3WZDA

Kdr in complex with ligand lenvatinib
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
298
structure length
278
Chain Sequence
LPYDASKWEFPRDRLKLGKPLGGQVIEADAFGIDKTATCRTVAVKMLKEGATHSEHRALMSELKILIHIGHHLNVVNLLGACTKPGGPLMVIVEFCKFGNLSTYLRSKRNEFVPYKVAPEDLYKDFLTLEHLICYSFQVAKGMEFLASRKCIHRDLAARNILLSEKNVVKICDFGLALPLKWMAPETIFDRVYTIQSDVWSFGVLLWEIFSLGASPYPGVKIDEEFCRRLKEGTRMRAPDYTTPEMYQTMLDCWHGEPSQRPTFSELVEHLGNLLQAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords Vascular endothelial growth factor receptor 2
publication title Distinct binding mode of multikinase inhibitor lenvatinib revealed by biochemical characterization.
pubmed doi rcsb
source organism Homo sapiens
total genus 94
structure length 278
sequence length 298
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2014-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3wzdA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3wzdA01
4EI4A 2X2LA 4D5KA 2PVLA 2QG5A 3PG3A 3QCYA 4L7FA 3GI3A 4Q9SA 3MH1A 3COMA 1BUHA 2R3RA 3ZM4A 5A4TA 1H1RA 5KMIA 3E8NA 4GVJA 4JDJA 1PMUA 5BQ0A 5JEBA 4FR4A 3MFTA 5EI8A 4DH3A 1OGUA 4AZSA 5I9YA 5JN2A 4IFGA 3FYJX 3R2YA 4M12A 1FMKA 4KNBA 3R8UA 2CLXA 2QURA 3FLSA 3R02A 4UYNA 3FUPA 3MPTA 2E9NA 4FKVA 5H9BA 3ZEPA 1QPDA 2XNPA 1ERKA 5FEDA 4E3CA 3A60A 2FSMX 3O71A 4JDHA 4L6QA 4R7IA 3WYXA 5L6PA 2BRBA 2XKDA 3BEAA 3ALNA 3CJGA 4JBVA 4FTKA 5G6VA 1NW1A 4M97A 3BE2A 5DR2A 4RWLA 3ZLYA 3OEFX 4ANOA 2WD1A 4XJ0A 4BI0A 4PP7A 5GINE 4L42A 2IJMA 5GIOE 4ZJIA 4AFEA 5FM3A 5DI1A 1CMKE 1YI4A 4GU9A 1YRPA 5CU2A 5E1EA 4DEAA 2VTPA 4J1RA 3PXYA 5C01A 4OT6A 1QPJA 4AOJA 4KKGA 2XK7A 4X7QA 4FKIA 3CE3A 1U59A 4Y5QA 4BDEA 4QMTA 2GHLA 3ALOA 4EYMA 2YCRA 3OCTA 4M8TA 5CSXA 3QQJA 3VQHA 3TM0A 2PVJA 3BPRA 4QTEA 2VD5A 4GT3A 3TDVA 2X39A 4QP2A 3KULA 4MAOA 5BYZA 4Y85A 5CAQA 2OZAB 3BHUA 4QYEA 1STCE 3W8LA 4FGRA 4ENYA 4F6UA 2YDJA 4DFNA 5ANKA 2VTQA 4QQJA 1JLUE 2DWBA 3EN4A 2QOKA 1GOLA 3W2CA 4H39A 1QPEA 4KSQA 5DHJA 5A4CA 5IH5A 4KIPA 4FV2A 3EOCA 3VBTA 2GMXA 3PSBA 4U42A 5I5ZA 1U54A 5F94A 4C33A 3UO5A 5GNKA 4RWJA 5CXHA 2X9EA 3ZSHA 4K0YA 4EBVA 3GU6A 3V6SA 3W2SA 3W1FA 4CEGA 5EM6A 3PJ2A 5GZ9A 5IA0A 4ZP5A 2F7ZE 2BFXA 2R3FA 2C5VA 2XCHA 4A4XA 2XIXA 5M53A 4JLCA 1PKGA 1H01A 3FLYA 4HZRA 4MKCA 4ASZA 4Z7HA 4I4FA 4DE4A 4YO4A 4ZZOA 4LRKA 2QQ7A 4UY9A 1BLXA 4R7BA 3W2RA 4BC6A 1EH4A 4JVGA 3ORPA 2ONLA 3R8PA 3QFVA 1GNGA 3DY7A 1GIIA 2W0JA 3E8CA 4DFLA 3PVUA 2OJIA 1XH4A 4I5PA 2I0EA 3LXKA 3NR9A 1XHAA 2NPQA 3NW6A 4W8EA 4TTHB 5A9UA 4PMMA 3PPJA 5AV4A 2QLQA 3QTWA 2YCQA 1KE5A 1E1VA 4FTUA 3EQDA 4Y83A 5K4JA 3SXFA 2XJ1A 3OF0A 3OVVA 3HKOA 5KMJA 3LMHA 4EH9A 2WTCA 4RIWA 3KL8A 2J0MB 5JKGA 3NGAA 4XBUA 1XKKA 3RWQA 1YOLA 3R9OA 3HV3A 4BDDA 2O2UA 4FKGA 2QO9A 3IGOA 3ZSGA 5HIDA 3OWPA 4D2SA 3OHTA 3QCSA 3HL7A 4U0IA 4LYNA 3NSZA 3GC0A 5ETIA 3R28A 4YTIA 3LIJA 3RPOA 2YLFA 3ELJA 2Z8CA 3VBXA 3K5UA 4N57A 3LM0A 1APME 3JPVA 3RCJA 3U6JA 3AD5A 4LV5A 3EIDA 1R0EA 4N0SA 1M2QA 1P4FA 4RWKA 3GCSA 1R0PA 4AACA 4FX3A 3V5TA 4O0RA 1P4OA 4L46A 1BL7A 3KGAA 2FH9A 1H1PA 3ZDIA 4WKQA 5AAGA 3DKCA 1TQMA 2HZ4A 2ITXA 3ENHA 4E26A 3F3ZA 3NW5A 3QZIA 2W99B 3WILA 4DEBA 4ZLZA 5TO8A 