4EH8A

Human p38 map kinase in complex with np-f7 and rl87
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
351
structure length
336
Chain Sequence
ERPTFYRQELNKTIWEVPERYQNLSPVGSYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 14
publication title Natural-product-derived fragments for fragment-based ligand discovery.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 105
structure length 336
sequence length 351
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2012-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4eh8A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4eh8A01
3IQ7A 2HYYA 1W83A 5K3YA 1WBTA 2JDVA 5HLWA 5TKDA 1YWVA 2JBPA 2NP8A 2C30A 4PMPA 4XJ0A 4FEWA 2QI8A 3QTUA 4JL9A 4L44A 5HBHA 4IJ9A 1NVQA 3KK8A 5EI2A 2WIHA 3K2LA 4U8ZA 4WNMA 3RCDA 4L43A 1BL6A 2BDWA 2XNGA 4UZDA 3PA3A 3GC0A 4UMRA 3PSDA 4I5HA 4GIIA 4GCJA 4IWOA 4NWMA 4UMTA 4FNXA 2CKOA 2UW0A 3V6SA 2PMOX 2JIUA 1IRKA 5EYDA 2C6MA 3G0FA 3LKMA 2HK5A 2G2IA 4BDFA 5JGBA 4RZVA 5A14A 3VWAA 2G2HA 4F1MA 3I5NA 5LVNA 4GG7A 5BYYA 4GL9A 3Q60A 5FBOA 3UTOA 4MNEA 4MNEB 3QX4A 4W4WA 4JAJA 5CZHA 4ASDA 2CNQA 4C35A 1UU3A 4O86A 4YSJA 4FV5A 3BI6A 5IQDA 4M0ZA 2YHVA 1W0XC 2JLDA 3OMVA 1FGKA 2XKDA 2PZPA 1UNHA 1ZOEA 4E4MA 4MQ1A 3S2PA 3LLAA 3PXRA 2EB3A 1RJBA 3G51A 5AM7A 4KBCA 4WT6A 1GZNA 4J1RA 3BRBA 5E8XA 4BTFA 1WVXA 4U3YA 4AT5A 5CVGA 5JT2A 4I24A 2YABA 4X21A 5LVPA 2E9PA 2PVFA 4ZTLA 4DBNA 4X7QA 4N70A 4G6OA 3R8LA 2G1TA 3RMFA 4TT7A 5JZNA 4XBUA 1Y8YA 3ORTA 4KSPA 5EW9A 4ZSAA 3EL8A 2UZEA 1ZOHA 1P2AA 3SOCA 3ZYAA 4D1SA 4CV8A 3QRUA 3CXWA 4C3PA 5L2WA 4EUTA 4IVBA 4O2PA 5CT0A 1SZMA 4OBPA 4YTIA 3THBA 3OCGA 4E1ZA 5FTOA 5FBNC 4EZ7A 3KU2A 2B0QA 1ZY4A 4U79A 3FYKX 5L6WL 1KE7A 4JOAA 4QPMA 5HNGA 1YKRA 3G9NA 4BN1A 2IJMA 4L42A 2HELA 1JKLA 3EQRA 4NSTA 3QFVA 2WHBA 4XUFA 2HZ0A 1KE9A 2RFEA 4F7JA 4XG7A 5BUJA 3DXPA 3HMIA 4IVDA 4UALA 2R3NA 1V0PA 3OHTA 1W8CA 3EFKA 3QQUA 3TV6A 4PL4A 3F3WA 4HNFA 1OKZA 3A8WA 5L6PA 4OR5A 4ZP5A 4GSBA 3UVQA 1P4OA 1SNXA 5TOZA 4JQEA 3DK6A 4GUBA 2PVMA 2BTRA 3ET7A 4FZFB 4XG8A 4DTKA 4USFA 1OKWA 3EN7A 3ZFXA 3N9XA 2W4JA 4J53A 4J8MA 4FSQA 4D0WA 2VWYA 4UY9A 5J5TA 3DDPA 5M4UA 2WB8A 3VUIA 5JFWA 1YOLA 2CGXA 4NH1A 4EK6A 3SQQA 3DY7A 3LFQA 1RQQA 3NUYA 3CTQA 3WE8A 1ZYCA 3H10A 3I7CA 4RBLA 5EI8A 3NUPA 5CLPA 5E8SA 4CZTA 4EOPA 1P4FA 2WTDA 3LCSA 5IF1A 4FG9A 3CTJA 1U54A 1U54B 2CGWA 3PJ8A 4RT7A 2PVYA 4XV2A 2R3PA 5CASA 2ZB1A 5T6KA 5JGAA 3LXPA 3NVKI 3O0GA 4D5HA 4ZTMA 2QKWB 4DG3E 1RW8A 2X1NA 2CCHA 2XKEA 3MTLA 5HCXA 3ZSIA 3CTHA 3P08A 2RGPA 3LW0A 3D5UA 4M7IA 2IZRA 4DYMA 3MFRA 4FKWA 5L2QA 3BX5A 4IB1A 3RWQA 3AMAA 5J8IA 4FE2A 2C1AA 1ND4A 3B8QA 3V5LA 4R5YA 3WZJA 5KUPA 4FG7A 4BCQA 3CSVA 4PMSA 2WMWA 3ODZX 4X3JA 5I3OA 3G6HA 4G3DA 4DEAA 2W17A 4NZWB 2XIRA 3ZONA 3ANRA 4O6EA 4ZK5A 3HMPA 1H00A 4ZZOA 4QRCA 3UO6A 4GU6A 4L7SA 4FK6A 1OL6A 1XBBA 3Q53A 3QXPA 4CCUA 4ACCA 4RQVA 2JDOA 4GW8A 2PVNA 2BRMA 1X8BA 4MYGA 4Y8DA 4YJUA 4BCNA 4TL0A 3BEAA 3EQBA 4N6ZA 3BLHA 4MX9A 5A4CA 5DFPA 5D12A 1URCA 2GNHA 3GU7A 1FGIA 2R3LA 4U44A 4IWPA 4ZTQA 3KXNA 4MWHA 4MXOA 2WMUA 3E5AA 2VTOA 2I0YA 4M84A 4E26A 4EH6A 4IHPA 5HTIA 1IA8A 3U54A 4X6RA 5DYJA 3ZRMA 2FB8A 3ACKA 3UG1A 4QOXA 4WG3A 4LL0A 4AA5A 5BVFA 3GU5A 3KULA 1KOBA 3KXGA 2OJ9A 3OD6X 3FC1X 4X2KA 4AZFA 5AP6A 4EKLA 4L01A 4JI9A 5EHYA 1BYGA 3PXZA 2GTNA 4YMJA 4HCTA 4FV4A 3RZFA 2JAVA 3I6UA 3LMGA 5D10A 5D9HA 4CTBA 5CEOA 5CT7A 5ETFA 4ANLA 3UNJA 4BC6A 5KMIA 4DN5A 2GHLA 4PPBA 4FKRA 4ALUA 5KKRC 1TQPA 3SAYA 5EHOA 2Z02A 1Q8TA 1LUFA 3KFAA 4GU9A 4C36A 4DG0E 4FIJA 3NAXA 4NW6A 3W2RA 1R78A 3R71A 4EHVA 2F57A 4EK5A 2BKZA 3OY3A 5BMSA 2C6EA 2PYWA 5E1SA 2XNMA 2WZJA 4WOVA 4QP8A 5EQYA 4ZJVA 2HZIA 3E8EA 3K3IA 5EH0A 4BY9E 2R3RA 3BLRA 4DFUA 5IDPA 4B7TA 1B6CB 3L9LA 4AA0A 4ASZA 4EH9A 4R6VA 1WBNA 2WEVA 2GS2A 2I0EA 3DNDA 2OI4X 5IA5A 3CP9A 4RC3A 3QTRA 4O7LA 2HWPA 4R77A 3SXFA 1SMHA 4IX3A 4FTLA 4MHAA 4RFMA 3U6HA 5CF4A 2VWIA 3ZXTA 3EKNA 5AR3A 2RF9A 5C4KA 1Z5MA 3R01A 2JDRA 3QQJA 4PP7A 5I9YA 3B8RA 1OUYA 1R1WA 2W1FA 4RVTA 2BRHA 1XH8A 5HIEA 2JAMA 3H4JA 3FKOA 3OBJA 4H39A 3EWHA 5CAUA 3DBEA 4RWJA 5C27A 4S31A 2PE1A 1FBNA 5J1WA 4QNAA 3QX2A 3R28A 4ZIMA 5EKOA 4NCTA 4QPSA 4BCIA 4LQMA 3RALA 2R7IA 3DNEA 3TCPA 2ZMDA 4NM7A 5L2SA 2OGVA 4I0SA 2OJFE 5K5NA 1YDSE 4IB0A 4RFYA 3K5VA 2YIRA 3A7IA 5JN2A 3G2FA 2WQEA 4P5ZA 5IQGA 3WYYA 1XR1A 5CI7A 3FMEA 2QOKA 5CS6A 4MXYA 3OWJA 4M13A 4AS0A 4YZCA 3QXOA 3TV4A 3HNGA 5JK3A 4J96A 1WBOA 4H1JA 4Q9SA 3C51A 3FKLA 2UVYA 5EI6A 3BLQA 3FZSA 3JYAA 4JG6A 3VS4A 4ZLYA 3VUKA 4UYAA 1XJDA 2R9SA 1O6KA 2ZM4A 2UZWE 4ZLOA 2ACXA 3AMBA 3HP5A 2WO6A 3ROCA 2WPAA 5HE2A 3II5A 3TM0A 4KBAA 2Q83A 4CG9A 4HCUA 3NUUA 3A62A 5EM8A 3TDWA 3OOGA 1PMVA 2PE2A 4FSUA 2XM8A 3WF9A 4IX6A 3TNPC 4DFZE 3A7HA 3FEGA 2YZAA 2HIWA 1VJYA 2WGJA 4BFMA 1IA9A 5G1XA 2VTAA 4CFXA 2XIZA 3RK7A 1PXIA 4BZOA 4EYMA 4LG4A 4UN0C 3I4BA 1H1WA 2WTVA 4V0GB 3C5IA 3NNXA 2J7TA 2JDTA 3PUPA 3DBDA 4D4RA 2EVAA 3F3VA 3W8QA 3D2IA 2VWBA 3T9TA 2ITXA 4LGGA 3MV5A 3RAKA 4YO4A 4XH6A 5J5SA 5HVYA 3QLFA 4X2JA 3OWLA 1OPKA 2ZV9A 4LRJA 4M3QA 4BDKA 3F3UA 1YXXA 5AP3A 2JIVA 4C58A 5IUHA 5L2TA 2F2UA 3NPCA 5EG3A 1CDKA 