCA 4CFMA 3WZJA 1BI8A 2QOBA 1OIUA 5HU9A 4QP6A 2OXXA 4CKRA 2CN5A 3IDPA 4FOCA 3SKCA 3EKNA 4XX9A 3SRVB 5C8KA 4F6WA 4UEUA 1M17A 1WMKA 1B6CB 3GEQA 3UIBA 3ANQA 5E8WA 3IW6A 5KCVA 4AG8A 2JDVA 3DDQA 4D58A 4O22A 4EWHA 3VAPA 5CF4A 3AC8A 4QP8A 1IAHA 3U9NA 4CLIA 1URWA 1Q8ZA 3EL7A 4D55A 4NEUA 5B2MA 4R7IA 2XM8A 5KHXA 3PG3A 4EH8A 3ALOA 5AP3A 4TYIA 3ORTA 3OWLA 1REJA 4F7NA 2QO2A 2PK9A 2ITZA 3NDMA 4RJ8A 4JG6A 5C1QB 4TZRA 4G16A 3G9NA 1YI3A 2BROA 4MTAA 5JKGA 1OL6A 3MYGA 4FTMA 4ITJA 2OGVA 3PRFA 3RAIA 5F95A 1U54B 4D4SA 1Q41A 5GZ9A 1UNGA 4FZDB 5HTBA 5DVRA 1XKKA 2E2BA 3G9LX 4ZS4A 1M2QA 5AV3A 4CSVA 2A27A 2E9PA 2BKKA 4RX5A 4C4HA 2W5BA 2VAGA 3Q9XA 5G1XA 1SVHA 3QCQA 2HWPA 2QCSA 4NT4A 5C27A 4L01A 4Y85A 4RC2A 1XWSA 4PV0A 3FXZA 2HXQA 2PL0A 2YACA 1WBTA 2BMCA 3O7LD 3R22A 4PPCA 1GZ8A 1H1SA 4G6LA 2W1ZA 4YHJA 1H28A 5CU0A 5LQFA 3DKOA 2XK6A 2VWZA 1SNUA 2O5KA 2VUWA 4L43A 4EZ7A 3VBXA 2Z8CA 4OLIA 2BTSA 2QOQA 2JGZA 2X9EA 4IB3A 3GP0A 4UYNA 2JIIA 4UY9A 5L2IA 3IW7A 4RBLA 4CGAA 3NAYA 3UZRA 3PPJA 4GL9A 3BGPA 3FLWA 4TTHB 3IW4A 3D5VA 3W16A 2GNJA 4UV0A 3OHTA 3O51A 4HVDA 2P3GX 3QQLA 3SC1A 4IZ5A 4F99A 1UA2A 3ZFXA 5IQGA 3IG7A 5JMSA 2CNQA 1KOAA 4J8MA 4AN9A 2X2MA 2W1FA 1OZ1A 3LJ2A 4G3GA 5CANA 3OW4A 3F7ZA 3W2CA 1PKDA 3RZBA 5DPVA 4FSZA 3AGMA 1TKIA 3CJGA 2XB7A 3QUDA 1QPEA 5M4FA 4Q5EA 3A61A 4LUDA 4E4MA 5EDQA 4LRJA 3QA8A 4H36A 3N4VA 4BL1A 3ZUTA 2B53A 3KRLA 3HECA 3H3CA 2ITXA 4K9YA 5BVOA 3AG9A 1JVPP 2J9MA 3C4FA 3OWKA 5BVNA 4DEIA 5I3RA 2WD1A 4BI0A 5ITAA 3DNEA 5HX6A 5EQEA 3LQ8A 3LQ3A 2UW7A 3HKOA 3LE6A 2BDFA 5DG5A 3EL8A 4FVRA 5CSVA 3UTOA 5IDPA 2R3IA 3NUPA 5KO1A 5FM3A 4ANQA 4W4WA 1VYWA 4X0MA 4O84A 4J1RA 5HHWA 3EN4A 2OU7A 3FI2A 3OBJA 5FXQA 2HY0A 2NP8A 3FLZA 5E7RA 2CGWA 2BIYA 3Q6UA 3UIUA 1E1VA 2JKQA 3E7OA 4HNIA 1CKPA 5H8EA 2C69A 4YO6A 5CSXA 2CGXA 4FSTA 4K0YA 4RVMA 2IW8A 2WMVA 5M09A 5AA8A 4NW6A 5E8TA 1YDSE 2F57A 3PWYA 5IQFA 4L45A 3Q9YA 4FTQA 1Q24A 4IWDA 3VIDA 1URCA 4DYMA 2OW3A 3ZSHA 4O21A 4XP0A 2G2IA 2JC6A 3MIAA 2G2HA 5DT3A 5IG1A 4U40A 3ORMA 1NY3A 5HD4A 2DS1A 4WG3A 3F2AA 4BVUA 4Y5QA 3UOLA 2PYWA 3RPRA 2JLDA 3ZHPC 4LGHA 2C6OA 