4EH8A

Human p38 map kinase in complex with np-f7 and rl87
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
351
structure length
336
Chain Sequence
ERPTFYRQELNKTIWEVPERYQNLSPVGSYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Natural-product-derived fragments for fragment-based ligand discovery.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Mitogen-activated protein kinase 14
total genus 105
structure length 336
sequence length 351
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2012-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4eh8A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4eh8A01
3VIDA 4IAFA 2JAVA 2OIDA 4JX7A 2A1AB 3VNTA 3ZLSA 1DAYA 2JIUA 3ZXZA 1Y8YA 4E4XA 4R3RA 5KMLA 3ANRA 4YC6A 3GT8A 5IKWA 4G17A 2HK5A 2CMWA 3PJ8A 4D9TA 4G9CA 4ZSLA 4N57A 1OPLA 3H30A 2VAGA 3Q4UA 4C58A 4KRDA 2BDFA 4YZ9A 4O0WA 5E8UA 4CCUA 4L43A 4BKJA 2GS6A 4USFA 2FO0A 4I5CA 3BHHA 5ANIA 3N51A 5E8ZA 4ZZNA 4WT6A 1DI8A 4U8ZA 2C68A 2VWXA 4O81A 3K54A 3P9JA 1ZYJA 3PJCA 4EBVA 4FSMA 3FZTA 2BVAA 3BEGA 3BYOA 4C59A 2VO6A 3IW4A 5IMXA 4C4JA 4EH8A 3G2FA 4X6RA 4L01A 3EHAA 3BI6A 3PVWA 5L8LA 1R1WA 5CANA 4ZK5A 4HVHA 2CKOA 2R2PA 4PNIA 4IWDA 5AR3A 4FKPA 5DWRA 5C4KA 4PY1A 3DBFA 4TYGA 3VF8A 1XWSA 4IH8A 4I3ZA 4PMTA 3NUXA 4HCTA 2HZNA 4B99A 1Y8GA 3OP5A 4OTGA 3AC4A 5CVGA 3BYVA 3KN5A 3Q9WA 5HCYA 5C8KA 2HWOA 2Z8CA 2GS7A 3RAIA 4BIEA 4UZHA 1JPAA 3RALA 1O9UA 4V01A 4FOCA 3UIMA 3SG9A 3A8WA 4RFYA 2XMYA 2RG5A 5EYKA 5IUHA 3TUDA 4L9IA 3O8TA 3OWJA 4GIIA 2YIRA 2VTHA 3CQEA 3VS1A 4ACCA 4ITJA 3RZFA 5EW3A 5HE1A 3FY2A 2HWPA 2PVMA 4FIFA 4QYHA 4EZ3A 5BVOA 5IPJA 5K5XA 3KC3A 1BX6A 5HORA 4BCMA 3R8ZA 2ITTA 2WMRA 4MVFA 4AS0A 4CFVA 4QYEA 1PRYA 3FMJA 3MW1A 5EI8A 4NH1A 2ITWA 2UVZA 5AV3A 5JMSA 4XUFA 5JT2A 5C1QB 5HKMA 5LMBA 4GU9A 2Y7JA 1P2AA 1REKA 3A62A 3R63A 4FIIA 4Y72A 4E6AA 1CM8A 2VTQA 4K18A 4DFNA 4DH7A 5CF6A 3E5AA 4XHKB 4CMTA 3D5WA 5B2KA 4BDKA 2BFYA 5T3QA 2Z7SA 1W82A 3FMHA 3MVHA 2VWZA 3LJ0A 2B4SB 3FZOA 5L3AA 5IQGA 3U9NA 4KSPA 1WBSA 3HV4A 1UVRA 4XLVA 5AV2A 5FTOA 4RBLA 4DG0E 4FV3A 4IAAA 4K0YA 4AT5A 4AXAA 3KXZA 3HGKA 2C4GA 4AN2A 5IQIA 3OY1A 3K5VA 1W8CA 4BHNA 4O0RA 3VUIA 4KS7A 2FYSA 3AD4A 3Q4TA 3FLZA 4ALWA 4F7SA 2JD5A 2XKEA 3VS6A 4OLIA 4IX4A 3VS4A 3DKCA 3PPZA 2WMBA 4KBKA 5IUIA 3VS0A 4BGHA 4DH5A 4LOPA 4JBQA 4AZTA 1VEBA 4XP2A 4WG4A 3R02A 5CAQA 2NPQA 4O7TA 3TG1A 5E8VA 2XJ0A 3PIYA 2YITA 4ERKA 5FLFA 3LFCA 1CSNA 2WMUA 3E8NA 2C6EA 2GNLA 3H10A 5LWMA 4HGEA 5KMKA 1UA2A 4MXOA 2GTNA 3BU6A 4F6SA 5AP0A 4MEDA 5CU0A 2EU9A 3BHUA 3Q04A 2Y6OA 4G5PA 3COMA 1O6YA 4RVLA 4JXFA 4F1OA 2JC6A 4I5MA 2UUEA 5BYLA 1U46A 4IB1A 4I21A 3CEKA 3T9IA 4DGOA 4IAZA 4M14A 4EHGA 4EI4A 2XK8A 4QRCA 5KMOA 3DQXA 2VWYA 2YAKA 3PZEA 4NM3A 1H07A 2IW9A 4YJVA 4YU2A 3DBQA 4I92A 3DJ7A 3JR1A 3NYOA 3PY0A 3F3VA 4UMTA 5AM6A 2A27A 4KKGA 1JAMA 5GJDA 5JH6A 1U4DA 2ZM3A 3KCKA 3KK8A 4KAOA 2B1PA 1V0PA 3PPKA 3ROCA 2DQ7X 4I93A 4I94A 4YHFA 1U5QA 5HE2A 2R0UA 2UV2A 3NGAA 3OT8A 5CAVA 2P2IA 4GFMA 3WF8A 4KIKA 1P4OA 4ANMA 3FMDA 3R7UA 3KRXA 4PDYA 4FZFB 5JFVA 4A4XA 3H9FA 3LCOA 3ZRLA 3QC9A 2QNJA 3EYGA 4KNBA 2H9VA 4YC3A 4ANSA 3DDQA 4GYIA 4FTQA 4ACHA 4L6QA 3W2CA 4AOJA 1H4LA 3SV0A 2PVHA 2I1MA 4KIPA 4M3QA 5IA2A 4C37A 3OCBA 4XOZA 4YZNA 4WIHA 4FL3A 3DPKA 4QMVA 5F95A 3UPXA 4DAWA 5FEDA 3DJ6A 2ZMCA 4ANBA 4AX8A 3KRLA 4A9TA 4D2SA 3ULZA 3EQRA 3V51A 3BV2A 3I6WA 5CU6A 3WBLA 2GQGA 3F9NA 1KWPA 4O0YA 5JFSA 3F66A 1ZYDA 3WF9A 4CMUA 5A4QA 3BCEA 2BKKA 4K11A 2R64A 3S3IA 4RA4A 3D5UA 2Q0NA 4TWCA 4O91A 3QZGA 3RK7A 5D41A 2HENA 4TYHA 3RBWA 3FXXA 2J5FA 3KK9A 2OICA 4ZOGA 1RW8A 4JDIA 5AUUA 3F5XA 1PXLA 2UZLA 2C5NA 4WD5A 4YTIA 4MXYA 3VUHA 4E7WA 3GNIB 3FZPA 3NNXA 4EH6A 3E63A 2VNWA 1QPEA 2C6TA 5BVNA 5E1EA 1V0BA 3F61A 3R22A 4XG9A 2IZSA 4AGDA 1URWA 5DFPA 2PMNX 2PMIA 5L2IA 5E8TA 4FEQA 5EFQA 2W5HA 3NR9A 2WMVA 2VWIA 4MK0A 2CSNA 3BLHA 3QX4A 4MNFA 3SKCA 3A61A 3UNJA 2GMXA 3QLGA 3QYWA 1CMKE 2PZRA 3D83A 5IG1A 4C35A 1H24A 2BRGA 2GFSA 4FTCA 1G5SA 4R3CA 5EK7A 4TKSA 1XH4A 4M66A 3ZO1A 1IA8A 4D28A 1ZXEA 5CENA 3LFBA 2JKKA 2ZDUA 2NRUA 4EORA 2J0LA 4MF0A 3L9MA 4TWOA 5HTCA 1TVOA 3EJ1A 1EH4A 3RCDA 4E93A 3W32A 3FLNC 2YIYA 3ZXTA 1NW1A 1Q62A 3LLTA 4BB4A 4BF2A 5I9VA 5F1ZA 2ITVA 4XG3A 1PYEA 4YHJA 2HZ0A 4M13A 3WF5A 3QTWA 2JIIA 5CI6A 2CKEA 3GU5A 3RK5A 4EK6A 1M14A 3NNUA 4C3FA 4FKQA 3HRCA 2PSQA 3G9LX 4JG8A 4WUAA 5CT7A 3ZFMA 2JEDA 4NFMA 3FWQA 3G6GA 3QRJA 4D4YA 4GRBA 2E9VA 2I0EA 4FEUA 3AGMA 5EM7A 2W0JA 5BVKA 4RJ4A 4BCNA 1Q41A 2W05A 5J8IA 4WSQA 4DFBA 1Q8ZA 4H36A 4TRLA 2JGZA 5M55A 5FEEA 3WOWA 2BRNA 4FR4A 3WZEA 5A6NA 5K0XA 4Z3VA 4J97A 2VO3A 2XEZA 3FLWA 3QGWA 1CKPA 3PZHA 3JY9A 5EW8A 4BTJA 3FDNA 3ID6C 2ZYBA 3RJCA 4F64A 3ZLWA 3KVXA 2R5TA 3QCSA 4O0VA 4B8LA 1Y6BA 3R21A 4FV1A 4E1ZA 5IF1A 1YHWA 4J95A 4G6NA 2ZVAA 2GNIA 2RIOA 3MPAA 2Z2WA 4QP3A 4PUZA 5AJQA 5L6WL 2O0UA 5E8WA 2PVLA 2QOBA 1ND4A 4TWNA 5JN2A 2XIRA 3I79A 2WIHA 4MD8E 3RCJA 5KX8A 3VRZA 4FK3A 4GT5A 4ASEA 2Y4IB 3QTRA 5AX3A 4AE6A 2BRMA 3R9HA 3FI8A 4K33A 5CNNA 4KKHA 4N6ZA 5CEQA 4IBMA 1BL6A 4OBQA 4R7HA 3VW8A 5KBQA 4YJQA 5LMKC 5AAGA 4GK2A 4NJ3A 4O82A 1QPDA 4KIOA 2BTSA 1WFCA 4L46A 4R1YA 3ZC6A 