2W99B 2W1CA 2FO0A 3EH9A 4I6QA 5AUWA 2A2AA 3U6JA 3W33A 4JIKA 1BI7A 5JEBA 2XJ1A 1OL2A 3MS9A 4L00A 4FT9A 4APPA 1GAGA 2VO7A 1J1BA 4PUZA 5EYMA 2X8EA 4IFGA 1YWRA 1VEBA 1YDTE 3CR0A 3NEWA 3P7BA 4O6LA 5J87A 3UC3A 5EYKA 3F61A 5E8VA 2C68A 1JSVA 1QL6A 3VBQA 4XP2A 4PY1A 4DT8A 3VS2A 3Q96A 4PRJA 4L46A 1GOLA 1Q41A 4K11A 2OSCA 2ONLC 3HEGA 4G3GA 3O23A 3HRFA 4U40A 2B9FA 5IQHA 3FMHA 2IZTA 2BIKB 3QKMA 4FV6A 1S9JA 2NPQA 2JITA 1KE5A 3LFBA 3MVHA 4U42A 4EJNA 3U87A 3VBWA 4KKGA 2JGZA 3AC3A 5FWKK 3UJGA 4TYIA 4O0TA 4FSMA 2C6OA 3FZPA 1P14A 3JS2A 4FVRA 2Y6OA 4RG0A 3UODA 3GXLA 5CF6A 3PSCA 4F9WA 3QC9A 4D28A 5JRSA 3BHVA 1M2RA 4IAIA 3MJ1A 4EOMA 1G8AA 4O0UA 3I0QA 3KXHA 2WTJA 4O0XA 3TUBA 4FIFA 3RZBA 5I5ZA 2DS1A 3E63A 2UW8A 2PL0A 2I7QA 1PKDA 3FZRA 3MFUA 4ANOA 2C6LA 4WNOA 3MESA 4XLIA 5CVHA 4ANBA 1GY3A 3RPVA 3FLSA 5E8YA 3FDNA 4K33A 2R3OA 5DG5A 4O7RA 4ORKA 2RFNA 5IA2A 4BCKA 1FQ1B 4FR4A 3IG7A 4U43A 2W96B 4PMTA 4EOSA 5HG7A 4YJVA 3MIAA 5KCVA 2IZUA 3FV8A 2OZAA 2RG6A 5HQ0A 4KS8A 4XV9A 2VNWA 3QCXA 4P4CA 3RCJA 2WU7A 3MB7A 3R9HA 1PYXA 4I22A 4ID7A 4TWNA 3REPA 1AGWA 4LMUA 5AIRA 3QTXA 4S34A 3VULA 2QG7A 3ZLSA 3CGOA 4O27B 4CKIA 4NTTA 3QWKA 3O71A 2XF0A 1F0QA 2XNNA 5DOSA 4MK0A 1J7UA 4DCAA 5K4JA 2X7GA 4X3FC 5B2LA 4AP7A 3QTWA 3FHIA 4JRNA 3NCGA 1OL7A 1NY3A 2BALA 4KWPA 4PMMA 5CY3A 5L8JA 2YFXA 4AZEA 2XS0A 4BCMA 4E5AX 1H01A 1PXKA 3O2MA 4FNWA 2OG8A 1QPEA 5HG5A 5HIDA 3R6XA 3V5QA 3WZUA 1NW1A 2GS7A 3AD5A 3IW5A 2C4GA 3IOPA 4IAYA 2YM7A 3WARA 2EU9A 4APCA 5AV0A 2H34A 1M14A 2W5HA 2ZDTA 4C4HA 1Q8WA 2PZYA 2QD9A 3ALNA 2BAKA 3JY0A 5HGIA 3IKAA 4IH8A 4L67A 2R2PA 5J7BA 4IACA 4RA4A 4GYGA 1FOTA 4QO9A 4G9RA 3FQEA 4GK3A 4M15A 2VWWA 3MDYA 2WU6A 4GFOA 4QQ5A 2V5QA 3MA6A 3KRJA 3NUNA 4QYHA 4QP9A 5IMEA 3UP2A 1JKKA 4IDTA 4ITIA 5D7AA 1G5SA 2C5VA 3BKBA 3D2KA 4MTAA 5AJQA 3VBVA 2RFSA 4AW2A 4BL1A 2X81A 5C26A 4RJ7A 5CEQA 2A19B 2OU7A 3H0YA 1OKYA 5IMXA 2C3JA 2XM9A 4IB3A 4U9AA 5IQEA 4M0YA 4WKQA 3ZDUA 4ZTHA 5KMJA 4PDOA 1REJA 4M69A 1M52A 3BGPA 5CENA 4WUNA 3A99A 4DH8A 4UWBA 5HO7A 5KHXA 2OBJA 3UC4A 3SC1A 3R8MA 3WF6A 4K6ZA 1LR4A 1JLUE 3DKGA 4LUEA 1OIUA 2YERA 3GGFA 4AF3A 2GSFA 4TYHB 4G9CA 5TE0A 5AUVA 5IDNA 4FTUA 4BRXA 3MBLA 4C4FA 5G6VA 4L3JA 4BCFA 4DITA 2ZAZA 5GIPE 2HW6A 1OI9A 2X39A 4E6AA 4Z55A 3TTJA 1MRUA 3BYUA 3R30A 3QYWA 2XK3A 1RDQE 1XHAA 3EN5A 4A4LA 2XIKA 3R04A 4DGNA 1YOMA 3ZEPA 2VWXA 3R7YA 4IFCA 3NWWA 4ASEA 2WOUA 5CU4A 4EH3A 4RLKA 4UYNA 4XP3A 4RX9A 3MFTA 4C38A 4MH7A 2V22A 1MQ4A 2J50A 1OL1A 4P90A 2RL5A 4XG6A 4Y85A 5FM3A 2YITA 2QOCA 4RQKA 3FXWA 4BDEA 4WO5A 4YSMA 3PG1A 4D9TA 4O1OA 5GZ8A 4PL5A 3AT2A 3DB8A 3V8SA 5KMLA 5AP1A 1PXPA 3UIMA 2J90A 4FV8A 4S32A 4D2TA 4F9CA 3FPQA 4AE9A 2F9GA 5L8KA 4FOBA 4FZAB 4LV5A 4EOIA 5K0XA 4LFIA 5H9BA 4ZY6A 5M08A 3BU3A 3DZQA 2J5FA 4ZJIA 4FV1A 3FI2A 2J4ZA 2LGCA 1SYKA 4IAKA 5M07A 3EQPA 4B99A 4EH5A 3COIA 5E7RA 3A8XA 4Q9ZA 4U7ZA 3NIEA 2ZV8A 5FXSA 3P79A 1KWPA 4USDA 4JG7A 3ZU7A 3HVCA 5KO1A 1PYEA 1HCLA 3U4UA 2VGPA 1OUKA 5EDQA 3OUNB 3RTPA 3EQFA 4KBKA 5LVLA 1PW2A 3P5KA 1RE8A 4CMOA 4E8AA 4HZSA 4S2ZA 4WSYA 2ZYBA 4ZTRA 2F49A 2QOLA 4NTSA 4JS8A 4QP2A 5KMOA 2R3HA 4F7SA 4EHEA 3FLYA 4CQGA 3CKXA 2QOBA 3B2WA 3DTCA 4KIKB 5DPVA 4ASXA 2Y0AA 3AT4A 3R7GA 3EB0A 2XRWA 4FZ6A 5E91A 5HIBA 3WZEA 3D83A 3AOXA 4UWYA 3L8SA 3ULIA 4FV0A 3CY3A 2QURA 3PE1A 1KE6A 4LGDA 5TF9A 3H9RA 4IXPA 4QMUA 3W10A 2FVDA 3P4KA 3V51A 4L3PA 4DH3A 4EH4A 5M57A 4PPCA 3CBLA 1F3MC 4JAIA 3CD3A 3ZO2A 3PYYA 3GCVA 2BRBA 4C02A 3TUDA 3ORIA 2P33A 4FL1A 5TR6A 3KRRA 3PXKA 4C8BA 5CU3A 3M42A 3ZRKA 5EOLA 3SW4A 4ZSLA 1NVRA 3GCUA 3QRTA 4PDPA 3VUDA 4CMUA 3FLWA 3QAME 3FPMA 3VF9A 2GDOA 2IVSA 3OC1A 4GJ3A 1JQHA 4I21A 2GQRA 5I4NA 2HZNA 3BE9A 2OH0E 1ZY5A 3HRCA 2LAVA 4ALWA 4ZJJA 3TNIA 4YJNA 5AUUA 4IZ7A 2XK6A 3T3VA 4FYNA 4DGMA 4LI5A 3GU8A 3RHXA 3FHRA 4Q5HA 2VX3A 2OIDA 2WTKB 3TNQB 4F6WA 3IDPA 5ANOA 3NCZA 4GK2A 3PVWA 1XH7A 2EWAA 4F0IA 2YIXA 3GFWA 4ONAA 2YAAA 4E20A 3KC3A 1K2PA 2OZOA 2XCKA 4WD5A 4MAOA 4EH2A 1K9AA 5LMBA 3C13A 3VS5A 2XIXA 5IQAA 3IONA 2QKRA 2ITNA 5CTPA 3OROA 2GMXA 1QPJA 4ANMA 4OAUC 4GKIA 5J95A 4QMNA 3OWPA 4WBBB 5EK7A 3A60A 4ZSEA 2UZLA 5AR4A 4PQNA 3V5WA 2WMAA 5EM5A 4RRVA 2JEDA 3QTIA 2XNOA 3FLZA 2VWZA 3S95A 3QZHA 3IDBA 4EH7A 3E8NA 2GFSA 3L8PA 3QTSA 5HX8A 4YUQA 2VU3A 3KK9A 1LP4A 4H36A 4DINA 4HVSA 4RWLA 5GJGA 4CTCA 2WMVA 1WBVA 4B9DA 2XB7A 3W55A 4C0TA 3NIZA 3R1NA 4O91A 4BI0A 2X2MA 3BBWA 3R63A 4J71A 4EEVA 3OXZA 2B9JA 4FT5A 3PZHA 1OIQA 2VTSA 4M66A 5HCZA 3PRIA 4K2RA 5T68A 3SLSA 3QGYA 1Y6AA 5CNOA 4GH2A 2HOGA 3FLNC 2X9EA 1OPLA 4RWIA 4ZY4A 3R02A 3KMWA 4MF0A 4S30A 2VGOA 4O21A 5AIKA 1NA7A 2HCKA 3K3JA 1I44A 4F63A 2PMNX 3ANQA 3DV3A 3LFSA 3QQGA 4R3CA 5AX3A 3VO3A 5IEXA 4O7SA 3R8UA 4UB7A 1H0VA 3V04A 1KOAA 1T45A 1ZZLA 2GS6A 2B55A 2O64A 3ORPA 3LZBA 4YBJA 3RM6A 3GEQA 3GC7A 5EQEA 5H8GA 5CF5A 3C50A 3PJCA 4I5MA 4V01A 3WZKA 1WBSA 5JFXA 2PY3A 4W4YA 1H1RA 4FL2A 1XBCA 4HGTA 2PMIA 3EQCA 2CGVA 2WQMA 2XP2A 4LM5A 1Q62A 4L68A 5BVOA 3MY0A 4IIRA 1YRPA 5JSMA 3EQIA 3QQLA 4AFJA 2OK1A 3DKOA 2UW9A 1WBPA 2YM4A 4GT3A 4CV9A 4EZ5A 5ETIA 4O0WA 4YO6A 2XEZA 5DWRA 3SVVA 2A1AB 4Y83A 4FI1A 1OPJA 4NM5A 3Q3BA 3D5VA 4DE4A 3ORKA 3LFAA 