4XV3A 3P86A 4HVSA 3F2RA 4Q9ZA 2BAJA 3LKMA 4U45A 4QMPA 4EWQA 4J99A 4F9CA 2UUEA 3FL5A 5CEPA 4QP3A 4CMTA 1U5RA 4HGTA 3QZFA 4YJOA 1ZOHA 5E8ZA 4D1SA 3IPHA 4IVAA 4D4VA 5M53A 4D2WA 2BILB 5ANGA 4O0XA 4BTFA 3RALA 3QD4A 2ZVAA 2VO6A 4FODA 4M12A 4F1MA 4FIGA 3CKWA 5B2KA 4YBJA 3VQHA 2GDOA 3HMOA 1H01A 1JKLA 4QO9A 3E64A 5EOLA 3CQUA 3BU3A 5KBQA 2JDOA 2GTNA 3O50A 3LCOA 4QMZA 3GC0A 3NW5A 2BCJA 2X4FA 2OWBA 3ENHA 3WOWA 2PPQA 3CKXA 3UBDA 2FYSA 5BQ0A 3U4WA 4BY9E 1PMVA 3PRIA 3PVBA 4USEA 2CNVA 4XG6A 3TEIA 1HCLA 4E4NA 5KKRB 3D5UA 4GV1A 4HYHA 4YO4A 3R8MA 2XKCA 2C1BA 2UW9A 4DBNA 3OTVA 3VBYA 4BIDA 3DB8A 2WU7A 3R04A 1OKYA 2GNLA 2R3FA 3LCDA 2XYUA 4OTQA 2ESMA 4O0SA 1W7HA 3R2YA 1M2RA 2HZNA 3DDPA 4FV6A 4M8TA 4FIHA 4EJNA 2F9GA 3CBLA 4N70A 3IDBA 3QCXA 3P9JA 2NO3A 3U87A 3RM7A 2PE0A 1OVEA 3ORNA 1Y57A 5EW3A 4AGWA 4DEEA 3U54A 1ZZ2A 4DGMA 5A54A 4WUAA 3ZUUA 5I4NA 3FHIA 4XRJA 3M42A 4PTGA 2R3LA 4IVBA 2PHKA 4KS7A 2OF2A 1F5QA
chains in the Genus database with same CATH superfamily
5FEQA 2F2CB 4GVJA 4QNYA 3Q04A 2XVDA 2H9VA 2ITVA 3VBWA 3ACJA 2OJJA 3GU4A 4FL1A 4D9UA 1M2PA 2GTMA 4I0TA 4N6ZA 4O1OA 4S31A 2BZKB 4CZYB 5FXRA 4W9WA 3QRIA 3PA4A 4HGSA 2H34A 3I7CA 5LMAA 4S32A 4BCJA 2XAMA 3JR1A 2HCKA 1ZMWA 3QWKA 4PUZA 5TE0A 4FZ6A 2GNFA 4APCA 1PYXA 4CMUA 3O0GA 3LHJA 4G31A 4O91A 4QOXA 4IVDA 4FKVA 3D94A 4R6VA 5AUTA 4LGGA 5B7VA 5GZ8A 4UWYA 5HIEA 3FZRA 3LLAA 3HRCA 2BFXA 4IANA 4QQJA 4KS8A 3R71A 4QD6A 2QHMA 4O0UA 2UZVA 2JIUA 1NXKA 5L2QA 3EOCA 2E9OA 3MB7A 4L3LA 4C57A 2ZFYA 3KULA 2C47A 3PWDA 2F4JA 3IDCA 3NLBA 3DAJA 3QD2B 2RFSA 2OIBA 3CP9A 3KRRA 2C0TA 5KMJA 2P0CA 2UZOA 3DCVA 3HNGA 4H58A 4R5YA 5HIDA 4IWQA 3CC6A 4ZTHA 5KMNA 1YI4A 3V3VA 1M7NA 3PIYA 4TKSA 3TUDA 2A1AB 4FKRA 4MD7E 4GUEA 4F70A 2RIOA 3P0MA 4CV8A 3H0ZA 4HYUA 4DHZA 3DY7A 2O63A 3FE3A 3LFDA 1Y91A 3MS9A 4IWPA 4QP7A 1Q62A 2AQXA 4HPTE 3ZSGA 4E4XA 3FMDA 3BU5A 1STCE 5BV3A 3OROA 4X7QA 3D5WA 5L8KA 3CSVA 3E7VA 4O96A 4JBVA 2Z60A 1A48A 4GKIA 4F64A 3W0NA 4L3JA 4X2KA 5KMOA 3MH2A 3TCPA 5LMBA 5CS6A 3PJ1A 3FPMA 4FSQA 3CTHA 5I9YA 3D7TB 2OSCA 3GGFA 2R3QA 4CFVA 4G3EA 1ZYCA 3BYMA 4GU9A 