3C50A 3HNGA 5DFPA 2YEXA 3AC1A 2X81A 2C6EA 2YLEA 5FXSA 4NCTC 3EN6A 4R3PA 2YJSA 1BI8A 5E8TA 2WELA 2QKWB 4TN6A 4F1OA 4I6FA 2CNUA 5FEEA 4FKTA 1G5SA 2YITA 3V8TA 2J50A 3A99A 3KCFA 3SXRA 3KREA 3BU3A 3MESA 3WF7A 5FTQA 2WQEA 4KS8A 5DR9A 2F7XE 2YIWA 2C69A 3T9TA 3QX4A 4YNOA 5J8IA 3TV7A 4MWHA 2BZKB 2QU6A 3D15A 4X0MA 1H1QA 2WOUA 3BHTA 3QQGA 1LP4A 3IKAA 4AE6A 1AQ1A 4IDTA 2PUPA 3PA4A 4WO5A 3U4WA 2Y4PA 4YJSA 4FV1A 4R1VA 1NT2A 1W8CA 4CD0A 4G5PA 2XCKA 3G90X 3RTPA 4QTBA 1PXLA 2REIA 3QHWA 3V51A 5D7AA 4OT5A 2A2AA 2PYWA 2X8EA 3PE1A 3D2IA 1J3HA 4JQ7A 4FZAB 4F7LA 3WI6A 3MFSA 4C4FA 3EFJA 3RNIA 3UPZA 3D83A 1YDSE 4QMLA 2O5KA 5L2IA 3L9PA 3BQCA 4NM0A 5M57A 2QODA 2VUWA 4DFUA 5HZNA 5IEYA 3Q5IA 3QXOA 4IACA 1BL6A 4RFMA 1Q8UA 1Z57A 4YSMA 3R9DA 3VF8A 4YHJA 4ZY5A 3VW8A 3QRTA 4FSUA 4EQUA 2ITUA 4YJUA 1OBDA 4GW8A 2JBPA 3R2BA 3TIYA 4BDFA 2QD9A 2Y6MA 4F6SA 2UW3A 2C5OA 4L3PA 1H0VA 4EH6A 1XH8A 3II5A 1VYZA 3OCGA 5AM6A 4D55A 5A4LA 3EQHA 4CV8A 2C6TA 2XYUA 4A9UA 4ZEGA 1P14A 5KNJA 4C02A 1RW8A 4O86A 4A07A 4Z16A 2VU3A 3L1SA 1UNGA 3ZUUA 4PTGA 4PL5A 2J4ZA 4IB0A 1Q62A 5HBEA 4E1ZA 3MB7A 3IQ7A 3VUMA 4IQ6A 4L00A 5E8VA 2XK6A 2OXYA 3G2FA 3Q9WA 3GBZA 1FGKA 1Q97A 4U7ZA 4WBBB 2YM3A 3VJOA 3UZTA 4A9YA 2QU5A 3LM5A 2QC6A 1H26A 1ZAOA 2UV2A 1O6YA 4X6QC 5HIBA 2VTMA 2OJGA 3V8SA 3EQCA 5FG8A 1ZYCA 2WPAA 1UKIA 3TXOA 4L45A 1ZRZA 5L8JA 4IB1A 3ORKA 4WNKA 4CT1A 5I4NA 3Q32A 3UP2A 4B8LA 3COKA 3LLAA 4QMWA 4YBJA 4XMOA 2QOFA 4TXCA 5BVNA 4JJRA 1TVOA 5CU0A 2JBOA 3U8WA 3V01A 4FOCA 4C2VA 5DE2A 1B39A 5IG1A 1WBVA 4LRMA 4R5SA 3HAMA 1REKA 2C4GA 3E7VA 2VTOA 4G3CA 5CF6A 3UZPA 1DM2A 3ZO1A 4OTQA 4TWCA 5J9ZA 3CGOA 3NYNA 3Q96A 1OKYA 2PE0A 2FSOX 5AR5A 4HW7A 4NW5A 4FZ6A 3CS9A 5IQFA 3GCUA 4JQ8A 4XP2A 2B9HA 5JQ5A 2WMAA 2C6KA 4OW8A 4BCPA 4BTMA 2OIDA 4DGMA 4BDIA 3O50A 3QKMA 3UVQA 2ZOQA 5EHLA 5EM5A 4EOPA 5CX9A 4Z7GA 3CJFA 3F9NA 4QPSA 4WOVA 4ALWA 3R7VA 5LVMA 2BFYA 3FEGA 3VQUA 2QOCA 3O7LB 2WTWA 2Y0AA 3UYSA 4DA5A 1YVJA 5B0XA 4HVSA 1Y57A 2ZYBA 3EFWA 2C30A 4FI1A 5A3XA 2WTKC 5KKRC 3FMNA 3KN6A 2E9PA 4S30A 5HE1A 2H6DA 4FVRA 4ZSGA 5IA3A 1J91A 2QKRA 4FSNA 4C37A 4HNFA 3CP9A 4K2RA 5FP5A 1PMVA 5ETAA 1H27A 3EFKA 4HJOA 2CGUA 4D2TA 1QPCA 5AFVA 3OZ6A 3I60A 5IISA 5KX8A 3CIKA 3L8VA 5E9EA 1OIQA 1Y8YA 2W1ZA 5CVHA 1G8AA 2JDTA 2ITQA 4HGTA 2XIYA 1WVXA 5DPVA 2PPQA 3OP5A 4IZ5A 3F5PA 3I1AA 2FSTX 4FT0A 4O6LA 3L8XA 3TIZA 5B2LA 4YZ9A 2Q0BA 4CG9A 4Y73A 3GU4A 4I93A 3TNWA 4F08A 4Z9LA 3PUPA 2JIIA 2W1GA 4LUEA 4TWNA 2E9OA 3R7YA 4E73A 3IPHA 4ZLYA 4OAVB 3H3CA 3NNXA 3RK7A 4MXOA 2WIPA 3EHAA 1PYXA 2VO0A 4FKRA 4QMZA 3JS2A 3ZTXA 5JFVA 5KMNA 1S9IA 3BE9A 3QLFA 4BZNA 3B2TA 4FYOA 4PDOA 2UW6A 3CQWA 1W83A 4WBOA 2PVKA 2XNEA 4YJVA 4YPDA 2CKQA 3TUDA 5CENA 4F1TA 2XIRA 3UP7A 5AA9A 4E6DA 5BYYA 1WBOA 3F2RA 3MIYA 4L3LA 3VN9A 5HLWA 4IAFA 5EK7A 2VTJA 3WBLA 4Q2AA 5AIKA 5T3QA 2X4ZA 4GT4A 5IA5A 4EH7A 3PSCA 4MD9E 5CAUA 4TPTA 4DFBA 5F20A 3G9NA 4KABA 3F7ZA 5D12A 2ITTA 4ZSEA 5HNGA 3TTJA 4C57A 3NUSA 3P9JA 3GENA 4BTJA 5CEQA 4ENXA 3VBWA 1Y8GA 2XK4A 2Z60A 3OY3A 4ASDA 3MVHA 3OTVA 4XG3A 4X2NA 2W4JA 3LFSA 3QWJA 4IMYA 1GAGA 1WMKA 4QYYA 4D2PA 2HY0A 5ANIA 4EQMA 5J5SA 5LVPA 4P5QA 4ZMEA 1H8FA 1MQ4A 4EOQA 3FC1X 