4FX3A 2IW9A 5DIAA 2W1IA 3COHA 2UZDA 4ACMA 3MH3A 3SXSA 2ITPA 4XG2A 2FSLX 3CIKA 2ONLA 2WQOA 5AMNA 3LXKA 3Q6UA 4AUAA 5KMKA 1NT2A 5FRIA 2WXVA 3RPRA 5AWMA 3Q5IA 3TNHA 4LRMA 4EUUA 4CG8A 3KEXA 3WF8A 4GV1A 4NUSA 4WBOA 3KA0A 3OW4A 1T46A 1KV2A 3D5WA 5GHVA 4U6RA 5TT7A 1NVSA 4FA2A 2ZMCA 3BIZA 5AAFA 3UE4A 2H96A 1JBPE 3L9MA 3PY0A 5BX0A 3LCDA 2PE0A 4E5BA 3LFDA 4G1WA 1LPUA 2J5EA 4AW0A 4BTMA 1U46A 2Z7RA 3U9NA 5LWMA 4QNYA 3JUHA 4KAOA 2PU8A 3P78A 4RSSA 5CZIA 3R7OA 2R3KA 3F3TA 1UV5A 4ZEGA 4XG4A 4RX5A 4FOCA 4TWOA 2R64A 3NUXA 2X4ZA 2BAJA 2HY0A 3DJ5A 1Y57A 4FTRA 1O6YA 2J6MA 1ZAOA 2QU6A 2BRGA 4ITJA 3RPYA 4D2SA 5FXQA 3W8LA 1WCCA 2VV9A 3C4WA 2ITTA 4GVAA 2UZVA 5GZAA 4OUCA 4FNYA 1ZYDA 4KKHA 1WVWA 4O0YA 5F9EA 1OIYA 3DQWA 3HV6A 2G15A 3D7TB 3UQGA 3AQVA 5A4EA 5CU0A 3G90X 4QD6A 3PWYA 3BHYA 4AAAA 5T3QA 3ORMA 5KX8A 5CXHA 2HW7A 4YC3A 4IVCA 3V8TA 3WF5A 4FKGA 3DS6A 3N51A 4HNIA 2B53A 2YIWA 4JQ8A 3RK9A 3I79A 4D2WA 5DEYA 2QO9A 1Q8UA 4O96A 3RNIA 4BGGA 4C4GA 5FUTA 4G3CA 2C3LA 2A0CX 2ITZA 1MRVA 1SVHA 4FKSA 5FLFA 4F99A 4YLJA 4RIWA 4RIWB 5IQCA 1W98A 1APME 5C01A 3OFMA 1XQZA 3FUPA 4JX7A 4C4EA 3AT3A 2J0LA 4X3FB 4X3FA 3TXOA 4A07A 4BCJA 2WMRA 4FKTA 5CSHA 3WE4A 1JSTA 3BYOA 2ZOQA 3BV2A 1R0PA 3A4OX 4FTQA 4QYYA 3B2TA 4YHFA 4E6CA 3F66A 3H9FA 3MI9A 3R8VA 3VC4A 3F5XA 4QQCA 5AFVA 2JDSA 4BWXA 3IECA 5M4IA 2XIYA 4GIHA 4YZNA 3W2SA 3L9PA 4DFXE 1XH5A 2PZIA 4H3BA 4PDSA 3R00A 5EDRA 3EFJA 3F69A 4M68A 1UWJA 4NKAA 4WRGA 4F9YA 5IUGA 3M11A 4GFGA 3TV7A 5BVWA 5HLNA 3GOPA 2ZJWA 2F4JA 2VTHA 3OY1A 2YIQA 5LCKA 5DLSA 3S4QA 5B7VA 2AYPA 3DXNA 5FGKA 5HESA 3QC4A 4HYHA 4IAZA 4CFVA 5CAVA 3FE3A 3ORXA 3UZPA 5IG1A 3K54A 4FV3A 4YJTA 5AP5A 1ZOGA 1R3CA 3HECA 3Q9ZA 2VTMA 5AV1A 4BIEA 4DG2E 4EZ3A 3I5ZA 4RLLA 1H1QA 4F6UA 4RPVA 3R9NA 1OGUA 3QCQA 5LOHA 4RIYA 4RIYB 3SDJA 4E6DA 4WSQA 3N4VA 3VJNA 3ULZA 3FAAA 3LCKA 4X2FA 4XS2A 3ZZWA 4FTJA 2R3QA 3PIZA 3ZFMA 3TI1A 4LRKA 2R3JA 5IEVA 1M2QA 2A4LA 2C0IA 4GVJA 2XYNA 5LJJA 2WD1A 4P2KA 5HE0A 4ZZNA 4MBJA 4TTHB 3ZUUA 2VWVA 4JNWA 4QMWA 3QGWA 4AACA 5BMMA 5DGZA 5BVEA 2WMQA 2Y6MA 2GNIA 4EQMA 2X8DA 4FG8A 4ANSA 5DMZA 4YJPA 1QCFA 3IW7A 3MSSA 1GNGA 3FMNA 3C9WA 3O8PA 1FMOE 4I92A 2OW3A 4N6YA 2C3IB 5FM2A 1LEZA 3RAIA 4B0GA 4YJRA 4FEXA 1YHVA 4E7WA 2FSOX 2W1ZA 1XH9A 4H3QA 1KV1A 4GFMA 4L45A 1W82A 2ETKA 2IN6A 1BMKA 3RINA 4GK4A 3HX4A 5FDPA 5HORA 4HVDA 3ZRLA 2OJIA 4E5WA 2YISA 4K8AA 4BI1A 2EUFB 5AR5A 2J9MA 2CJMA 3ZXZA 4EOKA 1URWA 3FJQE 4UMUA 4O22A 3R9RA 4BDIA 4FVPA 2BZKB 2JD5A 3PY1A 2WTKC 3KVWA 2XJ0A 4M14A 3PJ1A 3UOKA 2W05A 1GJOA 4W4XA 1CMKE 3P7AA 4MCVA 1XKKA 3LE6A 5E8TA 2GHGA 5HHWA 2R0UA 4UWCA 4BDHA 5IZFA 4E73A 5I0BA 2BCJA 2QR8A 4I0RA 4CFMA 2X0GA 2NNWB 3LM0A 4EBVA 1JKTA 5CVFA 4CMTA 2YA9A 3AC1A 4FL3A 3UQCA 3TZ8A 5H8BA 5ANJA 1V1KA 3DXQA 4PP9A 5BNJA 3COMA 2AC3A 4QMSA 3VQHA 1ZARA 5J1VA 4WG5A 4OLIA 4CFNA 1IG1A 1FVRA 2UW6A 3BZ3A 5ANKA 3HDNA 1H27A 5HD4A 4XYFA 4HPUE 3D4QA 1IASA 3BQRA 1GIJA 1VYZA 3NYVA 4X2GA 4Z16A 5FG8A 4YP8A 3C4ZA 1WZYA 3EYHA 2EXCX 2C5XA 4IMYA 2NO3A 4D1ZA 5EHLA 1UA2A 5BUEA 3FXZA 5AP2A 1YHSA 3GCPA 5M51A 1YI6A 3QYZA 2I0VA 3LJ0A 3LXLA 4F6SA 4AU8A 2W1GA 5A54A 1A06A 2OO8X 3A7GA 1CKPA 2WEIA 3V8WA 4CQEA 3FY2A 2PZRA 4EJ7A 5IU2A 3RKBA 2Z7SA 4DH5A 4QTCA 3QRIA 4G31A 2R5TA 2PVLA 3ATTA 1OBDA 3HUBA 2E2BA 4KABA 1Q8YA 4F65A 3PLAE 3IS5A 3RVGA 3BELA 1BI8A 3LCOA 3LQ5A 4V0GA 4WG4A 3MGYA 5IKWA 1H1PA 1OVEA 3OTUA 4TNBA 3VF8A 2PPQA 2PUUA 5ETCA 5BVNA 4YC6A 4RC4A 2Q0NA 5ICPA 4O84A 2ERZE 2O5KA 4GT5A 5HTCA 2O65A 3S0OA 3PVUA 5AADA 5AR2A 4DEIA 3LHJA 4OW8A 2F7XE 4G17A 4G2FA 4O38A 2VTJA 4TN6A 3EQHA 4DFYA 3CJFA 4EWHA 1PXJA 3F2AA 3VQUA 2PVJA 4R78A 3JY9A 3KN5A 4L3LA 5JMSA 1A48A 4K0YA 2HWOA 2W1EA 4PTGA 3IDCA 4IJPA 3KQ7A 4ERWA 3BYMA 2BDJA 2IVTA 5ANEA 5E4HA 4F1OA 3BQCA 3FYJX 1KE8A 4DT9A 4DGOA 4R5SA 1IAHA 4BDAA 1U5RA 2CLQA 4J7BA 2ZB0A 3D14A 3UZTA 3D0EA 4IC8A 3D94A 3AD6A 4I94A 3MPMA 4JIAA 2YCFA 3DK7A 4GG5A 4DF3A 2RSVA 5DR9A 4ALVA 5LXMA 5KMNA 3QTQA 3LLTA 1Q24A 3NNWA 3QQKA 4QTEA 4YU2A 5B2MA 3E3BX 3FZOA 3MYGA 4A9RA 5DN3A 3ZLYA 5HD7A 5AUZA 4KIOA 3MPAA 5HU3A 5I9VA 4CFWA 4UXLA 2R3MA 4DCEA 5AAGA 5BYLA 3IGOA 3GC8A 4DTBA 3EFLA 5HG9A 3FKNA 4JXFA 4D4SA 3SRVB 4CT1A 5AV2A 2UV2A 3MH1A 4FTCA 4TPTA 5HVJA 2BPMA 3BEGA 3LFCA 3CPCA 5HE1A 2W9ZB 4LOQA 1Q3DA 3ORLA 2YAKA 4YGAA 4PPAA 4I3ZA 3VJOA 4FIHA 3UQFA 3H30A 2NRUA 3F5GA 3TJDA 4D0XA 3UO4A 4GJ2A 3H3CA 4B8MA 3G5DA 4I4FA 2WIPA 4QMTA 2ZDUA 5L4QA 3PLSA 4IEBA 3BHTA 5E9EA 4PDYA 3DGKA 3VS6A 4EK8A 3PIXA 3MIYA 4H3PA 3VBXA 4DTAA 3CD8A 2FA2A 4FGBA 4MBIA 3R7VA 1VZOA 4TZRA 3LM5A 4NIFB 4TNDA 3GU4A 3DPKA 2W5AA 3TKIA 5C8KA 1OITA 4KRDA 2UZTA 4MXAA 5EOBA 3W16A 3ZDIA 3F2NA 4TWCA 3ZTXA 4U0IA 2J0JA 2GCDA 3KL8A 4TWPA 5GJFA 4QMVA 1PMUA 2CN5A 3HP2A 3ZUVA 1ZWSA 3V5TA 4AWIA 3FMKA 3BWFA 4YTCA 3N4UA 2RG5A 4ZMEA 2XMYA 3AC8A 4D9UA 2ITOA 1XBAA 3HMNA 2QC6A 3GFEA 4D55A 4MNFA 3FL4A 3QBNA 3IO7A 3IOKA 1Q61A 4S33A 2XA4A 3FSKA 4LOOA 5DRBA 3HRBA 4ZTNA 4PNIA 3UPXA 5BPYA 5M44A 3ZM9A 3KCKA 4FUYA 4IZAA 4XG3A 4JBVA 3TWJA 3TUCA 2VTNA 4QMXA 5KE0A 3CY2A 4YTFA 3ZMMA 3LJ1A 4EQCA 5HCYA 2YM6A 4FT3A 2W4OA 4UXQA 3JXWA 3UBDA 5I9XA 3C0HA 5HO6A 3ATSA 2CHLA 1QPCA 3OBGA 