4JRVA 2XNBA 3IO7A 4EONA 2XJ0A 3PIXA 4ONAA 2WTWA 5EYDA 3ZC5A 3TM0A 2VTHA 4OTPA 3P23A 5BMMA 3TTIA 5HLWA 1ND4A 4FIFA 4NFMA 4G3CA 3LM0A 2CGUA 4Y73A 4ANNA 3D4QA 4WRGA 1YHVA 2JIVA 2O3PA 1MUOA 3MI9A 2C3IB 3EQPA 4IIRA 5HCXA 4FRFA 1ATPE 5ANKA 4O7ZA 3GENA 3FI8A 4BCFA 4FK3A 3D15A 3GU8A 3E63A 2XAOA 2YLFA 3SX9A 3PE2A 2BRGA 4DFBA 3CS9A 5AIRA 5D7AA 1ZAOA 3TMOA 4NU1A 3NIZA 4O4CA 2XS0A 5IQAA 2BDWA 4GUBA 4Z16A 4PDSA 4E3CA 5TR6A 5HLNA 2WQMA 4TWPA 4MNFA 3E3BX 4MKCA 3BHUA 4YBKA 2GNIA 3FMNA 4F0GA 4UMPA 3UVQA 5IPJA 4AGCA 5CU2A 2C5VA 4XJ0A 5CU3A 4JL9A 5JGAA 2ZMCA 3KU2A 4O4FA 3PUFC 3NUUA 3H0YA 3LAUA 4FKIA 4FKPA 4NTTA 3ZM4A 5F9EA 3ZSIA 1P14A 4FIJA 4J53A 1H08A 4RX7A 5AP7A 3W0RA 1PXPA 3LVPA 2Y4IC 2XYNA 3ACKA 4F6UA 2X0GA 3RI1A 2ONLA 2ITOA 5GNKA 3O7LB 5E8VA 3R9DA 4AXAA 1FGKA 4EUTA 4PMPA 2HZIA 1WVWA 3NNXA 1YXUA 2X7OA 3WILA 4BJJB 1KOBA 4PNIA 4IZYA 3R30A 1W84A 3RAWA 4ASZA 5JQ8A 5A9UA 2R0UA 1UU9A 3BKBA 4FBXA 4QPAA 5AWMA 3R7VA 4PDYA 5IDNA 2HIWA 1CKJA 4DA5A 4WOVA 5LVPA 1RE8A 5M4CA 5CZHA 4GSBA 1ZYSA 5KE0A 5EHOA 5LMKA 4JR7A 4M67A 4GT4A 5F94A 1TQIA 2B9FA 1GAGA 3R7UA 3SXFA 2CSNA 3LFCA 4RWLA 4BKYA 1KWPA 3EN9A 4FTNA 3C13A 2KTYA 5HE0A 3TL8A 4MWIA 4CVAA 4IAKA 1JWHA 3F7WA 3ORIA 3IW5A 3ZFYA 4M14A 4E6DA 2QOFA 3MDYA 4DFNA 2OH4A 3L8PA 3S95A 4IX4A 3PJ2A 1W98A 4TYJA 5EDPA 4YZDA 4ACCA 5LVNA 3BV3A 4BDCA 3FXXA 1XH6A 5H3QA 2IVVA 3DLSA 5E90A 5HLPA 2OZOA 4RFMA 4C3PA 4EH3A 2DWBA 2VU3A 3ORLA 3E87A 2WNTA 4FTIA 1XBCA 4YU2A 2I0YA 4HNFA 4J95A 1JAMA 4UALA 1EH4A 2YERA 4QP1A 3E8CA 5BX0A 1H0WA 4L00A 1QPCA 2I0HA 4YSMA 1UKHA 4EHVA 4BDDA 1Q3DA 2ETKA 5AR3A 3FBVA 3I5ZA 4OTIA 3UO6A 4E7WA 1YOMA 5CALA 1LR4A 4O7LA 4AA4A 3NYXA 1ZMVA 4I5CA 4OTFA 3NRMA 3HAMA 3WZKA 4DH3A 2RG5A 3COIA 4FKUA 4C61A 2XIZA 3Q4UA 3SD0A 3C4WA 3U6HA 3N9XA 4Q2AA 2BZHB 5GHVA 3ROYA 1FOTA 1JOWB 3L8XA 1T45A 4TPTA 4BI2A 3SGCA 1V0PA 4DDGA 2OBJA 4ZSGA 3D2KA 1Q8WA 3OUNB 4YZMA 4FV8A 3GQIA 4ANMA 1XJDA 3LFSA 4C3FA 4ZY5A 3KMUA 4EJ7A 1J7UA 3FY0A 4F0FA 4RX8A 3AQVA 4C34A 2ZYBA 3F5PA 3QXOA 3W8LA 4L7FA 1IASA 3RBWA 3W55A 5D11A 4EH4A 3HV4A 5EW9A 3UO5A 1J1BA 1XH4A 4ZZOA 3EQHA 