4UX9A 3OY3A 3C9WA 3OS3A 3LFNA 4LYNA 4AN9A 2E9PA 2J2IB 1ZAOA 3PSBA 4KINA 4AAAA 3BYUA 3CE3A 1YXVA 3AT3A 1Z5MA 3O96A 4JOAA 5ETCA 5CF5A 2XNBA 5EI2A 3UQGA 4FSTA 4G34A 4GKHA 2WMWA 1IASA 2QQ7A 4UWBA 2R7BA 4L67A 3BBTB 3FXWA 2VO0A 5CQUA 4F1TA 5IDPA 1XHAA 1LPUA 3JY0A 4I6HA 1BUHA 2V7OA 4FZ6A 4M97A 5BVWA 4AG8A 4DGMA 1NXKA 5EQEA 3BX5A 3HMPA 4A4LA 4DH1A 3RTPA 4AUAA 2WO6A 5HQ0A 4FKIA 4GV1A 1BKXA 1DAWA 2PY3A 3LCTA 4KB8A 4YJRA 3F69A 2YWVA 3GOKA 3OWKA 2PTKA 5CEOA 3R9NA 5JKGA 4JG7A 1UV5A 5CWZA 4QPAA 2XCHA 1APME 2G15A 1GZNA 1Q8UA 3R28A 5E1SA 3EN4A 3KRRA 3ULIA 4UN0C 5C8NA 3EB0A 1LP4A 3EIDA 4MWHA 4QMXA 4EK5A 3O17A 5AR4A 4KUJA 2W1IA 3RZBA 1V1KA 3EQPA 4Z16A 2C0IA 3JS2A 1OKWA 3C0HA 4FV0A 4AZWA 3ZS5A 5CAPA 5L2WA 3F2RA 4XG6A 3ZO3A 3NCGA 2C30A 2W1HA 3EQIA 2CGUA 1KE5A 3R8UA 3RHXA 1NT2A 5AFVA 3PSDA 4U80A 4DG2E 4FYNA 4BL1A 5LOHA 2IJMA 1Q8YA 2P33A 5IZFA 4DCAA 4ASZA 3FY0A 3Q96A 4EH2A 2YZAA 4NW6A 2J6MA 1YHVA 4RLKA 2R3PA 3W10A 3TJCA 4CQGA 3B2WA 5EOBA 2OK1A 5AX9A 3FMEA 1MRVA 1OL7A 2C0OA 2W9FB 3ODZX 3QD2B 1H1SA 2OZAB 2UW4A 3KL8A 5CSHA 2C5XA 3G33A 3BKBA 5A4CA 2X2MA 1OIYA 3F5GA 4CTCA 3NEWA 4JAIA 4Y8DA 5JZNA 3CQUA 3TNPC 2C47A 3P5KA 4BKZA 2UW8A 4HYHA 3QCYA 2OXXA 4C3PA 4FT0A 3L9LA 2P0CA 3ORPA 2HY81 2VZ6A 3S00A 4YBKA 4F0GA 3OUKA 4YZDA 3NUYA 3KMMA 5HG5A 2WB8A 5J95A 2YCFA 3DFCB 1ZOGA 3A7GA 3U4UA 1OKYA 1JKTA 4O6EA 2OF4A 5I0BA 3QWJA 2F2UA 3A2CA 4TYJA 3R83A 2WNTA 4YC8A 3HV6A 1ZARA 3NYNA 5EI6A 2PMLX 4J1RA 2UZNA 1WBOA 2QONA 5HO6A 4EK8A 4G31A 3MH1A 2QU5A 5K9IA 5A3XA 3HDNA 4DHFA 1DM2A 5CXZA 4EONA 2ACXA 4S33A 4BR3A 2ITZA 3NAYA 5A46A 5LVOA 2WTCA 5IQAA 1UKHA 4TYIA 3PG3A 5AMNA 4CFWA 5JZJA 4DTBA 1FINA 2ZAZA 4BGGA 3B8QA 1L8TA 2ESMA 1KOBA 3PXRA 2ITUA 5DBXA 5CTPA 4BTFA 2XKCA 4K2RA 5IQCA 1Q99A 4HPTE 4I0SA 4RWKA 1H8FA 3MESA 3H9RA 3V5PA 5IMEA 2DWBA 2O63A 3IDCA 5M51A 1UWJA 3V6RA 3GU4A 2GNHA 4AWIA 5IQEA 1ATPE 5L2QA 4QPSA 4G3CA 1Q5KA 5TR6A 3OVVA 1OUYA 4LRJA 4FUXA 4QQTA 3U4WA 3U8WA 4P90A 4R1VA 3TN8A 5IDNA 3WZJA 2FSOX 2QG7A 1DI9A 4BCFA 3E8CA 4JNWA 5CSWA 4ALVA 4B9DA 4RX5A 2W99B 1P5EA 3W2PA 5HNIX 3GI3A 3R1NA 1XH9A 4H39A 2W96B 4D2VA 5KBRA 3A4OX 3ZZWA 5IH5A 1NVRA 4BC6A 3BBWA 2BHEA 3HUBA 4JQEA 3IW7A 5LARA 4OTRA 4C02A 3CSVA 4NYEA 4O84A 3DNEA 3IKAA 4U6RA 4OAVB 3RGFA 2YM7A 2X6EA 2ITYA 3MB6A 3F5UA 2VUWA 1TKIA 1WVYA 4FG7A 5JGBA 4U43A 4M15A 3QRIA 3D2IA 2B9FA 4MQ1A 5L6OA 1Q97A 2RSVA 1XO2B 5HLPA 3SHEA 4DA5A 4I20A 1ZRZA 3BLRA 2P55A 2UZOA 3FBVA 2VTOA 3KB7A 5DT3A 2R3IA 4RC4A 5M57A 2XS0A 4DC2A 1PXJA 3V5TA 2J0KA 5CZIA 3HV3A 3MA6A 4EH4A 4CFXA 3TV4A 4GW8A 5AUWA 3VBQA 3IW5A 2CDZA 5BX0A 4EUTA 3MBLA 3GP0A 5AP3A 5HX6A 1E9HA 4U79A 4LRKA 4PP9A 4FTIA 4NW5A 4M0YA 3ZHPC 1JSUA 4H1MA 2PWLA 2VGPA 1QPCA 2OJFE 2Z02A 1J91A 3QAME 4F4PA 5EYDA 2GTMA 4UWYA 4BI0A 3P79A 3DB8A 4F0FA 5CT0A 5CVFA 1YXXA 1BMKA 3POZA 4H1JA 4WHZA 4DEBA 3QU0A 2HW6A 4TZRA 4CFFA 1SVHA 5AA9A 2PZIA 4FSQA 4B8MA 4YZMA 3NS9A 4JDJA 4GK3A 2UW6A 3P1AA 5M4IA 3OZ6A 5CY3A 1ZOHA 2C6LA 5I3RA 5TKDA 3QD3A 5GZAA 4DBNA 2BAQA 3GCQA 3VJNA 1SVEA 1Q8WA 1YW2A 2AC3A 4XX9A 4YLJA 4FKUA 4NUSA 4AOIA 4XNEA 3R7OA 4IC7A 5L2SA 3MVJA 1UU7A 2GSFA 2BHHA 3O8PA 3SA0A 3UVQA 2XBAA 3O8UA 1IA9A 3RAWA 3VVHA 2XNEA 3LLAA 2XH5A 5AAFA 3M11A 2QOQA 3OTVA 5ANJA 1FOTA 3SG8A 3QQUA 4LV5A 3AC2A 3MFRA 3AQVA 3T8OA 2ZM4A 2ZB1A 5EQYA 3TZ9A 4UMPA 4JL9A 4UZDA 3CXWA 4WUNA 2PVJA 3SQQA 2ETRA 3C5UA 5ETFA 3UIXA 3IOPA 3GC0A 5ICPA 3NRMA 4FL1A 3PP1A 2IW8A 4EBWA 4JBOA 4EYMA 3UP2A 3PWDA 1BI7A 5IISA 5AV0A 3RINA 4F9BA 4QNAA 3PY1A 1M17A 5HE0A 4DGGA 5EHOA 4ZLZA 5GZ9A 2CN8A 4DFUA 5TT7A 5DPVA 5GIPE 2W7XA 2WOTA 2XBJA 4RQVA 5KZIA 3RM7A 3UJGA 5CEKA 5J1WA 3CTQA 5LVNA 2Z7RA 3ZUVA 2OLCA 1OMWA 1IAHA 2CPKE 4FEXA 2YM3A 3C13A 4QP1A 4GEOA 1J3HA 3AMYA 2RFDA 2XIXA 4W8DA 3UOLA 2QOHA 3C0GA 5HU3A 2WEVA 4XYFA 4ANOA 4PP7A 2GNFA 3E92A 1QCFA 4W8EA 3Q9XA 4FTNA 3OXTA 4IMYA 1H27A 1PXMA 2AC5A 3NUUA 2BTRA 3MFSA 5JRSA 3VBWA 4MCVA 3ZSGA 4DEEA 1KUTA 4BDIA 3D2KA 4EJNA 4PPAA 1PW2A 3ZRMA 3LW0A 4QTBA 4C34A 3HP2A 2WD1A 1ZZ2A 2JDRA 2XYUA 3QZFA 3PXYA 2RL5A 2HXLA 4QPMA 2PZ5A 1XR1A 2JAMA 2QG5A 3TTIA 1OUKA 4DYMA 1OB3A 3AC1A 4QMOA 2W4JA 4O0SA 3EN9A 3DBDA 4X2FA 4ZTQA 4F6WA 3FC2A 5JK3A 2PVNA 5DG5A 3UPZA 5CF8A 5DR2A 4IJPA 4MTAA 2YA9A 2IN6A 4EC9A 2ZB0A 5C26A 1QL6A 2OZAA 3D0EA 1KOAA 4QP7A 5EM6A 4ZSJA 3O7LB 1X8BA 4ZTRA 4FNZA 4XP0A 1UU9A 3OCGA 4BCOA 5IEVA 2Q83A 3AGLA 3UC3A 1AGWA 1XQZA 1F3MC 3EKNA 3V8SA 4GIHA 1ERKA 4BDEA 5A9UA 3HECA 3PXZA 5AV4A 5EDQA 2QKWB 2RFEA 4FC0A 4ZS0A 3VS2A 3FKLA 3N4UA 4QTEA 5FXQA 2XEYA 2X4ZA 2YM4A 2BFXA 4I0TA 2WPAA 3R2BA 4FKVA 4YTCA 4GG7A 5B7VA 2W1FA 1TQIA 4CT2A 2O65A 4D4RA 2VTMA 3DY7A 4QQ5A 2QC6A 1OIUA 3RAKA 5CF4A 4N6YA 3IECA 1OITA 1XH8A 3BIZA 2QLQA 4H58A 3PVUA 4JBPA 5J5TA 2WELA 2WQEA 4B4LA 4FKJA 3SXFA 4DEIA 3SGCA 4RFMA 4D5HA 2ZV7A 4AQCA 4F65A 1ZLTA 2WQNA 4GJ3A 3PJ1A 3V8TA 3OBGA 5AUYA 1OI9A 4IM2A 4EOIA 4ERWA 4QMLA 3ATSA 4KS8A 4DLIA 3CY2A 3PUPA 3IDPA 3GENA 1A06A 2W4KA 3W2RA 3CIKA 4R5YA 3S1HA 3HDMA 2UVXA 4J53A 3CP9A 3TL8A 3THBA 2BIYA 4M69B 2ITQA 3DLSA 4I6FA 1PMUA 4ANLA 3MYGA 3TDWA 4ZMFA 2A4LA 5DIAA 1KE9A 3A7JA 4EOMA 3QTZA 4U81A 4AW0A 4BCQA 4O6LA 3KN6A 3CPBA 5CEIA 