4I6BA 3ELJA 4B8LA 4F7LA 1FVTA 2GTMA 3F7WA 5DE2A 3G33A 2QOIA 4OTRA 5AM6A 2OFUA 2YLEA 1OBGA 5CI6A 3WOWA 3DZOA 1GZ8A 3SX9A 2V0DA 5DR6A 3WIGA 4YZ9A 2CKEA 5F1ZA 2ITQA 4ZAUA 5CANA 4FV2A 4NFMA 5CNNA 3GOKA 3QA0A 2VO3A 3ZEWA 4R1VA 4FUXA 2GPHA 3ZLWA 4W4VA 5L8LA 4BKZA 2ITYA 1M17A 1XWSA 4I5CA 4G34A 4NKSA 4C2WA 2ITWA 2R0IA 1FMKA 3RHKA 4FYOA 4HW7A 2BFYA 3C0IA 2JFMA 3ZS5A 3DCVA 3FI8A 4IVAA 5DHJA 3CS9A 3UYSA 3UMXA 4TY1A 2X6DA 2C6IA 3L9NA 4O0SA 4MD7E 2JKMA 1O9UA 2PVRA 5ANGA 1PKGA 3QRJA 1E1VA 3HV3A 3NNUA 4OGRA 5I9UA 4D4YA 3MTFA 3PJ2A 2B1PA 4W8DA 1SM2A 2YM8A 1H0WA 3L8XA 3V6RA 3ORNA 3FMDA 3ZBXA 1H28A 4CZUA 5JH6A 4CVAA 3QQFA 3WI6A 5IQBA 4U81A 4NEUA 3SXRA 5AA8A 4IX4A 5CEIA 4MWIA 2BVAA 3U55A 5DH3A 1PXLA 1H1SA 4FKUA 3OVVA 4TYHA 2G2FA 3T3UA 3GCQA 4YJQA 1G8SA 4EHGA 3H0ZA 5FXRA 5IEYA 4KNBA 5ANIA 1ERKA 2KULA 4AQCA 3PVBA 5D1JA 3ZC5A 3O8UA 3ZO4A 2WTCA 2C69A 2I1MA 4DFLA 2PMLX 5KNJA 2VTIA 3KRWA 4E6QA 2G9XA 4YZMA 1PY5A 3DBCA 4QMPA 4TRLA 4OTPA 3FBVA 2XZSA 3TL8A 4MD9E 4FEVA 2C0OA 3LOKA 2OXDA 2P55A 3R8PA 2WMXA 4YR8A 4L7FA 4C33A 4XEYA 4Y95A 4KIQA 4QYFA 4O0VA 3F6XA 5J9YA 3UVRA 2YDIA 4U45A 2OH4A 3OTVA 3KF7A 4QP7A 1DS5A 5ETAA 2BMCA 5CXZA 3O7LD 3ORZA 3ENMA 5IA4A 2DQ7X 3BWJA 4ARKA 4LGHA 3RPSA 5M4FA 3MVJA 5IH4A 5HLPA 4F0GA 4HGLA 3UMWA 4G5JA 4U41A 2W5BA 4EWQA 4DA5A 3ZO1A 3RM7A 2BKKA 3CJGA 3MVLA 1KUTA 1STCE 4IM3A 4BYJA 4HVGA 4GEOA 4G5PA 2YLFA 4TYGA 5DNRA 2W1HA 4LV8A 3UIBA 4JDIA 2XBJA 3VBYA 4C34A 1REKA 4FTIA 4FZ7A 4HYUA 4OTIA 4XHKB 3SKCA 4EOJA 4B6LA 4IBMA 1TQMA 3ZFYA 4BZDA 1AD5A 4QQTA 4FKPA 3E3PA 3FXXA 3LCTA 3MH0A 2OJGA 4FKIA 4P7EA 3T8OA 1YXTA 2VO0A 4FTAA 5HVKA 4V05A 4NW5A 4AW1A 3JVRA 3QL8A 3WYXA 5GZ9A 4DH1A 3G15A 2GU8A 4NU1A 2IW6A 4XOZA 5DT4A 5LVOA 2Z7QA 4KIKA 2IW8A 4NJDA 3UNZA 3UOJA 1UU7A 4D2RA 3RWPA 2JBOA 4QMLA 3CC6A 2O2UA 2C6KA 2XKCA 3QQHA 1V0OA 4PTEA 1PRYA 3ROYA 4QMOA 2UVZA 4BF2A 4FIIA 3ZO3A 5FTGA 2JFLA 3VW6A 2HZ4A 1UNLA 2JKKA 4USEA 2R3GA 4EK4A 2J0MB 3NYXA 4QQJA 5BUIA 2F2CB 4FKQA 3TZMA 3F82A 3C1XA 2DYLA 5AR8A 4CKJA 5IPJA 2QVSE 3BE2A 4HYIA 4K1BA 3TZ7A 5FP6A 2CKPA 2QONA 3NYOA 2Y4IB 2FSMX 2V7AA 3Q9XA 4IC7A 4RVLA 3QHWA 2J0KA 3W2OA 2FH9A 4E4NA 4WIHA 4FIGA 5FTQA 5B0XA 2O3PA 1ATPE 4XOYA 2GQGA 2H9VA 3LFFA 3LMHA 3COKA 4IADA 1OMWA 4EYJA 3Q9YA 2HXQA 5IQIA 4AZTA 4A9YA 2BFXA 5HO8A 4CXAA 3NGAA 4Y72A 2XK9A 4TKSA 4QPAA 4CFFA 4BBEA 1S9IA 3RJCA 4R7IA 4UV0A 1YHWA 4I4EA 2OWBA 4BI2A 1J91A 1Q3WA 2CDZA 4AX8A 3UO5A 4Q5EA 3Q2JA 3AD4A 3FI3A 3MFSA 3NW7A 2WNTA 3V5JA 3NSZA 1VYWA 2X8IA 1XO2B 3DBQA 3P9JA 4FNZA 4PWNA 4QYGA 5K4IA 1HOWA 3TKHA 2R3FA 1AQ1A 3BYVA 5CEKA 5CSVA 2CGUA 3FC2A 3F3ZA 1I09A 5GJDA 3AC5A 3M1SA 3OCTA 3PP1A 4F9BA 1OM1A 5KBRA 2UZOA 3MW1A 5D7VA 5AUYA 5DVRA 4PL3A 4L52A 5HEZA 2JIIA 3PXFA 2E9NA 2C6DA 3ODYX 4L8MA 1G3NA 2F7ZE 1TVOA 4M8TA 4AW5A 2QOFA 1OIRA 5JRQA 3DFCB 5HU9A 4O81A 2WOTA 3UNKA 1H26A 1MUOA 1ZYJA 2XRUA 3QHRA 2CSNA 5DI1A 5AX9A 4NL0A 2PVHA 4G3EA 1BL7A 3FL5A 4KS7A 4BZNA 5IH6A 5EW8A 1XH6A 4IW0A 1W7HA 4DH7A 3OCSA 4FTOA 5HNBA 5I9WA 3C4XA 4DFBA 2UW5A 4CFUA 5DT0A 3F7ZA 3TTIA 3AC4A 3Q4ZA 3QD3A 4HZRA 4IX5A 4L9IA 4YJSA 5EFQA 4CRLA 3E93A 3UG2A 4AT3A 5EM7A 4D2VA 2ZVAA 4DLJA 3A7JA 3Q5ZA 3AXWA 2RKUA 3IW8A 1YXSA 3NW5A 3O50A 4RZWA 4O7WA 5CYIA 4YPDA 2PWLA 4KKEA 1J3HA 4FSRA 4RVMA 4C7TA 1B39A 2EB2A 3OEZA 2REIA 1OKVA 3DBFA 5IISA 3KB7A 5LVMA 3OG7A 4HGSA 4RC2A 2P3GX 3FMMA 3HYHA 4CNHA 3KKVA 3QU0A 1UVRA 2YJRA 4XRLA 4QP6A 3VHKA 4E3CA 3HL7A 4FSTA 4A06A 4F7NA 4CSVA 4R3PA 1PMNA 4ACGA 3GNIB 1E1XA 3DKFA 4FTKA 4I20A 3DAKA 4IM2A 2VUWA 4BIBA 4RJ3A 3SA0A 4EC8A 1QMZA 4O7NA 1KSWA 4NJ3A 3D7ZA 4YBKA 5CF8A 1BKXA 3IGGA 4DEBA 3VIDA 4AZVA 4QTDA 3QZIA 5C4LA 2R4BA 3LFEA 4FF8A 3DB6A 1H25A 4EKKA 2B54A 3PPKA 2W9FB 2X4FA 3DQXA 3QF9A 2OF2A 4AGWA 5I3RA 4FKJA 3PFQA 5LWNA 3MPTA 5F95A 5GIOE 4KSQA 3KN6A 4OTFA 2CMWA 4KUJA 2W06A 3HMOA 3E8CA 4CD0A 3MY5A 3MB6A 3U6IA 1PMEA 4YZBA 5E1EA 3ZC6A 1SVGA 3UP7A 3QD2B 2R3IA 4QP1A 2YJSA 1IEPA 2W0JA 4Z9LA 3SD0A 5A6NA 5J9ZA 5ANDA 2ITUA 3P86A 4FICA 5JFVA 5BVDA 2WKMA 4TXCA 3UVPA 4EBWA 5AP7A 4F4PA 3C4FA 3S1HA 4BBFA 2C0TA 3R0TA 3VRYA 3C7QA 5CWZA 4RX8A 4QT1A 1YQJA 4ZSJA 3TG1A 1YI4A 2Q0BA 2OIBA 2O0UA 3AG9A 5DR2A 3JPVA 4IE9A 2YM3A 4J98A 2J0IA 4OTQA 5H8EA 2WTIA 2X2LA 3HUCA 4F70A 5ACBC 3NDMA 3C4EA 4FIEA 4DEHA 4F64A 2YZLA 3FMLA 1P5EA 3R1YA 3CEKA 3HDMA 5AAEA 3EN9A 3TIYA 4O7YA 3TNWA 1K3AA 3D7TA 1DAYA 3VHEA 3P23A 5LMAA 4O7ZA 3EN6A 4RX7A 4L53A 5HKMA 3WBLA 3E62A 3O7LB 1M2PA 2IWIA 3QD4A 5FEDA 4FT7A 5LMKC 4ERKA 4CRSA 5AP4A 3LXNA 3KVXA 3DTWA 1BUHA 4U97A 5FP5A 4O2ZA 3LQ3A 3R1QA 1WMKA 1Q97A 1JPAA 3PRFA 5CQUA 2XUUA 2XYUA 4Q2AA 3QA8A 4FTTA 1TQIA 3OF0A 3PZEA 2YCQA 4LMNA 4Y46A 4OTGA 4ZXTA 4ZS0A 4X0MA 4G6LA 1U59A 2DUVA 3I7BA 4BHNA 5AEPA 4I23A 2BR1A 4FZDB 3R8ZA 2ERKA 1A9UA 1Q8ZA 4V04A 3IW6A 4R7BA 5J9LA 2EXEA 1UU8A 5CSXA 4ANNA 5M4CA 4OBQA 2YM5A 3U4WA 3QCSA 2VTTA 3HKOA 4BDDA 2ZM1A 4FMQA 4C57A 2W4KA 3D15A 3EHAA 3W32A 1QPDA 2UVXA 4O83A 2B9IA 2H6DA 4HYSA 4D4VA 4K77A 3FZTA 2EXMA 3QKLA 3PSBA 3P7CA 2Y7JA 4O82A 3DAJA 3WZDA 2BUJA 3Q04A 5CEPA 2I6LA 2ETMA 3KCFA 3P1AA 3ZUTA 2UZBA 4QYEA 2BDFA 3EZVA 2HY81 5E92A 5JQ8A 5CEMA 2QG5A 4NM0A 3O17A 4W9WA 