4EH8A

Human p38 map kinase in complex with np-f7 and rl87
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
351
structure length
336
Chain Sequence
ERPTFYRQELNKTIWEVPERYQNLSPVGSYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Mitogen-activated protein kinase 14
publication title Natural-product-derived fragments for fragment-based ligand discovery.
pubmed doi rcsb
source organism Homo sapiens
total genus 105
structure length 336
sequence length 351
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2012-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4eh8A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4eh8A01
1G8SA 2Y9QA 4OBPA 5EW3A 4ZY6A 3PDTA 3KVWA 2PVYA 4KBAA 5IDPA 2GPHA 4BCKA 4D2SA 5GIPE 3OW3A 2WTDA 2XYUA 4EHZA 5CSHA 3V3VA 2X9EA 4AP7A 3QX4A 3DBCA 3UZPA 5DR2A 3LLAA 4ZTLA 2ZYBA 5BVKA 5HLWA 5K5NA 3Q5ZA 4MVFA 3SOAA 4ZJIA 4FYNA 4HZSA 2WTJA 4CG9A 2X8IA 2E9VA 4DTKA 2VGOA 2VO3A 2R3OA 4KIKB 1CMKE 5C1QB 3BHVA 2HWPA 1R3CA 3ZSHA 5L6OA 5FTQA 5CQWA 3D83A 5HNGA 4EHEA 3PRFA 5IH6A 2P0CA 3UNJA 3BYUA 5ETFA 5F1ZA 1JKLA 3RCDA 2OSCA 2C30A 4ZLOA 3EN7A 2XIXA 5CQUA 3EQPA 2CNQA 4UXLA 5HG5A 3LQ5A 4DEHA 3VNTA 2Z7RA 4G3CA 4I6FA 5M07A 4U42A 3GBZA 4PMSA 5CSXA 3V51A 5E7RA 3BE9A 4TPTA 5DR6A 2GFCA 3ZEPA 1NW1A 4EK5A 4OTGA 2OFUA 5HG8A 3HV6A 2IZSA 4GFGA 2SRCA 3MFSA 4EL9A 1PXLA 4RA4A 2J0LA 1JKTA 3ZH8A 3UO5A 2OJIA 3BHUA 3CJGA 4L46A 4DTAA 3NDMA 3O0GA 4QTDA 5CU2A 4ZSGA 4ID7A 3RAHA 3GENA 1PRYA 4LRMA 3NW6A 3R8PA 1ZOEA 4QP3A 4QYFA 4XHKB 3E7OA 5KMNA 4BCQA 1QCFA 4EONA 5L2QA 4U44A 3RZBA 4R5SA 3SD0A 1OKZA 4FMQA 2FSLX 4MWHA 2XM9A 4KRDA 4UWCA 3UYSA 5ETAA 4RX7A 5HVYA 3QLFA 3E87A 3G5DA 4DH3A 1WBVA 4RX8A 2IVTA 5E1SA 2YJSA 4EI4A 1XH5A 4OAUC 4FG8A 2XCKA 4FZDB 2XUUA 1B39A 4KS8A 2RIOA 3N4UA 1MRYA 2GS6A 2IZUA 1G3NA 3C51A 4O0UA 4CFFA 2PPQA 4AF3A 3UP7A 4MKCA 3A7HA 3VBWA 3BBTB 3EL8A 4U97A 4J95A 4LMNA 3OCTA 4YTFA 5BVNA 4FI1A 4ZY5A 4RIYA 1PW2A 2UW8A 1JSVA 2VNYA 3Q5IA 4M7IA 4A9UA 1PMNA 5HE1A 4X6RA 3KXHA 1QPDA 4IJ9A 4YZ9A 3NVKI 2BZIB 3BLHA 5HIDA 3EL7A 2NO3A 5B2KA 3F3VA 2DS1A 3NUYA 3KA0A 3CEKA 3QQUA 2XNEA 4DAWA 4HYUA 2GHMA 5IMXA 3ORZA 2UZVA 2ZDUA 5CASA 2IVVA 3WZJA 1WBWA 4TWOA 5EHYA 3FMEA 2GFSA 4E6QA 5HTBA 5AM7A 5HO8A 2W0JA 4O21A 4NIFB 2QKWB 4GG5A 3R7YA 3MPAA 2VU3A 2WMUA 4E73A 5IQFA 5LMAA 2VTPA 4G6OA 4PL4A 1XQZA 2WKMA 4YLJA 5FXQA 5CZIA 5AP1A 3E5AA 3WE8A 3C50A 5E8UA 4X2FA 4F1TA 4N6ZA 4DEBA 2RL5A 2RFSA 4FSYA 3QCXA 3QX2A 3AMYA 4TNBA 4A9TA 3NR9A 3ORTA 5EOLA 1BI8A 3VAPA 3PP1A 3VW8A 1RDQE 1E1VA 2OF2A 2YIYA 4LGHA 2BHEA 3BYVA 5CNOA 2W1HA 3V6SA 4O91A 2VO0A 5DH3A 4Q9ZA 3R9RA 4AWIA 4FKGA 3FYKX 2R3GA 3SHEA 4RPVA 5KO1A 2VD5A 3QLGA 2QO7A 2I0YA 4F0FA 4H36A 4D4RA 4YC8A 4BDIA 2A27A 2C6OA 3LHJA 3BGZA 4HPTE 3ZC5A 4PDPA 4L3PA 4FTNA 3DNDA 4JDIA 4M67A 5KHWA 2QD9A 4RWIA 3VF8A 3NUUA 3SV0A 5CEQA 3PXFA 4QMXA 4HCUA 1FVVA 3Q9YA 4K8AA 2CKQA 3VRZA 3FMHA 3LFNA 2QLUA 3FY2A 1ZYCA 4EORA 4L67A 1YHWA 2C6KA 3RPRA 4I41A 3TN8A 4WUNA 2HZNA 3EQDA 4P5ZA 2B53A 2UVZA 4XG3A 5K3YA 3RNYA 1R1WA 3DKOA 2J0IA 2W5AA 5IISA 5FM3A 4EOOA 5AUVA 2HCKA 3DOGA 4QYEA 1OL2A 3KXXA 4L9IA 1SYKA 4M69A 5TR6A 1WFCA 4C02A 4GT4A 4U79A 4GVAA 5H8EA 3NX8A 3EFJA 3QYZA 4NW6A 4JVGA 5KUPA 2Q83A 4ZOGA 5DIAA 2YIWA 5CF8A 2O64A 4ERKA 2HY81 3C4WA 4YUQA 4PMTA 4O6EA 4MTAA 4WUAA 3GNIB 4C3FA 3LLTA 4PL3A 1BYGA 4CLIA 4IACA 1SM2A 3FLSA 5HKMA 3TIYA 1JSUA 1H00A 3GC8A 3COHA 4DGLC 4F9WA 5LMKA 3FXXA 5M4UA 3SXRA 4I0SA 1K2PA 3ZUTA 3CIKA 3LFEA 4BCOA 3DBFA 3LM0A 2OG8A 5GJDA 1FMKA 3DKGA 2OJGA 1JWHA 2V55A 3QU0A 3QHRA 3G6HA 3TXOA 1YWVA 2YM5A 5CAQA 3GCPA 1KUTA 3AT4A 4LMUA 4YZDA 4PPCA 3NUXA 5AFVA 2UZOA 4U8ZA 4CV8A 2Z2WA 2UVXA 1R78A 5DT4A 4FKRA 4ANQA 4CXAA 2JDSA 3GOPA 5C01A 4ZJJA 4TYHA 2XJ2A 3CBLA 4ENXA 2YISA 4CQGA 2GQRA 2X7OA 1FPUA 2ZMDA 2BIKB 3KKVA 4IM0A 2C5XA 2VTOA 5AP6A 2CNUA 2XVDA 3ZRKA 4QD6A 4AW1A 3GC0A 4Y46A 4E20A 4R8QA 5JFXA 4DH1A 3EKNA 2YLEA 1VYWA 1OPLA 4QTAA 4BRXA 3DS6A 3WARA 5A4LA 1UWHA 2ZV7A 3CXWA 2XK3A 1PYXA 2BRMA 2HY0A 3D5XA 4E5AX 5IQHA 3LIJA 4FL2A 4QYHA 5HNBA 5B2LA 3LM5A 3PRIA 3PTGA 3A4PA 3B2TA 3OUKA 3U8WA 2UZTA 1H26A 3FZOA 4YC6A 2WMQA 4UWYA 3NMUF 3AMBA 5T6KA 5LXMA 3NUAA 4H3QA 4M66A 4OR5A 4FV4A 2IZRA 5A14A 5TT7A 3QQJA 2C6EA 4R7HA 4BDEA 2Z7LA 1CTPE 3BYMA 4AN2A 1WVWA 3HMNA 3GVUA 3D7TA 4GJ3A 4LV8A 3E92A 1I09A 4F0GA 2KULA 5HIBA 3TL8A 3PA5A 2YABA 5HZNA 4DH8A 3GCQA 1TKIA 2YLFA 2R64A 4U3YA 3FI3A 2PMOX 2JBPA 3EOCA 1DI8A 3QTIA 3F6XA 4GT3A 4II5A 2BCJA 4R3PA 2OJJA 4RWKA 4AE9A 4BVUA 5JGBA 4UMQA 2X6EA 1V0PA 2CKEA 3AC1A 3CR0A 3T9TA 3VUDA 1OUYA 4C36A 3P5KA 3QRIA 4QMWA 5D41A 3NUSA 4FSTA 5IA5A 3DAKA 4JG8A 4JI9A 4OTIA 5K9IA 4HJOA 2X9FA 5DN3A 1OBDA 2UV2A 3R0TA 3JXWA 5JH6A 2CJMA 4RC4A 3C5UA 4XOYA 2IW6A 2JAVA 3Q9WA 4DFBA 3ORPA 3BRBA 4RG0A 3QQGA 3I79A 5JMSA 5AJQA 1U46A 2ITNA 3D7ZA 4MAOA 2PUUA 5BVDA 1ZLTA 4JNWA 4YSMA 2YIRA 4O1OA 3NRMA 3FDNA 4FOCA 1FBNA 3PXYA 2R2PA 2DUVA 4HNIA 4FIGA 4K33A 4DHFA 5IQAA 3CP9A 3PP0A 3SG9A 3C0GA 5CU6A 4PV0A 5I0BA 2FA2A 3CD3A 4RC3A 4XRLA 3FBVA 2QHMA 3OS3A 2ZJWA 3OWPA 4JJRA 3VS7A 4PP7A 4NM0A 2ZVAA 1OI9A 1A9UA 3P4KA 3QZGA 3ROCA 2CSNA 2F2CB 2GDOA 3ZONA 3O51A 4FZ6A 