3OBJA 4PRJA 3QL8A 3WF7A 4IAIA 2G2HA 2JBPA 4W4VA 3GFEA 4XG7A 3FI3A 1REJA 2VV9A 3BWJA 5E4HA 2VWUA 4NJDA 4FSWA 4QTAA 2OWBA 4BCPA 2PVKA 3VAPA 3FEGA 2ZOQA 3R2YA 3VS3A 2X2LA 5I9WA 4CGAA 4EHVA 4WBBB 4YPDA 1J7UA 3IPHA 3U55A 3QTQA 4NKAA 4QOXA 4IQ6A 4BKYA 4U9AA 4FTTA 5GINE 4C8BA 1P4FA 1E1VA 3QUDA 3R7GA 3JVSA 2C6OA 4F9AA 2R3KA 2C3KA 3R6XA 3FPMA 3REPA 1TQPA 4C7TA 4NM0A 4X3JA 3LXLA 2W1ZA 4J7BA 4BDAA 5HLWA 3FZSA 5IA4A 5H9BA 4YNEA 4GYGA 5AEPA 5DA3A 3Q2MA 2XNPA 3POOA 4M68A 3ZO4A 3ZTXA 4MNEA 2X7OA 2YLFA 3TT0A 2WTVA 4MWIA 4IADA 2OI4X 3OUNB 5I9XA 4FNYA 3VS7A 3CKWA 3MJ2A 3MN3A 3LKMA 2OSCA 4NTTA 2NO3A 2VN9A 4V04A 4MNEB 4PNKA 2PU8A 3CTHA 5AWMA 4JDKA 4GFOA 3UO4A 5HNGA 3GQLA 5IA1A 4W4YA 4UMRA 2H96A 4WSYA 5FXRA 3SAYA 4R78A 5LCJA 4UEUA 5D7VA 4A7CA 1JSTA 4N4SA 5LWNA 1SVGA 3IGOA 4FSYA 4O7WA 3HKOA 1PXOA 4FEVA 1Z57A 1M2QA 5BUIA 4QTCA 4FTAA 3UOJA 2F7ZE 3BQRA 4R8QA 4O7SA 2JKMA 3WF6A 4R7BA 3IDBA 1PKGA 4I22A 2PK9A 4LL0A 2I7QA 4YBJA 5AP7A 5CNOA 3LZBA 4CSVA 4FVRA 5CASA 1PXPA 5LCKA 4C4GA 5BYYA 2XZSA 4HVSA 4K6ZA 3G0FA 3ZBXA 4XJ0A 3P23A 4AA5A 4UBAA 4XMOA 4HGTA 1GOLA 3QTXA 4FTLA 5AP1A 3SVVA 2BRHA 3ODYX 4QP2A 2R0IA 1SNUA 3GBZA 3UDBA 3QHRA 1GIIA 4RPVA 4U0IA 5LMAA 2HIWA 3BRBA 3NIEA 3OFMA 3OXIA 2XK4A 4MBIA 4FG9A 4GKIA 2WMAA 4UB7A 4ITIA 1R0PA 4C4EA 2ITOA 1GZOA 4OTQA 5FDPA 4QT1A 1UU3A 3A7FA 2GS2A 1UWHA 3DZOA 4YO4A 2XNMA 4FT5A 4RT7A 2EXCX 3GCUA 2B7AA 4J71A 3NAXA 4Z9LA 2QCSA 3EYHA 3DXQA 3SXRA 4M67A 2Z60A 2IVUA 3VBVA 2ERKA 2P3GX 4B0GA 5F9EA 5J9YA 4L00A 3W8QA 3G6HA 3U54A 4ZLYA 4PTEA 3V8WA 3TIYA 4EOQA 3AMBA 3QF9A 1J1BA 5L8JA 2UW5A 3LCDA 3PWYA 5EDPA 3V5QA 4CV9A 4DTKA 3HMMA 3TZMA 4KIKB 3MIAA 1KV1A 1FMKA 3Q5ZA 3BV3A 2E2BA 4NKSA 4EUUA 4IHPA 4GT3A 3WYXA 5FTQA 2BAJA 3DBCA 2OXYA 3VWAA 1YXTA 4BDFA 4BCKA 1QPJA 4K8AA 5E8XA 3VN9A 4FIHA 3W8LA 3R9RA 4Y73A 4Y85A 5A4LA 3I5NA 2XP2A 4CZTA 3O7LD 3R8PA 2WMQA 3D9VA 4ZEGA 3Q4ZA 4LFIA 4FSNA 4X2GA 4OW8A 4AGUA 4DFYA 1ZMWA 4FTJA 3EQCA 3BPRA 2CGWA 2UZWE 1YWNA 3FQEA 3DK3A 2WU7A 4FV8A 5CU3A 3PG1A 1RQQA 5IU2A 3DFAA 3FC1X 4ENYA 3VJOA 3R7YA 5H8BA 3QZIA 3BE2A 2CHLA 4XG2A 1DS5A 3KY2A 4O27B 2NRYA 3RHKA 3TNIA 3KCFA 5J7BA 3ZBFA 3F3TA 2C3LA 4M84A 4AT3A 4O7NA 3QXPA 4NCTC 4J98A 5H8GA 5AR5A 1YQJA 4F9CA 5IA0A 3RNYA 4CG8A 3U6JA 4CFMA 2JKQA 3VULA 2IW6A 3FMLA 3DZQA 3WILA 4MXXA 4IZ7A 3PFQA 4XV9A 3R8MA 4IAKA 3CBLA 3MH2A 4NSTA 5HG9A 4K77A 2YIXA 4HNFA 4MYGA 3HMNA 4NIFB 3WI6A 2JBOA 3MY5A 4FTRA 2QVSE 4D0WA 3E7VA 4PF4A 4G3EA 1V0OA 3VHKA 2CKQA 4UYNA 4Y5HA 1RJBA 5G1XA 4LI5A 3E8EA 3IG7A 3PRIA 4H3QA 2OO8X 4CV8A 4RWJA 4C61A 4O7RA 5EYCA 2V7AA 2C5YA 4JQ7A 3PY3A 3HMOA 4E5WA 4CLJA 1GJOA 1WBWA 4XOYA 3V5WA 3NUAA 1OPKA 4GVAA 4OTHA 1SNXA 2RKUA 4L8MA 4MBLA 3ZDUA 2C3IB 4JRVA 2GFCA 3TNQB 5DLSA 4BCIA 3BGZA 1JKKA 4XCUA 4HW7A 3ZZEA 3C1XA 4MX9A 3OWPA 4YGAA 2Y4IC 5FBOA 3ORLA 4DFXE 2IPXA 3Q9YA 4AF3A 3Q3BA 1VZOA 3DOGA 5HNBA 4B7TA 4R5SA 2CGXA 1IRKA 1MRYA 1PXKA 3DAKA 2E9UA 4IZYA 2OIQA 4A9SA 5DN3A 2PULA 4QMSA 3ZFYA 4DCEA 2B52A 2LAVA 3M2WA 3VQUA 1GZ8A 2BRBA 3E62A 4F7JA 4D9UA 5JQ8A 2WMSA 3MV5A 4R7IA 4EWQA 1GIJA 2V5QA 1Q3DA 4LRMA 4E6CA 3ZU7A 4I41A 4CKJA 3QUEA 4RC3A 4IACA 2WQOA 2PE1A 3OW3A 2O3PA 1YVJA 4IDVA 4S2ZA 5I4NA 3R73A 4K9YA 3F2NA 2REIA 4Q2AA 4U97A 4IANA 5JFXA 4RJ6A 4PX6A 2WTDA 4WNKA 4PMMA 4APCA 5IEYA 4YNOA 1HCKA 3ZEPA 3LFSA 2OKRA 2IZUA 4NTSA 1SZMA 5H8EA 2J4ZA 3FLYA 5CX9A 2H6DA 4I23A 5HG7A 1ZMVA 5KCVA 4PDPA 3QQGA 3TNHA 4BRXA 3BGQA 3MPTA 2QOLA 1GY3A 3UMXA 3D4QA 3CS9A 3QQHA 3PLSA 4DGLC 4TW9A 4EOPA 3BHTA 4G16A 4MHAA 3OG7A 5FDXA 4GSBA 5LVLA 3KF4A 4Y83A 5GIOE 3I0OA 4QP9A 3WE4A 3AD5A 5D11A 4OGRA 1PJKA 1WBNA 3TXOA 4ZJIA 3VS5A 1G3NA 4DEGA 3QD0A 4BWXA 4J99A 5M56A 2PYWA 4TWPA 3MH0A 4CRLA 4F1MA 4DE4A 4EEVA 3MPMA 4CD0A 4EOLA 5AR7A 2WTKC 2R3HA 3H0ZA 3ZFXA 3G9NA 5BMSA 4CKIA 2BALA 3HVCA 5JRQA 2JITA 4FIJA 1OZ1A 1NA7A 4FKTA 4QO9A 4WG5A 5FG8A 1CTPE 5FUTA 5C8MA 5I9YA 4FV7A 4BIDA 1KV2A 2QOIA 3HYHA 4RLLA 2F57A 2W4OA 4E4NA 2FA2A 4QMQA 3RM6A 4BDHA 3NW7A 3D15A 4IEBA 3U87A 2F4JA 3F82A 5C03A 5CS6A 3PIXA 2O8YA 5K5NA 4APPA 5HLNA 3FSKA 2JDOA 3I81A 5CYIA 4BICA 3SLSA 5CXHA 5FGKA 4EC8A 4G3DA 3HZTA 3L8PA 5A4EA 4D2RA 5AR8A 2HZIA 5CEMA 3HEGA 4ZAUA 2OG8A 4CXAA 4IWQA 3TDVA 4YJPA 2PUNA 1B38A 4FV5A 3KFAA 4BI2A 5CSVA 4LGHA 4RWLA 2XK6A 5HO8A 2ERZE 3L8XA 2CNUA 1WBTA 5F4NA 4EOKA 2IVTA 4W4XA 2I0HA 3QLFA 4E20A 5JSMA 2J9MA 4X21A 4E3CA 3ZLYA 4F70A 1O6LA 5A14A 3ALNA 3NYXA 1ZYSA 2J0IA 1M2RA 5BQ0A 5GNKA 3KGAA 2I0VA 4EHZA 2WAJA 3GCSA 3UIUA 2I0YA 4LMUA 5K4IA 3DXPA 4FIGA 2WMTA 2HY0A 2IZRA 2C0TA 2Y4PA 4G5JA 4U42A 3ORIA 1LEZA 3K5UA 4FTUA 4WOVA 3ZLXA 4YPSA 3N9XA 1GZKA 4TY1A 4EH3A 3QXOA 2XM8A 5DGZA 4FSZA 3OEZA 1YHSA 4CYIA 4FK6A 3QKLA 2ITXA 2J51A 5H3QA 4QD6A 3AC3A 3I5ZA 3TJDA 4U45A 4RFZA 1PF8A 3BU3A 2GDOA 2PE0A 2VTIA 1JNKA 3ANQA 4IW0A 3FJQE 2G2FA 1OL6A 1Q24A 2X7FA 2PZPA 3QRKA 4IFCA 3TKHA 3QTIA 3SW4A 1Y57A 3BZ3A 2OFUA 3V04A 2X9FA 2QKRA 4RVMA 4MF1A 4F0IA 2GQRA 1U54B 3PXQA 4RJ7A 3QRTA 5IA5A 2QURA 3D7ZA 3EFKA 2R3RA 4X3FC 5EYMA 4O0TA 2JLDA 5HEZA 2GU8A 2PHKA 3TZ8A 3FUPA 4LUDA 2NP8A 4O0UA 5ANGA 1XH6A 2BDJA 2WFYA 3ZDIA 3OCTA 4ZS4A 4NU1A 4GK4A 1H1WA 4IAYA 5EOLA 3LXKA 4YSJA 