1W8CA 2FO0A 5HTCA 5G6VA 3OOGA 4AT4A 1YXXA 4OTDA 4J8NA 4JG7A 4BZOA 4ACMA 4AZWA 3RTPA 3COKA 5D41A 4D2PA 1WBOA 3MB6A 1YI6A 5IA1A 4D4RA 2CPKE 3VQUA 5DMZA 3OS3A 5IH6A 1TQPA 4CKJA 2G2FA 3JXWA 4YURA 2QLUA 4FEXA 3GFEA 3W10A 3HMIA 2X7GA 4O82A 5KBRA 2A19B 3PE1A 2C4GA 3S00A 5M08A 5E8XA 3K3JA 3DLZA 3P7CA 3C1XA 1K9AA 4KBKA 3S1HA 3FWQA 4HOKA 4L8MA 5ACKA 5CVHA 4QMOA 4UX9A 2DQ7X 5LCJA 1S9JA 2Z7RA 1YOJA 4II5A 4EKKA 4WBBB 2J6MA 5DEYA 4G6NA 4PP9A 3POZA 4S30A 4KBCA 1MQBA 5AMNA 5AR8A 5T68A 3RPOA 4LMUA 4QYEA 4AP7A 5A3XA 5IKWA 1P4FA 3TWJA 2OIQA 1APME 3UVRA 2GPHA 2DUVA 3PJ8A 5TT7A 3ZFMA 4W9XA 3V04A 4LYNA 2PVNA 1YVJA 3I60A 2WIPA 5FUTA 3MFUA 4AN2A 5KMMA 3PUPA 5DBXA 5FDXA 4ORKA 3POOA 4YHFA 5IA5A 2BHHA 4X3FC 4NL0A 2GFSA 5FRIA 3TZMA 5EQPA 4X2JA 3GNIB 2Y4IB 2FA2A 3CCNA 3R02A 3HYHA 5HG9A 1SNXA 4JMQA 4RT7A 4XG2A 2VWVA 5EOBA 4L7SA 3QTZA 3L8VA 3PXYA 3COHA 2OLCA 4PL5A 3BL9A 3PY0A 4NKSA 4DEDA 2J0MB 2HK5A 4FR4A 4WNKA 5F1ZA 1FMKA 2A98A 2BALA 5IA2A 2OF4A 4U6RA 4YJQA 3U8WA 3VF8A 2X39A 3DAEA 4MHAA 5J1VA 5FBOA 2BFYA 1YDTE 5JSMA 1FMOE 2IVTA 5HNGA 3FKOA 5FQDC 4EOMA 4DG0E 4U81A 3VS0A 2C6IA 2JKKA 1NW1A 4FI1A 2J50A 2O64A 3RNYA 3CPBA 4CFUA 2FUMA 4ZJJA 3FZ1A 2UW5A 2CCIA 2LGCA 4FL3A 4RFZA 3UZTA 4MXOA 4RIXA 3ZO1A 1KUTA 3R7GA 5LCKA 3V5QA 2BVAA 3KN5A 4RJ5A 3BU6A 3FDNA 1WZYA 5JZJA 3I6UA 3K5VA 4QTEA 3KA0A 4BC6A 4NM7A 3C4ZA 2YCSA 3DA6A 1H1PA 3RVGA 4GG7A 4BDGA 1UWJA 5EM8A 2X1NA 3I4BA 4ASEA 3UMWA 5CVFA 4BZNA 3QALE 3QBNA 2X2LA 4JDHA 3DBCA 3IK3A 4E73A 5KX8A 3NWWA 1DI9A 3RNIA 4AZFA 3DXNA 1KE9A 4BTKA 3C7QA 1UKIA 4FV4A 4RJ6A 4MXAA 4O6EA 2ONLC 1IAJA 5EFQA 2JDTA 3M2WA 3BWJA 1ZXEA 1H8FA 3RK5A 3NGAA 4FTJA 1PYEA 3GB2A 3QX2A 2QR7A 1OKVA 3A4PA 3C0GA 4I6FA 4KIQA 1FVRA 1PXKA 4MX9A 3OG7A 4WA9A 1FPUA 4DH7A 4DN5A 2RL5A 4FNXA 3S0OA 3W0MA 2B7AA 2UVZA 3D7TA 1YXTA 1YW2A 3QKMA 4Y83A 2ZM4A 2FSMX 5KZIA 4HW7A 2R3OA 4FEUA 2WOTA 4F1OA 1OPJA 3VJOA 3DJ7A 4E6QA 3ZRKA 4O0YA 4U41A 3TUBA 5J9LA 4FV0A 5C03A 2ZDTA 5AV4A 5LMKC 4IAIA 3HP5A 3KY2A 4OAUC 4YTHA 4YPDA 3PZEA 2IZTA 5HG7A 5C8MA 3FPQA 2OXDA 4B4LA 4EQCA 4YC6A 4KKGA 1YWVA 3FQHA 5CT7A 4FV1A 