4DH5A 3PIZA 3VN9A 1W0XC 3OCSA 4FSQA 2XCHA 3W2OA 4AN3A 1XH7A 3LZBA 3FZPA 3OFMA 4TWCA 3SX9A 4E1ZA 3ANRA 3OP5A 5E8XA 2ETRA 4QMTA 2ERZE 3BGQA 2I0VA 5L2WA 4YR8A 5HU9A 4FC0A 4RJ3A 5CSVA 4D9TA 3M1SA 2OJFE 3QC4A 4DGMA 1ATPE 2ITQA 3QA8A 4FGRA 3L1SA 3ET7A 3F88A 3HGKA 3QTRA 4FNXA 4IAAA 3ZO3A 5JKGA 3R83A 4V01A 4BDCA 3GP0A 3MH2A 3LKMA 3EFLA 3ALOA 2CCIA 4AOTA 4MNEA 1OUKA 4YNEA 1YWNA 2ONLC 2VTIA 4ACMA 3KN6A 1WCCA 3R7GA 4N6YA 4ZTRA 2R3FA 1UU7A 2BKZA 5EKOA 4GJ2A 4QP9A 5CX9A 5DRBA 5JZNA 2YIQA 3ZO4A 3TG1A 1DAWA 2VWZA 2Y4IC 4AS0A 1J1BA 2QO2A 4YMJA 2Y6MA 2F7ZE 3RHXA 3UQGA 4JLCA 2IW8A 3R7EA 4RQKA 1UVRA 3IW6A 1U54A 4XV9A 4RQVA 3TNPC 4RIYB 1UA2A 1ZOGA 2WMVA 3OG7A 4MHAA 3G15A 3JR1A 4IVCA 5HGIA 3G9LX 3TUDA 4FNYA 3FPQA 2IN6A 4MBIA 5E91A 2OZOA 4J1RA 4G2FA 3OC1A 2ESMA 3FZSA 3RVGA 3ZZEA 4FV0A 4F9BA 1OPKA 4ACHA 4MBLA 4AFJA 2QOHA 3EN5A 5CAOA 5F94A 4CKIA 3NSZA 5ANEA 4BTKA 5BYYA 4IMYA 1T46A 5JRSA 3FLWA 5HNIX 2Y6OA 3BU6A 1J7LA 3OXIA 2X7GA 3WIKA 3FZRA 5L6PA 1XBBA 3C7QA 2NRUA 3NWWA 4QP4A 1NVRA 2UW4A 3ORXA 3OOMA 4YNOA 4E5BA 3VS1A 5IUGA 4O7TA 2ITOA 2BUJA 4CZTA 4U41A 4EK4A 2P2HA 2WB8A 5KMOA 3DLZA 3QTQA 2ITTA 3PA3A 3R30A 2GNHA 2F57A 3I81A 4C61A 4NSTA 4FEUA 4ORKA 5EDQA 1P14A 2VTQA 4ZP5A 3VULA 2XJ1A 2YDIA 4S33A 3UVRA 4G5PA 4I5MA 5AR2A 3R8VA 2PULA 2WHBA 4KA3A 1OKVA 4RZWA 3PE1A 4C0TA 3CGOA 1DS5A 3I0QA 3LAUA 2PVNA 3NYVA 3UVQA 3V5PA 4C37A 4ZY4A 4O81A 3VQUA 2WMAA 2ZV9A 1OL7A 1ZMVA 2XK9A 4X21A 4MK0A 4ZK5A 5BNJA 4PP9A 4UYNA 3KC3A 4JQ8A 2XKFA 5E8VA 2CN8A 5FEEA 3EKKA 1YI4A 4EJ7A 4WNKA 1PXKA 2PZPA 3BBWA 5AUXA 4HVGA 4B0GA 2ITWA 5L2SA 1M14A 3DJ7A 5AP3A 3BE2A 4DT9A 2FUMA 4B9DA 4D2TA 4KKGA 4I94A 5TE0A 1OMWA 2G2HA 3MVJA 4JQEA 4KB8A 4RRVA 2I1MA 4RGJA 4GG7A 3TNQB 5HTIA 4QP7A 1Z9XA 5LWNA 2YCSA 4YLKA 4D0WA 3W2PA 1HCKA 4F70A 4QPSA 3AMAA 3VRYA 3DFAA 3HNGA 1U5QA 3IQ7A 3LFSA 2YAKA 2QLQA 4Y5QA 4AZVA 5HIEA 4JDKA 2E2BA 4LL5A 4NCTC 5FEDA 5C4LA 4FK6A 2V5QA 2CLXA 2ZB1A 4EQMA 3COIA 3IONA 3C4ZA 3FZ1A 3OZ6A 5L4QA 3NAYA 4A7CA 4M69B 1E9HA 2WIPA 3NUPA 4O6LA 4ZTHA 4EC9A 4EWHA 2VTSA 4D28A 3BHTA 1YXXA 4WSYA 4BR3A 4DTBA 3QZFA 1OIUA 2PUNA 3DDQA 4H3BA 3FKOA 2OLCA 3UG1A 3OWKA 3PY0A 3T3UA 5CU4A 3UYTA 5AV1A 5CZHA 1GZKA 2XBJA 1PMVA 4HOKA 4QYGA 3ACJA 2Z60A 2ZB0A 3HKOA 4AN9A 5AADA 3CS9A 5ETCA 3F3TA 4I21A 3A62A 1PY5A 3R1NA 4EJNA 3ORIA 5DFPA 4V0GA 3F2AA 3V8SA 5IH4A 4P4CA 3NLBA 5HG7A 3ZS5A 4XG7A 2IVUA 2UZLA 4PTCA 4IEBA 4DEIA 5AV4A 4MEDA 3IW7A 5CVFA 4WG3A 2LGCA 2QURA 3UE4A 4CRLA 2GNFA 5ETIA 2X0GA 3MW1A 4Q5HA 4DN5A 1ERKA 4GV1A 3VQHA 4EK6A 1VZOA 3QUPA 3R7IA 3BELA 3PZHA 4UALA 2JC6A 2J2IB 4YJRA 4TYHB 5M44A 1UU3A 3HYHA 4FEVA 3MYGA 4D58A 2QOLA 2IJMA 4YJSA 1LEWA 1NVQA 1Q3WA 3OTUA 5BVEA 2R9SA 3MB7A 4AW0A 3CKWA 5EG3A 3GCSA 3TZ7A 1PMUA 4E93A 4JT3A 2KTYA 3FMLA 3MESA 5CANA 3IOPA 4F9CA 3W18A 3R7VA 4IAFA 4X6QC 3E8DA 3LMGA 4BTJA 1H08A 1WBPA 4XV1A 3NNXA 4QMOA 4C7TA 5ANKA 2PUPA 2OZAB 3KULA 4IFCA 5CEIA 3C4XA 2JKKA 2EWAA 4FKLA 2R3IA 3DA6A 2VO6A 4IADA 3W55A 4D1XA 2QOKA 1VJYA 2ZDTA 2HELA 3MTLA 3Q04A 3ZOSA 4F1MA 3LQ3A 4R78A 4OTFA 3H9FA 3QA0A 3EQRA 3PA4A 3VUKA 4ZTSA 4RSSA 5KHXA 3UJGA 4NH1A 3ZC6A 4QMYA 2GTMA 5LCJA 1SZMA 4GFOA 4IZ5A 4O2PA 3DAEA 4IAIA 4Y95A 4BCNA 1GZ8A 4FSNA 2XNGA 3IO7A 1OIYA 2P3GX 4FKPA 4HGSA 3O8TA 3NPCA 4EC8A 1OB3A 4MD9E 2VTRA 4AZWA 3UNKA 3FWQA 3KQ7A 3DY7A 4FTQA 3QAME 2XA4A 5DG5A 4E8AA 4UMTA 4HVDA 3T8OA 4BWPA 4BTMA 1GNGA 4R6VA 5EDRA 4CEGA 5B7VA 3WF6A 3I1AA 3KXZA 5L2IA 3IK3A 4FEWA 2JBOA 2C3KA 3JVRA 4XLIA 4Z7HA 3CKXA 5GZ9A 5EHLA 5EYCA 4BDDA 5AX9A 4F65A 1T45A 2G2FA 2VWVA 1A06A 3KRLA 4OW8A 5GJGA 3CPBA 4ZZOA 5TO8A 4FZ7A 4YC3A 4BN1A 4MH7A 3G0EA 2BR1A 3UC3A 3A2CA 3MA6A 3EZRA 4O27B 4IX5A 3V04A 3DNEA 3HAVA 5LVPA 4GKHA 2HIWA 2CMWA 2BTSA 3NEWA 5E8TA 4W4WA 4ACCA 4TT7A 5GZAA 2Q0NA 4C33A 4EOIA 4G31A 2J51A 4WHZA 2F9GA 1ZZ2A 4NEUA 5ANGA 4TYJA 4GEOA 4YJVA 2QHNA 4Y72A 5CT0A 4APPA 3LMHA 4USDA 4Y85A 2VAGA 1CDKA 3K2LA 3ATTA 5LARA 5C4KA 2R4BA 3FQSA 3IKAA 1BKXA 4RFMA 3ZM4A 4UV0A 5AEPA 3VUHA 4K0YA 4ANSA 5AR7A 2YHVA 1SNXA 5BVOA 3OWLA 4M15A 3RMFA 3RPVA 2WQOA 4FSUA 1ZMWA 4EWQA 1G5SA 3BV2A 2W5BA 3ENHA 3UBDA 2WQBA 2OI4X 4AT5A 4B6LA 4EYJA 2QONA 4MXZA 5DOSA 4D2RA 5CNNA 5AR4A 4EOQA 3P7BA 3MBLA 3VO3A 4XRJA 4F9YA 4A9RA 4OT5A 2C1AA 4FNWA 2BRBA 2O0UA 5FD2A 3UIXA 4KKEA 5F95A 2YITA 3WZUA 2I6LA 5M55A 4YBJA 4AGUA 4EKLA 3DQWA 3LFAA 3SDJA 4XV2A 5FLFA 1MRUA 2AC5A 5CU3A 3VUMA 4E5WA 5KNJA 3EFKA 1SVHA 3G0FA 4KS7A 3TZMA 4BDKA 4W9WA 4D5KA 1WBSA 3VUIA 5DEWA 3CCNA 3IW8A 3L9MA 1H4LA 4DGGA 4ERWA 2BZKB 3BHYA 5HEZA 3MY0A 1YVJA 4ANLA 4WOVA 5IDNA 1M7NA 3COKA 4OTQA 2ZM4A 3TNWA 4O0XA 3VHEA 2H96A 3O2MA 3QUEA 5CYIA 5EOBA 2W1FA 4KBCA 5DGZA 1UKHA 3JS2A 4RFYA 5HD4A 4GUEA 3M2WA 3KEXA 5F20A 1ZZLA 4XMOA 2W05A 4D2WA 5AUYA 1JQHA 1KOAA 3QQKA 3NVMB 5EKNA 5KBQA 3T9IA 2XNMA 3G6GA 3OT8A 4JRVA 3LCDA 4JIKA 4YJOA 5FRIA 4E6AA 4AZFA 1RW8A 4C38A 3BEAA 4FG9A 1ZYDA 3UIUA 4F6WA 3Q2MA 4GSBA 2QQ7A 4KNBA 2IPXA 3TDVA 3UQCA 4BCHA 3GCVA 5KMMA 4YJUA 3K5VA 3VUTA 2RFNA 4PF4A 3DK6A 3QGWA 4EOMA 4OTWA 4EH8A 3FXZA 1YW2A 2G2IA 4QMSA 1YDRE 2VZ6A 1YXVA 4OLIA 4C59A 3AC2A 1ZARA 4UEUA 4BKZA 3I4BA 4R1YA 2J5EA 3QRKA 3DXQA 3LCTA 4CGAA 