4CFUA 3OHTA 3NNVA 5DI1A 4DFZE 5BVFA 1UU8A 3E93A 4FI1A 2B55A 3EZRA 1H1QA 4FL2A 5TOZA 3TWJA 1FGKA 3QWKA 4ARKA 3WZKA 5JEBA 3NW5A 4KA3A 2YZLA 2IVSA 2QLUA 4C2WA 2F49A 2VX3A 3IQ7A 4RZWA 1HOWA 4IIRA 5C27A 3FHIA 4WNMA 3NVKI 4JT3A 1M7QA 4S32A 5HIBA 4EOJA 5LQFA 3DK7A 4FT9A 4L3PA 4O22A 3QQKA 2YM8A 5FD2A 3KMWA 1FMOE 5EG3A 4FTMA 4QMZA 3CD8A 4ACGA 4C4IA 4QMNA 4RSSA 3A4PA 3UG1A 2VD5A 4ZP5A 3BWFA 2QO2A 5HO7A 5KO1A 2Y9QA 2BIKB 3NYVA 1IR3A 4DTAA 2PUUA 3BE9A 2UZTA 4R3PA 4L7SA 2R7IA 2VTPA 2WTIA 4D2TA 5HICA 4AU8A 2J50A 5EH0A 5DOSA 1OECA 2UW3A 1OKZA 1AD5A 2ITPA 3QC4A 4GH2A 3A60A 1M2PA 3H3CA 3V3VA 2YERA 2V62A 1OIRA 3HL7A 2A2AA 5HBEA 2WZJA 1VR2A 1NVQA 2HW7A 3MJ1A 4HCVA 4WKQA 4NZWB 3E3PA 5I9ZA 2BDWA 5DRDA 3UO6A 1CKIA 3FKOA 4IC8A 4KRCA 3EZVA 3PE2A 5DE2A 3I7CA 4ONAA 4QQCA 1SMHA 4QYFA 4DEAA 3L9NA 1P14A 3CC6A 4ENXA 2Z7LA 5HVJA 4IFGA 2R3LA 4LOQA 2VTSA 1ZOEA 2VX0A 3QCQA 1FQ1B 3I60A 5TF9A 1E1XA 1VJYA 5EKOA 3V6SA 3NIZA 3FE3A 1FVRA 4RG0A 3GCVA 3UYTA 3PXFA 3DCVA 5J7HA 2VTAA 4EK3A 3M42A 4AW1A 3A7IA 2F7EE 4BDBA 2ZJWA 1OL1A 2YIWA 4XG4A 3NZ0A 4KD1A 4TNDA 5C4LA 5B2MA 1OPJA 4FTKA 4HVGA 4BCJA 2R9SA 4IXPA 2OFVA 5HOAA 1PXIA 5DYJA 4RWIA 4IM0A 1W98A 3G51A 4X2NA 3P0MA 3UQFA 4JRNA 2BZKB 1YRPA 4ZTNA 4QNYA 5AUVA 3R71A 2Y6MA 4LUEA 3CJFA 3LQ5A 3G90X 3PE1A 4U3ZA 4O7YA 2HAKA 3MSSA 3SOCA 3MWUA 5ETAA 4ZJJA 3W33A 1KE8A 2OBJA 4D1ZA 4IWPA 5BVDA 2CN5A 4QMMA 4ASXA 3C4ZA 1R0EA 4W9WA 4IX6A 1LR4A 4UXLA 1PMNA 4BDGA 4JX3A 2XK9A 3AMAA 5ACKA 4CKRA 4DH3A 3K2LA 2W1CA 3GFWA 3OTUA 4QMTA 3BYMA 1JVPP 4O7VA 2W5AA 2QU6A 3EN5A 3LMGA 4BIBA 4FV4A 3ETAA 4BBEA 1R78A 3ZRKA 5HIEA 3N4TA 5IEXA 1G8SA 3ORXA 3FI4A 4D5KA 3O0GA 1FPUA 3ALOA 2XVDA 3RPOA 2WEIA 2C6KA 1K9AA 3O2MA 4E8AA 3EFWA 4ZXTA 3MS9A 2IZTA 2VTNA 3RI1A 4GL9A 4C3RA 2QR8A 5FM3A 3U51A 4JIKA 3C0IA 4J96A 2BZHB 3PYYA 3VHEA 2V22A 2BR1A 3C4WA 3UIBA 3SRVA 4FVQA 3FSFA 4LQMA 3FYKX 4LL5A 4JBVA 2XNOA 3ZOSA 3L1SA 1STCE 1XBAA 1OM1A 2E9OA 5J9LA 3UVPA 1L3RE 3I7BA 3Q52A 4OBPA 4GJ2A 4XBRA 2FUMA 5GZ8A 4TPTA 5JFWA 3HAMA 3VUDA 2I40A 3KKVA 5AUTA 4ORKA 2XK7A 4U40A 4OT5A 4XV1A 5DVRA 4EJ7A 5M09A 3P86A 2YM5A 3LXPA 2KULA 2WTJA 4YO6A 2CNQA 1M52A 2BILB 2EUFB 2O64A 2UZDA 2QOKA 3GC8A 4EHEA 5K4JA 5DMZA 4OTWA 5FXSA 2IWIA 2R4BA 3F88A 2HELA 2HOGA 4UY9A 2WXVA 3C50A 3V5LA 4FZDB 3PVGA 3QUPA 3QKKA 5IQDA 4Y5QA 5CALA 1PHKA 4MXAA 2XUUA 4Z7HA 4QMWA 4ZSGA 4UYAA 2C5VA 4PPCA 2I6LA 2YEXA 5M06A 4BN1A 4HVIA 2W06A 4L3JA 3LMHA 1W0XC 1BI8A 4TYEA 4O83A 3D7TB 2GPHA 4V0GA 3EFJA 3Q5IA 3QA8A 3FV8A 1YXSA 3R8LA 3WYYA 4RJ8A 4EKLA 2O5KA 5DR9A 2PPQA 5T68A 4E73A 1K2PA 2HYYA 3Q32A 3CPCA 3DK6A 4GMYA 5HCZA 3DJ5A 3OF0A 1Q3WA 4O86A 3LFEA 4P7EA 5EM8A 3TI1A 4RQKA 4S30A 1QMZA 5A6OA 4AP7A 5CLPA 3A99A 5BUEA 2ONLA 4NL0A 3JYAA 4IVBA 4U5JA 4Z7GA 4ZJVA 4JS8A 3MY1A 2JFMA 5EHYA 3TKUA 4YJSA 5A54A 4BTKA 3GCPA 1Y6AA 3CY3A 4FKRA 3NX8A 2QI8A 2NNWB 2WQBA 3ACKA 3E88A 3EWHA 5IA3A 4L7FA 4D0XA 3KRWA 3LAUA 2QHMA 3HP5A 4WA9A 4O0XA 2VTTA 5KKRB 1YI3A 4GU6A 4L53A 5BYZA 4OUCA 1F5QA 4N70A 3CD3A 4WNPA 3ZH8A 5HU9A 3C4EA 4C4FA 4GT4A 4D2WA 3QQJA 5GHVA 5ANEA 3MTFA 5CU4A 1SM2A 2FSTX 1GIHA 3LHJA 2RG6A 5H2UA 5IH6A 2WHBA 3NLBA 5ACBC 2KTYA 4M8TA 4UV0A 2VTJA 4QTDA 1JKSA 3GUBA 2YWPA 4EK4A 3VF9A 3F2AA 4DH8A 2YCQA 3TV7A 3T9TA 4FZ7A 4ZTHA 4A4OA 3SX9A 4U44A 1XH7A 2DYLA 5DR6A 1Y91A 4OTIA 5KHXA 2WTKB 4W4WA 1CKJA 5L6PA 4PQNA 2UZBA 1YDSE 3L8SA 2J5EA 5FBNC 4J8NA 3OEFX 4Q9SA 4GVJA 3T3UA 4EH9A 3W18A 4RA5A 3QX2A 5FQDC 4BYJA 4F9YA 3LFDA 3TZ7A 1URCA 4HZRA 5ANKA 4L52A 4PL4A 4AA4A 4AN3A 3HLLA 3UODA 1MUOA 2CLQA 2UZUE 1RDQE 4KABA 2X8EA 2RF9A 1JBPE 4HPUE 4IM3A 3AD6A 3RPYA 2GQSA 4BDCA 3O71A 4MKCA 4EH7A 4E6QA 2WIPA 2HCKA 1U59A 3NNWA 3C7QA 3MY0A 4G9RA 3EN7A 4NM7A 1Q4LA 2VO7A 5M08A 4AGWA 1YKRA 3P7BA 1K3AA 4C38A 4EQCA 2WKMA 1OGUA 1YWRA 5JQ5A 5AP5A 3ORTA 4I4FA 4X3FA 3FL4A 3F5PA 3MB7A 3B8RA 3NWWA 4ANQA 5J5SA 3V5JA 3GU6A 4F09A 4GUEA 3WARA 4UMQA 4RC2A 3EQGA 1BLXA 4I4EA 5HESA 5BMMA 3OD6X 4KBCA 5ITAA 1U54A 4FTOA 4FNXA 4GCJA 4RX8A 4XV3A 5HVYA 1PY5A 2YDIA 1JWHA 4ITHA 3VO3A 4JR3A 4KWPA 3MFTA 3PRFA 3ZUUA 3R01A 2LGCA 2YAAA 4BY9E 4IB5A 3IW6A 3CGOA 4FSUA 3FPQA 2CJMA 1FGIA 3KQ7A 5T6KA 3D7TA 3TV6A 4AW2A 5HG8A 1SYKA 4L45A 2B53A 5EW9A 3R0TA 3ZM4A 3P78A 3RVGA 3W55A 4YLLA 1YI6A 1YI4A 1PXNA 3R1QA 4CCBA 4OTPA 1YOLA 2C6MA 2OH0E 3DNDA 3DKGA 3GXLA 4FKSA 4EKKA 3R00A 3ZONA 2JDTA 4Q9ZA 1OBDA 2R3FA 4ZZOA 2F7XE 4AZFA 1YDRE 3UBDA 1MQBA 3F3ZA 3P7CA 4OTDA 5F20A 5J87A 4BTMA 3C5IA 5IQHA 1KSWA 3K3IA 2V0DA 4FKGA 5JGAA 1ZMUA 3KXHA 3ORNA 3SOAA 4C2VA 3R1YA 3KULA 4EH5A 4MXCA 4FKWA 4YJOA 4TTHB 4USDA 3Q6UA 4KKEA 4FBXA 4GFGA 5D12A 4AFJA 4CYJA 2B9IA 2OJ9A 4MH7A 3KU2A 1MRUA 4FOBA 4O2ZA 3FZRA 2JIVA 3MVLA 1JOWB 4RIYB 3RP9A 2QODA 5EKNA 5DHJA 4CTBA 1JQHA 4RX9A 3S95A 4G3GA 3GB2A 3EH9A 4NM5A 4FSRA 4UALA 1IAJA 3DAJA 4DEHA 4ZZMA 3FHRA 4FV9A 3FAAA 4D4SA 2J0JA 2DS1A 4F99A 5L2TA 3SXSA 3UZPA 3ZSIA 2UW7A 5FTGA 2VWBA 3W2QA 4YZBA 4AACA 4UMUA 3BHYA 4RIWB 3R1SA 3EMGA 5CSXA 3RPVA 4DGNA 4F08A 1JSVA 3F7WA 4HYSA 4YJTA 3IS5A 4YURA 2PVRA 5KMJA 3VUGA 1IEPA 4BHZA 3G0EA 5D9HA 4E5BA 4FMQA 4AW5A 2X9EA 4FIEA 2Q0BA 4Z55A 2P4IA 4LM5A 4RIXA 5HBJA 3TEIA 4EOSA 4A9UA 5LMKA 