5CT0A 2W06A 5CX9A 5HI2A 1OL2A 3TNIA 4L52A 5CENA 3EFKA 4PNKA 4WKQA 4JBQA 3OCTA 4BB4A 3EQBA 2EB3A 3VO3A 5DT0A 3EJ1A 4TY1A 1CDKA 3C0HA 5AM7A 5ANIA 1P5EA 2XK4A 3GOPA 2OJFE 4HZRA 3QRJA 5AR5A 3ZMMA 2R9SA 3OXTA 5D12A 3ELJA 1H1QA 2PUUA 2XNPA 1BKXA 4IBMA 4J52A 4AXFA 1H27A 2YM8A 4FV9A 4E26A 4CZTA 1PMEA 3F5UA 3VS3A 2WB8A 3AKJA 1PXLA 5LVOA 4ANLA 3O23A 3QLFA 4NKAA 4XG9A 3BI6A 4EH9A 5K0KA 2VWXA 2XIRA 3DKGA 3U6JA 2J0IA 2ERZE 4LOOA 4BIBA 2C5XA 2C6MA 2UVYA 5EM7A 1Q4LA 4F08A 3BBWA 2UW4A 4C4JA 4QPSA 3KULB 5M06A 2R7IA 3CIKA 2JBOA 3RAKA 3ZYAA 2OJ9A 3NFGB 4OBOA 2C6DA 3OP5A 3EIDA 3HP2A 4IQ6A 3ZDUA 4DGGA 5KHWA 4FC0A 1WBVA 2WPAA 2VTLA 4L42A 4BTMA 4CTBA 4AE9A 4LQMA 3MH1A 2QOIA 3F5GA 4EEVA 1Q3WA 4O4DA 3ZXTA 3DZQA 1GJOA 3FMEA 4FVPA 4WUNA 3V8WA 3SG8A 2J5FA 3FL4A 4W4XA 5E1SA 5KMLA 4QNAA 3VBQA 4EHZA 3DNDA 3UYTA 4AOIA 4YR8A 3O96A 4H1MA 2VGOA 3AC3A 3QCYA 3EN6A 5E8YA 2WMSA 3SW7A 3C4CA 2R3KA 3NNVA 3KF4A 3D14A 4LOPA 3JVRA 1J1CA 3GVUA 2YHVA 5AP5A 5IUIA 1KV2A 5M55A 4C3RA 5HCZA 3RPVA 4EK3A 1XMMA 4UWCA 1ZZLA 3GBZA 4I41A 3AKKA 3CY3A 5C9CA 4U42A 4I20A 4XUFA 3W2RA 5JFXA 4RWKA 3NNUA 3ULIA 2Y6MA 2XIKA 4KD1A 4GG5A 2Y8OA 4O27B 4LM5A 3QQUA 2GQRA 4EQUA 2Z2WA 2IVSA 2Q0BA 2YCRA 4R3CA 4WRSA 5M07A 4ZS0A 1ERKA 3ZOSA 5BNJA 3DOGA 4JR3A 3ZLWA 4KUJA 4C58A 2XNGA 3AMAA 3F69A 5GIPE 3VONA 3EZVA 3AD4A 4AUAA 4HGEA 5A4EA 2UZDA 4RMZA 1R78A 5ANEA 5FEDA 5AV1A 4PPAA 2V0DA 2C3KA 4IFGA 3DFCB 4ASDA 4O7WA 5HQ0A 4TT7A 1Y6BA 4YJVA 4YUQA 2W4JA 3G2FA 4OBPA 3TZ9A 2XJ1A 4J71A 3VS5A 3CPCA 2J0JA 4F6SA 2YAAA 1V0OA 4XV1A 2YLEA 1R0EA 3FMJA 3Q60A 3L8SA 4RVLA 5FM2A 2JAMA 3LPBA 4D1ZA 2WMUA 5CEIA 1QCFA 5DR9A 3OY3A 2R3PA 4AQCA 1WBPA 4AW0A 3ZH8A 2VTAA 2WOUA 4R5SA 4XNEA 4FKGA 3VW6A 4ID7A 5IQCA 3C0IA 4BDKA 4BCQA 5AUYA 4CFFA 3KF7A 5EYMA 1OIYA 3R28A 3OT8A 2RFEA 4LDTA 4KBAA 1Z5MA 4RC4A 2WMQA 2ITQA 4MYGA 2PZIA 3HDMA 4I3ZA 3AT4A 4F9BA 5L8JA 4QYHA 2WGJA 4AT3A 4HJOA 3R1QA 4U0IA 1YQJA 3CTJA 3F3TA 3RMFA 3T9IA 5EKNA 3LCTA 1Q8TA 5EM6A 1DI8A 3W0SA 1ST4A 4FKTA 5HG5A 2YDJA 3B2TA 4TWCA 4FT5A 1JNKA 2VNWA 4CTCA 2WXVA 1V1KA 4IC8A 4IJ9A 4CFXA 1VR2A 3MIYA 2LAVA 