3GU5A 5HORA 3KF4A 3IW5A 3UG2A 3TTJA 5D12A 4GYIA 5HCXA 4DFXE 1XO2B 5E8ZA 1J1CA 4IX4A 3VBQA 2BFXA 4L7FA 5AR3A 3BLRA 1PMEA 2CLQA 3BWFA 4E7WA 2VWBA 3V5LA 1UWJA 3UOLA 1IEPA 1IAHA 4MX9A 3HRCA 2J7TA 3GU4A 4FICA 5CVHA 5EI8A 5I4NA 2YCRA 4ZMEA 4O7RA 2QU6A 3MFUA 1P4OA 3N51A 3WF8A 3GFWA 3HVCA 2UZEA 2BILB 4DGOA 2PE2A 2HOGA 4L3LA 2VUWA 4R3RA 2FGIA 3RCJA 4DC2A 1VEBA 1H1WA 3MY1A 4RX5A 4ZLYA 4G3DA 4I5HA 3OCGA 5AMNA 5C8NA 2QCSA 4FF8A 4IQ6A 1M2QA 2C6TA 4JOAA 4YTIA 3NIEA 2OJ9A 4KINA 4BI2A 4DCEA 5CF5A 4FK3A 4FIHA 2GQSA 4FTRA 3ORLA 3S2PA 2XNOA 3H30A 3HMIA 5IA0A 1GAGA 3HP5A 3H0YA 3VVHA 3DV3A 3IDCA 4HPUE 2AC3A 5AA9A 5K5XA 3SG8A 3ZUUA 4NT4A 3LE6A 1M2PA 3QQHA 3PVBA 4PL5A 3HA6A 3WF7A 5KMLA 2PUIA 2WIHA 4L01A 4X3JA 2C0OA 1YXSA 3KGAA 5CAPA 3MVHA 2QOBA 2JD5A 3NYXA 4HZRA 5BPYA 5DYJA 4FKWA 5GHVA 5ITAA 1GIHA 2PVRA 3A8XA 5IA1A 5IZFA 5EM7A 4WNPA 4RA5A 4BB4A 2VTHA 3FV8A 3KFAA 4RVMA 2R3KA 3WBLA 4EK3A 4O0RA 2DYLA 3QTXA 4NZWB 5I3RA 4MCVA 4JS8A 5K0XA 3RK9A 4USEA 2V22A 3CY3A 3PG1A 2OFVA 1VR2A 3CD8A 3K3IA 4C4FA 1ND4A 3AQVA 2CDZA 2WMRA 1QPJA 3PXQA 3WZKA 2WNTA 4YHTA 1SVGA 2PZYA 4FOBA 4U5JA 3FQHA 4NKAA 4QNYA 1S9IA 3SC1A 4U40A 5BUJA 4ZJVA 2QOOA 2WAJA 2YCQA 4UMUA 4GUBA 5JFVA 4CFXA 1F5QA 4O82A 2UW7A 2Z7QA 1YI6A 3II5A 4RVTA 2JEDA 4Z7GA 4CLJA 3IGOA 3U6IA 4HVIA 1M2RA 4XEYA 3M11A 1P5EA 1O6LA 4V0GB 3MFTA 3CTQA 3U4WA 1ZAOA 4A07A 4EZ5A 3TTIA 3OMVA 4FV7A 5FXSA 3ID6C 2J0MB 4RVLA 5AAGA 4LQMA 4W4XA 5JZJA 5C26A 1Y91A 2C0IA 4XLVA 5TKDA 2FYSA 3LCKA 4FVRA 3T3VA 2W9FB 5ICPA 3Q9XA 2F4JA 4Q9SA 5M08A 4EQCA 4BGQA 3GQLA 3R2YA 4Z55A 3F61A 5AP0A 1G8AA 1R0EA 5IEVA 3QKLA 4IVDA 4N4SA 1TVOA 3LJ2A 4WKQA 4LG4A 5HU3A 3MGYA 4JR7A 3TUBA 5CWZA 4ASZA 4R5YA 3KK9A 4ITJA 4I0RA 4BIBA 2EXCX 1OKWA 4TZRA 5IUIA 2OH0E 4B8LA 3QUDA 2I0HA 5IG1A 4F99A 2A2AA 3WZDA 4IWQA 5CEOA 5B0XA 2WTVA 4QP1A 3PJ8A 3W2QA 2OBJA 3VJOA 3L8VA 4FUXA 3QC9A 4LFIA 4XP0A 3BGPA 3KULB 5HE2A 4BCGA 2BDJA 2EUFB 2RF9A 4FKTA 4I22A 4JDHA 1YRPA 3R1SA 2P55A 4WBOA 4WT6A 3ZDIA 5A4CA 4DBXA 1K3AA 5EHOA 4RBLA 3AC8A 4TW9A 4RWLA 3EQIA 1YDSE 4XYFA 4X2JA 4XH6A 2ETKA 5D7VA 2ZAZA 4PDOA 2ZV8A 4TYEA 3BU3A 4IFGA 3WI6A 2RGPA 4Q5EA 2QR7A 4X7QA 4UMPA 1JBPE 3VIDA 5AR8A 4ZTQA 4TN6A 3ZSIA 3SXFA 3U51A 4XS2A 1OGUA 2NPQA 4JX7A 1H1SA 2PU8A 3R02A 3WE4A 5L8JA 5HG9A 3ZFYA 4IAZA 4NFNA 2R3MA 2WFYA 2BFYA 3BI6A 2HW7A 2CKPA 2RFEA 1XJDA 2I0EA 5LQFA 5EW8A 1V0BA 2VTAA 3KL8A 4GH2A 4GVJA 5H3QA 2QU5A 3ANQA 2VX3A 4PY1A 1E1XA 4HNFA 4DT8A 4BZOA 3JY0A 3Q32A 4QYYA 3L8PA 5AV3A 4AZTA 3POOA 2Z8CA 3W2CA 1LP4A 1PXOA 5J5TA 4BL1A 4JBVA 3Q60A 5FTGA 4CD0A 5KZ0A 5J79A 4EBWA 3FL4A 4PRJA 3VS2A 4J8MA 4IWOA 1V0OA 3UOJA 4I23A 2VTLA 5IKWA 4YO4A 4D4VA 4HW7A 1ZY5A 4YU2A 2W4KA 3IOKA 1CM8A 3HDMA 4IB0A 4DA5A 4OTHA 2XZSA 3E64A 3OXZA 3R01A 4ZEGA 4S34A 4PX6A 4FVPA 1R0PA 3F82A 2PTKA 4UZDA 4DFYA 3CE3A 4M0YA 5CAVA 4ZS4A 3BCEA 3TI1A 2W4OA 4H39A 4AACA 4CFUA 4K18A 1Q5KA 2UW0A 5HLPA 4CT1A 2BHHA 3QBNA 5AUUA 5KX8A 4X3FA 3I0OA 3OBGA 3ZTXA 4IDTA 3ZFXA 1Q24A 4AUAA 4DFUA 5TOZA 3K54A 2WTKB 4IJPA 3RGFA 2PZRA 3D2IA 3DPKA 4EH3A 3ALNA 3GEQA 3GU7A 4A4LA 1IASA 4ITHA 3R73A 2C3LA 4WSQA 3NYOA 4C2WA 3HUBA 2VWYA 4JQ7A 4BC6A 3Q4ZA 4FKOA 3EYHA 4QRCA 1U59A 1ZWSA 5LVLA 4JRNA 4M3QA 4F08A 2I7QA 4C57A 3PJ3A 5AM6A 1LUFA 2QOQA 4I6HA 3ZFMA 4OTRA 4BI0A 4O7VA 3FMJA 4HGTA 1PXNA 2B1PA 3DT1A 2QODA 5FP5A 1Q41A 4UWBA 2X4FA 4Y8DA 3LXLA 4D55A 3P1AA 2PZ5A 4AGCA 4ARKA 1PXIA 4IWPA 3HDNA 4K77A 4R7BA 1YDTE 5D10A 5E8WA 2PHKA 3ELJA 3PVGA 4ASXA 3V5JA 3WYXA 4GRBA 1FQ1B 3THBA 2OH4A 2G1TA 2RFDA 3AD4A 2XK7A 4QMNA 1QL6A 3L8SA 4FV5A 3OY3A 2EB3A 3Q9ZA 4BIEA 2HZ0A 4XJ0A 3WYYA 4F6SA 4BY9E 3RAKA 4DEEA 4MD8E 1ZMUA 4HGEA 5HOAA 2PE0A 4GK3A 4GU6A 4I4FA 1W8CA 3HA8A 3EQFA 3TWJA 3HMMA 3LFFA 4JAJA 4QMPA 3CSVA 2WGJA 4QP8A 4EOJA 5HO7A 5LMKC 4QP2A 4O7ZA 5J7HA 4FL1A 3F69A 1LR4A 3OHTA 2YA9A 4YZBA 3NW7A 3F5PA 3EB0A 2C47A 3LXNA 4O86A 1MQ4A 3F7ZA 1YHVA 3QTUA 5I9ZA 5LWMA 2UW3A 3V5QA 3UVPA 3C1XA 4FV6A 5AWMA 5HTCA 4G1WA 4IE9A 4QMUA 4NK9A 4O96A 2VV9A 4YPSA 3OWJA 3KMWA 3D2KA 3E88A 2G15A 4CTBA 5LOHA 5HHWA 3ZMMA 3LW0A 5CEMA 3Q4TA 2W17A 4ACGA 1CKIA 2R3PA 3LXPA 3R8UA 1WZYA 2WU7A 2HZIA 3ZO1A 5A54A 3I60A 5CU0A 1S9JA 1W84A 3ETAA 3C4CA 4G17A 4O22A 1STCE 1QPCA 2B4SB 2OXDA 3DTWA 3E93A 4L53A 3ULZA 4K6ZA 4AGWA 4BDFA 2P4IA 5GIOE 3HEGA 3G33A 2R3LA 3UNZA 5HBEA 2XB7A 4XUFA 1Q62A 5EI6A 3LOKA 2ETMA 2JLDA 2VTMA 2XIYA 3Q4CA 3ZU7A 3QCYA 3R1QA 4XG2A 3BZ3A 4GIIA 5JFSA 3GT8A 4DEAA 1W82A 5ACBC 3VBTA 2QOFA 2X2KA 4ASDA 3KF7A 3MPTA 2R7IA 4FT5A 4O38A 3P79A 4CMOA 2OF4A 3EQGA 2CGXA 3Q6WA 5IQDA 4FKJA 4D1SA 3HECA 2VNWA 5HQ0A 4CSVA 4DCAA 2A19B 2GSFA 2JKQA 3L9LA 2XRWA 4FV9A 4CZYB 3OEFX 4BKYA 5M53A 3LXKA 4QOXA 4R77A 4X0MA 1OBGA 3AD6A 4D2PA 2XK6A 3CPCA 2JDOA 4FTIA 2YDKA 4AU8A 4JBPA 4YGAA 3OROA 4L3JA 2EVAA 3NZ0A 3I7BA 3EN9A 3VUGA 4DITA 1IAJA 4FR4A 5L8LA 1Q8WA 2GNJA 3RP9A 3GU6A 2H34A 1Y8GA 3HRBA 3R8LA 3HP2A 4J97A 3VW6A 4RC2A 5D1JA 4MQ2A 4BHZA 5A4TA 5AA8A 3RPOA 3E62A 3KY2A 1K9AA 1NY3A 4RFZA 3G2FA 4GK4A 4NM3A 4LV5A 5EK7A 3RWPA 4K11A 4QMQA 2V62A 4DE4A 2DQ7X 3GUBA 3MPMA 2YCFA 5A4EA 4FTMA 5E92A 5J95A 1Q97A 4OTDA 5E1EA 3RHKA 4WNMA 3Q53A 3O23A 4CNHA 5T68A 4WRSA 