2YWVA 2XK7A 3W2PA 3G9LX 2C1BA 3ACJA 2ITVA 4E4XA 1FPUA 2UW3A 5JKGA 4K18A 4CEGA 4MQ2A 1Y8GA 2Y8OA 3GBZA 4IB5A 3GQIA 4JDHA 4Y5QA 4QTAA 5L6OA 2XKFA 3JVSA 4JG8A 4Z3VA 4RGJA 1PHKA 4C59A 4U80A 4BGHA 5IA0A 3QZGA 5I9ZA 3E88A 3BBTB 3DLSA 1UNGA 2V55A 5DRDA 4DGLC 3RAWA 4YLKA 2BHEA 3BHHA 1FINA 4MXZA 1JWHA 3OZ6A 3EOCA 2JKOA 4C61A 2BTSA 2UW4A 3ETAA 4RWKA 5BVKA 3CPBA 4IQ6A 2WMBA 3EYGA 5LQFA 4UMQA 2OICA 3QCYA 4OT6A 3HV5A 4C4IA 2PUNA 1HCKA 1MP8A 4CGAA 2ESMA 2QCSA 3KULB 3PPZA 1WAKA 4FSYA 1H07A 3CCNA 3BPRA 2ZV2A 4YLLA 1GZOA 5KZIA 3FQSA 4N57A 1MQBA 1OECA 2B52A 4XMOA 2C5OA 4XBRA 5HOAA 1ZXEA 3V5PA 4BCGA 4JBQA 2PVKA 4O1PA 3RNYA 1FVVA 2Y4IC 1Q5KA 4PV0A 1ZMVA 5HBJA 2V7OA 4JR3A 3TEIA 3R9DA 5HX6A 4DHFA 5JZJA 2DWBA 4YZDA 3BCEA 5FEQA 4AGCA 4H05A 4JQ7A 3F2RA 2UZNA 5LCJA 4RJ4A 4QMMA 3ZZEA 3LMIA 3I60A 4YNOA 4J99A 3OOMA 4L6QA 2YWPA 2HAKA 1DI8A 4NFNA 4A9TA 4BBMA 2AC5A 3TT0A 2WQNA 5HG8A 3OW3A 1F5QA 3QRKA 4FBXA 4GMYA 4OTDA 4BYIA 5BQ0A 2Y9QA 3GENA 2QU5A 3EQDA 4FEQA 3NUAA 2P0CA 4YHTA 5M53A 3QKKA 3Q4UA 4JBOA 1LEWA 4BDGA 1O6LA 1BX6A 3MH2A 5CU2A 3FI4A 3VAPA 4EK3A 4BVUA 4EOQA 4BCHA 3OUKA 3PVGA 3NR9A 2BROA 4EI4A 3QUEA 3HLLA 5C9CA 5JGDA 2C5YA 2V62A 4MF1A 3RK5A 4CYJA 4QMQA 4KA3A 1M7NA 1R39A 2CNVA 4XX9A 2QNJA 4FVQA 4U5JA 4Y73A 4EHZA 2G01A 5GINE 3A61A 3C5UA 3LJ2A 2XEYA 3DKCA 5F4NA 4BB4A 3DA6A 3G0EA 4BCPA 3SG8A 2QR7A 4JX3A 3UIUA 4Z7HA 3KF4A 2VAGA 3QLGA 3NZ0A 3CQWA 1ZMUA 4RMZA 4OTWA 4CLJA 5B2KA 4DFNA 3PP0A 3E92A 3PA5A 4JT3A 3VVHA 3HGKA 1UWHA 2XNEA 4W9XA 4G6NA 3SHEA 2I40A 2HENA 4ANQA 4R7HA 4FV9A 4AN2A 3POOA 3IK3A 3QALE 4AZWA 2Z7LA 4BDJA 1JVPP 2BIYA 5E8UA 1V0BA 1EH4A 2WAJA 2VO6A 3TJCA 4NT4A 3JR1A 2CCIA 3IW4A 4BIDA 5AA9A 3NVMB 3A2CA 4RIOA 2BAQA 4GT4A 4IWQA 3NUSA 4FK3A 1H4LA 3BU6A 5F94A 5E8ZA 1M7QA 5JQ5A 4DBXA 4GS6A 4KIPA 5KBQA 2GNGA 4NK9A 2P2IA 2NRYA 4QMYA 5DEWA 4XRJA 1YWNA 1YOJA 3Q9WA 4CT2A 4GRBA 4RA5A 5AP0A 3H9OA 2X7FA 3O51A 2JKQA 3R83A 4Z7GA 1DAWA 4ZSGA 2ZV7A 3VUGA 4G16A 2R7BA 4TW9A 3OT8A 3NNVA 2GHMA 3TIZA 5CAQA 1Z57A 5A3XA 2IZSA 4KD1A 4EC9A 1GIHA 3FY0A 3KMMA 4FTNA 1H24A 1Y6BA 4UEUA 2JC6A 5FQDC 3R7UA 3UOHA 1H08A 2CKQA 1B38A 2YEXA 2VWUA 4ZMFA 3NRMA 4ACHA 5IUIA 2XNPA 2QO7A 4OTHA 4RJ8A 4KB8A 3ALOA 4MXCA 3TN8A 3ZHPC 3SG9A 4MVFA 1CKJA 3VS0A 5M56A 2WQBA 4I6FA 3R2YA 3N4TA 4IZ5A 2FUMA 2OF4A 5H3QA 3U9CA 3ENHA 4WNKA 2BILB 4FTMA 4ENYA 3C0GA 2IPXA 1R0EA 1WVYA 4EOLA 1L3RE 3FWQA 2VNYA 3FMJA 3QD0A 4ZY5A 5M06A 1GZKA 2WMTA 1ZZ2A 3UYTA 4IANA 4O7TA 4JDJA 4LUDA 5M55A 3OS3A 3NX8A 4BICA 4PNKA 5HI2A 4JRVA 3D9VA 3QZFA 4YTHA 4H58A 4IAFA 4HOKA 1JKSA 3MVMA 3ERKA 2UUEA 4AGDA 3R21A 3VS1A 2C47A 3Q52A 1WFCA 2BRNA 4JR7A 1Y91A 4FT0A 3SRVA 2VX0A 3G6GA 4YC8A 1TKIA 4OAVB 5IQFA 1SNUA 3NAYA 3MA3A 3UGCA 2UZUE 4II5A 4A4XA 3C4CA 2WELA 2WFYA 2J51A 2QODA 1MRYA 2VRXA 4WHZA 3ZSGA 3HV7A 4CKRA 4CLIA 3FZ1A 3R7EA 4DEDA 5EDPA 4I1ZA 3WILA 3DDQA 4DLIA 5L3AA 3LPBA 3S00A 3WIKA 2PUIA 3ZCLA 3AC2A 4CCBA 5CSWA 4KRCA 2YIYA 3BGQA 3EL7A 3UOLA 3EN4A 5J7HA 3K5UA 3Q6WA 5HTBA 2KTYA 2QLUA 2XH5A 2PSQA 3I1AA 3KRXA 4NIFA 2GNJA 4QTBA 2C3KA 3CKWA 3RAHA 3VNTA 4RVKA 4XNEA 3VUHA 4XCUA 2RFDA 4YPSA 5JFSA 4WNPA 4I41A 3GP0A 3KXZA 4WUAA 4NYEA 4YNEA 3TZ9A 2OFVA 2E9VA 3KMUA 2IVVA 4EORA 1VR2A 5CX9A 4A9UA 4EH8A 2VN9A 4AN3A 3HA8A 3P0MA 3U51A 3R7IA 4D2PA 1Q4LA 3HMMA 3KY2A 3R73A 2Z60A 4K9YA 3EKKA 4RIXA 4RIXB 4BCOA 4X6QC 5C8NA 4AXAA 3GQLA 3MN3A 4FSZA 1IR3A 2VZ6A 3ZOSA 5KMMA 4PTCA 3O96A 2E9UA 5E90A 4FC0A 1U4DA 2OZAB 1JSUA 2B9HA 2X6EA 2XBAA 3SV0A 4C3FA 3NS9A 5EYCA 1UKIA 5DT3A 4R8QA 2GNLA 2IG7A 3E87A 4IDVA 4Y5HA 4WRSA 2Y4PA 2AUHA 4EQUA 2BHHA 1ZRZA 3F5UA 2ZM3A 4UBAA 3GC9A 3L1SA 4HJOA 4DGGA 4YURA 4HCVA 5J79A 2W7XA 1CKIA 5C03A 3PXQA 5A4TA 4RFZA 4W8EA 2YDKA 4IAAA 4RJ5A 4BGQA 1H8FA 5C1QB 4A4OA 4O7VA 5KZ0A 3PIYA 4FKOA 4ZOGA 3I0OA 4I0TA 5CALA 3DLZA 5CQWA 5CAOA 1JNKA 3PPJA 3KXMA 4CZYB 1DI9A 3W2CA 3BYSA 4EL9A 3CQUA 4M97A 3GU6A 4EONA 3DK3A 3DFAA 4QP4A 4YHJA 3DAEA 3DJ7A 3FQHA 3W1FA 4ZS4A 3TDVA 3VUTA 1XH4A 3NW6A 3SOAA 3RI1A 4D58A 2F7EE 5LARA 3VRZA 5AV4A 5IH5A 3ID6C 2GNFA 3TACA 3I81A 3A4PA 3BHUA 4PF4A 3HAMA 1W84A 5D11A 3AMYA 5D41A 3PJ3A 3LAUA 4AG8A 2VTLA 3PWDA 4F1TA 2QOOA 3F9NA 4ENXA 5A4QA 4H1MA 4C4JA 3E8DA 5HICA 3ZLXA 4AT4A 3I6WA 1PXNA 2X2KA 3OWKA 3QUDA 4JLCA 4LYNA 5HBEA 4AFEA 2PZ5A 3OXIA 5LMKA 2OXXA 4FODA 1PXMA 2GQSA 5CAPA 3A7FA 3ZH8A 5H2UA 3Q4CA 4XLVA 3EIDA 2WTWA 1BLXA 2VTRA 5BYZA 4FSWA 5KHWA 2C5NA 3D5XA 4MXXA 1IAJA 2GFCA 1YXUA 2OIQA 4XG9A 3VUMA 4UMPA 4M69B 5A46A 3S3IA 4FEUA 1YXVA 2C6TA 3RP9A 1NXKA 1JAMA 1OZ1A 3CE3A 4AGUA 3FLQA 3ZBFA 4J52A 2IO6A 3CLYA 3OEFX 4BHZA 2ETRA 3RGFA 4BR3A 3IPHA 1U5QA 2PTKA 3E64A 2XK4A 2BZIB 4C2VA 2VX1A 5TO8A 4OT5A 3V3VA 4XV1A 3R22A 2VD5A 2CLXA 3F5PA 3OXTA 4RJ6A 2H8HA 3ZSHA 3UZRA 4AZSA 2QO2A 4R1YA 4BWKA 3MWUA 1ZYLA 3ZM4A 3U8WA 4BWPA 4NM3A 5IA3A 2QQ7A 4E93A 2XCHA 3VBTA 2YCRA 3CQEA 3GI3A 4F08A 4HVHA 1JOWB 4KINA 5EQPA 4BKJA 4FGRA 3LQ8A 3R1SA 4IM0A 5HNIX 2XVDA 5K0KA 2YACA 2BZHB 3KXXA 4GYIA 2YCSA 3W2QA 4FV7A 4AN9A 1CM8A 1PJKA 5K5XA 4JJRA 4I6HA 2IVUA 2XNBA 4AOTA 1YW2A 3HZTA 3AGLA 4I5PA 4F9AA 3BU5A 4AOIA 4F09A 4ZLZA 4UX9A 3KRLA 5CSPA 4HVIA 3PXYA 5DBXA 3Q32A 2VTQA 