3TDVA 4UZHA 4TYEA 4DFLA 4O6LA 1X8BA 1XQZA 3RPSA 5D1JA 3K54A 4EOIA 4O7VA 1S9IA 3D7ZA 4NUSA 5J8IA 3FV8A 4WNPA 1DAYA 3JYAA 4AW1A 3W2PA 3ITZA 4H1JA 2JBPA 3PYYA 3G5DA 4FEQA 4A9YA 4RIYA 4AS0A 5HORA 3EB0A 4O0VA 2ZOQA 4N0SA 3TDWA 3MN3A 4B8MA 5BVKA 3SOAA 3RPYA 4BHNA 4CT2A 2EXMA 1OUKA 2BKZA 2R3JA 3PP0A 4PP7A 4C2VA 2JDRA 4KWPA 2IZUA 2WEIA 4JRNA 5HBEA 4G3FA 2WTCA 3PA3A 4QMYA 4U79A 4U7ZA 3ID6C 4QMUA 2GS7A 1HOWA 4X3JA 4ERWA 2R2PA 3PSDA 2C6EA 4IDTA 1JSTA 2R0IA 4QQ5A 4XBUA 3OCGA 2YISA 5F20A 3FUPA 4LV5A 4FEVA 5LVLA 5I9XA 4QP2A 1YXSA 4A4OA 2OO8X 3MVMA 3TNQB 2UZNA 5CTPA 4UXLA 2ITPA 2VZ6A 1PW2A 3TI1A 5M56A 4K77A 4KIPA 4XV9A 3UOJA 2PVKA 1ZY5A 4I4EA 5E91A 2UV2A 4YJUA 4NJ3A 2F7ZE 3FAAA 4PPBA 3MESA 1PMNA 5AR7A 4LG4A 2UZBA 4Y46A 5DE2A 3UIXA 5I9UA 4ZMFA 5LWMA 4MEDA 4FT9A 4TWNA 4AZEA 3UQCA 2JFMA 3I81A 2H96A 5H2UA 4HVHA 1K2PA 3LOKA 5BMSA 2XRWA 5IA0A 3NUNA 2VD5A 4EOQA 2QOOA 4FYOA 5ANJA 4RZWA 1TFFA 3BZ3A 4O2ZA 3H30A 4DEGA 2BHEA 3C9WA 1H00A 3GC8A 3ZUVA 4DHIB 3ODYX 2VWIA 4IW0A 2CJMA 5EI2A 1PXJA 4KAOA 3Q9WA 5L6PA 2Y9QA 4O4EA 3QTWA 3EQIA 4FV5A 1PKGA 2B9HA 5EDRA 3SA0A 2BZIB 3QGWA 5AUZA 3R9HA 4IAAA 3HGKA 3ODZX 4KIOA 4ZTNA 4MUQA 3HAVA 3WZUA 1O6YA 2YM3A 4BGQA 4UXQA 2W7XA 5AX3A 3T8OA 4LFIA 2R4BA 3AXWA 3PTGA 4USDA 4JAJA 2VTRA 2VTNA 4IM3A 4QYFA 1ZOEA 3QQKA 4U8ZA 5EYCA 5AUUA 2VTSA 2O2UA 3PDTA 1H07A 3OUKA 4JVGA 3E62A 4MQ2A 5DR2A 3F3VA 3UIMA 2PMLX 3EQCA 4C4EA 4EHGA 3QHRA 3N4TA 4XG8A 3WBLA 4E5BA 4W4YA 4DEAA 5IEVA 3R9RA 4DCEA 4D2RA 3LFNA 1SYKA 5M44A 2PUNA 1UNLA 2QNJA 3OW3A 3PY3A 3QGYA 1JBPE 4X6QC 3D5XA 4O7YA 4W4VA 3TKUA 3V5JA 4BBEA 4O7TA 3UZPA 4U97A 4I0RA 2W99B 5ETIA 1UU3A 4RC3A 1OL7A 2VX0A 2NRUA 3A7IA 2PY3A 3BGZA 5BUEA 2FGIA 2YIQA 4M97A 4F9WA 2W96B 2X7FA 4P90A 3Q6WA 5FTGA 3IGGA 5LVMA 2I1MA 2ZJWA 5HVYA 5A4CA 2PMNX 4IADA 4CYIA 1YHWA 3NFFB 4BCMA 3LM5A 4GFOA 3K3IA 2UZEA 4XMOA 2C30A 3EQFA 1AQ1A 3MGYA 3MV5A 2PUPA 3NUYA 4QMMA 2V22A 2ZDUA 3UP7A 4C59A 3H9FA 1ZYLA 3BLHA 5AV0A 1MRUA 4FKOA 4MQ1A 4RIXB 3RAHA 4U3YA 3TZ8A 4FTAA 5CAVA 2C6TA 2CLQA 3PVUA 4I6LA 4TXCA 3QWJA 2IN6A 2YIWA 1R1WA 2RF9A 3TIYA 3R2BA 3RK7A 