4B8MA 3S1HA 5FUTA 4J7BA 2NRYA 1MRVA 3U4UA 3FI2A 3VS6A 4EHVA 1WBOA 3R2BA 5HI2A 5KMJA 3DXNA 3EQBA 3BYSA 4F7SA 1OM1A 2XJ0A 2YN8A 4XP3A 1KOBA 4BGHA 3PY3A 3UODA 3R63A 5E8YA 5HD7A 3K5UA 3ZLXA 4O84A 3D9VA 3QD4A 1SVEA 3SGCA 2WTIA 3DLSA 1Q61A 4QT1A 5D7AA 3UMWA 4BZNA 4RIOA 2X2LA 3NNWA 5CXZA 3H9OA 3PWYA 5CXHA 4PTEA 4JG6A 5ANDA 1OL1A 2OO8X 3QZHA 4QNAA 3GCUA 3ODYX 4A9YA 5HX8A 4C3PA 5M4CA 1GIJA 2XRUA 3D4QA 4GKIA 1H28A 2W1GA 4PWNA 1KE5A 3PFQA 3TZ9A 3U9NA 4WNOA 2O65A 3MH0A 3U87A 4F7NA 3BIZA 3PPJA 3E7VA 4MXXA 4OAVB 4JIAA 4F7LA 4QP6A 4I6BA 3UGCA 1YOMA 5BX0A 3GXLA 3AC3A 5IMEA 2YJRA 1JVPP 1Q99A 4G6NA 1URWA 3QQLA 3F9NA 3O8UA 3ZLSA 4HVSA 5AP7A 3UIBA 4J52A 3V8WA 5LVNA 4D4SA 3ZBXA 1AD5A 4XBRA 3NCZA 4IAYA 4J8NA 1RJBA 2BDFA 2C6IA 1OIRA 3REPA 4FUYA 4MXCA 4FTJA 5FM2A 3NS9A 4TXCA 3PJCA 2HYYA 1BLXA 4M14A 5BMMA 4G16A 4RIXA 2Y8OA 1Y6AA 4ALWA 1JNKA 4FTKA 3B8QA 4DG3E 4EOKA 2CNVA 1CSNA 3UO4A 5EYMA 5ACKA 3U55A 3OTVA 3E8NA 4CYIA 4A9SA 5HBHA 3HUCA 2IO6A 2BROA 5HLNA 3N9XA 3W8LA 3AT3A 3A7JA 5HE0A 3TJCA 4NTSA 2QI8A 5JGDA 4V04A 4O2ZA 4EUTA 1U4DA 2WMSA 5GNKA 3Q3BA 3VF9A 1PXPA 3H9RA 5H8BA 1H24A 4BDJA 5M4FA 2GQGA 2O63A 3IG7A 5J9ZA 5LMBA 1UNHA 2X39A 3ZLYA 4CFNA 3AGMA 4EK8A 3DTCA 3ACKA 3F5XA 1OL5A 2WMTA 5BVWA 5JQ8A 3FQEA 4I20A 4M84A 4QMLA 3UP2A 5M06A 3TV7A 1WBTA 4BWXA 2XKEA 1XH6A 2YWPA 2IW9A 5F9EA 3PVWA 5JGAA 5ANIA 3TKUA 4YTCA 4FA2A 3RM6A 5H2UA 4PPAA 4YTHA 2R7BA 3BU5A 3K3JA 3ROYA 3R9HA 2JFMA 3SQQA 3A99A 3BQCA 2IZTA 4ALVA 3ULIA 4YO6A 3HLLA 3S0OA 4FBXA 2ZMCA 3RKBA 4R7IA 3W10A 4XP2A 5C9CA 5IQBA 2PMLX 5BQ0A 5I9VA 3RJCA 2YM4A 3TJDA 4Z3VA 3U54A 3FKNA 4GYGA 4TWNA 3W1FA 2B52A 3WF9A 4AQCA 1JOWB 3BV3A 4CRSA 1AQ1A 4B4LA 4BYJA 4OUCA 4F7JA 4ALUA 4KSQA 3FHIA 3LPBA 5IA3A 4G3EA 3AC4A 4EZ7A 5IUHA 3DB8A 3RNIA 2ZV2A 2EB2A 1LPUA 3A4OX 3D7TB 2YERA 3CC6A 3FY0A 4G9RA 4LRKA 5LCKA 1GZNA 5EM5A 4IDVA 2F2UA 4MBJA 3SRVA 4QTBA 2X81A 3KXGA 4IC7A 2XYNA 3DDPA 3QD2B 3G9NA 4BDAA 4AA5A 2PVJA 2BRGA 4NFMA 3EN6A 5FDXA 4FVQA 3F3ZA 2GNGA 5AAEA 2WQEA 2O2UA 2OXYA 3AG9A 4HCTA 4X2NA 4I92A 2B9HA 3CGFA 2RG5A 4IW0A 2VN9A 4KIPA 5EI2A 4KABA 4PUZA 3OY1A 4YSJA 5KKRC 4L00A 1NXKA 2XMYA 2C0TA 3HMOA 2YACA 3RPYA 3OCBA 3PXKA 5DT3A 5L8KA 3DAJA 3VS0A 3FHRA 3DKFA 1PXMA 2R5TA 2OIQA 3GI3A 4BCIA 2UZBA 4FKQA 2O5KA 3ZZWA 3TUCA 4IANA 5IH5A 2R0UA 4OBQA 4RMZA 5HVJA 2B9IA 3Q6UA 1H01A 3QFVA 3UPZA 4O7WA 4FE2A 2WOUA 3KMMA 3MJ1A 4EH2A 1VYZA 3WIGA 2B0QA 1XBCA 3BLQA 4MXOA 1UU9A 4Y83A 2PVKA 1YOJA 4E4NA 4F4PA 2PVFA 4MXAA 4PMPA 5M51A 3DCVA 5HBJA 3QRUA 1W83A 3H10A 1YXTA 3B2WA 4U80A 4ZMFA 2C69A 3JY9A 4I6QA 3MS9A 4NL0A 3HV5A 3SLSA 4FSZA 4AA4A 5L2TA 2BZHB 3ZRLA 1KE7A 4BCFA 3ZLWA 4ZSLA 3TKIA 4QQTA 4C3RA 4E4XA 4YJTA 3PLSA 5K4JA 3OF0A 1OKYA 3R04A 2J0KA 4IB3A 3ORNA 2W96B 3ZYAA 2C6LA 2OICA 4AX8A 4ITIA 3JYAA 2VX0A 5CLPA 1DAYA 5DEYA 1UKIA 3OUNB 1XH4A 3PJ1A 3DJ5A 4MNEB 3QD0A 5AAFA 5IU2A 3KRRA 4YBKA 2JIVA 3QTWA 1B6CB 3A61A 5HE3A 3VBVA 3VWAA 1GIIA 5D11A 4I24A 4UMRA 2VWUA 3FMNA 4QO9A 3DBQA 1W7HA 2Y7JA 2VWIA 4YJNA 3HAMA 3OBJA 3FLNC 4L45A 2CGVA 2C5VA 3OXTA 1WBNA 4F63A 1U54B 3PE2A 2R3JA 4LRJA 4DGNA 3WZEA 4EYMA 1WVYA 2UZDA 2B9JA 2W1DA 4EOSA 4KSPA 3BX5A 4EOPA 2HENA 3U6HA 4A4XA 4RIWA 4YLLA 3PWDA 3F3WA 1YI3A 3NYNA 2P2IA 4EHGA 3HMPA 3SAYA 2QOCA 5I5ZA 4TYGA 3RALA 3FC2A 3OOGA 4NWMA 2G9XA 4B99A 2X1NA 3D15A 3EFWA 3R9OA 2GNLA 3DK7A 2F49A 2WEIA 5CS6A 1FINA 2I40A 3VS5A 5EQPA 3GC7A 3PPZA 4YURA 2UUEA 3FC1X 2JAMA 2C6MA 2Q0BA 2WZJA 3ITZA 2BRHA 3ORKA 5CVGA 3V5WA 3TZ8A 4FSWA 3AXWA 4CT2A 1UNGA 1OITA 4OGRA 4QQ5A 3M42A 4IVBA 4C4IA 1R39A 3A7GA 3GOKA 2OGVA 3SW4A 3U6JA 2PVMA 4BHNA 3P0MA 4TKSA 5C27A 3SOCA 4N70A 1UU8A 3TIZA 4QTEA 3LQ8A 5BUEA 3OT3A 3PSDA 4HGLA 4MYGA 3SKCA 3O8PA 4KIQA 2E9PA 2QVSE 3QL8A 1O9UA 3MVLA 4TL0A 3FSKA 3HL7A 3QWJA 4XOZA 4NJ3A 1J7UA 3MFRA 2ZOQA 1XR1A 4I4EA 2PVLA 4O7NA 4EH5A 2B7AA 4WBBB 5L6WL 3R7OA 2FSMX 2BAKA 4ZXTA 2JDVA 4JL9A 3UC4A 2GCDA 5E90A 4FTOA 3V01A 3R9NA 5DMZA 1ZYSA 2QG5A 3F5UA 4J71A 4I93A 3HZTA 3VJNA 1X8BA 3FI8A 4I5PA 3KVXA 4EZ3A 5FGKA 1F3MC 4AE6A 4CCUA 3CTJA 4S32A 4AGDA 5CAUA 2HW6A 4FTAA 3A7IA 4DF3A 4BDBA 3FMKA 2A4LA 3S3IA 3EN4A 1FMOE 1Q4LA 1XBAA 3GC9A 4ONAA 2YFXA 3FMMA 4JG7A 4BKJA 2C3IB 1JKSA 3R8ZA 4N57A 4J53A 4IM2A 4XX9A 3FLYA 1TQPA 4IC8A 2V0DA 1TQIA 4QPAA 2WTKC 1YXUA 2RG6A 3QF9A 4GW8A 3RAIA 4I5CA 2R3RA 4NKSA 5EM6A 3DKCA 1H0WA 4HVHA 2OIDA 5EH0A 4EBVA 5IEYA 4FV3A 4M97A 2XP2A 2QNJA 5E8SA 4QMVA 2XEYA 4WRGA 4G3GA 3DGKA 2OWBA 3QHWA 4GS6A 1H8FA 5CTPA 3KB7A 3LJ0A 4ENYA 1ZYLA 1PYEA 3BKBA 2AUHA 5J5SA 5KKRB 2WU6A 2OXXA 3IECA 2AYPA 5FP6A 1QPEA 2FO0A 3POZA 4G5JA 5BMSA 4F9AA 5M56A 2YAAA 3KMUA 1NT2A 5M09A 4DINA 3OVVA 1RQQA 2VTTA 3PPKA 3F2NA 4FIFA 3PYYA 5DBXA 1Y8YA 2ZM3A 2B55A 4A06A 2XK4A 4FKSA 2WPAA 3O71A 3PIYA 4FZFB 5G6VA 3RBWA 4M12A 2JKMA 3ZUVA 4AOJA 4L7SA 3D94A 3IS5A 4O1PA 2J0JA 1GJOA 2OK1A 2XKCA 4RIXB 1OVEA 4CVAA 3LFBA 1GZOA 3WF5A 5HCZA 4CKRA 4F0IA 1ZXEA 3PSBA 4BDGA 4E6DA 5BUIA 3EZVA 4JBOA 2QC6A 5FBNC 5EYDA 4OBOA 4AT3A 5A46A 3KXNA 2A1AB 4TNDA 4U3ZA 3MH1A 4IZ7A 2PZIA 4ZSAA 4WA9A 4P5QA 1Z5MA 5C8KA 2QO9A 2CGUA 2WELA 3FJQE 4J96A 4MF0A 3Q52A 3HX4A 3P78A 4FSRA 4IX3A 5BVFA 1JAMA 1GOLA 