4OLIA 5BPYA 2X7FA 4ZJJA 4DFYA 2VX1A 4L52A 1GIJA 2WMTA 3NW7A 3P0MA 4PL3A 2YIRA 3BLQA 5ANDA 4EYJA 3LQ3A 2C6IA 3BGPA 3DKGA 2P2IA 1FGIA 2VTLA 3JXWA 1OMWA 4FTAA 3LAUA 3RAHA 4MBLA 4BKYA 3PE2A 2J5EA 4KIKA 4RVMA 4EH4A 3BRBA 3LCDA 2R3LA 2XKFA 2JEDA 3BCEA 4CLIA 4CGAA 3GU7A 4ZZNA 1DI8A 2P4IA 4CRSA 2PVNA 3U9NA 5ANOA 1ZWSA 2C0TA 4LOOA 4AE9A 3O96A 3KA0A 4H1JA 2PULA 4OBOA 5FBOA 4UBAA 4O21A 3FZTA 3PPKA 4PP9A 3DCVA 4I22A 2Y4IC 5DVRA 4XG7A 3C4XA 5AUZA 1ZOHA 5EQPA 3TKUA 3PZEA 5BNJA 4R8QA 3CQEA 4TYHA 4GYIA 5D7VA 5HI2A 4BDCA 4BVUA 3QRJA 4MX9A 4XP3A 1OECA 4ID7A 3WARA 5HORA 4V0GA 3PVGA 4U45A 3MY1A 5JRQA 1WBPA 3HEGA 2GHMA 3NLBA 4F9YA 3QD0A 3R8LA 5HTBA 3KMUA 3K2LA 3KXZA 3PG1A 4H1MA 4CFNA 1CDKA 4DHFA 3OD6X 1ZYJA 2XUUA 3OUKA 3Q2MA 3WF6A 4IWQA 4BDKA 3PZHA 4FT7A 3R8ZA 4DN5A 4XBRA 3PLAE 4L9IA 2UW4A 3BI6A 5EG3A 4FKUA 4O0YA 1F5QA 5L8KA 4F9CA 4DLJA 3LFNA 3EN7A 3W32A 4BCNA 5CI6A 4D1ZA 1V0PA 5CU3A 2C6MA 3H9FA 5I9VA 4XG4A 3D2KA 3FLQA 3I5NA 4BCJA 2YIQA 2IZTA 4BGQA 3PWDA 2NNWB 4CMUA 1BI7A 3CGFA 5IMEA 4I6HA 4AN9A 3LFDA 4JL9A 5DA3A 3TNIA 3HVCA 3TZ9A 2QVSE 4X3FC 5EI2A 3NUAA 2VWXA 5AIRA 4USEA 3PP1A 3S1HA 2PUNA 1WBSA 1XQZA 4IWDA 1UU8A 3N4TA 2F57A 5L8LA 1OIYA 2BTRA 1SZMA 4F63A 3D7ZA 3R7OA 4BYIA 2VX0A 2X2KA 4RJ7A 3O23A 3P1AA 4NTSA 5IUGA 2C0OA 1Y6AA 5AV1A 2C3LA 3CPCA 3G5DA 3R00A 4UZDA 3D5XA 4JDKA 3F7WA 4IZ7A 5KMMA 1Y6BA 1JBPE 3TZMA 5E4HA 2PMLX 5C26A 2ETKA 3RP9A 5IPJA 2XRUA 2HENA 4G6LA 2VWUA 4QTDA 3GXLA 4I5MA 5JFXA 3ORMA 3BWFA 3W33A 1PXMA 4EQCA 2BAJA 3RM7A 4EL9A 3HX4A 5AUUA 3HP2A 4ERKA 3NUUA 4QYFA 4MNEB 1H1SA 3F3UA 3Q6WA 5AR4A 3VUGA 4J52A 4AZEA 4EOMA 2WOTA 4LOQA 3V5PA 2PWLA 3UOJA 2OF2A 2BHHA 3FYKX 3R9NA 4NFNA 4DBNA 5B2MA 5IQIA 3GQLA 3P4KA 3C0HA 1YOJA 5HEZA 3ATSA 2ITYA 3ZONA 1G3NA 2WMBA 2YERA 3FWQA 4OTFA 3FZOA 3R0TA 3MH0A 3RK9A 2PZYA 4PMSA 2LAVA 5CU6A 4O91A 4M0YA 4MBJA 5HVYA 4CVAA 3M1SA 4IM3A 3ZO2A 5KE0A 4M15A 4DEEA 5IA2A 3BYMA 4EK8A 1ZMUA 4XV9A 4DEGA 2JIUA 3QYWA 2CKPA 4DGOA 1Q4LA 4FV7A 3AD4A 4DH8A 3SVVA 4YUQA 2BDJA 3HA6A 5HG7A 4O7VA 5AUVA 2UW7A 4OR5A 5C27A 4RJ4A 5EQYA 3ZFMA 3QC9A 4EHVA 3DV3A 3QTUA 3E8EA 4GUBA 4QMOA 3SXSA 3LVPA 4FKJA 4XYFA 5EW3A 3ZOSA 4AZWA 3EH9A 4I1ZA 1Z5MA 4D1SA 3PXFA 4QQ5A 4DTAA 4FSTA 4FA2A 3CTQA 3E7OA 3FMKA 4C34A 1PF8A 2YZLA 3CSVA 5EFQA 4PDSA 2RKUA 4AOIA 1YWVA 4EK6A 1VZOA 3ET7A 5AADA 3FI3A 1W7HA 3EKNA 2G15A 2OIBA 4NH1A 3V3VA 3FMMA 3DGKA 2NP8A 5HVJA 1XO2B 3ZU7A 4S33A 3A7JA 2ZV9A 4IB5A 4BTKA 4C4IA 2R3HA 4ANMA 5TF9A 3AXWA 4RX8A 5EM7A 4YSJA 2PZ5A 3UNKA 2I40A 1Q24A 3LLTA 2XMYA 3MSSA 2YWPA 4YLJA 3SD0A 4RSSA 3UIMA 5KHXA 3LKMA 3C4EA 4YJPA 4NWMA 1XJDA 4CV9A 4YJRA 1WCCA 3RNYA 4FICA 4LQMA 4X6RA 3U9CA 3R9RA 1PXNA 4A4OA 4DITA 3I5ZA 5D11A 4HGEA 4MK0A 2B9IA 3MN3A 4BDJA 2BROA 3G51A 4J96A 3FXWA 4EC8A 5IH6A 1J7UA 2UUEA 2VNYA 1IAJA 1IR3A 3V5WA 1F3MC 4IB3A 4IZYA 5JMSA 1MP8A 3BYVA 4U9AA 3O8UA 4IVBA 2UZLA 4MXZA 4XG2A 3CY2A 3A2CA 4G16A 3T9IA 2XKCA 4P7EA 4IVAA 5T68A 2WO6A 3EWHA 4MH7A 5AX3A 3R04A 4NL0A 3DZQA 3NS9A 2YM8A 2DYLA 4M84A 3ZC5A 5LVNA 1AGWA 4R78A 3SG9A 2VWYA 3ZBFA 4E4MA 5GIPE 5GJFA 3LFFA 3WF9A 2W9ZB 5AR2A 4RQVA 3DXPA 1Q99A 2EXCX 4U43A 4X2GA 3RAIA 2XNBA 4O0SA 4DLIA 3E64A 