3PTGA 4DC2A 5EM6A 4NCTC 1YI3A 1OL5A 4N0SA 3UPZA 3BGZA 3GVUA 3VW8A 4GKHA 2CPKE 3Q4TA 1UKHA 5HE3A 2OLCA 1CSNA 4FKLA 2W1DA 3PA4A 2QOHA 2Z2WA 4XP0A 3PDTA 4XV3A 4I93A 2QHNA 2Z8CA 4O0RA 4P5QA 3R2BA 2QLQA 3GT8A 1YDRE 2FYSA 4TYEA 3CGFA 1ZYSA 4BDCA 4MEDA 5GNKA 1GIIA 2E9OA 3PG3A 3VS3A 2BZJA 4D1XA 3RPOA 3UIXA 3EFWA 4R3RA 2FGIA 4HPTE 3UDBA 2B7AA 4C3RA 1J7IA 5FEEA 3LVPA 1L8TA 1UU9A 3VN9A 4DAWA 1PXOA 3QTZA 1OB3A 3EZRA 1PF8A 3KREA 4MD8E 4BDBA 4FSNA 4DEGA 3TKUA 3RBWA 3NMUF 3QUPA 5FD2A 3GUBA 5AR7A 4X2NA 4JVGA 3E7VA 4UZHA 4J8NA 2P4IA 5AUXA 5C8MA 3F88A 3R9OA 3ITZA 4D5KA 2CNUA 1ZLTA 3EJ1A 4J95A 1J1CA 2OXYA 4FKVA 3VS7A 5KKRB 5HZNA 2J2IB 5CU6A 3BV3A 1WBWA 3L8VA 3MY1A 5AV3A 2XK8A 4A9SA 1YVJA 4AE6A 5F20A 2OJJA 4C62A 3SW7A 1SVEA 4ACDA 3OCBA 4MBLA 4WA9A 4BKYA 2XJ2A 4QP3A 5L2IA 2PHKA 4HGEA 3PY3A 3POZA 2X9FA 2FSTX 2I0HA 3NYNA 2VTPA 5ACKA 2CN8A 3QWJA 4G3FA 5A4LA 4AOJA 1DM2A 4M12A 5EKNA 3HAVA 3OT3A 3V01A 2SRCA 5ITAA 4ITHA 2WMSA 1CTPE 3GCSA 5A6OA 3FSFA 5DA3A 5IA1A 2OKRA 3DU8A 4U3ZA 4BTKA 5K9IA 4B4LA 4N4SA 4ZTSA 4F0FA 4EOOA 3M2WA 4M67A 4IZYA 4CYIA 3SGCA 2UW7A 2P2HA 3HV4A 4GUEA 3HA6A 2B4SB 3OP5A 2QOQA 3NLBA 5EW3A 4J97A 4MKCA 4YJOA 4A7CA 4AA4A 2PULA 3KGAA 4IWDA 5M09A 3EQGA 3GB2A 4JBPA 2A27A 4TYJA 5AUTA 2PUPA 4BTJA 1ZMWA 3DOGA 4DEEA 3O8TA 4ZZMA 3AGMA 1J7LA 4JDKA 5A9UA 2YN8A 4PX6A 5E8WA 3T9IA 4LL5A 3DT1A 4LOPA 2YDJA 3W18A 3DJ6A 3E7OA 4C37A 3WF7A 2QHMA 4OBOA 2O63A 3PE2A 2RIOA 2PK9A 1Q99A 3MJ2A 3LIJA 3EMGA 2X7OA 4E4LA 3LFNA 4QMZA 3Q2MA 1E9HA 2O8YA 2HXLA 5FDXA 1Z9XA
chains in the Genus database with same CATH superfamily
3IQ7A 2HYYA 1W83A 5K3YA 1WBTA 2JDVA 5HLWA 5TKDA 1YWVA 2JBPA 2NP8A 2C30A 4PMPA 4XJ0A 4FEWA 2QI8A 3QTUA 4JL9A 4L44A 5HBHA 4IJ9A 3W0RA 1NVQA 3KK8A 5EI2A 2WIHA 3K2LA 4U8ZA 4WNMA 3RCDA 4L43A 1BL6A 2BDWA 2XNGA 4UZDA 3PA3A 3GC0A 4UMRA 1XMMA 3PSDA 4I5HA 4GIIA 4GCJA 4IWOA 4NWMA 4UMTA 4FNXA 2CKOA 4DHIB 2UW0A 3V6SA 2PMOX 2JIUA 1IRKA 5EYDA 2C6MA 3G0FA 3LKMA 2HK5A 2G2IA 4BDFA 5JGBA 4RZVA 5A14A 3VWAA 2G2HA 4F1MA 3I5NA 5LVNA 4GG7A 5BYYA 4GL9A 3Q60A 5FBOA 3UTOA 4MNEA 4MNEB 3QX4A 4W4WA 4JAJA 2AQXA 5CZHA 4ASDA 2CNQA 4C35A 1UU3A 4O86A 4YSJA 4FV5A 3BI6A 5IQDA 4M0ZA 2YHVA 1W0XC 2JLDA 3OMVA 1FGKA 2XKDA 2PZPA 1UNHA 1ZOEA 4E4MA 4MQ1A 3S2PA 3LLAA 3PXRA 2EB3A 1RJBA 3G51A 5AM7A 3BL9A 4KBCA 4WT6A 1GZNA 4J1RA 3BRBA 5E8XA 4BTFA 1WVXA 4U3YA 4AT5A 5CVGA 5JT2A 4I24A 2YABA 4X21A 5LVPA 2E9PA 2PVFA 4ZTLA 4DBNA 4X7QA 4N70A 4G6OA 3R8LA 2G1TA 3RMFA 4TT7A 5JZNA 4XBUA 1Y8YA 3ORTA 4KSPA 5EW9A 4ZSAA 3EL8A 2UZEA 1ZOHA 1P2AA 3SOCA 3ZYAA 4D1SA 4CV8A 3QRUA 3CXWA 4C3PA 5L2WA 4EUTA 4IVBA 4O2PA 5CT0A 1SZMA 4OBPA 4YTIA 3THBA 3OCGA 4E1ZA 5FTOA 5FBNC 4EZ7A 3KU2A 2B0QA 1ZY4A 4U79A 3FYKX 5L6WL 1KE7A 4JOAA 4QPMA 5HNGA 1YKRA 3G9NA 4BN1A 2IJMA 4L42A 2HELA 1JKLA 3EQRA 4NSTA 3QFVA 2WHBA 4XUFA 2HZ0A 1KE9A 2RFEA 4F7JA 4XG7A 5BUJA 3DXPA 3HMIA 4IVDA 4UALA 2R3NA 1V0PA 3OHTA 1W8CA 3EFKA 3QQUA 3TV6A 4PL4A 3W0OA 3F3WA 4HNFA 1OKZA 3A8WA 5L6PA 4OR5A 4ZP5A 4GSBA 3UVQA 1P4OA 1SNXA 5TOZA 4JQEA 3DK6A 4GUBA 2PVMA 2BTRA 3ET7A 4FZFB 4XG8A 4DTKA 4USFA 1OKWA 3EN7A 3ZFXA 3N9XA 2W4JA 4J53A 4J8MA 4FSQA 4D0WA 2VWYA 4UY9A 5J5TA 3DDPA 5M4UA 2WB8A 3VUIA 5JFWA 1YOLA 2CGXA 4NH1A 4EK6A 3SQQA 3DY7A 3LFQA 4DDGA 1RQQA 3NUYA 3CTQA 3WE8A 1ZYCA 3H10A 3I7CA 4RBLA 5EI8A 3NUPA 5CLPA 5E8SA 4CZTA 4EOPA 1P4FA 2WTDA 3LCSA 5IF1A 4FG9A 3CTJA 1U54A 1U54B 2CGWA 3PJ8A 4RT7A 2PVYA 4XV2A 2R3PA 5CASA 2ZB1A 5T6KA 5JGAA 3LXPA 3NVKI 3O0GA 4D5HA 4ZTMA 2QKWB 4DG3E 1RW8A 2X1NA 2CCHA 2XKEA 3MTLA 5HCXA 3ZSIA 3CTHA 3P08A 3AKLA 2RGPA 3LW0A 2X0OA 3D5UA 4M7IA 2IZRA 4DYMA 3MFRA 4FKWA 5L2QA 3BX5A 4IB1A 3RWQA 3AMAA 5J8IA 4FE2A 2C1AA 1ND4A 3B8QA 3V5LA 4R5YA 3WZJA 5KUPA 4FG7A 4BCQA 3CSVA 4PMSA 2WMWA 3ODZX 4X3JA 5I3OA 3G6HA 4G3DA 4DEAA 2W17A 4NZWB 2XIRA 3ZONA 3ANRA 4O6EA 4ZK5A 3HMPA 1H00A 4ZZOA 4QRCA 3UO6A 4GU6A 4L7SA 4FK6A 1OL6A 1XBBA 3Q53A 3QXPA 4CCUA 4ACCA 4RQVA 2JDOA 4GW8A 2PVNA 2BRMA 1X8BA 4MYGA 4Y8DA 4YJUA 4BCNA 4TL0A 3BEAA 3EQBA 4N6ZA 3BLHA 4MX9A 5A4CA 5DFPA 5D12A 1URCA 2GNHA 3GU7A 1FGIA 2R3LA 4U44A 3W0NA 4IWPA 4ZTQA 3KXNA 4MWHA 4MXOA 2WMUA 3E5AA 2VTOA 2I0YA 4M84A 4E26A 4EH6A 4IHPA 5HTIA 1IA8A 3U54A 4X6RA 5DYJA 3ZRMA 2FB8A 3ACKA 3UG1A 4QOXA 4WG3A 4LL0A 4AA5A 5BVFA 3GU5A 3KULA 1KOBA 3KXGA 2OJ9A 3OD6X 3FC1X 4X2KA 4AZFA 5AP6A 4EKLA 4L01A 4JI9A 5EHYA 1BYGA 3PXZA 2GTNA 4YMJA 4HCTA 4FV4A 3RZFA 2JAVA 3I6UA 3LMGA 5D10A 5D9HA 4CTBA 5CEOA 5CT7A 5ETFA 4ANLA 3UNJA 4BC6A 5KMIA 4DN5A 2GHLA 4PPBA 4FKRA 4ALUA 5KKRC 1TQPA 3SAYA 5EHOA 2Z02A 1Q8TA 1LUFA 3KFAA 4GU9A 4C36A 4DG0E 4FIJA 3NAXA 4NW6A 3W2RA 1R78A 3R71A 4EHVA 2F57A 4EK5A 2BKZA 3OY3A 5BMSA 2C6EA 2PYWA 5E1SA 2XNMA 2WZJA 4WOVA 4QP8A 5EQYA 4ZJVA 2HZIA 3E8EA 3K3IA 5EH0A 4BY9E 2R3RA 3BLRA 4DFUA 5IDPA 4B7TA 1B6CB 3L9LA 4AA0A 4ASZA 4EH9A 4R6VA 1WBNA 2WEVA 2GS2A 2I0EA 3DNDA 2OI4X 5IA5A 3CP9A 4RC3A 3QTRA 4O7LA 2HWPA 4R77A 3SXFA 1SMHA 4IX3A 4FTLA 4MHAA 4RFMA 3U6HA 5CF4A 3VONA 2VWIA 3TYKA 3ZXTA 3EKNA 5AR3A 2RF9A 5C4KA 1Z5MA 3R01A 2JDRA 3QQJA 4PP7A 5I9YA 3B8RA 1OUYA 1R1WA 3ML1A 2W1FA 4RVTA 2BRHA 1XH8A 5HIEA 2JAMA 3H4JA 3FKOA 3OBJA 4H39A 3EWHA 