3ERKA 4EH9A 1J3HA 2HXQA 3R8MA 3O7LD 1IA9A 5A4QA 3MY5A 3FZTA 4W4YA 5FDPA 3C13A 3V8TA 4C4HA 3UOKA 4CG8A 1OZ1A 3EHAA 1GY3A 2UZUE 3FPMA 3UOHA 2PY3A 2E9OA 4IH8A 4CKJA 3CQWA 4BCPA 3E3PA 5C03A 4RJ4A 4ANMA 1O6YA 2JFLA 3FL5A 3QD3A 4K2RA 3P86A 2ERKA 2ITVA 1XHAA 5CALA 3JPVA 4LL0A 1L3RE 5AIRA 1URCA 4U45A 4RLKA 3JUHA 5DWRA 4EUUA 5IQGA 4KRCA 2VRXA 1OL6A 2JDRA 2P33A 4FTUA 4IAKA 4XG4A 4FIJA 2W9ZB 4ZZNA 2PVHA 3H3CA 3O17A 3I6UA 4LUEA 4O0WA 2FVDA 4CFWA 3NGAA 4XG9A 2JGZA 5AIKA 5KBRA 5LVMA 3KXMA 4XBUA 2XNPA 2BRNA 3FLZA 2UZNA 3NUNA 3HRFA 4O7SA 3MN3A 1JLUE 2QOIA 5KCVA 3LVPA 4DBNA 4K9YA 5ANJA 3MA3A 3HV3A 4FT9A 3SW7A 1I44A 4FZAB 1JKKA 1F0QA 4O0YA 4RT7A 4R1VA 4E3CA 3SRVB 2GHLA 3A7FA 3F3UA 3R1YA 1IR3A 3F5GA 4E4LA 3EIDA 4H1JA 3H4JA 2CGWA 3NW5A 5DLSA 4BDHA 4XNEA 5HX6A 4KUJA 3FEGA 2CPKE 3DXPA 3VBXA 2UW9A 3EWHA 3RK7A 4MXYA 1ZRZA 1SMHA 4N0SA 4YHJA 5DR9A 4GL9A 3NNUA 5ANOA 4AZSA 2W5HA 3ZM9A 3N4VA 5AP2A 2VO7A 2R3HA 4P7EA 3Q2JA 4FV8A 5IA2A 3TNIA 5H9BA 2W99B 4F6UA 4JDJA 3PIXA 4PMMA 4FYOA 2J50A 5A3XA 3R6XA 2UVYA 4J98A 2GHGA 2YWVA 2BZJA 3C0IA 3IDBA 3MVMA 3QRJA 3COMA 3U9CA 3R00A 2O3PA 4D9UA 1ZYJA 4IB1A 4YJQA 5A9UA 2IVSA 2NP8A 3D5WA 4KAOA 3TEIA 3WILA 5J87A 5DVRA 3NAXA 3NCGA 4EH4A 3BWJA 4BWKA 3TV6A 4EOLA 4CMUA 2HXLA 2XIRA 5DA3A 3PUPA 3QKMA 3ZXTA 2BKKA 2X6DA 4O83A 4FODA 3MH3A 4IWDA 3C4EA 4GFMA 5EM8A 3UPXA 4G3FA 1OECA 4UN0C 2ITZA 3I6WA 5CF4A 4USFA 3AGLA 4FKIA 5B2MA 4B7TA 3TDWA 3RM7A 3BEGA 3FMDA 2PMNX 2J6MA 5HESA 3RTPA 5T3QA 3RWQA 2YZLA 4RWJA 4FIIA 4LGGA 4CV9A 4M13A 3QRTA 4H05A 5L3AA 3ZDUA 3IW4A 2VWWA 2ONLA 2PE1A 5HCYA 3BPRA 3P7CA 4C4JA 5GJFA 1UV5A 2BIYA 2JIUA 4W9XA 2XK8A 3R9DA 3IGGA 5CT7A 1P4FA 3OEZA 4D2VA 2E9NA 2XKDA 5DRDA 2OZAA 2C4GA 2J5FA 2JDTA 4L42A 4P2KA 4YZCA 1J7IA 3F7WA 3QKKA 1A48A 4CMTA 4TTHB 5JK3A 1PKDA 1ZY4A 2GNIA 4FTCA 5CSWA 4C4EA 1J91A 1WAKA 1FGIA 4NW5A 3EQHA 2XF0A 3NNVA 3LJ1A 4KKHA 3VS3A 2Z7SA 5KE0A 2CHLA 4PPBA 4IZYA 2R3NA 3EMGA 3GFEA 3MJ2A 4FG7A 4ANBA 2GU8A 4XG6A 5CF6A 4LUDA 4PTGA 2OU7A 4I1ZA 2O8YA 2PYWA 3LCOA 3PLAE 1WVXA 3UDBA 4BZDA 2X8DA 2WMWA 2X2MA 5EW9A 4YP8A 3FI4A 4LYNA 3KRWA 3PY1A 3O96A 4G34A 4R3CA 4RIWB 2PK9A 4UXQA 2H9VA 4FV1A 1IRKA 4WG5A 5CI6A 2LAVA 2BPMA 5IF1A 2PWLA 3HV4A 4CTCA 3ORMA 4IZAA 4FKVA 3AT2A 3QALE 4M0ZA 5CSPA 3UQFA 5J1VA 3TKHA 4CCBA 5LVOA 4U81A 4JBQA 4MNFA 5DNRA 4ZAUA 4LGDA 1U5RA 1REJA 3C4FA 4QPMA 3QQFA 1KWPA 4XCUA 1M52A 3DJ6A 2NNWB 2YDJA 2XIZA 3FSFA 4S31A 1W98A 2BAQA 4TWPA 3LMIA 1B38A 1IA8A 2R0IA 3L9NA 2WTCA 3H0ZA 4CQEA 5E9EA 4DYMA 3PVUA 1UNLA 2VX1A 4ZTMA 2H6DA 4IX6A 2FB8A 2W06A 3W16A 3ODZX 2HWOA 3AOXA 4WIHA 3WOWA 3ZRMA 5J7BA 3L9PA 4M68A 4DEGA 4DG2E 2ITUA 2HAKA 3VC4A 2YM7A 4CZUA 5FXRA 4U6RA 4GK2A 5IQIA 3MSSA 3P9JA 4CYJA 1OPJA 3KCKA 2WXVA 4D5HA 3A60A 5CY3A 1WMKA 3DBEA 4L44A 2C1BA 3D0EA 3G90X 3LFQA 5AV0A 5I9UA 4YHFA 3TV4A 4DFLA 5JN2A 5H8GA 2GTNA 5CEPA 2WO6A 1YKRA 3I5NA 1BMKA 3ATSA 1RE8A 4L52A 2W1CA 3ZCLA 1Q3DA 4E26A 4J99A 4MD7E 3CJFA 1QMZA 2V7AA 3UTOA 4UX9A 4IVAA 4HYHA 4IB5A 5D9HA 4FX3A 4U0IA 3RPSA 2WTWA 1JSTA 4JX3A 4CFVA 1CKJA 4K1BA 5J1WA 3UMXA 1PKGA 3Q96A 4X3FC 3W33A 4FGBA 4NCTA 3ZO2A 3O7LB 3B8RA 3RZFA 3F2RA 2C5NA 4E4MA 4FT7A 1KSWA 2CCHA 3PXZA 4BFMA 3DB6A 4XV3A 3VS4A 4U43A 4V05A 4KIKA 4UBAA 4BBMA 3Q4UA 5KZIA 1FVTA 4OT6A 1BL6A 4OTPA 4C34A 4LM5A 2JITA 3FAAA 3KN5A 4BTFA 4RJ6A 1Z57A 4ZSJA 2QG7A 3SXSA 4Z16A 4W4VA 3CQEA 4APCA 4F09A 1Q8ZA 1XH8A 4RJ7A 2UW5A 4ZZMA 1BX6A 2EXEA 3R22A 4UB7A 3TM0A 4O0VA 1H25A 1FVRA 5BYZA 4QMZA 4BYIA 4NTTA 3O50A 2UW6A 3VBYA 3FLQA 3GGFA 4YPDA 5JQ5A 2B9FA 2OW3A 3FYJX 4LOPA 4BCJA 4C35A 5C8MA 4KWPA 2REIA 5EQYA 1H0VA 2V7OA 1PJKA 4L43A 4AOIA 4DH7A 4YZNA 4NUSA 3D5VA 1LEZA 3EQCA 1Q8YA 2XS0A 3EH9A 3QTSA 2F7EE 4YJPA 1SNUA 4Z9LA 4NJDA 5IEXA 2IWIA 3PJ2A 5GZ8A 2PL0A 4C4GA 4O7YA 4AG8A 2E9UA 3DZOA 4ANNA 4A4OA 1KV2A 3IPHA 5DHJA 4O7LA 5AR5A 3AC5A 2HK5A 3JVSA 3QXOA 4Q2AA 3TT0A 1CKPA 2C5YA 1Y6BA 3E63A 4QQJA 3R7UA 5AV2A 3TACA 2BDWA 5AUWA 2J90A 2W1ZA 2WD1A 1YOLA 3CTHA 3I7CA 4IIRA 4JR3A 5FQDC 5TF9A 2VGPA 2YM3A 3BYOA 3KRJA 4FKUA 4IXPA 4EH7A 2W1IA 5DPVA 1JPAA 2RKUA 2XNBA 3DK3A 3I5ZA 4I0TA 3L8XA 1IG1A 2XM8A 5F4NA 5JT2A 1KE9A 4EQUA 5I3OA 3GQIA 3QXPA 3A8WA 3C5IA 2PSQA 1PXJA 5M4IA 3D5UA 4DFNA 3BQRA 4RJ8A 1FGKA 4FSMA 5IPJA 1MP8A 1M7QA 4O0TA 4EEVA 3S00A 4FL3A 3NIZA 4H1MA 1ZOHA 4PDSA 2IG7A 4WO5A 1XKKA 4TRLA 4LI5A 1KV1A 4FEXA 3P23A 3LCSA 2C3JA 3G51A 2PMIA 5J9LA 1HOWA 3MIYA 2GMXA 4LOQA 4IHPA 3ZBFA 4AAAA 4GCJA 3IDPA 2J4ZA 2ZM1A 5HICA 2YM8A 2FSOX 4NYEA 2EXMA 4HYIA 4ZIMA 1NA7A 3TNHA 5FEQA 4LOOA 3FXWA 3RINA 2FH9A 4TY1A 4IBMA 4FTLA 4L6QA 4FIEA 3PG3A 4O0SA 3QZIA 2ITPA 3KU2A 3R28A 1H1PA 4FT0A 5A6OA 2HZ4A 4Y5HA 3F66A 3QGYA 4C8BA 4HYSA 4BGGA 3GB2A 1APME 4KD1A 1H07A 3V6RA 3MB6A 3QWKA 1H27A 4XG8A 5FWKK 1NVSA 2R3QA 3PXRA 4RZVA 5EQEA 4RLLA 2ACXA 5G1XA 4NIFA 1KE8A 4E6CA 3W32A 4QTCA 4FNZA 1OIQA 1HCLA 5DE2A 2WOTA 4QMMA 5AUZA 2G01A 2W1EA 2WMBA 3UZRA 2X7FA 4P90A 2W7XA 5FG8A 4C2VA 5I9WA 1DI9A 4L8MA 5FBOA 5A6NA 4GIHA 2XIKA 5JSMA 4H3PA 5JRQA 1REKA 3E8CA 5I9XA 3ZHPC 3ZEWA 3E3BX 1BI7A 3BHHA 3TCPA 1Y57A 3R21A 2XBAA 4JXFA 5JFWA 1TQMA 3E8EA 4G9CA 3DBDA 3KREA 1PHKA 2UZWE 3ENMA 4L68A 5IA4A 