4CQEA 2EXEA 4F65A 2PVRA 3D14A 2IW6A 2OWBA 2PTKA 1DS5A 2HXQA 2JFLA 2PVFA 2WQBA 3M42A 3QD2B 4OTDA 3RAKA 1K3AA 2WTDA 5BYLA 2IZRA 4JR7A 5F95A 3TTIA 4O0VA 4HVHA 3P23A 2YM7A 5C8KA 5HU3A 1O6LA 1LEWA 1SYKA 3HYHA 4RG0A 2A19B 3UVPA 4CZYB 5IH4A 3ZO3A 1M17A 2CPKE 4FEUA 4ZY6A 2PZPA 4II5A 4I94A 3SOAA 5IDPA 3MYGA 1M14A 3U6IA 4CXAA 4ITIA 4LMUA 3HRFA 3JVRA 5IQBA 2R9SA 4KBKA 4CLJA 1YI6A 3FL4A 4PNIA 4JIAA 3ORLA 3PJ8A 1XBAA 3I7CA 4K77A 4L01A 4OTGA 4RJ3A 3E62A 5J1VA 3FLZA 5E8YA 4NU1A 4YLLA 4CYJA 2J0JA 3MPAA 3ID6C 3S2PA 2OK1A 5AP4A 3OMVA 2GNGA 3D4QA 2I0VA 3BYUA 4BCGA 4C4EA 5I9ZA 4LG4A 3OROA 5BUIA 1UU9A 3ZLWA 3C1XA 3VWAA 3HUCA 1VJYA 2BVAA 4YZBA 4TYIA 4ACMA 4FUYA 4AP7A 1WVYA 4MEDA 5E8SA 3NPCA 3FQEA 2QOQA 5HTCA 3FHIA 3I6WA 4I4EA 2JAMA 3DBCA 3UOHA 5CVFA 5AM7A 4QTCA 4AZVA 5I9WA 5IKWA 2XNOA 4EOJA 3DFAA 1MRUA 2XM8A 3KY2A 4FOBA 4A9RA 2VAGA 3UODA 1E1XA 5GZAA 4NYEA 2I1MA 3PA3A 4HYIA 1F0QA 4O38A 4XH6A 3LCKA 3IW4A 2JKOA 2X0GA 3EMGA 3OFMA 4AAAA 3THBA 4XP0A 4CKIA 2GU8A 3QQUA 2GSFA 2GQSA 1FINA 3PY1A 4RX5A 2Z7LA 3MWUA 5HE3A 4BBEA 5A4EA 2P3GX 2GPHA 3MH3A 1PMEA 2GCDA 2F4JA 5HG5A 1ZYLA 2CGVA 5KUPA 2IW9A 4WRSA 3NIZA 5HO6A 5A6NA 3PVBA 4IAIA 2R3QA 3U55A 1IRKA 1PYEA 3LXLA 1OL6A 4RWIA 3ZC6A 3MS9A 1H07A 4QMQA 4YR8A 2G9XA 3H4JA 4Q5EA 1FVRA 5HIEA 4G6NA 4OBPA 5BVWA 3DKOA 3C0IA 2FUMA 3VUHA 3VS3A 4W4YA 1PXJA 2G1TA 2PK9A 5HCXA 5ACBC 5CT7A 2OGVA 2O8YA 4P90A 5E8WA 4RA4A 4D9UA 1PHKA 3ZXTA 2Z2WA 4QOXA 4DINA 2OW3A 5J9LA 2GTNA 3VIDA 2PMOX 4O1PA 1KE7A 1TQIA 2YABA 4QP1A 4IJ9A 2Y7JA 4FSRA 4NCTA 5J9YA 2RL5A 4MNFA 5CSWA 1L3RE 3AC5A 3IOPA 4JG6A 3PIXA 4YZMA 5ITAA 4XRLA 4GIHA 3RPSA 4BCIA 3RAWA 4WUAA 2PY3A 1Q3WA 4JS8A 3Q5ZA 5JGDA 1OKZA 1OZ1A 4O0TA 5GJDA 4JQEA 1SNXA 4XLVA 1XBBA 5EW9A 3VJNA 3VUTA 4GVAA 2GS2A 2IVUA 3GC7A 3QWKA 3FI2A 3AMBA 3MVLA 4FGBA 1OB3A 3QCQA 4W4VA 3E5AA 3CTJA 3VS6A 3OOMA 4R77A 3T3VA 5KZ0A 4AOTA 4AT5A 2UZUE 4OUCA 4RFZA 4LGDA 3ZDUA 4RIYA 4EK5A 1KE9A 3TNPC 2I0YA 4PMTA 2PE1A 2CHLA 4R6VA 4UWBA 3VHKA 4QMNA 3ZUVA 2XNNA 4NJ3A 4FK3A 3IECA 4WNMA 4P5ZA 4AA5A 3BELA 5A14A 3OXZA 4FSZA 3FKOA 3NUPA 3MIAA 4FF8A 4NIFA 1XH7A 2WIHA 1OPLA 2X6EA 3E93A 4RIXA 4CNHA 4MXCA 2BUJA 3S0OA 2RFNA 5CNNA 5D41A 4D4VA 2V7AA 4FTMA 2CDZA 3Q3BA 4B8MA 2ZB0A 2O0UA 3VW6A 2HCKA 4RRVA 3EQRA 4CFFA 1A9UA 4FK6A 4RVLA 2GNHA 3D7TA 4O7SA 2YACA 2HOGA 1Q41A 2VRXA 3O17A 5K5XA 3DBQA 3ZUTA 4IWPA 1JNKA 2EVAA 4AW2A 3OW3A 5J79A 2W4OA 3L9NA 5DOSA 3C4ZA 5EOBA 4ZTNA 5BVDA 4QO9A 1PJKA 5FRIA 4FT9A 4BCHA 2XJ0A 5CT0A 5CYIA 5DBXA 4BIDA 5IMXA 3G6GA 3NRMA 4WIHA 3TV6A 3TWJA 4ZSLA 2VTNA 3ACKA 3ROYA 2JDOA 2BKKA 2X9FA 2LGCA 3ZM9A 1O9UA 1CTPE 2OO8X 2PVYA 3A62A 4NT4A 1OM1A 2EWAA 2JKQA 3QU0A 3DK7A 3JYAA 3PIZA 4EZ3A 5DNRA 4G6OA 4TWOA 3RCDA 4EWHA 4O7TA 2BZHB 3BX5A 5CXZA 2BKZA 3OCSA 4TW9A 3ROCA 2ZDTA 3HV5A 4FODA 5KBQA 3TUCA 3KXHA 5IF1A 1GJOA 3KULB 2C3IB 2IO6A 3GC8A 2VO6A 5K4IA 3MJ1A 3VULA 2ZV7A 2I6LA 4RMZA 1ZMWA 2ESMA 3RWPA 2HK5A 3EFLA 5DRBA 3WF8A 4JOAA 3LJ0A 3UO4A 5ACKA 5DEWA 4AA0A 3W2PA 2C5XA 3QQLA 4FIFA 4USFA 4AW0A 2XVDA 3NNUA 4FIIA 3SRVA 3QCXA 3ZH8A 2Q83A 3UYTA 3VS0A 5JFSA 5EKNA 1U54B 2B1PA 5TT7A 5DH3A 2DS1A 3SOCA 4C4JA 4M7IA 4U6RA 3P7BA 2OJJA 4FEXA 