5CAUA 3DBEA 4RWJA 5C27A 4S31A 2PE1A 1FBNA 5J1WA 4QNAA 3QX2A 3R28A 4ZIMA 5EKOA 4NCTA 4QPSA 4BCIA 4LQMA 3RALA 2R7IA 3DNEA 3TCPA 2ZMDA 4NM7A 5L2SA 2OGVA 4I0SA 2OJFE 5K5NA 1YDSE 4IB0A 4RFYA 3K5VA 2YIRA 3A7IA 5JN2A 3G2FA 2WQEA 4P5ZA 5IQGA 3WYYA 1XR1A 5CI7A 3FMEA 2QOKA 5CS6A 4MXYA 3OWJA 4M13A 4AS0A 4YZCA 3QXOA 3TV4A 3HNGA 5JK3A 4J96A 1WBOA 4H1JA 4Q9SA 3C51A 3FKLA 2UVYA 5EI6A 3BLQA 3FZSA 3JYAA 4JG6A 3VS4A 4ZLYA 3VUKA 4UYAA 1XJDA 2R9SA 1O6KA 2ZM4A 2UZWE 4ZLOA 2ACXA 3AMBA 3HP5A 2WO6A 3ROCA 2WPAA 5HE2A 3II5A 3TM0A 4KBAA 2Q83A 4CG9A 4HCUA 3NUUA 3A62A 5EM8A 3TDWA 3OOGA 1PMVA 2PE2A 4FSUA 2XM8A 3WF9A 4IX6A 3TNPC 4DFZE 3A7HA 3FEGA 2YZAA 2HIWA 1VJYA 2WGJA 4BFMA 1IA9A 5G1XA 2VTAA 4CFXA 2XIZA 3RK7A 1PXIA 4BZOA 4EYMA 4LG4A 4UN0C 3I4BA 1H1WA 2WTVA 4V0GB 3C5IA 3NNXA 2J7TA 2JDTA 3PUPA 3DBDA 4D4RA 2EVAA 3F3VA 3W8QA 4MUQA 3D2IA 2VWBA 3T9TA 2ITXA 4LGGA 3MV5A 3RAKA 4YO4A 4XH6A 5J5SA 5HVYA 3QLFA 4X2JA 3OWLA 1OPKA 2ZV9A 4LRJA 4M3QA 4BDKA 3TMOA 3F3UA 1YXXA 5AP3A 2JIVA 4C58A 5IUHA 5L2TA 2F2UA 3NPCA 5EG3A 1CDKA 2W99B 2W1CA 2FO0A 3EH9A 4I6QA 5AUWA 2A2AA 3U6JA 3W33A 4JIKA 1BI7A 5JEBA 2XJ1A 1OL2A 3MS9A 4L00A 4FT9A 4APPA 1GAGA 2VO7A 1J1BA 4PUZA 5EYMA 2X8EA 4IFGA 1YWRA 1VEBA 1YDTE 3CR0A 3NEWA 3P7BA 4O6LA 5J87A 3UC3A 5EYKA 3F61A 5E8VA 2C68A 1JSVA 1QL6A 3VBQA 4XP2A 4PY1A 4DT8A 3VS2A 3Q96A 4PRJA 4L46A 1GOLA 1Q41A 4K11A 2OSCA 2ONLC 3HEGA 4G3GA 3O23A 3HRFA 4U40A 2B9FA 5IQHA 3FMHA 2IZTA 2BIKB 3QKMA 4FV6A 1S9JA 2NPQA 2JITA 1KE5A 3LFBA 3MVHA 4U42A 4EJNA 3U87A 3VBWA 4KKGA 2JGZA 3AC3A 5FWKK 3UJGA 4TYIA 4O0TA 4FSMA 2C6OA 3FZPA 1P14A 3JS2A 4FVRA 2Y6OA 3P5JC 4RG0A 3UODA 3GXLA 5CF6A 3PSCA 4F9WA 3QC9A 4D28A 5JRSA 3BHVA 1M2RA 4IAIA 3MJ1A 4EOMA 1G8AA 4O0UA 3I0QA 3KXHA 2WTJA 4O0XA 3TUBA 4FIFA 3RZBA 5I5ZA 2DS1A 3E63A 2UW8A 2PL0A 2I7QA 1PKDA 4FJVA 3FZRA 3MFUA 4ANOA 2C6LA 4WNOA 3MESA 4XLIA 5CVHA 4ANBA 1GY3A 3RPVA 3FLSA 5E8YA 3FDNA 4K33A 2R3OA 5DG5A 4O7RA 4ORKA 2RFNA 5IA2A 4BCKA 1FQ1B 4FR4A 3IG7A 4U43A 2W96B 4PMTA 4EOSA 5HG7A 4YJVA 3MIAA 5KCVA 2IZUA 3FV8A 2OZAA 2RG6A 5HQ0A 4KS8A 4XV9A 2VNWA 3QCXA 4P4CA 3RCJA 2WU7A 3MB7A 3R9HA 1PYXA 4I22A 4ID7A 4TWNA 3REPA 1AGWA 4LMUA 5AIRA 3QTXA 4S34A 3VULA 2QG7A 3ZLSA 3CGOA 4O27B 4CKIA 4NTTA 3QWKA 3O71A 2XF0A 1F0QA 2XNNA 5DOSA 4MK0A 1J7UA 4DCAA 5K4JA 2X7GA 4X3FC 5B2LA 4AP7A 3QTWA 3FHIA 4JRNA 3NCGA 1OL7A 1NY3A 2BALA 4KWPA 4PMMA 5CY3A 5L8JA 2YFXA 4AZEA 2XS0A 4BCMA 4E5AX 1H01A 1PXKA 3O2MA 4FNWA 2OG8A 1QPEA 5HG5A 4AAYA 5HIDA 3R6XA 3V5QA 3WZUA 1NW1A 2GS7A 3AD5A 3IW5A 2C4GA 3IOPA 4IAYA 2YM7A 3WARA 2EU9A 4APCA 5AV0A 2H34A 1M14A 2W5HA 2ZDTA 4C4HA 1Q8WA 2PZYA 2QD9A 3ALNA 2BAKA 3JY0A 5HGIA 3IKAA 4IH8A 4L67A 2R2PA 5J7BA 4DHZA 4IACA 4RA4A 4GYGA 1FOTA 4QO9A 4G9RA 3FQEA 4GK3A 4M15A 2VWWA 3MDYA 2WU6A 4GFOA 4QQ5A 2V5QA 3MA6A 3KRJA 3NUNA 4QYHA 4QP9A 5IMEA 3UP2A 1JKKA 4IDTA 4ITIA 5D7AA 1G5SA 2C5VA 3BKBA 3D2KA 4MTAA 5AJQA 3VBVA 2RFSA 4AW2A 4BL1A 2X81A 5C26A 4RJ7A 5CEQA 2A19B 2OU7A 3H0YA 4O4BB 1OKYA 5IMXA 2C3JA 2XM9A 4IB3A 4U9AA 5IQEA 4M0YA 4WKQA 3ZDUA 4ZTHA 5KMJA 4PDOA 1REJA 4M69A 1M52A 3BGPA 4FRFA 5CENA 4WUNA 3A99A 4DH8A 4UWBA 5HO7A 5KHXA 2OBJA 3UC4A 3SC1A 3R8MA 3WF6A 4K6ZA 1LR4A 1JLUE 3DKGA 4LUEA 1OIUA 2YERA 3GGFA 4AF3A 2GSFA 4TYHB 4G9CA 5TE0A 5AUVA 5IDNA 4FTUA 4BRXA 3MBLA 4C4FA 5G6VA 4L3JA 4BCFA 4DITA 2ZAZA 5GIPE 2HW6A 1OI9A 2X39A 4E6AA 4Z55A 3TTJA 1MRUA 3BYUA 3R30A 3QYWA 2XK3A 1RDQE 1XHAA 3EN5A 4A4LA 2XIKA 3R04A 4DGNA 1YOMA 3ZEPA 2VWXA 3R7YA 4IFCA 3NWWA 4ASEA 2WOUA 5CU4A 4EH3A 4RLKA 4UYNA 4XP3A 4RX9A 3MFTA 4C38A 4MH7A 2V22A 1MQ4A 2J50A 1OL1A 4P90A 2RL5A 4XG6A 4Y85A 5FM3A 2YITA 2QOCA 4RQKA 3FXWA 4BDEA 4WO5A 4YSMA 3PG1A 4D9TA 4O1OA 5GZ8A 4PL5A 3AT2A 3DB8A 3V8SA 5KMLA 4BJJB 5AP1A 1PXPA 3UIMA 2J90A 4FV8A 4S32A 4D2TA 4F9CA 3FPQA 4AE9A 2F9GA 5L8KA 4FOBA 4FZAB 4LV5A 4EOIA 5K0XA 4LFIA 5H9BA 4ZY6A 5M08A 3BU3A 3DZQA 2J5FA 4ZJIA 4FV1A 3FI2A 2J4ZA 2LGCA 1SYKA 4IAKA 5M07A 3EQPA 4B99A 4EH5A 3COIA 5E7RA 3A8XA 4Q9ZA 4U7ZA 3NIEA 2ZV8A 5FXSA 3P79A 1KWPA 4USDA 4JG7A 3ZU7A 3HVCA 5KO1A 1PYEA 1HCLA 3U4UA 2X0PA 2VGPA 1OUKA 5EDQA 3OUNB 3RTPA 3EQFA 4KBKA 5LVLA 1PW2A 3P5KA 1RE8A 4CMOA 4E8AA 4HZSA 4S2ZA 4WSYA 2ZYBA 4ZTRA 2F49A 2QOLA 1G8JA 4NTSA 4JS8A 4QP2A 5KMOA 2R3HA 3O5AA 4F7SA 4EHEA 3FLYA 4CQGA 3CKXA 2QOBA 3B2WA 3DTCA 4KIKB 5DPVA 4ASXA 2Y0AA 3AT4A 3R7GA 3EB0A 2XRWA 4FZ6A 5E91A 5HIBA 3WZEA 3D83A 3AOXA 4UWYA 3L8SA 3ULIA 4FV0A 3CY3A 2QURA 3PE1A 1KE6A 4LGDA 3BLAA 5TF9A 3H9RA 4IXPA 4QMUA 3W10A 2FVDA 3P4KA 3V51A 4L3PA 4DH3A 4EH4A 5M57A 4PPCA 3CBLA 1F3MC 4JAIA 3CD3A 3ZO2A 3PYYA 3GCVA 2BRBA 4C02A 3TUDA 3ORIA 2P33A 4FL1A 5TR6A 4QDVA 3KRRA 3PXKA 4C8BA 5CU3A 3M42A 3ZRKA 5EOLA 3SW4A 4ZSLA 1NVRA 3GCUA 3QRTA 4PDPA 3VUDA 4CMUA 3FLWA 3QAME 3FPMA 3VF9A 2GDOA 2IVSA 3OC1A 4GJ3A 1JQHA 4I21A 2GQRA 5I4NA 2HZNA 3BE9A 2OH0E 1ZY5A 3HRCA 2LAVA 4ALWA 4ZJJA 3TNIA 4YJNA 5AUUA 4IZ7A 2XK6A 3T3VA 4FYNA 4DGMA 4LI5A 3GU8A 3RHXA 3FHRA 4Q5HA 2VX3A 2OIDA 2WTKB 3TNQB 4F6WA 3IDPA 5ANOA 3NCZA 4GK2A 3PVWA 1XH7A 2EWAA 4F0IA 2YIXA 3GFWA 4ONAA 2YAAA 4E20A 3KC3A 1K2PA 2OZOA 2XCKA 4WD5A 4MAOA 4EH2A 1K9AA 5LMBA 3C13A 3VS5A 2XIXA 5IQAA 3IONA 