5IQCA 2GS7A 1YHSA 1MQBA 4AA0A 4C58A 4DFZE 5AUTA 3C0HA 5BYLA 2X8EA 4X2KA 5AP4A 4KIOA 4BIDA 4AW2A 4GT5A 4D1ZA 1MUOA 1P2AA 4UYAA 2VWXA 2Y0AA 4Y73A 4DLJA 5K4IA 4DG0E 4PNKA 4GMYA 3PZEA 4EKKA 2W4JA 3CY2A 4RJ5A 4S30A 5EYKA 4IM3A 3UZTA 4PDYA 4NM5A 2RSVA 4D4YA 3ZXZA 4AT4A 1EH4A 5K0KA 4W8EA 5DT0A 4U7ZA 4X3FB 2WQNA 3QYWA 3P08A 3MTFA 4AXAA 4ZLZA 5EDPA 4BCMA 3C9WA 2XH5A 1YWRA 4BBEA 3D14A 4WG4A 5J9YA 2EU9A 3DFCB 2YZAA 2C68A 3CLYA 2DWBA 1L8TA 2BALA 3QCQA 4BBFA 4ZSEA 2Y4IB 2ITYA 2Y4PA 2BAJA 3QTZA 3RAWA 1DM2A 5AX3A 2H8HA 5E4HA 1O6KA 4PQNA 4ZS0A 3UIMA 5GINE 4AZEA 5LJJA 4BI1A 5KMKA 1YQJA 4ACDA 4BF2A 4RVKA 2ITXA 4CFMA 3DZQA 4FT3A 4RX9A 3W2SA 2GS2A 2YEXA 3PSCA 4HCVA 3FE3A 4NU1A 4DLIA 1FOTA 5HO6A 5I9YA 4YZMA 4EH6A 2YIXA 2JKOA 2BVAA 4ZTNA 4X2GA 2FSTX 5CI7A 3SVVA 3EJ1A 3DQXA 4UZHA 4MWIA 2OIBA 3OW4A 4ASEA 3N4TA 3MV5A 4H58A 3MIAA 4UY9A 4JAIA 3EYGA 1Q8UA 4AFEA 3FKLA 3W2RA 4U9AA 3KK8A 1H1RA 4FV2A 3MI9A 3KCFA 4M8TA 3HV7A 3KRXA 4G6LA 4FEQA 2JIIA 2BTRA 1M17A 4KBKA 4MQ1A 1Q8TA 2QR8A 3LFDA 4WD5A 5CEKA 3OD6X 3R71A 3RK5A 4C62A 5J8IA 3ZSGA 4I3ZA 4BICA 3UO6A 3V5TA 2WEVA 3DU8A 4AW5A 1XWSA 4NM7A 3GU8A 2C6DA 2WQMA 4ANOA 1V1KA 1BUHA 2WMXA 3AD5A 3SA0A 2CN5A 3VHKA 2J9MA 2X4ZA 2C5OA 5IQEA 3LFCA 4PNIA 5AP5A 5EFQA 4DEDA 2B54A 3MWUA 2CKOA 5KMIA 3QCSA 5HVKA 3CQUA 4GU9A 1KE6A 2XEZA 1AGWA 2YM6A 1H1QA 3P7AA 2F7XE 2VTNA 4F64A 1XH9A 2VTJA 5CENA 3S4QA 2A0CX 3FUPA 5FTOA 4F1OA 3RI1A 1PF8A 4TYIA 3MDYA 2QKRA 4FTTA 1BL7A 2Z02A 4W8DA 2XNNA 5DI1A 3W8QA 5JEBA 5M57A 4D0XA 3S95A 2OKRA 2BMCA 4QQCA 4S2ZA 4MF1A
chains in the Genus database with same CATH superfamily
1G8SA 2Y9QA 4OBPA 5EW3A 4ZY6A 3PDTA 3KVWA 2PVYA 4KBAA 5IDPA 2GPHA 4BCKA 4D2SA 5GIPE 3OW3A 2WTDA 2XYUA 4EHZA 5CSHA 3V3VA 2X9EA 4AP7A 3QX4A 3DBCA 3UZPA 5DR2A 3LLAA 4ZTLA 2ZYBA 5BVKA 5HLWA 5K5NA 3Q5ZA 4MVFA 3SOAA 4ZJIA 3NFFB 4FYNA 4HZSA 2WTJA 4CG9A 2X8IA 2E9VA 4DTKA 2VGOA 2VO3A 2R3OA 4KIKB 1CMKE 5C1QB 3BHVA 2HWPA 1R3CA 3ZSHA 5L6OA 5FTQA 5CQWA 3D83A 5HNGA 4EHEA 3PRFA 5IH6A 2P0CA 3UNJA 3BYUA 5ETFA 5F1ZA 1JKLA 3RCDA 2OSCA 2C30A 4ZLOA 3EN7A 2XIXA 5CQUA 3EQPA 2CNQA 4UXLA 5HG5A 3LQ5A 4DEHA 3VNTA 2Z7RA 4G3CA 4I6FA 5M07A 4U42A 3GBZA 4PMSA 5CSXA 3V51A 5E7RA 3BE9A 4TPTA 5DR6A 2GFCA 3ZEPA 1NW1A 4EK5A 4BJJB 4OTGA 2OFUA 5HG8A 3HV6A 2IZSA 4GFGA 2SRCA 3MFSA 4EL9A 1PXLA 4RA4A 2J0LA 1JKTA 3ZH8A 3UO5A 2OJIA 3BHUA 3CJGA 4L46A 4DTAA 3NDMA 3O0GA 4QTDA 5CU2A 4ZSGA 4ID7A 3RAHA 3GENA 1PRYA 4LRMA 3NW6A 3R8PA 1ZOEA 4QP3A 4QYFA 4XHKB 3E7OA 5KMNA 4BCQA 1QCFA 4EONA 5L2QA 4U44A 3RZBA 4R5SA 3SD0A 1OKZA 4FMQA 2FSLX 4MWHA 2XM9A 4KRDA 4UWCA 3UYSA 5ETAA 4RX7A 5HVYA 3QLFA 3E87A 3G5DA 4DH3A 1WBVA 4RX8A 2IVTA 5E1SA 2YJSA 4EI4A 1XH5A 4OAUC 4FG8A 2XCKA 4FZDB 2XUUA 1B39A 4KS8A 2RIOA 3N4UA 4AXCA 1MRYA 2GS6A 2IZUA 1G3NA 3C51A 4O0UA 4CFFA 2PPQA 4AF3A 3UP7A 4MKCA 3A7HA 3VBWA 3BBTB 3EL8A 4U97A 4J95A 4LMNA 3OCTA 4YTFA 5BVNA 4FI1A 4ZY5A 4RIYA 1PW2A 2UW8A 1JSVA 2VNYA 3Q5IA 4M7IA 4A9UA 1PMNA 5HE1A 4X6RA 3KXHA 1QPDA 4IJ9A 4YZ9A 3NVKI 2BZIB 3BLHA 5HIDA 3EL7A 2NO3A 5B2KA 3F3VA 2DS1A 3NUYA 3KA0A 3CEKA 3QQUA 2XNEA 4DAWA 4HYUA 2GHMA 5IMXA 3ORZA 2UZVA 2ZDUA 5CASA 2IVVA 3WZJA 1WBWA 4F78A 4TWOA 5EHYA 3FMEA 2GFSA 4E6QA 5HTBA 5AM7A 5HO8A 2W0JA 4O21A 4LDTA 4NIFB 2QKWB 4GG5A 3R7YA 3MPAA 2VU3A 2WMUA 4E73A 5IQFA 5LMAA 2VTPA 4G6OA 4PL4A 1XQZA 2WKMA 4YLJA 5FXQA 5CZIA 5AP1A 3E5AA 3WE8A 3C50A 5E8UA 4X2FA 4F1TA 4N6ZA 4DEBA 2RL5A 2RFSA 4FSYA 3QCXA 3QX2A 3AMYA 4TNBA 4A9TA 3NR9A 3ORTA 5EOLA 1BI8A 3VAPA 3PP1A 3VW8A 1RDQE 1E1VA 2OF2A 2YIYA 4LGHA 2BHEA 3BYVA 5CNOA 2W1HA 3V6SA 4O91A 2VO0A 5DH3A 4Q9ZA 3R9RA 4AWIA 4FKGA 3FYKX 1ST4A 2R3GA 3SHEA 4RPVA 5KO1A 2VD5A 3QLGA 2QO7A 2I0YA 4F0FA 4H36A 4D4RA 4YC8A 4BDIA 2A27A 2C6OA 3LHJA 3BGZA 4HPTE 3ZC5A 4PDPA 4L3PA 4FTNA 3DNDA 4JDIA 4M67A 5KHWA 2QD9A 4RWIA 3VF8A 3NUUA 3SV0A 5CEQA 3PXFA 4QMXA 4HCUA 1FVVA 3Q9YA 4K8AA 2CKQA 3VRZA 3FMHA 3LFNA 2QLUA 3FY2A 1ZYCA 4EORA 4L67A 1YHWA 2C6KA 3RPRA 4I41A 3TN8A 4WUNA 2HZNA 3EQDA 4P5ZA 2B53A 2UVZA 4XG3A 5K3YA 3RNYA 1R1WA 3DKOA 2J0IA 2W5AA 5IISA 5FM3A 4EOOA 5AUVA 2HCKA 3DOGA 4QYEA 1OL2A 3KXXA 4L9IA 1SYKA 4M69A 5TR6A 1WFCA 4C02A 4GT4A 4U79A 4GVAA 5H8EA 3NX8A 3EFJA 3QYZA 4NW6A 4JVGA 5KUPA 2Q83A 4ZOGA 5DIAA 3TMOA 2YIWA 5CF8A 2O64A 4ERKA 2HY81 2X0PA 3C4WA 4YUQA 4PMTA 4O6EA 4MTAA 4WUAA 3GNIB 4C3FA 3LLTA 4PL3A 1BYGA 4CLIA 4IACA 1SM2A 3FLSA 5HKMA 3TIYA 1JSUA 1H00A 3GC8A 3COHA 4DGLC 4F9WA 5LMKA 3FXXA 5M4UA 3SXRA 4I0SA 1K2PA 3ZUTA 3CIKA 3LFEA 4BCOA 3DBFA 3LM0A 2OG8A 5GJDA 1FMKA 3DKGA 2OJGA 1JWHA 2V55A 3QU0A 3QHRA 3G6HA 3TXOA 1YWVA 2YM5A 5CAQA 3GCPA 1KUTA 3AT4A 4LMUA 4YZDA 4PPCA 3W0MA 3NUXA 5AFVA 2UZOA 4U8ZA 4CV8A 2Z2WA 2UVXA 1R78A 5DT4A 4FKRA 4ANQA 4CXAA 2JDSA 3GOPA 5C01A 4ZJJA 4TYHA 2XJ2A 3CBLA 4ENXA 2YISA 4CQGA 2GQRA 2X7OA 1FPUA 2ZMDA 2BIKB 3KKVA 4IM0A 2C5XA 2VTOA 5AP6A 2CNUA 2XVDA 3ZRKA 4QD6A 4AW1A 3GC0A 3P5JC 4Y46A 4E20A 4R8QA 2NYAA 5JFXA 4DH1A 3EKNA 2YLEA 2XARA 1VYWA 1OPLA 4QTAA 4BRXA 3DS6A 3WARA 5A4LA 1UWHA 2ZV7A 3CXWA 2XK3A 1PYXA 2BRMA 2HY0A 3D5XA 4E5AX 5IQHA 3LIJA 4FL2A 4QYHA 5HNBA 5B2LA 3LM5A 3PRIA 3PTGA 3A4PA 3B2TA 3OUKA 3U8WA 2UZTA 1H26A 3FZOA 