5A6OA 3QYZA 2V7OA 2GQGA 4GK2A 1NY3A 2YJRA 4DGGA 5LVOA 4FG8A 4Y95A 3KRLA 4YLKA 2B52A 3A7HA 5HU9A 1H1WA 4AWIA 3AG9A 4RZVA 1YDRE 3UBDA 3EL8A 4UMPA 4MCVA 3WE4A 5M06A 3EQGA 2I7QA 4IAYA 2GFSA 4S31A 1GIHA 1L8TA 4RIOA 5IQCA 4FL1A 2XIZA 4OTPA 3U51A 2XEYA 3IONA 3L8SA 4D0XA 4BZOA 5EDQA 3AC2A 5IDNA 4G9RA 3OC1A 3AMYA 2WQOA 3R21A 4IEBA 1Q3DA 1CKIA 4F9WA 4X2FA 3A4PA 5LMAA 3F2AA 5M56A 2OF4A 3BQRA 2DUVA 3E8DA 4YMJA 4IH8A 4JI9A 4EONA 4KSPA 2OJFE 4AUAA 4O83A 2OICA 3AQVA 1FOTA 4PQNA 2C0IA 1ZYSA 3I4BA 4JRVA 4RIWB 4RC2A 4V04A 4ZK5A 3Q4ZA 4X21A 4UMUA 5CAVA 3RBWA 4ORKA 5HNBA 4P2KA 5HX6A 4MXXA 3R7UA 4MHAA 3BWJA 2UZVA 3EYHA 4EHEA 5HHWA 1LPUA 1BYGA 3SKCA 4YP8A 4F6WA 5CF5A 2XP2A 3C4WA 4EOIA 3PDTA 2R0IA 1OUKA 1NXKA 4C4HA 4CSVA 3HV7A 3IDCA 2QCSA 3MY0A 4NM3A 2WTJA 3ZLXA 5CEMA 1W82A 4LUDA 4CYIA 2UZNA 2BPMA 2V55A 3F3WA 4BDHA 3Q53A 5LMKC 4XS2A 3DTWA 4GG5A 4KKHA 4XG6A 3UNZA 3U87A 4ZS0A 4MVFA 4F9AA 3NDMA 4HNIA 3H9RA 4JT3A 3W2QA 4CCBA 4E20A 4I0RA 3TN8A 4E5WA 3DXQA 5HG8A 4M0ZA 4ZTHA 5IA1A 1O6KA 2HYYA 4OTRA 4MD7E 3R1YA 2XIKA 3DOGA 4O0XA 4XV3A 2JITA 2Z7SA 4O7WA 1YQJA 2YIXA 2BRGA 2WMXA 4I23A 5T6KA 1Y91A 3R1QA 2A0CX 3IW6A 3U54A 4JG7A 3UJGA 3CBLA 3QC4A 4G2FA 2W5HA 3LHJA 3ANQA 3DU8A 4QYGA 2XJ2A 4J98A 2QOBA 3BU5A 3MTLA 4MTAA 4E6CA 3QTRA 3NCZA 2UZWE 3DNEA 3QUDA 4U41A 1FQ1B 3K3IA 3DJ5A 2VO3A 4Y5HA 3LXNA 4ANBA 4G3GA 4DH1A 4LV8A 5EHOA 2FO0A 3KRWA 1OL7A 4CZTA 2ZVAA 4KB8A 2W1IA 2R3NA 3VRYA 5KO1A 3OUNB 4APCA 3FXXA 5E8UA 5HO7A 1WVWA 4F0IA 2X6DA 4I0SA 5HVKA 3C13A 4GV1A 3HMPA 5L2WA 1JKLA 2YISA 3DK3A 4R3RA 4YZCA 5AP2A 3GEQA 4GFGA 3KXXA 2YN8A 2W1CA 3RALA 3VS1A 5C4LA 3CPBA 4PDPA 4BI1A 3A7GA 3QTSA 2VN9A 5BUEA 3ORZA 3MH2A 2FVDA 4H3PA 5KMOA 1PMNA 3FPQA 4QTAA 4G5JA 5DRDA 4KUJA 4F64A 4YHFA 2FA2A 5E92A 4MQ2A 1QMZA 4HCTA 4BIEA 3ZZEA 5I9UA 5GZ8A 1Q5KA 4K6ZA 5BVEA 2Z7RA 4E4XA 4FTLA 3R7EA 4UWYA 2BHEA 3R8VA 2XF0A 2J0IA 5CVGA 1PXKA 4RJ5A 4UXQA 4BGGA 5LWNA 3S3IA 4DEDA 1GZOA 5HD4A 2IVSA 4LGGA 4I5HA 2NO3A 1HOWA 3HA8A 5FDPA 4CT2A 4XHKB 2UZTA 1WFCA 3C4CA 4ANSA 3D5VA 3RHKA 2PUUA 3UQGA 2B54A 3MFRA 4Q9ZA 1SVEA 3OT3A 5HBHA 5CASA 4RT7A 1K2PA 1DAWA 3I0OA 3NWWA 3W10A 5IUIA 1HCLA 3UGCA 5FDXA 3GNIB 3B8RA 3IK3A 3BIZA 4HVGA 3LW0A 4UN0C 2VTIA 4EOOA 3KVWA 4XX9A 3TEIA 3DQWA 4B99A 4TYEA 3R63A 3TJCA 2GQRA 4IWOA 1M2RA 4YZNA 4WSYA 5KKRB 2ZJWA 4OTHA 3HZTA 1JKKA 1P2AA 4GMYA 4EHZA 4U5JA 1W84A 3GB2A 4IAAA 3S00A 4C59A 4QP8A 4B9DA 4DH7A 4FIEA 3WIGA 2BMCA 4M69A 5K9IA 3UMWA 2B55A 4QQTA 3D94A 4O1OA 1VEBA 2Q0NA 4MD8E 3JR1A 3JUHA 3W55A 1HCKA 3UIUA 3WZJA 4YTCA 3NMUF 2A1AB 3UG2A 3F3TA 4IXPA 3GUBA 4FMQA 4FT5A 4C35A 4X3FA 3S95A 4IE9A 4OAUC 4V01A 3C9WA 3I0QA 4UZHA 2YAKA 3PXRA 2IWIA 4AW1A 4FTIA 2VTSA 3W8QA 4D58A 3VS5A 4IVCA 2UZBA 4JG8A 4ZTQA 5AAFA 3R7GA 3VBQA 5C8NA 5CEOA 4UXLA 4V05A 5BMSA 2UW9A 4KIOA 2IZUA 3N9XA 3G33A 1JSTA 5JGBA 2W5AA 5M07A 3WF5A 1YXSA 4CQGA 5JZNA 4DEIA 2IN6A 4RC4A 3ANRA 3FQHA 5D1JA 3ORTA 4ACDA 3NCGA 3P5KA 4IBMA 4KKEA 4XG9A 1VYWA 3UC3A 5AEPA 3CTHA 1PW2A 3F2NA 4LGHA 5EI6A 4C7TA 3FI8A 4K33A 1TQPA 3ATTA 3HLLA 4RLKA 2BILB 4Q5HA 4LOPA 1YXTA 3CXWA 3NNWA 4QPAA 3BHHA 1J7LA 3ITZA 4I0TA 4TY1A 2JDRA 3PXKA 2BAKA 4U97A 5E7RA 3ZYAA 