5CEPA 3PP0A 3CJGA 3SD0A 3L9PA 4PL3A 1J7LA 4E5AX 4QP4A 4MXZA 3FLSA 1FVVA 2W1GA 3QKMA 2H8HA 3LQ8A 4FG8A 4JVGA 4U7ZA 4X7QA 3WZDA 5KMNA 4S31A 3A8XA 1OVEA 2XA4A 4UXQA 4ZTMA 3W16A 3MGYA 4ACDA 4YJNA 3UVRA 3AT2A 3WIGA 1U5RA 2FSLX 1WVXA 3COIA 4HJOA 2JKOA 1JKLA 3LXNA 4I6QA 3OROA 2OXDA 4CFNA 2GNJA 4H05A 4RJ5A 3RKBA 2XB7A 3QYZA 5K3YA 4JIAA 5C9CA 4RRVA 4G6OA 3UOKA 3ELJA 4AE9A 4CT1A 4BBFA 4X2KA 2OW3A 3C51A 3DBEA 4JJRA 3NUPA 3QTUA 2C3JA 4OT6A 3FZ1A 2VWVA 4YTHA 5E9EA 2QOCA 4CG9A 4A07A 2QD9A 1S9JA 1ZZLA 1ZY5A 2UW0A 3DT1A 1ZWSA 3PPJA 4WNOA 4BZOA 2W17A 5A4TA 3G5DA 5J9ZA 4IZAA 4RIWA 1YXUA 3VC4A 2OF2A 1W84A 3LCKA 4QP8A 4AT4A 2ZV2A 3PSCA 3L8VA 4F7LA 5BUJA 3I6UA 4YSMA 4JAJA 4FGRA 1T46A 3LFAA 5L4QA 1WZYA 1G8AA 2XRUA 5CZHA 3DTWA 3C4FA 2WOUA 3LIJA 3QGYA 4KSQA 3EL8A 3JPVA 3E87A 1IG1A 2ZMDA 2A19B 2OJIA 3B2TA 4PDSA 3HUCA 3GC9A 2GHMA 4G1WA 3K3JA 2PVFA 4IVCA 4FV2A 3F6XA 3P7AA 3P4KA 3NPCA 2QOOA 2X1NA 2C6DA 3PA4A 4BZDA 4G3FA 4CZUA 3TCPA 4A9YA 2YCSA 2SRCA 5FM2A 4ACMA 3QRUA 5I3OA 3C4XA 3ERKA 3SRVB 2B0QA 3OWLA 3LVPA 1YDTE 1WMKA 1UNGA 2PZYA 4AZVA 4CMOA 3DS6A 4TNBA 1ZYLA 5E8SA 4NWMA 4OTFA 5HD7A 2CNVA 4G2FA 1VYWA 4QYYA 4BCHA 4CRSA 3KULB 2G01A 3I4BA 3FMMA 4KIQA 4C36A 3DV3A 1PMVA 3MI9A 3DQWA 3LJ1A 3ZEWA 4MD7E 4CLIA 4HGLA 4IB3A 4RVTA 3HRBA 1XH5A 5ETIA 4BYIA 3KXNA 2XKDA 3U6IA 5FP5A 3RNIA 2XYNA 4TN6A 3OMVA 5K0KA 3QD4A 3UNKA 3IGGA 4BVUA 1OL5A 2QR7A 2AYPA 4V05A 4X6QC 3RWQA 1H0VA 4RZVA 3ZYAA 3OCSA 3IW8A 3R7EA 4XG8A 5B2LA 2Y0AA 5D10A 4DT8A 2B54A 2HXQA 2BUJA 3JVRA 4FV6A 3W2SA 5HX8A 5LVPA 3ITZA 2XKFA 4IVDA 4WRGA 3F7ZA 5EQPA 2RGPA 3IK3A 2PE2A 4TYHB 3KEXA 4F7NA 3RAHA 4IX3A 4PTCA 5L8KA 4ZIMA 4BWKA 4DEDA 2R3GA 2J7TA 3GU8A 4UWCA 3WZUA 2WGJA 3VQHA 1T45A 2F9GA 4C0TA 4FT7A 3R9DA 2XJ1A 2YHVA 1XJDA 4YR8A 2EXEA 4RIXB 3RPRA 4BZNA 4WBOA 4L3LA 1OIQA 5LVMA 4D4VA 4NCTA 2YISA 5ANDA 5I5ZA 2YIQA 4OAUC 2DUVA 1OBGA 3GVUA 4LOOA 4YHTA 4IWOA 3BEAA 3ET7A 5G6VA 3OC1A 4XS2A 4ZTLA 3F3UA 4FVPA 2XM9A 4AA0A 4EZ5A 4I6BA 2X8DA 2XRWA 3EQBA 1A48A 5HI2A 3FKNA 3VBXA 3BU5A 5DRBA 5AA8A 3UZTA 4G6LA 3ZUTA 4RGJA 2WTWA 3LCSA 4X3FB 5LJJA 1I44A 4DN5A 1WBVA 3ZC5A 2B9JA 3LPBA 2BZJA 4FYOA 5CI7A 1CDKA 3V01A 4C4HA 2BZIB 2OU7A 3HRFA 3CGFA 3AG9A 3HMIA 4Q5EA 5FRIA 5GJFA 3TUBA 2W1EA 4M7IA 3FYJX 5AIRA 4MD9E 3OOGA 5AP4A 4DLJA 5HZNA 4ZLOA 4USEA 1KE7A 2C6IA 4YP8A 2XNGA 4U41A 2XCKA 3PLAE 4FT3A 2E9NA 3DB6A 4OBOA 3D5VA 3PIZA 4AOTA 1Q8TA 3ENMA 3FQSA 3BGPA 4TL0A 1J7IA 4RX7A 3IONA 3Q2JA 3ENHA 3PJ3A 4M69A 3UP7A 3Q9ZA 3ZO2A 5DEWA 5FEQA 5HIDA 3HNGA 5CVHA 2UZVA 3EQHA 4IB0A 4QYGA 4DITA 2PVYA 3NCZA 4IDTA 3LE6A 2ONLC 4AZSA 3AT4A 2C1AA 3PVBA 5IUGA 4B6LA 3R04A 4XEYA 5E92A 3DU8A 3KXMA 1FVTA 4QP6A 2ETMA 2JDSA 3UMWA 4EZ7A 4ZY5A 4D58A 4ZY6A 4DINA 3QBNA 4HVDA 2R3NA 3LFFA 4HOKA 2OZOA 3HA6A 4U3YA 2C5OA 5HTIA 2J90A 5KUPA 3LJ2A 2R3JA 1ZY4A 4NFNA 4YMJA 3NMUF 4HYUA 3QTSA 4NEUA 4RIYA 5IH4A 2OGVA 2EWAA 3D14A 3E64A 3O50A 3EKKA 3PTGA 4P2KA 4ZY4A 3EL7A 2G1TA 5I9UA 2W5BA 2XIYA 3PA5A 4H3BA 2VTLA 4P4CA 1WAKA 4DFLA 3ORMA 2BKZA 4E26A 3QQLA 4FF8A 1H1PA 3GU7A 3R9OA 3SDJA 4FE2A 2GHLA 2EXMA 2Z7QA 3EQFA 1BL7A 3KF7A 4D1SA 4K1BA 5F94A 4F63A 5HTBA 3VBYA 4IX5A 3Q4CA 4DT9A 2AUHA 4WG3A 3DGKA 3SW7A 4RVKA 5CU2A 3CTJA 3TACA 4F9WA 2P2HA 2CKPA 3R7IA 4ZSAA 2CGVA 3DDPA 4ID7A 4IJ9A 4ALUA 2XJ2A 2CCHA 4XV2A 5AM7A 4QQJA 4TXCA 5KE0A 2QO7A 4BFMA 4JR7A 3R30A 4RJ3A 2X4FA 3QA0A 3NSZA 3AC5A 3TM0A 1XKKA 2VTRA 3MH3A 4O96A 3UYSA 3M1SA 4R77A 1Q61A 4CEGA 3D5XA 3UZRA 2XF0A 3ATTA 2C69A 2BMCA 5M44A 4A06A 3KREA 3PJ2A 5HBHA 2WU6A 4YTFA 2PL0A 3BQCA 3BHVA 3H0YA 3RMFA 4E4MA 1BYGA 2QOFA 4PMPA 2GNGA 2VX1A 5HD4A 4XH6A 3EOCA 1WVWA 2YN8A 5BNJA 5IQFA 2YABA 2W9ZB 4DG3E 5DH3A 3COKA 1MQ4A 4HGSA 3FMNA 4YLKA 5J79A 4PDOA 2X39A 3VUTA 4PV0A 3BLQA 4EWHA 5DT0A 4XRLA 2OIBA 3RWPA 3CLYA 5AUZA 3EFLA 5AAEA 3NVMB 1F0QA 3W1FA 2XNNA 5AP2A 4ZSEA 4IE9A 3CKXA 4XP3A 2ZV8A 2FH9A 5AIKA 1B6CB 4O21A 2Y8OA 3UO5A 2ZV9A 2R3QA 2YDKA 5ANOA 3KMUA 5M07A 4I5HA 4NT4A 3PDTA 4Y46A 5E7RA 2J0MB 4C62A 2WMXA 4HZSA 3OW4A 3TNWA 4LGDA 3OT3A 4Y95A 1HCLA 1TQMA 3R8VA 3RK9A 4AGCA 4FA2A 1PKDA 3QALE 4BBMA 2X0GA 5CSPA 2VNYA 3U9CA 4CVAA 2UZEA 4OR5A 3OOMA 5E8YA 1PMEA 4FNWA 3LQ3A 2ZM1A 2G9XA 1R39A 2OJJA 5HHWA 4D2PA 5J1VA 2EB2A 3FMKA 4J52A 4KBAA 3S0OA 4O2PA 4PMSA 3DAEA 3H9OA 3D94A 5AP6A 4FICA 3FI2A 1J1CA 2JFLA 2PMOX 3QHWA 4TT7A 5TE0A 1FBNA 4FUYA 4ZTSA 3UNZA 4E6DA 2PUIA 1R3CA 4L44A 3UE4A 1W7HA 4BI1A 1Z9XA 3DTCA 3LMIA 4CZYB 4EQMA 2PUPA 3S2PA 2JDVA 3MDYA 5EHLA 3IO7A 5KZ0A 4XLIA 3P08A 3AC8A 5FP6A 5HGIA 3LFQA 4E4LA 4EOOA 2BAKA 4JQ8A 4N0SA 4QMPA 4FKOA 5GJGA 4BDDA 3TUCA 5AV1A 4GUBA 1XBCA 4I24A 5E91A 3NUNA 4RMZA 5D7AA 3FQHA 4YZCA 3KA0A 3TIZA 3R7VA 2YACA 3KVWA 3UTOA 5KHWA 3U6HA 4I5PA 3DA6A 3AXWA 4EQUA 4C33A 1RE8A 2EB3A 2FSMX 1H1RA 3Q53A 2UVYA 2VWWA 3EQDA 3HAVA 4XRJA 2X7GA 3CR0A 5KMIA 4HYIA 1LUFA 2UW9A 3GGFA 2YJSA 3GOPA 3QZHA 4FZAB 4L68A 5AR2A 3CCNA 1H26A 1NVSA 2X81A 1I09A 1O6KA 4FKLA 3DLZA 4BWPA 4EL9A 2XIKA 3DXNA 4R6VA 2GHGA 2ZDTA 4P5QA 1H28A 2VU3A 3GC7A 1W83A 4WO5A 4FGBA 3ORKA 4D55A 3ORZA 5M4CA 4LV8A 5TO8A 2O2UA 4JG6A 1VYZA 4NIFA 3LM0A 1JLUE 3VW6A 1GAGA 3WIKA 3NUSA 3O51A 2V55A 1WBPA 