3SOCA 1OBGA 4W8EA 1LEZA 2E9VA 3CEKA 2QOLA 3P4KA 3LFBA 3HV6A 3UG2A 2GFCA 4F0IA 2HW7A 2Z7SA 4V05A 5C01A 3VC4A 5JK3A 1F0QA 4CNHA 3U6IA 3BX5A 2XEYA 5J9ZA 4PTCA 4I6BA 4WSYA 3ENMA 3KGAA 4CEGA 2OIDA 4BICA 5E9EA 4YZ9A 3BYVA 1ZY4A 4BYJA 4BWXA 5CAOA 1L3RE 4IWOA 3TT0A 2HXLA 3MH3A 4FL2A 4ZSLA 3KC3A 4IB0A 2B9IA 4C35A 2X8IA 3G6HA 4X3FA 4RWIA 1Q61A 1BMKA 4BTJA 2CKOA 2PZ5A 3KMMA 2QQ7A 4U3ZA 4YJRA 1ZMUA 2YZLA 3C50A 1A06A 2VWYA 3R8UA 4MBIA 2QG5A 3KK9A 4YGAA 1XH7A 2PMOX 1XHAA 4PQNA 5HCYA 4HVGA 1ZYJA 3VWAA 4CT1A 3PIZA 3NYNA 3QX4A 4EZ5A 5A6NA 4D5KA 3HRFA 3RHKA 2OI4X 4FSUA 1HCKA 1KE5A 3ULZA 3V8TA 4ANBA 2IWIA 5J1WA 2WQNA 2PUIA 4CV9A 4CG8A 1WCCA 5ETCA 4L46A 2FSOX 3MPTA 4FSRA 3HUBA 3H9RA 4H39A 1E9HA 5IQBA 3GC7A 3RWPA 4BGGA 4ZLZA 4YTCA 5L8LA 2JEDA 4YJTA 3WZEA 3CE3A 2YM7A 1PXNA 1T46A 4EC9A 4QMXA 3QC4A 2WTJA 4F7SA 5K9IA 3F9NA 3LIJA 5LXMA 3AT3A 4RJ7A 5GIOE 5CQUA 2O8YA 4FTKA 3VUDA 1E1XA 3BQCA 4ZMEA 3JPVA 1DAWA 4FTLA 4JNWA 5DWRA 4IAYA 2QOKA 5BYZA 4X21A 2YIXA 1DS5A 2YM4A 3P7AA 2XANA 3OEZA 5GJFA 3QTUA 4ANSA 3VBVA 2V7OA 5J87A 2QODA 3GCQA 3ORKA 4X2NA 3KFAA 3NEWA 4R3PA 4QTAA 3TNWA 4EK6A 5IISA 3QLGA 3Q52A 2ITUA 4M7IA 5A4TA 2W9ZB 2XEZA 4FT3A 2GMXA 4HYSA 5LARA 3DJ5A 4K2RA 3WI6A 2J7TA 5L2WA 4QYYA 3SVVA 2PTKA 3NMUF 4FX3A 3HV5A 2PMIA 3TV7A 2WKMA 4DCAA 3ZO2A 2QD9A 4L6QA 5AEPA 5ACBC 3UC3A 2VX1A 3Q9ZA 4L3PA 4ZTMA 1WAKA 4XS2A 4AU8A 4BKJA 3DQWA 5K0XA 2W1DA 4PMMA 2A0CX 1DM2A 4FF8A 4U43A 4I5MA 1AD5A 4GT5A 3Q4TA 4A9UA 3DK6A 3MJ1A 4DGOA 2R3GA 4DTBA 4PX6A 2X2KA 2XBJA 3AD5A 4QT1A 4ANOA 4DH1A 2NNWB 2X0OA 4FNWA 4C7TA 3FYJX 4BCNA 3MVLA 4YZNA 5JGBA 3FLNC 1I44A 3C5IA 4PTEA 4J97A 3NS9A 3NUXA 4ZAUA 4WHZA 2W5AA 2OZAB 3C4XA 5IH4A 1ZWSA 2PVFA 3PJCA 3MSSA 2QU6A 3WF7A 2RFNA 4IH8A 3QKKA 3WE8A 3R0TA 4KNBA 3UOHA 4FTOA 3UG1A 3GFWA 2X81A 5IQEA 3RP9A 3A7JA 3EKKA 5I0BA 3TYKA 3H10A 2CMWA 5BVWA 4BRXA 2XIYA 3W0OA 4IX5A 2KULA 4IJPA 4I93A 4OT5A 1XBBA 3VW8A 4JI9A 3FZPA 5EM5A 1BLXA 3VS7A 1JPAA 4QMWA 1FVTA 1R39A 5DN3A 3DPKA 5AP2A 1IR3A 4GT3A 3ML1A 5TOZA 2J90A 3NVMB 4TNDA 3HMNA 2W05A 4YMJA 2ZB1A 4IAZA 4V0GA 4AZTA 4QDVA 3QTIA 4C36A 2XF0A 