3HV6A 3KMMA 3TL8A 3U4UA 3FMHA 2RFEA 3F5GA 1ZARA 5KMKA 2NRUA 4PPAA 3LFBA 3A4OX 2OFUA 4JR3A 1FMOE 4KWPA 5CQWA 4QP7A 5EYDA 1NVSA 2ZMCA 1OKWA 1ATPE 1YHWA 1U5RA 2QOLA 3FLNC 1M7QA 3WZKA 5KCVA 2VWWA 4JDIA 4IZAA 1J7IA 2AUHA 4EC9A 4JX3A 2X8IA 4O22A 4E4LA 2I0HA 3OS3A 3PFQA 5HGIA 4ACCA 1A06A 1AD5A 4K8AA 4GYGA 3NYXA 4IX5A 4D2WA 4ANNA 5FTGA 5FXQA 5CSPA 3DAEA 3OBJA 2GS7A 5AV2A 5ANEA 3R1SA 2RFDA 3QXPA 2W5BA 4X2KA 5C1QB 2PZRA 2UVYA 3FI4A 4FV4A 4HVIA 1G8SA 1WAKA 3HDNA 1OIRA 3KF7A 4IDVA 4CMOA 3BHVA 4A7CA 4ERWA 3FMDA 2OKRA 3QTQA 2JD5A 4RPVA 4A4LA 2WQMA 5CY3A 5M4UA 2W4KA 5IQAA 1LR4A 2AC5A 4MQ1A 5CNOA 2UVZA 5JH6A 1KSWA 4DC2A 2JGZA 4JAJA 4NFMA 3R30A 5L2QA 3Q4UA 4GFOA 2R3PA 4U8ZA 4A9SA 4R5YA 2ZM3A 5A4QA 4E7WA 3DXNA 2BRNA 3PVWA 4C4GA 2BIYA 3T8OA 3WE8A 4FNXA 2F2CB 3DBFA 1ZYDA 3FHRA 2ACXA 5K0XA 1FPUA 4LRJA 2G2IA 5FEQA 5F4NA 3BZ3A 3COHA 3DAKA 3KXMA 3HMMA 4P4CA 4QNYA 2OH4A 3EJ1A 2C5NA 4NKSA 5HE2A 5HCYA 2R2PA 1T45A 4ZXTA 1OPJA 4WG3A 3G15A 3BU6A 1ZZLA 2WZJA 2X8DA 4RLLA 4A9TA 3NYVA 4G3DA 5KMLA 3N4VA 5B2KA 2WMRA 3QZGA 4EJNA 3GFWA 2J5FA 2OJ9A 3LOKA 2ITWA 4I5CA 1JQHA 4TYGA 3ERKA 5DWRA 3DLZA 5IEVA 2OSCA 2C1BA 3TI1A 5ETCA 5H8BA 4BFMA 3LCOA 1YOMA 2F7EE 2VNWA 4TRLA 4KIKB 5FTOA 3IDBA 4YBKA 3FPMA 3IO7A 2JDSA 3Q9YA 4ZZMA 5HO8A 4M13A 2R0UA 5K3YA 3V6RA 3QUPA 5CLPA 1U46A 4KRDA 4C8BA 2YA9A 4E4NA 3D9VA 3G6HA 3VRZA 3JVSA 4O0UA 4W9WA 4H58A 4UWCA 4UV0A 2PVHA 4O2ZA 4QMVA 4G3FA 4UEUA 2FGIA 5TOZA 3RZBA 2YZAA 3QA8A 3VF9A 1JOWB 2W7XA 4FV5A 3CD8A 1XBCA 4G17A 5J5TA 4TYHB 1TKIA 2ZMDA 2GDOA 2VX3A 1FBNA 4BDAA 2ITPA 2H9VA 4V0GB 5CWZA 3PPZA 3SA0A 1JSUA 3NVMB 1B38A 3ZBXA 5M4CA 4K1BA 3AC4A 3R8MA 4DG3E 5CF8A 4N6YA 3F66A 2V22A 3AC8A 3F82A 2V62A 4MF0A 4PY1A 1XH5A 2GNFA 3KQ7A 4H3QA 5AUWA 2BALA 3K3JA 4BR3A 5D10A 5H3QA 4TYJA 1KE8A 3BBWA 4MYGA 4L67A 3NNVA 4USDA 5LCJA 3CC6A 4IHPA 4G9CA 3AT3A 5BVOA 2XNMA 3Q9ZA 5IU2A 1SVGA 1R78A 3HUBA 4ZJVA 3A61A 1LEZA 3ZLSA 4BN1A 4I6QA 3F6XA 2UZOA 2QHNA 4FZDB 3TACA 1IASA 1V0BA 2OLCA 2WMUA 5I3OA 3PWYA 3ZS5A 1KE6A 5LOHA 4DGNA 4O27B 3KKVA 3R6XA 5DLSA 2VGPA 4FL2A 5FLFA 3UIBA 4O84A 1I09A 3MI9A 4RX9A 4MBIA 3QRKA 4H36A 3OWKA 3UQFA 3DBEA 4ANLA 5J1WA 1GZ8A 2J90A 2WQNA 4GK3A 3ZSIA 5CZHA 4BBFA 4LI5A 5LXMA 4EORA 3C7QA 2YCFA 2BZJA 3V04A 3MY5A 5L6OA 2IG7A 2YHVA 3KN5A 4ZS4A 4NK9A 4N4SA 2X2MA 1GY3A 2XBAA 3QQHA 3PP0A 3VO3A 3KK9A 3DAJA 2F49A 2JDVA 3DKFA 2X7GA 3UNJA 3OEZA 4GU6A 4BCOA 4CKRA 3LCTA 3QD4A 4ALVA 3BLRA 3F88A 3GCQA 1SMHA 2E9VA 4JAIA 5HKMA 1IG1A 2CLQA 3VC4A 2OI4X 4U79A 3EQFA 4C38A 1IA8A 3EB0A 4I92A 3GCPA 4TWPA 3DLSA 3F61A 5AUXA 1OL5A 3GT8A 2C47A 3LMIA 3BLHA 4CG8A 4F7JA 3LQ8A 5CAPA 1MQBA 4GG7A 4FKPA 5DIAA 5BMMA 1H00A 3GVUA 4EZ5A 2UZEA 2JIVA 5AP3A 1DAYA 4BKJA 4CFMA 3LQ5A 1OUYA 4L7SA 4CTCA 2BRMA 2UW5A 2XA4A 3AD6A 2W1FA 4R3CA 3ULIA 3UOLA 3CY3A 2B53A 3ZFXA 1QCFA 5I3RA 5CEIA 4WG4A 1GZNA 2HZIA 3V8WA 4KA3A 4U3ZA 4AZTA 4XOYA 2FYSA 4ARKA 2X7OA 4XUFA 4RX7A 4FTQA 1S9JA 2AYPA 4FTOA 4QMXA 4O96A 4APPA 3Q60A 5AP1A 4C36A 3FQSA 5CU4A 4BICA 4IAKA 3AGLA 3KK8A 4FL3A 2XKEA 3WYYA 2QR7A 3W16A 4GL9A 3F3VA 5JZJA 1BX6A 4LFIA 5FD2A 2WKMA 3NEWA 3B8QA 5H8GA 5HLNA 3VHEA 3ZRMA 3OOGA 2QOOA 4O7RA 4PTEA 3SHEA 