2OH4A 4L42A 3HV5A 4X2JA 3EN6A 3C4CA 3BELA 3VUKA 2X2KA 3KXGA 4EYJA 1H00A 4GS6A 5EM5A 4QMYA 2CLXA 1WCCA 1H01A 3HX4A 3ACJA 3LM5A 3Q6WA 5E90A 2EVAA 4LG4A 3PA3A 4X0MA 2IO6A 1YOJA 4BCGA 5M4FA 5DEYA 3PXKA 4BGQA 1NY3A 5B0XA 2BROA 4I1ZA 2BCJA 3IOKA 1OKVA 2YLEA 5AUXA 3TTJA 3VUMA 2FB8A 1H08A 4C57A 4ASDA 2H34A 2FVDA 3FLQA 4PTGA 4RIOA 3GEQA 2ITNA 3HA8A 1YOMA 1M7NA 1KE6A 2XK3A 2HZ4A 4O1PA 4II5A 5BPYA 4CQEA 2YCRA 1PYXA 3ZCLA 4H3PA 5LXMA 1A9UA 3DKOA 3MVMA 3ZM9A 5KKRC 3UOHA 4O7ZA 4D1XA 1YWVA 4PL5A 5AADA 2R3OA 4LMNA 1AQ1A 3CQWA 4YUQA 2IVVA 2OJGA 4PPBA 2VGOA 2YFXA 4XBUA 3UQCA 2W1DA 3UC4A 2VRXA 4O1OA 3I0QA 2ETKA 3BYSA 1MP8A 4JI9A 3SC1A 2RFSA 5IQBA 3MA3A 2C1BA 2X8IA 4FODA 2CCIA 3NDMA 5D1JA 3FL5A 1B39A 4CNHA 1H0WA 5M53A 4FX3A 2QO9A 5CAUA 4IVAA 4O7LA 4Q5HA 3ZMMA 4A9RA 1UKIA 5CAOA 4JDHA 3O23A 1LEWA 3E7OA 4FEWA 2R3MA 4AFEA 1H25A 4O38A 4AZEA 4QMUA 5KNJA 2RFNA 5KMMA 2BPMA 1UNLA 3Q60A 3E8DA 3MFUA 4HCUA 4DBXA 5HE3A 1GNGA 3A7HA 2F2CB 4DF3A 2YM6A 4MQ2A 3MIYA 5C01A 3F3WA 3OXZA 4M12A 4PWNA 3ZSHA 5HCXA 3JUHA 4S34A 4F6UA 3JXWA 2YJRA 3HV7A 3QFVA 3T3VA 3KXXA 2GCDA 2WQMA 2X6DA 4MAOA 1S9IA 3AOXA 1XBBA 3W2OA 3VBTA 2QHNA 3WE8A 3VRYA 4P5ZA 4M0ZA 5BVEA 3TKIA 5M4UA 3G15A 4GG5A 5FWKK 3N4VA 3QQFA 4I0RA 2A0CX 5CQWA 3UGCA 3RPSA 3NW6A 3E3BX 1UNHA 3II5A 3QCXA 3I1AA 5DT4A 4W9XA 3MTLA 5DNRA 3ROYA 3COHA 4ANNA 2G2IA 4MBJA 2FGIA 3UG2A 3FXZA 4IZ5A 5HVKA 4YJUA 1OL2A 4LGGA 2B9HA 4JLCA 4BDJA 4NK9A 3S4QA 4V0GB 3KRJA 4J8MA 1ZYCA 3DKFA 5EDRA 3GQIA 3H4JA 4HNIA 2IG7A 3LOKA 2YDJA 2XIZA 5JGDA 4ZMEA 4WRSA
chains in the Genus database with same CATH superfamily
3VIDA 4IAFA 2JAVA 2OIDA 4JX7A 2A1AB 3VNTA 3ZLSA 1DAYA 2JIUA 3ZXZA 1Y8YA 4E4XA 4R3RA 5KMLA 3ANRA 4YC6A 3GT8A 5IKWA 3BLAA 4G17A 2HK5A 2CMWA 3PJ8A 4D9TA 4G9CA 4ZSLA 4N57A 4LV7A 1OPLA 3H30A 2VAGA 3Q4UA 4C58A 4KRDA 2BDFA 4YZ9A 4O0WA 5E8UA 4CCUA 4L43A 4BKJA 2GS6A 4USFA 2FO0A 4I5CA 3BHHA 5ANIA 3N51A 5E8ZA 4ZZNA 4WT6A 1DI8A 4U8ZA 2C68A 2VWXA 4O81A 3K54A 3P9JA 1ZYJA 3PJCA 4EBVA 4FSMA 3FZTA 2BVAA 3BEGA 3BYOA 4C59A 2VO6A 3IW4A 5IMXA 4C4JA 4EH8A 3G2FA 4X6RA 4L01A 3EHAA 3BI6A 3PVWA 5L8LA 1R1WA 5CANA 4ZK5A 4HVHA 2CKOA 2R2PA 4PNIA 4IWDA 5AR3A 4FKPA 5DWRA 5C4KA 4PY1A 3DBFA 4TYGA 3VF8A 1XWSA 4IH8A 4I3ZA 4PMTA 3NUXA 4HCTA 2HZNA 4AG8A 1Y8GA 3OP5A 4OTGA 3AC4A 5CVGA 4B99A 3BYVA 3KN5A 4DDGA 3Q9WA 5HCYA 5C8KA 2HWOA 2Z8CA 2GS7A 3RAIA 4BIEA 4UZHA 1JPAA 3RALA 1O9UA 4V01A 4FOCA 3UIMA 3SG9A 3A8WA 4RFYA 2XMYA 2RG5A 5EYKA 5IUHA 3TUDA 4L9IA 3O8TA 3OWJA 4GIIA 2YIRA 2VTHA 3CQEA 3VS1A 4ACCA 4ITJA 3RZFA 5EW3A 5HE1A 3FY2A 2HWPA 2PVMA 4FIFA 4QYHA 4EZ3A 5BVOA 5IPJA 5K5XA 3KC3A 1BX6A 5HORA 4BCMA 3R8ZA 2ITTA 2WMRA 4MVFA 4AS0A 4CFVA 4QYEA 1PRYA 3FMJA 3MW1A 5EI8A 4NH1A 2ITWA 2UVZA 5AV3A 5JMSA 2XANA 4XUFA 5JT2A 5C1QB 5HKMA 5LMBA 4GU9A 4BJJB 2Y7JA 1P2AA 1REKA 3A62A 3R63A 4FIIA 4Y72A 4E6AA 1CM8A 2VTQA 4K18A 4DFNA 4DH7A 5CF6A 3E5AA 4XHKB 4CMTA 3D5WA 5B2KA 4BDKA 2BFYA 5T3QA 2Z7SA 1W82A 3FMHA 3MVHA 2VWZA 3LJ0A 2B4SB 3FZOA 5L3AA 5IQGA 3U9NA 4KSPA 1WBSA 3HV4A 1UVRA 4XLVA 5AV2A 5FTOA 1XMMA 4RBLA 4DG0E 4FV3A 4IAAA 4K0YA 4AT5A 4AXAA 3KXZA 4O4FA 3HGKA 2C4GA 4AN2A 5IQIA 3OY1A 3K5VA 1W8CA 4BHNA 4O0RA 3VUIA 4KS7A 2FYSA 3AD4A 3Q4TA 3FLZA 4ALWA 4F7SA 2JD5A 2XKEA 3VS6A 4OLIA 4IX4A 3VS4A 3DKCA 3PPZA 2WMBA 4KBKA 5IUIA 3VS0A 4BGHA 4DH5A 4LOPA 4JBQA 4AZTA 1VEBA 4XP2A 4WG4A 3R02A 5CAQA 2NPQA 4O7TA 3TG1A 2XALA 5E8VA 2XJ0A 3PIYA 2YITA 4ERKA 5FLFA 3LFCA 1CSNA 2WMUA 3E8NA 2C6EA 2GNLA 3H10A 5LWMA 4HGEA 5KMKA 1UA2A 4MXOA 2GTNA 3BU6A 4F6SA 5AP0A 4MEDA 5CU0A 2EU9A 3BHUA 3Q04A 2Y6OA 4G5PA 3COMA 1O6YA 4RVLA 4JXFA 4F1OA 2JC6A 4I5MA 2UUEA 5BYLA 1U46A 4IB1A 4I21A 3CEKA 3T9IA 4DGOA 4IAZA 4M14A 4EHGA 4EI4A 2XK8A 4QRCA 5KMOA 3DQXA 2XAOA 2VWYA 2YAKA 3PZEA 4NM3A 1H07A 2IW9A 4YJVA 4YU2A 3DBQA 4I92A 3DJ7A 3JR1A 3NYOA 3PY0A 3F3VA 4UMTA 5AM6A 2A27A 4KKGA 1JAMA 5GJDA 5JH6A 1U4DA 2ZM3A 3KCKA 3KK8A 4KAOA 2B1PA 1V0PA 3PPKA 3ROCA 2DQ7X 4I93A 4I94A 4YHFA 1U5QA 5HE2A 2R0UA 2UV2A 3NGAA 3OT8A 5CAVA 2P2IA 4GFMA 3WF8A 4KIKA 1P4OA 4ANMA 3FMDA 3R7UA 3KRXA 4PDYA 4FZFB 5JFVA 4A4XA 3H9FA 3LCOA 3ZRLA 3QC9A 2QNJA 3EYGA 4KNBA 2H9VA 4YC3A 4ANSA 3DDQA 4GYIA 4FTQA 4ACHA 4L6QA 3W2CA 4AOJA 1H4LA 2IEWA 2PVHA 3SV0A 2I1MA 4KIPA 4M3QA 5IA2A 4C37A 3OCBA 4XOZA 4YZNA 4WIHA 4FL3A 3DPKA 4QMVA 5F95A 3UPXA 4DAWA 5FEDA 3DJ6A 2ZMCA 4ANBA 4AX8A 3KRLA 4A9TA 4D2SA 3ULZA 3EQRA 3V51A 3BV2A 3I6WA 5CU6A 3WBLA 2GQGA 3F9NA 1KWPA 4O0YA 5JFSA 3F66A 1ZYDA 3WF9A 4CMUA 5A4QA 3BCEA 2BKKA 4K11A 2R64A 3S3IA 4RA4A 3D5UA 2Q0NA 4TWCA 4O91A 3QZGA 3RK7A 5D41A 2HENA 4TYHA 3RBWA 3FXXA 2J5FA 3KK9A 2OICA 4ZOGA 1RW8A 4JDIA 5AUUA 3F5XA 1PXLA 2UZLA 2C5NA 4WD5A 4YTIA 4MXYA 3VUHA 4E7WA 3GNIB 3FZPA 3NNXA 4EH6A 4DHZA 3E63A 2VNWA 1QPEA 2IF8A 2C6TA 5BVNA 5E1EA 1V0BA 3F61A 3R22A 4XG9A 2IZSA 4AGDA 1URWA 5DFPA 2PMNX 2PMIA 5L2IA 5E8TA 4FEQA 5EFQA 2W5HA 3NR9A 2WMVA 2VWIA 4MK0A 2CSNA 3BLHA 3QX4A 4MNFA 3SKCA 3A61A 3UNJA 2GMXA 3QLGA 3QYWA 1CMKE 2PZRA 3D83A 5IG1A 4C35A 1H24A 2BRGA 2GFSA 4FTCA 1G5SA 4R3CA 5EK7A 4TKSA 1XH4A 4M66A 3ZO1A 1IA8A 4D28A 1ZXEA 5CENA 3LFBA 2JKKA 2ZDUA 2NRUA 4EORA 2J0LA 4MF0A 3L9MA 4TWOA 