4YC6A 2WMQA 4UWYA 3NMUF 3AMBA 5T6KA 5LXMA 3NUAA 4H3QA 4M66A 4OR5A 4FV4A 2IZRA 5A14A 5TT7A 3QQJA 2C6EA 4R7HA 4BDEA 2Z7LA 1CTPE 3BYMA 4AN2A 1WVWA 3HMNA 3GVUA 3D7TA 4GJ3A 4LV8A 3E92A 1I09A 4F0GA 2KULA 5HIBA 3TL8A 3PA5A 2YABA 5HZNA 4DH8A 3GCQA 1TKIA 2YLFA 2R64A 1XMLA 4U3YA 3FI3A 2PMOX 2JBPA 3EOCA 1DI8A 3QTIA 3F6XA 4GT3A 4II5A 2BCJA 4R3PA 2OJJA 4RWKA 4AE9A 4BVUA 5JGBA 4UMQA 2X6EA 1V0PA 2CKEA 3AC1A 3CR0A 3T9TA 3VUDA 1OUYA 4C36A 3P5KA 3QRIA 4QMWA 5D41A 3NUSA 4FSTA 5IA5A 3DAKA 4JG8A 4JI9A 4OTIA 5K9IA 4HJOA 2X9FA 5DN3A 1OBDA 2UV2A 3R0TA 3JXWA 5JH6A 2CJMA 4RC4A 3C5UA 4XOYA 2IW6A 2JAVA 3Q9WA 4DFBA 3ORPA 3BRBA 4RG0A 3QQGA 3I79A 5JMSA 5AJQA 1U46A 2ITNA 3D7ZA 4MAOA 2PUUA 5BVDA 1ZLTA 4JNWA 4YSMA 2YIRA 4O1OA 3NRMA 3FDNA 4FOCA 1FBNA 3PXYA 2R2PA 2DUVA 4HNIA 4FIGA 4K33A 4DHFA 5IQAA 3CP9A 3PP0A 3SG9A 3C0GA 5CU6A 4PV0A 5I0BA 4I6LA 2FA2A 3CD3A 4RC3A 4XRLA 3FBVA 2QHMA 3OS3A 2ZJWA 3OWPA 4JJRA 3VS7A 4PP7A 4NM0A 2ZVAA 1OI9A 1A9UA 3P4KA 3QZGA 3ROCA 2CSNA 2F2CB 2GDOA 3ZONA 3W0OA 3O51A 4FZ6A 4DH5A 3PIZA 3VN9A 1W0XC 3OCSA 4FSQA 2XCHA 3W2OA 4AN3A 1XH7A 3LZBA 3FZPA 3OFMA 4TWCA 3SX9A 4E1ZA 3ANRA 3OP5A 5E8XA 2ETRA 4QMTA 2ERZE 1TZDA 3BGQA 2I0VA 5L2WA 4YR8A 5HU9A 4FC0A 4RJ3A 5CSVA 4D9TA 3M1SA 2OJFE 3QC4A 4DGMA 1ATPE 2ITQA 3QA8A 4FGRA 3L1SA 3ET7A 3F88A 3HGKA 3QTRA 4FNXA 4IAAA 3ZO3A 5JKGA 3R83A 4V01A 4BDCA 3GP0A 3MH2A 3LKMA 3EFLA 3ALOA 2CCIA 4AOTA 4MNEA 1OUKA 4YNEA 1YWNA 2ONLC 2VTIA 4ACMA 3KN6A 1WCCA 3R7GA 4N6YA 4ZTRA 2R3FA 1UU7A 2BKZA 5EKOA 4GJ2A 4QP9A 5CX9A 5DRBA 5JZNA 2YIQA 3ZO4A 3TG1A 1DAWA 2VWZA 2Y4IC 4AS0A 1J1BA 2QO2A 4YMJA 2Y6MA 2F7ZE 3RHXA 3UQGA 4JLCA 2IW8A 3R7EA 4RQKA 1UVRA 3IW6A 1U54A 4XV9A 4RQVA 3TNPC 4RIYB 1UA2A 1ZOGA 2WMVA 3OG7A 4MHAA 3G15A 3JR1A 4IVCA 5HGIA 3G9LX 3TUDA 4FNYA 3FPQA 2IN6A 4MBIA 5E91A 4O4EA 2OZOA 4J1RA 4G2FA 3OC1A 2ESMA 3FZSA 3RVGA 3ZZEA 4FV0A 4F9BA 1OPKA 4QDVA 4ACHA 4MBLA 4AFJA 2QOHA 3EN5A 5CAOA 5F94A 4CKIA 3NSZA 5ANEA 4BTKA 5BYYA 4IMYA 1T46A 5JRSA 4O4BB 3FLWA 5HNIX 2Y6OA 3BU6A 1J7LA 3OXIA 2X7GA 3WIKA 3FZRA 5L6PA 1XBBA 3C7QA 2NRUA 3NWWA 4QP4A 1G8KA 1NVRA 2UW4A 3ORXA 3OOMA 4YNOA 4E5BA 3VS1A 5IUGA 4O7TA 2ITOA 2BUJA 4CZTA 4U41A 4EK4A 2P2HA 2WB8A 5KMOA 3DLZA 3QTQA 2ITTA 3PA3A 3R30A 2GNHA 2F57A 3I81A 4C61A 4NSTA 4FEUA 4ORKA 5EDQA 1P14A 2VTQA 4ZP5A 3VULA 2XJ1A 2YDIA 4S33A 3UVRA 4G5PA 4I5MA 5AR2A 3R8VA 2PULA 2WHBA 4KA3A 1OKVA 4RZWA 3PE1A 4C0TA 3CGOA 1DS5A 3I0QA 3LAUA 2PVNA 3NYVA 3UVQA 3V5PA 4C37A 4ZY4A 4O81A 3VQUA 2WMAA 2ZV9A 1OL7A 1ZMVA 1W2FA 2XK9A 4MK0A 4X21A 4ZK5A 4PP9A 5BNJA 4UYNA 3KC3A 4JQ8A 2XKFA 5E8VA 2CN8A 5FEEA 3EKKA 1YI4A 4EJ7A 4WNKA 1PXKA 2PZPA 3BBWA 5AUXA 4HVGA 4B0GA 2ITWA 5L2SA 1M14A 3DJ7A 5AP3A 3BE2A 4DT9A 2FUMA 4B9DA 4D2TA 4KKGA 4I94A 5TE0A 1VLRA 1OMWA 2G2HA 3MVJA 4JQEA 4KB8A 4RRVA 2I1MA 4RGJA 4GG7A 3TNQB 5HTIA 4QP7A 1Z9XA 5LWNA 2YCSA 4YLKA 4D0WA 3W2PA 1HCKA 4F70A 4QPSA 3AMAA 3VRYA 3DFAA 3HNGA 1U5QA 3IQ7A 3LFSA 2YAKA 2QLQA 4Y5QA 4AZVA 5HIEA 4JDKA 2E2BA 4LL5A 4NCTC 5FEDA 5C4LA 4FK6A 2V5QA 2CLXA 2ZB1A 4EQMA 3COIA 3IONA 3C4ZA 3FZ1A 3OZ6A 5L4QA 3NAYA 4A7CA 4M69B 1E9HA 2WIPA 3NUPA 4O6LA 4ZTHA 4EC9A 4EWHA 2VTSA 4D28A 3BHTA 1YXXA 4WSYA 4BR3A 4DTBA 3QZFA 1OIUA 4O4CA 2PUNA 3W0RA 3DDQA 4H3BA 3FKOA 2OLCA 3UG1A 3OWKA 3PY0A 3T3UA 5CU4A 3UYTA 5AV1A 5CZHA 1GZKA 2XBJA 1PMVA 4HOKA 4QYGA 3ACJA 2Z60A 2ZB0A 3HKOA 2AQXA 4AN9A 5AADA 3CS9A 5ETCA 3F3TA 4I21A 3A62A 1PY5A 3R1NA 4EJNA 3ORIA 5DFPA 4V0GA 3F2AA 3V8SA 5IH4A 4P4CA 3NLBA 5HG7A 3ZS5A 4XG7A 2IVUA 2UZLA 4PTCA 4IEBA 4DEIA 5AV4A 4MEDA 3IW7A 5CVFA 4WG3A 2LGCA 2QURA 3UE4A 4CRLA 2GNFA 5ETIA 2X0GA 3MW1A 4Q5HA 4DN5A 1ERKA 4GV1A 3VQHA 4EK6A 1VZOA 3QUPA 3R7IA 3BELA 3PZHA 4UALA 2JC6A 2J2IB 4YJRA 4TYHB 5M44A 1UU3A 3HYHA 4FEVA 3MYGA 4D58A 2QOLA 2IJMA 4YJSA 1LEWA 1NVQA 1Q3WA 3OTUA 5BVEA 2R9SA 3MB7A 4AW0A 3CKWA 5EG3A 3GCSA 3TZ7A 1PMUA 4E93A 4JT3A 2KTYA 3FMLA 3MESA 5CANA 3IOPA 4F9CA 3W18A 3R7VA 4IAFA 4X6QC 3E8DA 3LMGA 4BTJA 1H08A 1WBPA 4XV1A 3NNXA 4QMOA 4C7TA 5ANKA 2PUPA 2OZAB 3KULA 4IFCA 5CEIA 3C4XA 2JKKA 2EWAA 4FKLA 2R3IA 3DA6A 2VO6A 4IADA 3W55A 4D1XA 2QOKA 1VJYA 2ZDTA 2HELA 3MTLA 3Q04A 3ZOSA 4F1MA 3LQ3A 4R78A 4OTFA 3H9FA 3QA0A 3EQRA 3PA4A 3VUKA 4ZTSA 4RSSA 5KHXA 3UJGA 4NH1A 3ZC6A 4QMYA 2GTMA 5LCJA 1SZMA 4GFOA 4IZ5A 4O2PA 3DAEA 4IAIA 4Y95A 4BCNA 1GZ8A 4FSNA 2XNGA 3IO7A 1OIYA 2P3GX 4FKPA 4HGSA 3O8TA 3NPCA 4EC8A 1OB3A 4MD9E 2VTRA 4AZWA 3UNKA 3FWQA 3KQ7A 2AEGA 3DY7A 4FTQA 3QAME 2XA4A 5DG5A 4E8AA 4UMTA 4HVDA 3T8OA 4BWPA 4BTMA 1GNGA 4R6VA 5EDRA 4CEGA 5B7VA 3WF6A 3I1AA 3KXZA 5L2IA 3IK3A 4FEWA 2JBOA 2C3KA 3JVRA 4XLIA 4Z7HA 3CKXA 5GZ9A 5EHLA 5EYCA 4BDDA 5AX9A 4F65A 1T45A 2G2FA 2VWVA 1A06A 3KRLA 4OW8A 5GJGA 3CPBA 4ZZOA 5TO8A 4FZ7A 4YC3A 4BN1A 4MH7A 3G0EA 2BR1A 3UC3A 3A2CA 3MA6A 3EZRA 2ZFYA 4O27B 4IX5A 3V04A 3DNEA 3HAVA 5LVPA 4GKHA 2HIWA 2CMWA 2BTSA 3NEWA 5E8TA 5BV3A 4W4WA 4ACCA 4TT7A 5GZAA 2Q0NA 4C33A 4EOIA 4G31A 2J51A 4WHZA 2F9GA 1ZZ2A 4NEUA 5ANGA 4TYJA 4GEOA 4YJVA 2QHNA 4Y72A 5CT0A 2XALA 4APPA 3LMHA 4USDA 4Y85A 2VAGA 1CDKA 3K2LA 3ATTA 5LARA 5C4KA 2R4BA 3FQSA 3IKAA 1BKXA 4RFMA 3ZM4A 4UV0A 5AEPA 3VUHA 4K0YA 4ANSA 5AR7A 2YHVA 