4FSMA 5CALA 3P79A 4YHTA 5M09A 3KU2A 5AP7A 3LFQA 4IC7A 1ZOEA 2VTAA 4QP9A 3DPKA 4YGAA 4IADA 3IW5A 4QMSA 4UX9A 5E90A 3C5IA 3A7FA 4QNAA 2ETMA 5CANA 5JSMA 4AGUA 4BDGA 3SLSA 4YC8A 2X1NA 3FBVA 4MXYA 5EM8A 2B0QA 3P86A 5E8XA 4YURA 3HDMA 3TG1A 2R4BA 4UB7A 1ZXEA 3BYSA 5IQGA 5AUYA 1PXIA 5DT0A 1URCA 4ZSAA 5IA4A 4RJ6A 2PSQA 5AX9A 4CZUA 4EZ7A 3S4QA 4HOKA 4IFCA 4OTWA 3O51A 4GKHA 2H34A 4U40A 3I81A 4D1XA 2O64A 3QX2A 4NW6A 2BDFA 5AR3A 3FXZA 3FKLA 4FG7A 5F1ZA 2YDIA 5AV0A 4TNBA 2YWVA 4BTFA 4BCQA 2EXMA 4AX8A 3QLGA 4PL4A 4DTKA 4AGWA 3R71A 2P55A 2VTTA 5FP6A 5M4IA 3DA6A 2W17A 4S32A 2OG8A 4GSBA 1H28A 3O8TA 4AW5A 1RE8A 3MW1A 2C3KA 3PXQA 4PX6A 1MRYA 2HIWA 1IAHA 1BKXA 4HYHA 5AAEA 4FTNA 5J87A 4B6LA 3CEKA 2GS6A 5AUTA 2EUFB 2XBJA 4JRNA 4AA4A 2ZM1A 4F0FA 4NM7A 3Q2JA 2OBJA 4D28A 2PMNX 4YZDA 4AN3A 3NIEA 3FSFA 3BHYA 1H0WA 4QPMA 4RVKA 2GHGA 3OWJA 5K0KA 3SG8A 1ZZ2A 2ITOA 2B4SB 4FV9A 3VBYA 2R7IA 1W0XC 3MPMA 3QTXA 2ERKA 4XG8A 3UMXA 4EKKA 5TKDA 2ZV8A 4PNKA 4FKLA 3JY9A 3I7BA 4FEWA 4CCUA 4ITHA 3G9LX 4J8NA 3LJ2A 2YM4A 4DTBA 4BY9E 3OCBA 4Y8DA 5EW8A 4BDBA 4S2ZA 3TCPA 1Z9XA 4YJTA 3KB7A 4NSTA 2VWBA 4WT6A 3HMOA 2ZAZA 1WZYA 5LJJA 3T3UA 3EL7A 1REJA 1ZOGA 2PVMA 2VWZA 4FIHA 4DH5A 5M08A 1JKTA 3UVRA 4TNDA 4LL5A 4TL0A 4M66A 4U44A 4WRGA 3ORNA 4GUEA 2WEVA 4KRCA 4FV8A 5F9EA 4B4LA 3QA0A 1FVTA 1OI9A 2RG5A 4ANQA 3QGWA 4BCKA 3VS4A 4CRLA 4FZ7A 4UALA 1Q8ZA 4ZIMA 2RFSA 4L44A 2CGWA 3O0GA 3ZCLA 3SX9A 2GTMA 3DNDA 3KXGA 4U3YA 3VS2A 3MB6A 4JX7A 1UKHA 4DFZE 5DMZA 3LJ1A 4UMRA 2YFXA 3G0FA 4ZTSA 5CF4A 2VZ6A 4IX4A 4E5BA 4I24A 1E9HA 1MRVA 2C6OA 1W98A 5DT3A 4OBQA 2OH0E 3ODYX 2WMVA 2R64A 3QRUA 2HZNA 2WMWA 4J8MA 3RPVA 5M55A 1H4LA 4I20A 1NVQA 4KIQA 4QMYA 5E8ZA 5LWMA 2W05A 2IW8A 3FE3A 4AZFA 4WNPA 3K54A 3CCNA 4L3JA 3EN9A 2JAVA 5CEKA 4E8AA 4C61A 4IC8A 5IEXA 3CR0A 2F2UA 3SW7A 3RKBA 5HCZA 3R83A 2HWPA 3PXZA 4KINA 3NVKI 1KWPA 2R3MA 3DT1A 3E63A 3KEXA 3M2WA 3QTZA 2QO7A 2RIOA 4QMUA 3VBVA 3F5XA 4BIBA 4RQKA 4E5AX 1XH6A 1YXXA 5FQDC 3CKXA 3TUBA 4NTTA 1UVRA 3B2WA 3UTOA 1XH9A 4DAWA 4E93A 4W4WA 4EHGA 2HY81 5JRSA 5EH0A 3RI1A 4DGLC 2YM6A 4HGLA 2RF9A 2R7BA 3OG7A 4FTRA 5DG5A 5E1SA 3O8PA 1M7NA 4UYAA 4EBWA 1YI3A 5EYCA 2ONLC 2P2HA 2W1DA 5CI7A 5AMNA 3HMNA 1JSVA 1SVHA 5HX8A 1ND4A 2P33A 3RINA 5ANJA 3FSKA 1DI9A 2PZIA 1CM8A 1JKSA 3IGGA 3UIXA 4O7NA 3I79A 1FVVA 4LMNA 3PJ1A 3RVGA 2QG7A 3EQPA 4M14A 4D2RA 4DYMA 5DN3A 2BCJA 2P0CA 3E92A 3FC2A 3IW8A 4AU8A 3ZEWA 2GNIA 3QUEA 2C1AA 4NUSA 2OXDA 3QD3A 2R3GA 4JBPA 5IZFA 1J1BA 2XM9A 5H2UA 4QYHA 4RJ8A 1UU7A 3FAAA 2JC6A 3LPBA 3Q4TA 3UPXA 2CN8A 4FZFB 5LMKA 3UOKA 1MUOA 2R3OA 2GFCA 1T46A 1OKVA 3HECA 5EOLA 4DCEA 4EH3A 4J71A 4BHZA 4ONAA 4YC6A 4B7TA 4QP6A 4IVDA 5L6WL 5DEYA 3RZFA 3NX8A 1Q61A 2FB8A 3OTUA 3FZ1A 2WGJA 3N4UA 3DK6A 4YJOA 4F9BA 2PMIA 1I44A 1JPAA 3U6HA 4FE2A 3GCVA 4MXAA 2VGOA 1OVEA 3OWLA 3ZFYA 3ORXA 3RHXA 3LMGA 3P7AA 3MBLA 3QBNA 4BI2A 3H10A 5JT2A 3PLSA 4BB4A 3WZDA 1Q8YA 2HW6A 2E9UA 5JGAA 2R5TA 3F69A 2W1HA 4BYJA 4U81A 1V0OA 3VUDA 5LVLA 2J9MA 2BZIB 2DQ7X 4HZSA 5CSHA 3QF9A 3KC3A 4AT4A 2WEIA 4GS6A 4EOLA 4O7ZA 3NYOA 2J7TA 2QO2A 3IG7A 1PXPA 3GC9A 1XWSA 5IQDA 4I3ZA 3KCKA 3M11A 2PU8A 3KMWA 4YO6A 4F7NA 2ITVA 