5HTCA 1TVOA 3EJ1A 1EH4A 3RCDA 4E93A 3W32A 3FLNC 2YIYA 3ZXTA 1NW1A 1Q62A 3LLTA 4BB4A 4BF2A 5I9VA 5F1ZA 2ITVA 4XG3A 1PYEA 4YHJA 2HZ0A 4M13A 3WF5A 3QTWA 2JIIA 5CI6A 2CKEA 3GU5A 3RK5A 4EK6A 1M14A 3NNUA 4C3FA 4FKQA 3HRCA 2PSQA 3G9LX 4JG8A 4WUAA 5CT7A 3ZFMA 2JEDA 4NFMA 3FWQA 3G6GA 3QRJA 4D4YA 4GRBA 2E9VA 2I0EA 4FEUA 3AGMA 5EM7A 2W0JA 5BVKA 4RJ4A 4BCNA 1Q41A 2W05A 5J8IA 1G8KA 4WSQA 4DFBA 1Q8ZA 4H36A 4TRLA 2JGZA 5M55A 5FEEA 3WOWA 2BRNA 4FR4A 3WZEA 5A6NA 5K0XA 4Z3VA 4J97A 2VO3A 2XEZA 3FLWA 3QGWA 1CKPA 3PZHA 3JY9A 5EW8A 4BTJA 3FDNA 3ID6C 2ZYBA 2X0OA 3RJCA 4F64A 3ZLWA 3KVXA 2R5TA 3QCSA 4O0VA 4B8LA 1Y6BA 3R21A 4FV1A 4E1ZA 5IF1A 1YHWA 4J95A 4G6NA 2ZVAA 2GNIA 2RIOA 3MPAA 2Z2WA 4QP3A 4PUZA 5AJQA 5L6WL 2O0UA 5E8WA 2PVLA 2QOBA 1ND4A 4TWNA 5JN2A 2XIRA 3I79A 2WIHA 4MD8E 3RCJA 5KX8A 3VRZA 4FK3A 4GT5A 4ASEA 2Y4IB 3QTRA 5AX3A 4AE6A 2BRMA 3R9HA 3FI8A 4K33A 5CNNA 4KKHA 4N6ZA 5CEQA 4IBMA 1BL6A 4OBQA 4R7HA 3VW8A 5KBQA 4YJQA 5LMKC 5AAGA 4GK2A 4NJ3A 4O82A 1QPDA 4KIOA 2BTSA 1WFCA 4L46A 4R1YA 3ZC6A 4UX9A 4LDTA 3OY3A 3C9WA 3OS3A 3LFNA 4LYNA 4AN9A 2E9PA 2J2IB 1ZAOA 3PSBA 4KINA 4AAAA 3BYUA 3CE3A 1YXVA 3AT3A 1Z5MA 3O96A 4JOAA 5ETCA 5CF5A 2XNBA 5EI2A 3UQGA 4FSTA 4G34A 4GKHA 2WMWA 1IASA 2QQ7A 4UWBA 2R7BA 4L67A 3BBTB 3FXWA 2VO0A 5CQUA 4F1TA 5IDPA 1XHAA 1LPUA 3JY0A 4I6HA 1BUHA 2V7OA 2X0QA 4FZ6A 4M97A 5BVWA 4DGMA 1NXKA 5EQEA 3BX5A 4AXFA 3HMPA 4A4LA 4DH1A 3RTPA 4AUAA 2WO6A 5HQ0A 4FKIA 4GV1A 1BKXA 1DAWA 2PY3A 3LCTA 4KB8A 4YJRA 3F69A 2YWVA 3GOKA 3OWKA 2PTKA 5CEOA 3R9NA 5JKGA 4JG7A 1UV5A 5CWZA 4QPAA 2XCHA 1APME 2G15A 1GZNA 1Q8UA 3R28A 5E1SA 3EN4A 3KRRA 3ULIA 4UN0C 5C8NA 3EB0A 1LP4A 3EIDA 4MWHA 4QMXA 4EK5A 3O17A 5AR4A 4KUJA 2W1IA 3RZBA 1V1KA 3EQPA 4Z16A 2C0IA 3JS2A 1OKWA 3C0HA 4FV0A 4AZWA 3ZS5A 5CAPA 5L2WA 3F2RA 4XG6A 3ZO3A 3NCGA 2C30A 2W1HA 3EQIA 2CGUA 1KE5A 3R8UA 3RHXA 1NT2A 5AFVA 3PSDA 4U80A 4DG2E 4FYNA 4BL1A 3W0RA 5LOHA 2IJMA 1Q8YA 2P33A 5IZFA 4DCAA 4ASZA 3FY0A 3Q96A 4EH2A 2YZAA 4NW6A 2J6MA 1YHVA 4RLKA 2R3PA 3W10A 3TJCA 4CQGA 3B2WA 5EOBA 2OK1A 5AX9A 3FMEA 1MRVA 1OL7A 2C0OA 2W9FB 3ODZX 3QD2B 1H1SA 2OZAB 2UW4A 3KL8A 5CSHA 2C5XA 3G33A 3BKBA 5A4CA 2X2MA 1OIYA 3F5GA 4CTCA 3NEWA 4JAIA 4Y8DA 5JZNA 3CQUA 3TNPC 4AXCA 2C47A 3P5KA 4BKZA 2UW8A 4HYHA 3W0NA 3QCYA 2OXXA 4C3PA 4FT0A 3L9LA 2P0CA 3ORPA 2HY81 2VZ6A 3S00A 4YBKA 4F0GA 3OUKA 4YZDA 3ML1A 3NUYA 3KMMA 5HG5A 2WB8A 5J95A 2YCFA 3DFCB 1ZOGA 3A7GA 3U4UA 1OKYA 1JKTA 4O6EA 2OF4A 5I0BA 3UDSA 3QWJA 2F2UA 3A2CA 4TYJA 3R83A 2WNTA 4YC8A 3HV6A 1ZARA 3NYNA 5EI6A 2PMLX 4J1RA 2UZNA 1WBOA 2QONA 5HO6A 4EK8A 4G31A 3MH1A 2QU5A 5K9IA 5A3XA 3HDNA 4DHFA 1DM2A 5CXZA 2AQXA 4EONA 2ACXA 4S33A 4BR3A 2ITZA 3NAYA 5A46A 5LVOA 2WTCA 5IQAA 1UKHA 4TYIA 3PG3A 5AMNA 4CFWA 5JZJA 4DTBA 1FINA 2ZAZA 4BGGA 3B8QA 1L8TA 2ESMA 1KOBA 3PXRA 2ITUA 5DBXA 5CTPA 4BTFA 2XKCA 4K2RA 5IQCA 1Q99A 4HPTE 4I0SA 4RWKA 1H8FA 3MESA 3H9RA 3V5PA 5IMEA 2DWBA 2O63A 3IDCA 5M51A 1UWJA 3V6RA 3GU4A 2GNHA 4AWIA 5IQEA 1ATPE 5L2QA 4QPSA 3W0SA 4G3CA 1Q5KA 5TR6A 3OVVA 1OUYA 4LRJA 4FUXA 4QQTA 3U4WA 3U8WA 4P90A 4R1VA 3TN8A 5IDNA 3WZJA 2FSOX 2QG7A 1DI9A 4BCFA 3E8CA 4JNWA 5CSWA 4ALVA 4B9DA 4RX5A 2W99B 1P5EA 3W2PA 5HNIX 3GI3A 3R1NA 1XH9A 4H39A 2W96B 4D2VA 5KBRA 3A4OX 3ZZWA 5IH5A 1NVRA 4BC6A 3BBWA 2BHEA 3HUBA 4JQEA 3IW7A 5LARA 4OTRA 4C02A 3CSVA 4NYEA 4O84A 3DNEA 3IKAA 4U6RA 4OAVB 3RGFA 2YM7A 2X6EA 2ITYA 3MB6A 3F5UA 2VUWA 1TKIA 1WVYA 4FG7A 5JGBA 4U43A 4M15A 3QRIA 3D2IA 2B9FA 4MQ1A 5L6OA 1Q97A 2RSVA 1XO2B 5HLPA 3SHEA 4DA5A 4I20A 1ZRZA 3BLRA 2P55A 2UZOA 3FBVA 2VTOA 3KB7A 5DT3A 2R3IA 4RC4A 5M57A 2XS0A 4DC2A 1PXJA 3V5TA 2J0KA 5CZIA 3HV3A 3MA6A 4EH4A 4CFXA 3TV4A 4GW8A 5AUWA 3VBQA 3IW5A 2CDZA 5BX0A 4EUTA 3MBLA 3GP0A 5AP3A 5HX6A 1E9HA 4U79A 4LRKA 4PP9A 4FTIA 4NW5A 4M0YA 3ZHPC 1JSUA 4H1MA 2PWLA 2VGPA 4I6LA 1QPCA 2OJFE 2Z02A 2ZFYA 1J91A 3QAME 4F4PA 5EYDA 2GTMA 4UWYA 4BI0A 3P79A 3DB8A 4F0FA 5CT0A 5CVFA 1YXXA 1BMKA 3POZA 4H1JA 4WHZA 4DEBA 3QU0A 2HW6A 4TZRA 4CFFA 1SVHA 5AA9A 2PZIA 4FSQA 4B8MA 4YZMA 3NS9A 4JDJA 4GK3A 2UW6A 3P1AA 5M4IA 3OZ6A 5CY3A 1ZOHA 2C6LA 5I3RA 5TKDA 3QD3A 5GZAA 4DBNA 2BAQA 1OGYA 3GCQA 3VJNA 1SVEA 1Q8WA 1YW2A 2AC3A 4XX9A 4YLJA 4FKUA 4NUSA 4AOIA 4XNEA 3R7OA 4IC7A 4MUQA 5L2SA 3MVJA 1UU7A 2GSFA 2BHHA 3O8PA 3SA0A 3UVQA 3BL9A 2XBAA 3O8UA 1IA9A 4FJVA 3RAWA 3VVHA 2XNEA 3LLAA 2XH5A 5AAFA 3M11A 2QOQA 3OTVA 5ANJA 1FOTA 3SG8A 3QQUA 4LV5A 3AC2A 3MFRA 3AQVA 3T8OA 2ZM4A 2ZB1A 5EQYA 3TZ9A 4UMPA 4JL9A 4UZDA 3CXWA 4WUNA 2PVJA 3SQQA 2ETRA 3C5UA 5ETFA 3UIXA 3IOPA 3GC0A 5ICPA 3NRMA 4FL1A 3PP1A 2IW8A 4EBWA 4JBOA 4EYMA 3UP2A 3PWDA 1BI7A 5IISA 5AV0A 3RINA 4F9BA 4QNAA 3PY1A 1M17A 5HE0A 4DGGA 5EHOA 4ZLZA 5GZ9A 2CN8A 4DFUA 5TT7A 5DPVA 5GIPE 2W7XA 2WOTA 2XBJA 4RQVA 5KZIA 3RM7A 3UJGA 5CEKA 5J1WA 3CTQA 5LVNA 2Z7RA 3ZUVA 2OLCA 1OMWA 1IAHA 2CPKE 4FEXA 2YM3A 3C13A 4QP1A 4GEOA 1J3HA 3AMYA 2RFDA 2XIXA 4W8DA 3UOLA 2QOHA 3C0GA 5HU3A 2WEVA 4XYFA 4ANOA 4PP7A 2GNFA 3E92A 1QCFA 4W8EA 3Q9XA 4FTNA 3OXTA 4IMYA 1H27A 1PXMA 2AC5A 3NUUA 2BTRA 3MFSA 5JRSA 3VBWA 4MCVA 3ZSGA 4DEEA 1KUTA 4BDIA 3D2KA 4EJNA 4PPAA 1PW2A 3ZRMA 3LW0A 4QTBA 4C34A 3HP2A 2WD1A 