2QKRA 2ITNA 5CTPA 3OROA 2GMXA 1QPJA 4ANMA 4OAUC 4GKIA 5J95A 4QMNA 3OWPA 4WBBB 5EK7A 3A60A 4ZSEA 2UZLA 5AR4A 4PQNA 3V5WA 2WMAA 5EM5A 4RRVA 2JEDA 3QTIA 2XNOA 3FLZA 2VWZA 3S95A 3QZHA 3IDBA 4EH7A 3E8NA 2GFSA 3L8PA 3QTSA 5HX8A 1TZDA 4YUQA 2VU3A 3KK9A 1LP4A 4H36A 4DINA 4HVSA 4RWLA 5GJGA 4CTCA 2WMVA 1WBVA 4B9DA 2XB7A 3W55A 4C0TA 3NIZA 3R1NA 4O91A 4BI0A 2X2MA 3BBWA 3R63A 4J71A 4EEVA 3OXZA 2B9JA 4FT5A 3PZHA 1OIQA 2VTSA 4M66A 5HCZA 2ZFYA 3PRIA 4K2RA 5T68A 3SLSA 3QGYA 1Y6AA 5CNOA 4GH2A 2HOGA 3FLNC 2X9EA 1OPLA 4RWIA 4ZY4A 3R02A 3KMWA 4MF0A 4S30A 2VGOA 4O21A 5AIKA 1NA7A 2HCKA 3K3JA 1I44A 4F63A 2PMNX 3ANQA 3DV3A 3LFSA 3QQGA 4R3CA 5AX3A 3VO3A 5IEXA 4O7SA 3R8UA 4UB7A 1H0VA 3V04A 1KOAA 1T45A 1ZZLA 2GS6A 2B55A 2O64A 3ORPA 3LZBA 4YBJA 3RM6A 3GEQA 3GC7A 5EQEA 5H8GA 5CF5A 3C50A 3PJCA 4I5MA 4V01A 3WZKA 1WBSA 5JFXA 2PY3A 4W4YA 1H1RA 4FL2A 1XBCA 4HGTA 2PMIA 3EQCA 2CGVA 2WQMA 2XP2A 4LM5A 1Q62A 4L68A 5BVOA 3MY0A 4IIRA 1YRPA 5JSMA 3EQIA 3QQLA 4AFJA 2OK1A 3DKOA 2UW9A 1WBPA 2YM4A 4GT3A 4CV9A 4EZ5A 5ETIA 4O0WA 4YO6A 2XEZA 5DWRA 3SVVA 2A1AB 4Y83A 4FI1A 1OPJA 4NM5A 3Q3BA 3D5VA 4DE4A 3ORKA 3LFAA 4FX3A 2IW9A 5DIAA 2W1IA 3COHA 2UZDA 4ACMA 3MH3A 3SXSA 2ITPA 4XG2A 2FSLX 3CIKA 2ONLA 2WQOA 5AMNA 3LXKA 3Q6UA 4AUAA 5KMKA 1NT2A 5FRIA 2WXVA 3RPRA 5AWMA 3Q5IA 3TNHA 4LRMA 4EUUA 4CG8A 3KEXA 3WF8A 4GV1A 4NUSA 4WBOA 3KA0A 3OW4A 1T46A 1KV2A 3D5WA 5GHVA 3W0SA 4U6RA 5TT7A 1NVSA 4FA2A 2ZMCA 3BIZA 5AAFA 3UE4A 2H96A 1JBPE 3L9MA 3PY0A 5BX0A 3LCDA 2PE0A 4E5BA 3LFDA 4G1WA 1LPUA 2J5EA 4AW0A 4BTMA 1U46A 2Z7RA 3U9NA 5LWMA 4QNYA 3JUHA 4KAOA 2PU8A 3P78A 4RSSA 5CZIA 3R7OA 2R3KA 3F3TA 1UV5A 4ZEGA 4XG4A 4RX5A 4FOCA 4TWOA 2R64A 3NUXA 2X4ZA 2BAJA 2HY0A 3DJ5A 1Y57A 4FTRA 1O6YA 2J6MA 1ZAOA 2QU6A 2BRGA 4ITJA 3RPYA 4D2SA 5FXQA 3W8LA 1WCCA 2VV9A 3C4WA 2ITTA 4GVAA 2UZVA 5GZAA 4OUCA 1ST0A 4FNYA 1ZYDA 4KKHA 1WVWA 4O0YA 5F9EA 1OIYA 3DQWA 3HV6A 2G15A 3D7TB 3UQGA 3AQVA 5A4EA 5CU0A 3G90X 4QD6A 3PWYA 3BHYA 4AAAA 5T3QA 3ORMA 5KX8A 5CXHA 2HW7A 4YC3A 4IVCA 3V8TA 3WF5A 4FKGA 3DS6A 3N51A 2IF8A 4HNIA 2B53A 2YIWA 4JQ8A 3RK9A 3I79A 4D2WA 5DEYA 2QO9A 1Q8UA 4O96A 3RNIA 4BGGA 4C4GA 5FUTA 4G3CA 2C3LA 2A0CX 2ITZA 1MRVA 1SVHA 4FKSA 5FLFA 4F99A 4YLJA 5BV3A 4RIWA 4RIWB 5IQCA 1W98A 1APME 5C01A 3OFMA 1XQZA 3FUPA 4JX7A 4C4EA 3AT3A 2J0LA 4X3FB 4X3FA 3TXOA 4A07A 4BCJA 2WMRA 4FKTA 5CSHA 3WE4A 1JSTA 1G8KA 3BYOA 2ZOQA 3BV2A 1R0PA 3A4OX 4FTQA 4QYYA 3B2TA 4YHFA 4E6CA 3F66A 3H9FA 3MI9A 3R8VA 3VC4A 3F5XA 4QQCA 5AFVA 2JDSA 4BWXA 3IECA 5M4IA 2XIYA 4GIHA 4YZNA 3W2SA 3L9PA 4DFXE 1XH5A 2PZIA 4H3BA 4PDSA 3R00A 5EDRA 3EFJA 3F69A 4M68A 1UWJA 4NKAA 4WRGA 4F9YA 5IUGA 3M11A 4GFGA 3TV7A 5BVWA 5HLNA 3GOPA 2ZJWA 2F4JA 2VTHA 3OY1A 2YIQA 5LCKA 5DLSA 3S4QA 5B7VA 2AYPA 3DXNA 5FGKA 5HESA 3QC4A 4HYHA 4IAZA 4CFVA 5CAVA 3FE3A 3ORXA 3UZPA 5IG1A 3K54A 4FV3A 4YJTA 2XALA 5AP5A 1ZOGA 1R3CA 3HECA 3Q9ZA 2VTMA 5AV1A 4BIEA 4DG2E 4EZ3A 3I5ZA 4RLLA 1H1QA 4F6UA 4RPVA 3R9NA 1OGUA 3QCQA 5LOHA 4RIYA 4RIYB 3SDJA 4E6DA 4WSQA 3N4VA 3VJNA 3ULZA 3FAAA 3LCKA 4X2FA 4XS2A 3ZZWA 4FTJA 2R3QA 3PIZA 3ZFMA 3TI1A 4LRKA 2R3JA 5IEVA 1M2QA 2A4LA 2C0IA 4GVJA 2XYNA 5LJJA 2WD1A 4P2KA 5HE0A 4ZZNA 4MBJA 4TTHB 3ZUUA 2VWVA 4JNWA 4QMWA 3QGWA 4AACA 5BMMA 5DGZA 5BVEA 2WMQA 2Y6MA 2GNIA 4EQMA 2X8DA 4FG8A 4ANSA 5DMZA 4YJPA 1QCFA 3IW7A 3MSSA 1GNGA 3FMNA 3C9WA 3O8PA 1FMOE 4I92A 2OW3A 4N6YA 2C3IB 5FM2A 1LEZA 3RAIA 4B0GA 4YJRA 4FEXA 1YHVA 4E7WA 2FSOX 2W1ZA 1XH9A 4H3QA 1KV1A 4GFMA 4L45A 1W82A 2ETKA 2IN6A 1BMKA 4O4EA 4GK4A 3HX4A 3RINA 5FDPA 5HORA 4F78A 4HVDA 4DDIA 3ZRLA 2OJIA 4E5WA 2YISA 4K8AA 4BI1A 2EUFB 5AR5A 2J9MA 2CJMA 3ZXZA 4EOKA 1URWA 3FJQE 4UMUA 4O22A 3R9RA 4BDIA 4FVPA 2BZKB 2JD5A 3PY1A 2WTKC 3KVWA 2XJ0A 4M14A 3PJ1A 3UOKA 2W05A 1GJOA 4W4XA 1CMKE 3P7AA 4MCVA 2XAMA 1XKKA 3LE6A 5E8TA 2GHGA 5HHWA 2R0UA 4UWCA 4BDHA 5IZFA 4E73A 5I0BA 2BCJA 2QR8A 4I0RA 4CFMA 2X0GA 2NNWB 3LM0A 4EBVA 1JKTA 5CVFA 4CMTA 2YA9A 3AC1A 4FL3A 3UQCA 3TZ8A 5H8BA 5ANJA 1V1KA 3DXQA 4PP9A 5BNJA 3COMA 2AC3A 4QMSA 3VQHA 1ZARA 5J1VA 4WG5A 4OLIA 4CFNA 1IG1A 1FVRA 2UW6A 3BZ3A 5ANKA 3HDNA 1H27A 5HD4A 4XYFA 4HPUE 3D4QA 1IASA 3BQRA 1GIJA 1VYZA 3NYVA 4X2GA 4Z16A 5FG8A 4YP8A 3C4ZA 1WZYA 3EYHA 2EXCX 2C5XA 4IMYA 2NO3A 4D1ZA 5EHLA 1UA2A 5BUEA 3FXZA 5AP2A 1YHSA 3GCPA 5M51A 1YI6A 3QYZA 2I0VA 3LJ0A 3LXLA 4F6SA 4AU8A 2W1GA 5A54A 1A06A 2OO8X 3A7GA 1CKPA 2WEIA 3V8WA 4CQEA 3FY2A 2PZRA 4EJ7A 5IU2A 3RKBA 2Z7SA 4DH5A 4QTCA 3QRIA 4G31A 2R5TA 2PVLA 3ATTA 1OBDA 3HUBA 2E2BA 4KABA 1Q8YA 4F65A 3PLAE 3IS5A 3RVGA 3BELA 1BI8A 3LCOA 3LQ5A 4V0GA 4WG4A 3UDZA 3MGYA 5IKWA 1H1PA 1OVEA 3OTUA 4TNBA 3VF8A 2PPQA 2PUUA 5ETCA 5BVNA 4YC6A 4RC4A 2Q0NA 5ICPA 4O84A 2ERZE 2O5KA 4GT5A 5HTCA 2O65A 3S0OA 3PVUA 5AADA 5AR2A 4DEIA 3LHJA 4OW8A 2F7XE 4G17A 4G2FA 4O38A 2VTJA 4TN6A 3EQHA 4DFYA 3CJFA 4EWHA 1PXJA 3F2AA 3VQUA 2PVJA 4R78A 3UDSA 3JY9A 3KN5A 4L3LA 5JMSA 1A48A 4K0YA 2HWOA 2W1EA 4PTGA 3IDCA 4IJPA 3KQ7A 4ERWA 3BYMA 2BDJA 2IVTA 5ANEA 5E4HA 4F1OA 3BQCA 3FYJX 1KE8A 4AXEA 4DT9A 4DGOA 4R5SA 1IAHA 4BDAA 1U5RA 2CLQA 4J7BA 2ZB0A 3D14A 3UZTA 3D0EA 4IC8A 3D94A 3AD6A 4I94A 3MPMA 4JIAA 2YCFA 3DK7A 4GG5<