1SNXA 5BVOA 3OWLA 4M15A 3RMFA 3RPVA 2WQOA 4FSUA 1ZMWA 4EWQA 1G5SA 3BV2A 2W5BA 3ENHA 3UBDA 2WQBA 2OI4X 4AT5A 4B6LA 4EYJA 2QONA 4MXZA 5DOSA 4D2RA 5CNNA 5AR4A 4EOQA 3P7BA 3MBLA 3VO3A 4XRJA 4F9YA 4A9RA 4OT5A 2C1AA 4FNWA 2BRBA 2O0UA 5FD2A 3UIXA 4KKEA 5F95A 2YITA 3WZUA 2I6LA 5M55A 4YBJA 4AGUA 4EKLA 4QEBA 3DQWA 3LFAA 3SDJA 4XV2A 5FLFA 1MRUA 2AC5A 5CU3A 3VUMA 4E5WA 5KNJA 3EFKA 1SVHA 3G0FA 4KS7A 3TZMA 4BDKA 4W9WA 4D5KA 1WBSA 3VUIA 5DEWA 3CCNA 3IW8A 3L9MA 1H4LA 4DGGA 4ERWA 2BZKB 3BHYA 5HEZA 3MY0A 1YVJA 4ANLA 4WOVA 5IDNA 1M7NA 3COKA 4OTQA 2ZM4A 3TNWA 4O0XA 3VHEA 2H96A 3O2MA 3QUEA 5CYIA 5EOBA 2W1FA 4KBCA 5DGZA 1UKHA 3JS2A 4RFYA 5HD4A 4GUEA 3M2WA 3AKJA 3KEXA 5F20A 1ZZLA 4XMOA 2W05A 4D2WA 1TFFA 5AUYA 1JQHA 1KOAA 3QQKA 3NVMB 5EKNA 5KBQA 3T9IA 2XANA 2XNMA 3G6GA 3OT8A 4JRVA 3LCDA 4JIKA 4YJOA 5FRIA 4E6AA 4AZFA 1RW8A 4C38A 3BEAA 4FG9A 1ZYDA 3UIUA 4F6WA 3Q2MA 4GSBA 2QQ7A 4KNBA 2IPXA 3TDVA 3UQCA 4BCHA 3GCVA 5KMMA 4YJUA 3K5VA 3VUTA 2RFNA 4PF4A 3DK6A 3QGWA 4EOMA 4OTWA 4EH8A 3FXZA 1YW2A 2G2IA 4QMSA 1YDRE 2VZ6A 1YXVA 4OLIA 4C59A 3AC2A 1ZARA 4UEUA 4BKZA 3I4BA 4R1YA 2J5EA 3QRKA 3DXQA 3LCTA 4CGAA 3GU5A 5HORA 2X0OA 3KF4A 3IW5A 3UG2A 3TTJA 5D12A 4GYIA 5HCXA 4DFXE 1XO2B 5E8ZA 1J1CA 4IX4A 3VBQA 2BFXA 4L7FA 5AR3A 3BLRA 1PMEA 2CLQA 3BWFA 4E7WA 2VWBA 3V5LA 1UWJA 3UOLA 1IEPA 1IAHA 4MX9A 3HRCA 2J7TA 3GU4A 4FICA 5CVHA 5EI8A 5I4NA 2YCRA 4ZMEA 4O7RA 2QU6A 3MFUA 1P4OA 3N51A 3WF8A 3GFWA 3HVCA 2UZEA 2BILB 4DGOA 2PE2A 2HOGA 4L3LA 2VUWA 4R3RA 2FGIA 3RCJA 4DC2A 1VEBA 4LV7A 1H1WA 3MY1A 3W0QA 4RX5A 4ZLYA 4G3DA 4I5HA 3OCGA 5AMNA 5C8NA 2QCSA 4FF8A 4IQ6A 1M2QA 2C6TA 4JOAA 4YTIA 3NIEA 2OJ9A 4KINA 4BI2A 4DCEA 5CF5A 3W0NA 4FK3A 4FIHA 2GQSA 4FTRA 3ORLA 3S2PA 2XNOA 3H30A 3HMIA 5IA0A 1GAGA 3HP5A 3H0YA 3VVHA 3DV3A 3IDCA 4HPUE 2AC3A 5AA9A 5K5XA 3SG8A 3ZUUA 4NT4A 3LE6A 1M2PA 3QQHA 3PVBA 4PL5A 3HA6A 3WF7A 5KMLA 2PUIA 2WIHA 4L01A 4X3JA 2C0OA 1YXSA 3KGAA 5CAPA 3MVHA 2QOBA 2JD5A 3NYXA 4HZRA 4FRFA 5BPYA 5DYJA 4FKWA 5GHVA 5ITAA 1GIHA 2PVRA 3A8XA 5IA1A 5IZFA 5EM7A 4WNPA 4RA5A 4BB4A 2VTHA 3FV8A 3KFAA 4RVMA 2R3KA 3WBLA 4EK3A 4O0RA 2DYLA 3QTXA 4NZWB 5I3RA 4MCVA 4JS8A 5K0XA 3RK9A 4USEA 2V22A 3CY3A 3PG1A 2OFVA 1VR2A 3CD8A 3K3IA 4C4FA 1ND4A 3AQVA 2CDZA 2WMRA 1QPJA 3PXQA 3WZKA 2WNTA 4YHTA 1SVGA 2PZYA 4FOBA 4U5JA 3FQHA 4NKAA 4QNYA 1S9IA 3SC1A 4U40A 5BUJA 4ZJVA 2QOOA 2WAJA 2YCQA 4UMUA 4GUBA 5JFVA 4CFXA 1F5QA 4O82A 2UW7A 2Z7QA 1YI6A 3II5A 4RVTA 2JEDA 4Z7GA 4CLJA 3IGOA 3U6IA 4HVIA 1M2RA 4XEYA 3M11A 1P5EA 1O6LA 4V0GB 3MFTA 3CTQA 3U4WA 1ZAOA 4A07A 4EZ5A 2XAOA 3TTIA 3OMVA 4FV7A 5FXSA 3ID6C 2J0MB 4RVLA 5AAGA 4LQMA 4W4XA 5JZJA 5C26A 1Y91A 2C0IA 4XLVA 5TKDA 2FYSA 3LCKA 4FVRA 3T3VA 2W9FB 5ICPA 3Q9XA 2F4JA 4Q9SA 5M08A 4EQCA 4BGQA 3GQLA 3R2YA 4Z55A 3F61A 5AP0A 1G8AA 1R0EA 5IEVA 3QKLA 4IVDA 4N4SA 1TVOA 3LJ2A 4WKQA 4LG4A 5HU3A 3MGYA 4JR7A 3TUBA 5CWZA 4ASZA 4R5YA 3KK9A 4ITJA 4I0RA 4BIBA 2EXCX 1OKWA 4TZRA 5IUIA 2OH0E 4B8LA 3QUDA 2I0HA 5IG1A 4F99A 2A2AA 3WZDA 4IWQA 5CEOA 5B0XA 2WTVA 4QP1A 3PJ8A 3W2QA 2OBJA 3VJOA 3L8VA 4FUXA 3QC9A 4LFIA 4XP0A 3BGPA 3KULB 5HE2A 4BCGA 2BDJA 2EUFB 2RF9A 4FKTA 4I22A 4JDHA 1YRPA 3R1SA 2P55A 4WBOA 4WT6A 3ZDIA 5A4CA 4DBXA 1K3AA 5EHOA 4RBLA 3AC8A 4TW9A 4RWLA 3EQIA 1YDSE 4XYFA 4X2JA 4XH6A 2ETKA 5D7VA 2ZAZA 4PDOA 2ZV8A 3O5AA 4TYEA 3BU3A 4IFGA 3WI6A 2RGPA 4Q5EA 2QR7A 4X7QA 4UMPA 1JBPE 3VIDA 5AR8A 4ZTQA 4TN6A 3ZSIA 3SXFA 3U51A 4XS2A 1OGUA 2NPQA 4JX7A 1H1SA 2PU8A 3R02A 3WE4A 5L8JA 5HG9A 3ZFYA 4IAZA 4NFNA 2R3MA 2WFYA 2BFYA 3BI6A 2HW7A 2CKPA 2RFEA 1XJDA 2I0EA 5LQFA 5EW8A 1V0BA 3KIOC 2VTAA 3KL8A 4GH2A 4GVJA 5H3QA 2QU5A 3ANQA 2VX3A 4PY1A 1E1XA 4HNFA 4DT8A 4BZOA 3JY0A 3Q32A 4QYYA 3L8PA 5AV3A 4AZTA 3POOA 2Z8CA 3W2CA 1LP4A 1PXOA 5J5TA 4BL1A 4JBVA 3Q60A 5FTGA 4CD0A 5KZ0A 5J79A 4EBWA 3FL4A 4PRJA 3VS2A 4J8MA 4IWOA 1V0OA 3UOJA 4I23A 2VTLA 5IKWA 4YO4A 4D4VA 4HW7A 1ZY5A 4YU2A 2W4KA 3IOKA 1CM8A 3HDMA 4IB0A 4DA5A 4OTHA 2XZSA 3E64A 3OXZA 3R01A 4ZEGA 4S34A 4PX6A 4FVPA 1R0PA 3F82A 2PTKA 4UZDA 4DFYA 3CE3A 4M0YA 5CAVA 4ZS4A 3BCEA 3TI1A 2W4OA 4H39A 4AACA 4CFUA 4K18A 1Q5KA 2UW0A 5HLPA 4CT1A 2BHHA 3QBNA 5AUUA 5KX8A 4X3FA 3I0OA 3OBGA 3ZTXA 4AXFA 4IDTA 3ZFXA 1Q24A 4AUAA 4DFUA 5TOZA 3K54A 2WTKB 4IJPA 3RGFA 2PZRA 3D2IA 3DPKA 4EH3A 3ALNA 3GEQA 3GU7A 4A4LA 1IASA 4ITHA 3R73A 2C3LA 4WSQA 3NYOA 4C2WA 3HUBA 2VWYA 4JQ7A 4BC6A 3Q4ZA 4FKOA 3EYHA 4QRCA 1U59A 1ZWSA 5LVLA 4JRNA 4M3QA 4F08A 2I7QA 4C57A 3PJ3A 5AM6A 1LUFA 2QOQA 4I6HA 3ZFMA 4OTRA 4BI0A 4O7VA 3FMJA 4HGTA 1PXNA 2B1PA 3DT1A 2QODA 5FP5A 1Q41A 4UWBA 2X4FA 4Y8DA 3LXLA 4D55A 3P1AA 2PZ5A 4AGCA 4ARKA 1PXIA 4IWPA 3HDNA 4K77A 4R7BA 1YDTE 5D10A 5E8WA 2PHKA 3ELJA 3PVGA 4ASXA 3V5JA 3WYXA 4GRBA 1FQ1B 3THBA 2OH4A 2G1TA 2RFDA 3AD4A 2XK7A 4QMNA 1QL6A 3L8SA 4FV5A 3OY3A 2EB3A 3Q9ZA 4BIEA 2HZ0A 4XJ0A 3WYYA 4F6SA 4AXEA 3RAKA 4DEEA 4BY9E 4MD8E 1ZMUA 4HGEA 5HOAA 2PE0A 4GK3A 4GU6A 4I4FA 3AKKA 1W8CA 3HA8A 3EQFA 3TWJA 3HMMA 3LFFA 4JAJA 4QMPA 3CSVA 2WGJA 4QP8A 4EOJA 5HO7A 5LMKC 4QP2A 4O7ZA 5J7HA 4FL1A 3F69A 1LR4A 3OHTA 2YA9A 3UDTA 4YZBA 3NW7A 3F5PA 3EB0A 2C47A 3LXNA 4O86A 1MQ4A 3F7ZA 1YHVA 3QTUA 5I9ZA 4QDEA 5LWMA