3HVCA 3PG1A 3LW0A 4FSYA 4O7NA 3B2WA 3RJCA 4DGNA 3FQEA 1NVSA 3NR9A 4FG8A 3ZLXA 4IC7A 4GK2A 3MFTA 3R01A 2OICA 3BIZA 4IDVA 3MW1A 4YNEA 3GCSA 3QUEA 2ZAZA 3ORZA 3IGOA 2GSFA 4APPA 2W1GA 4IAFA 1W2DA 1FGIA 3NPCA 3PPZA 1H25A 1PY5A 4LRKA 4XG7A 1G8AA 1GNGA 5H9BA 3T3VA 3N4UA 4Y8DA 5ETAA 1GIJA 4AW5A 2C0IA 2YZAA 4ZEGA 2JKOA 1FINA 3SV0A 4B7TA 3H4JA 4CMOA 3NUSA 1BYGA 5FDPA 5AV2A 3QF9A 5DHJA 1YWRA 2W9FB 2C3LA 2XJ2A 3BLRA 1U46A 3R9NA 1FBNA 4I94A 3R8LA 1WFCA 3OXZA 3QA0A 3A99A 1XH5A 2NRYA 3KB7A 3QU0A 4PMSA 5L4QA 4KIKA 2ZV7A 3OXIA 3NYOA 3COMA 4HZSA 5E4HA 1PHKA 5CVGA 3LFQA 4QMSA 3FI3A 3F3ZA 4HVIA 2XARA 1GIHA 3KN6A 3DB6A 3DT1A 4BDAA 2VNYA 4E6CA 4L9IA 4W8DA 5IZFA 2XUUA 3PJ3A 4U80A 4Y5HA 5HESA 4GVAA 5HVJA 4BCOA 4JT3A 4BZDA 4DEHA 4GMYA 4D2TA 1GZKA 4B9DA 2VWWA 4BHZA 3VBTA 3AMBA 3L9MA 2QKWB 2XKEA 2ZMDA 1VYZA 2VX3A 4FTRA 3THBA 4DFUA 3LZBA 4PDOA 4L67A 4IZ7A 3Q4ZA 5CF8A 4GIHA 2WTKC 2X6DA 4JJRA 3MFSA 3HMMA 4QMQA 3NIEA 4RIYB 4JX3A 2YWPA 5CQWA 4WSQA 1XH9A 3ZRMA 4EQMA 2YN8A 3HA8A 2W5HA 4Y95A 3MTFA 5EHYA 5BVEA 4BCKA 4C33A 3LCSA 3Q2MA 3R8PA 3V01A 2W0JA 5J7HA 4ZK5A 5A46A 5L6OA 4RX9A 5GINE 3VN9A 1J91A 1CSNA 4XOYA 4F09A 5IUHA 4MXCA 4LL5A 4I6HA 4TWOA 5JT2A 3W18A 4PL4A 2NYAA 4DFYA 3BELA 4HCVA 3K5UA 3REPA 4XLIA 1IA8A 2ACXA 3LMHA 2W1CA 4C4GA 1H1RA 4RJ4A 4CXAA 4YLLA 3R21A 4DLJA 3WF9A 4ZSAA 2V7AA 3G51A 5KMIA 3MA3A 2GQGA 4ALWA 5HGIA 2WAJA 3ETAA 3T3UA 4MBLA 4QTDA 4AF3A 3BHYA 2UZUE 4EUUA 4OAVB 5IQDA 4EOKA 2Q83A 3CGFA 4MNEA 4RIWA 2BRBA 5DIAA 4KINA 4LGDA 1LEWA 3BRBA 3R1NA 5K4IA 2XCHA 1OGUA 2BRMA 4BFMA 5AFVA 2GS2A 3FI4A 5FTOA 3VUHA 1XBAA 5I3OA 3NW6A 4ACDA 2QOCA 3FMMA 5J79A 4M0ZA 4JG8A 2UZLA 4ZOGA 4JLCA 4MD9E 5BYYA 3QTXA 2YDIA 3EYHA 3R7EA 4MXYA 5IQHA 3E8NA 2QO7A 2YAKA 3R1SA 2OJIA 3D2IA 2PVRA 3W1FA 1RDQE 4GFMA 5GZAA 3OFMA 5CY3A 3V6SA 3FMKA 4AA5A 4E4LA 2BPMA 2JD5A 3E3PA 3KKVA 2BDJA 2R3MA 4TRLA 5HICA 4ZIMA 2YM5A 3I0QA 1H26A 1JLUE 3O8UA 4GJ2A 1OPLA 2XNNA 1ZLTA 3NVKI 2I6LA 3Q53A 5EYKA 2C6LA 2W17A 4QYGA 4NYEA 1UV5A 2C5YA 5JEBA 1SVEA 2YITA 4I22A 5B2LA 3E8EA 1YWNA 4R8QA 2VTMA 4YJSA 5IEXA 2VTIA 1H0VA 2JKMA 5H8G<