1ZZ2A 2JDRA 2XYUA 3QZFA 3PXYA 2RL5A 2HXLA 4QPMA 2PZ5A 1XR1A 2JAMA 2QG5A 3TTIA 1OUKA 4DYMA 1OB3A 3AC1A 4QMOA 2W4JA 4O0SA 3EN9A 3DBDA 4X2FA 4ZTQA 4F6WA 3FC2A 5JK3A 2PVNA 5DG5A 3UPZA 5CF8A 5DR2A 4IJPA 4MTAA 2YA9A 2IN6A 4EC9A 2ZB0A 5C26A 1QL6A 2OZAA 3D0EA 1KOAA 4QP7A 5EM6A 4ZSJA 3O7LB 1X8BA 4ZTRA 4FNZA 4XP0A 1UU9A 3OCGA 4BCOA 5IEVA 2Q83A 3AGLA 3UC3A 1AGWA 1XQZA 1F3MC 3EKNA 3V8SA 4GIHA 1ERKA 4BDEA 5A9UA 3HECA 3PXZA 5AV4A 5EDQA 2QKWB 2RFEA 4FC0A 4ZS0A 3VS2A 3FKLA 3N4UA 4QTEA 5FXQA 2XEYA 2X4ZA 2YM4A 2BFXA 4I0TA 2WPAA 3R2BA 4FKVA 4YTCA 4GG7A 5B7VA 2W1FA 1TQIA 4CT2A 2O65A 4D4RA 2VTMA 3DY7A 4QQ5A 2QC6A 1OIUA 3RAKA 5CF4A 4N6YA 3IECA 1OITA 1XH8A 3BIZA 2QLQA 4H58A 3PVUA 4JBPA 5J5TA 2WELA 2WQEA 4B4LA 4FKJA 3SXFA 4DEIA 3SGCA 4RFMA 4D5HA 2ZV7A 4AQCA 4F65A 1ZLTA 2WQNA 4GJ3A 3PJ1A 3V8TA 3OBGA 5AUYA 1OI9A 4IM2A 4EOIA 4ERWA 4QMLA 3ATSA 4KS8A 4DLIA 3CY2A 3PUPA 3IDPA 3GENA 1A06A 2W4KA 3W2RA 3CIKA 4R5YA 3S1HA 3HDMA 2UVXA 4J53A 3CP9A 3TL8A 3THBA 2BIYA 4M69B 2ITQA 3DLSA 4I6FA 1PMUA 4ANLA 3MYGA 3TDWA 4ZMFA 2A4LA 5DIAA 1KE9A 3A7JA 4EOMA 3QTZA 4U81A 4AW0A 4BCQA 4O6LA 3KN6A 3CPBA 5CEIA 3OBJA 4PRJA 3QL8A 3WF7A 4IAIA 2G2HA 2JBPA 4W4VA 3GFEA 4XG7A 3FI3A 1REJA 2VV9A 3BWJA 5E4HA 2VWUA 4NJDA 4FSWA 4QTAA 2OWBA 4BCPA 2PVKA 3VAPA 3FEGA 2ZOQA 3R2YA 3VS3A 2X2LA 5I9WA 4CGAA 4EHVA 4WBBB 4YPDA 1J7UA 3IPHA 3U55A 3QTQA 4NKAA 4QOXA 4IQ6A 4BKYA 4U9AA 4FTTA 5GINE 4C8BA 1P4FA 1E1VA 3QUDA 3R7GA 3JVSA 2C6OA 4F9AA 2R3KA 2C3KA 3R6XA 3FPMA 3REPA 1TQPA 4C7TA 4NM0A 4X3JA 3LXLA 2W1ZA 4J7BA 4BDAA 5HLWA 3FZSA 5IA4A 5H9BA 4YNEA 4GYGA 5AEPA 5DA3A 3Q2MA 2XNPA 3POOA 4M68A 3ZO4A 3ZTXA 4MNEA 2X7OA 2YLFA 3TT0A 2WTVA 4MWIA 4IADA 2OI4X 3OUNB 5I9XA 4FNYA 3VS7A 3CKWA 3MJ2A 3MN3A 3LKMA 2OSCA 4NTTA 2NO3A 2VN9A 4V04A 4MNEB 4PNKA 2PU8A 3CTHA 5AWMA 4JDKA 4GFOA 3UO4A 5HNGA 3GQLA 5IA1A 4W4YA 4UMRA 2H96A 4WSYA 5FXRA 3SAYA 4R78A 5LCJA 4UEUA 3W0MA 5D7VA 4A7CA 1JSTA 4N4SA 5LWNA 1SVGA 3IGOA 4FSYA 4O7WA 3HKOA 1PXOA 4FEVA 1Z57A 1M2QA 5BUIA 4QTCA 4FTAA 3UOJA 2F7ZE 3BQRA 4R8QA 4O7SA 2JKMA 3WF6A 4R7BA 3IDBA 1PKGA 4I22A 2PK9A 4LL0A 4AQKA 2I7QA 4FRFA 4YBJA 5AP7A 5CNOA 3LZBA 4CSVA 4FVRA 5CASA 1PXPA 5LCKA 4C4GA 5BYYA 2XZSA 4HVSA 4K6ZA 3G0FA 3W0OA 3ZBXA 4XJ0A 4O4CA 3P23A 4AA5A 4UBAA 4XMOA 4HGTA 5BV3A 1GOLA 3QTXA 4FTLA 5AP1A 3SVVA 2BRHA 3ODYX 4QP2A 2R0IA 1SNUA 3GBZA 3UDBA 3QHRA 1GIIA 4RPVA 4U0IA 5LMAA 2HIWA 3BRBA 3NIEA 3OFMA 3OXIA 2A98A 2XK4A 4FG9A 4MBIA 4GKIA 2WMAA 4UB7A 4ITIA 1R0PA 4C4EA 2ITOA 1GZOA 4OTQA 5FDPA 4QT1A 1UU3A 3A7FA 2GS2A 1UWHA 3DZOA 4YO4A 2XNMA 4FT5A 4RT7A 2EXCX 3GCUA 2B7AA 4J71A 3NAXA 1ST4A 4Z9LA 2QCSA 3EYHA 3DXQA 3SXRA 4M67A 2Z60A 2IVUA 3VBVA 2ERKA 2P3GX 4B0GA 5F9EA 5J9YA 4L00A 3W8QA 3G6HA 3U54A 4ZLYA 4PTEA 3V8WA 3TIYA 4EOQA 3AMBA 3QF9A 1J1BA 5L8JA 2UW5A 3LCDA 3PWYA 5EDPA 3V5QA 4CV9A 4DTKA 3HMMA 3TZMA 4KIKB 3MIAA 1KV1A 1FMKA 3Q5ZA 3BV3A 2E2BA 4NKSA 4EUUA 4IHPA 4GT3A 3WYXA 5FTQA 2BAJA 3DBCA 2OXYA 3VWAA 1YXTA 4BDFA 4BCKA 1QPJA 4K8AA 5E8XA 3VN9A 4FIHA 3W8LA 3R9RA 4Y73A 4Y85A 5A4LA 3I5NA 2XP2A 4CZTA 3O7LD 3R8PA 2WMQA 3D9VA 4ZEGA 3Q4ZA 4LFIA 4FSNA 4X2GA 4OW8A 4AGUA 4DFYA 1ZMWA 4FTJA 3EQCA 3BPRA 2CGWA 2UZWE 1YWNA 3FQEA 3DK3A 2WU7A 4FV8A 5CU3A 3PG1A 1RQQA 5IU2A 3DFAA 3FC1X 4ENYA 3VJOA 3R7YA 5H8BA 3QZIA 3BE2A 2CHLA 4O4EA 4XG2A 1DS5A 3KY2A 4O27B 2NRYA 3RHKA 3TNIA 3KCFA 5J7BA 3ZBFA 3F3TA 2C3LA 4M84A 4AT3A 4O7NA 3QXPA 4NCTC 4J98A 5H8GA 5AR5A 1YQJA 4F9CA 5IA0A 3RNYA 4CG8A 3U6JA 4CFMA 2JKQA 3VULA 2IW6A 3FMLA 3DZQA 3WILA 3KIOC 3TYKA 4MXXA 4IZ7A 3PFQA 4XV9A 3R8MA 4IAKA 3CBLA 3MH2A 4NSTA 5HG9A 4K77A 2YIXA 4HNFA 4MYGA 3HMNA 4NIFB 3WI6A 2JBOA 2XARA 3MY5A 4FTRA 2QVSE 4D0WA 3E7VA 4PF4A 4G3EA 1V0OA 3VHKA 2CKQA 4UYNA 4Y5HA 1RJBA 5G1XA 4LI5A 3E8EA 3IG7A 3PRIA 4H3QA 2OO8X 4CV8A 4RWJA 4C61A 4O7RA 5EYCA 2V7AA 2C5YA 4JQ7A 3AKJA 3PY3A 3HMOA 4E5WA 4CLJA 1GJOA 1WBWA 4XOYA 3V5WA 3NUAA 1OPKA 4GVAA 4OTHA 1SNXA 2RKUA 4L8MA 4MBLA 3ZDUA 2C3IB 4JRVA 2GFCA 3TNQB 3PFYA 5DLSA 4BCIA 3BGZA 1JKKA 4XCUA 4HW7A 3ZZEA 3C1XA 4MX9A 3OWPA 4YGAA 2Y4IC 5FBOA 3ORLA 4DFXE 2IPXA 3Q9YA 4AF3A 3Q3BA 1VZOA 3DOGA 5HNBA 4B7TA 4R5SA 2CGXA 1IRKA 1MRYA 1PXKA 3DAKA 2E9UA 4IZYA 2OIQA 4A9SA 5DN3A 2PULA 4QMSA 3ZFYA 4DCEA 2B52A 2LAVA 3M2WA 3VQUA 1GZ8A 2BRBA 3E62A 4F7JA 4D9UA 5JQ8A 2WMSA 3MV5A 4R7IA 4EWQA 1GIJA 2V5QA 1Q3DA 4LRMA 4E6CA 3ZU7A 4I41A 4CKJA 3QUEA 4O4BB 4RC3A 4IACA 2WQOA 2PE1A 3OW3A 2O3PA 1YVJA 4IDVA 4S2ZA 5I4NA 3R73A 4K9YA 3F2NA 2REIA 4Q2AA 4U97A 4IANA 5JFXA 4RJ6A 4PX6A 2WTDA 4WNKA 4PMMA 4APCA 5IEYA 4YNOA 1HCKA 3ZEPA 3LFSA 2OKRA 2IZUA 4NTSA 1SZMA 5H8EA 2J4ZA 3FLYA 5CX9A 2H6DA 4I23A 5HG7A 1ZMVA 5KCVA 4PDPA 3QQGA 3TNHA 4BRXA 3BGQA 3MPTA 2QOLA 1GY3A 3UMXA 3D4QA 3CS9A 3QQHA 3PLSA 4DGLC 4TW9A 4EOPA 3BHTA 4G16A 4MHAA 3OG7A 5FDXA 4GSBA 5LVLA 3KF4A 4Y83A 5GIOE 3I0OA 4QP9A 3WE4A 3AD5A 5D11A 4OGRA 1PJKA 1WBNA 3TXOA 4ZJIA 3VS5A 1G3NA 4DEGA 3QD0A 4BWXA 4J99A 5M56A 2PYWA 4TWPA 3MH0A 4CRLA 4F1MA 4DE4A 4EEVA 3MPMA 4CD0A 4EOLA 5AR7A 2WTKC 2R3HA 3H0ZA 3ZFXA 3G9NA 5BMSA 4CKIA 2BALA 3HVCA 5JRQA 2JITA 4FIJA 1OZ1A 1NA7A 4FKTA 4QO9A 4WG5A 5FG8A 1CTPE 5FUTA 5C8MA 5I9YA 4FV7A 4BIDA 1KV2A 2QOIA