1J1CA 4DCAA 4RIYB 4PWNA 4FNZA 2CN5A 4AQCA 4JBQA 5C4KA 2KTYA 3BKBA 3WOWA 2EB2A 4EUTA 3N51A 5EQEA 3MA3A 4GRBA 2XB7A 4ALUA 4D5HA 3GP0A 3HAVA 1KOBA 3LCSA 1UA2A 3E87A 3LFEA 4GIIA 4NIFB 5EKOA 4RIXB 2J51A 3E3PA 4G34A 5KHWA 3RM6A 4I6BA 4QD6A 1UNHA 2IVVA 4CKJA 4XV2A 5HOAA 3KF4A 3UO6A 2HELA 2A4LA 2JFMA 5C03A 1WBWA 1YXUA 3JY0A 2O63A 4GJ2A 3VUIA 4FG9A 3D7TB 2B9FA 2QLUA 2QONA 5AJQA 3OXTA 4UMQA 5IUHA 2CMWA 2ITZA 5DGZA 4I21A 2CJMA 4FKQA 4AGDA 1GZKA 3QZFA 2E2BA 3GFEA 2PHKA 4D4YA 3RGFA 4M67A 5TR6A 5CTPA 5FUTA 2RG6A 5FXRA 4WNOA 3BV2A 2OXXA 2C6LA 1H25A 2WMQA 3FLWA 5KZIA 4RGJA 4YU2A 4PDYA 3TDWA 4TZRA 3FZSA 4FVPA 2H8HA 4FV0A 3H0YA 4NEUA 5FBNC 5GJGA 4EWQA 4RC3A 1NA7A 2XRWA 3QRIA 4C3RA 5L3AA 3FV8A 1URWA 5C9CA 3GU8A 4JXFA 3OXIA 2J2IB 3Q04A 3DJ7A 3MTFA 1ZMVA 4LL0A 4KD1A 5CZIA 5C8MA 2QR8A 4JNWA 5DR6A 5I9XA 3DS6A 4FKSA 5HLPA 5AV3A 3SQQA 4AGCA 2F9GA 2HW7A 2QI8A 4XNEA 5HICA 4DF3A 3ETAA 5HTIA 3ACJA 1R39A 1YKRA 1YWNA 2XS0A 3DTCA 3EQIA 2PUIA 2W9FB 2R3IA 4QP4A 5AR7A 2QNJA 4GH2A 3PJCA 2XEZA 5EYKA 1SM2A 3R01A 1PKDA 4MWIA 4NJDA 3ZXZA 2B9JA 3SAYA 3VUKA 3FMLA 3SRVB 3LFCA 3H9OA 3BBTB 4F09A 1YDTE 3HRBA 1H08A 2X4FA 3VS7A 4QMMA 4O6EA 4W4XA 4ZSJA 4HVDA 4AFJA 4C0TA 1UNLA 4C62A 3TV4A 4BBMA 4EK3A 4O82A 2UVXA 2WHBA 1BMKA 1IEPA 1R3CA 4N70A 4BL1A 1PRYA 3AGMA 4GEOA 4FTJA 4FTTA 3TZ8A 3GQIA 4DT9A 4AF3A 4FTCA 5IQEA 3QKKA 3R22A 2CKEA 3O2MA 3L9LA 4X3JA 5D9HA 4ACGA 4BGHA 1X8BA 3DDPA 1KV1A 1KV2A 4S34A 5CSVA 2RSVA 3POOA 3RK5A 2XK3A 4F4PA 4PRJA 4CFWA 1RJBA 1WBTA 2WNTA 2Y8OA 4F0GA 2WFYA 5AP0A 4O7LA 4IIRA 4YC3A 4WG5A 4OTIA 4PF4A 5DYJA 3KRJA 2IZSA 2J6MA 2YCSA 4KBAA 2UW8A 4RZWA 4Y46A 3ZZWA 4EH2A 3QTIA 3LE6A 4R1YA 4BHNA 4BWXA 3PTGA 5BVFA 4XCUA 5ANGA 1U4DA 3Q4CA 4HPTE 4CTBA 5CS6A 1ZY5A 3HGKA 1CKPA 2WTKB 3G0EA 3R73A 3CQUA 4ASXA 4BRXA 1KUTA 3NUNA 4D0WA 4CMTA 3QQKA 2VWIA 3QHRA 3DZOA 5EYMA 4FSWA 2BIKB 2BR1A 3P08A 3V5LA 4FV3A 4G3EA 4MNEA 3GGFA 5JFWA 1JVPP 4FKWA 2O65A 5TE0A 3SDJA 3MFUA 3TKIA 3FKNA 5AWMA 4BZDA 4TKSA 3IDPA 4WHZA 4AT3A 3EZVA 4BCMA 4C3FA 3D0EA 4AN2A 1JWHA 4DT8A 3BYOA 3ZRKA 3HRCA 1IA9A 5J95A 2OZOA 4J95A 2A27A 5FGKA 1PXOA 3QZHA 2WXVA 2OFVA 4G1WA 3FJQE 4IM0A 3COIA 4YJQA 1VR2A 4DBXA 2WMSA 2KULA 5CQUA 1Q8TA 2R3JA 2YDKA 5FM2A 1KOAA 4GCJA 4AG8A 4AS0A 4BWPA 3FY2A 4PUZA 4RFYA 2PE2A 4QP3A 2OU7A 1OIUA 2CNQA 4D4SA 4IX6A 2XYNA 2QOHA 2VO7A 3DB8A 3QL8A 4FSQA 3EQBA 3IOKA 4RA5A 4XOZA 3POZA 4EOSA 2XNGA 3Q9XA 4LM5A 3REPA 4PTCA 2JKMA 5B7VA 2W1EA 4CFUA 3OBGA 5FWKK 4FKOA 5LQFA 2V5QA 3QAME 3R7IA 3KRXA 3LXPA 4FIGA 5BUJA 4L53A 3Q6UA 4D2VA 3C51A 4IJPA 4F7SA 2IPXA 3TJDA 2BRHA 3BV3A 3NAXA 5CAOA 4M3QA 2QOIA 4ZTLA 5G1XA 4HYUA 4BCFA 3PRFA 4EOKA 4ZAUA 5A46A 2ZM4A 2IVTA 4EKLA 2YIYA 3P78A 3GU5A 3KXNA 3D5WA 4IAZA 4XV1A 3V5QA 3P7CA 3FZRA 4YJNA 1OL2A 2Y9QA 2W96B 4FVQA 1M2PA 1JAMA 5BVKA 4IW0A 3VAPA 4NZWB 4YTHA 1SNUA 3A8XA 2WTVA 4FT3A 2GNLA 3DB6A 3MGYA 4NM5A 3TZ7A 3MVMA 1QL6A 3EZRA 4HGSA 4O7YA 5K5NA 4ASEA 4G31A 5JQ8A 4FIJA 5H8EA 1P5EA 3GOKA 2ETRA 3PRIA 5AR8A 2XH5A 2WAJA 2WB8A 2NRYA 4J97A 3L9MA 4FEQA 4WUNA 4J53A 2XZSA 2H96A 4FUXA 3FMJA 4PV0A 4GKIA 3AT4A 2BTSA 4JIKA 3WZUA 5J7HA 4BWKA 2JKKA 2PL0A 3SC1A 3QQFA 2Y4IB 1RDQE 3MJ2A 4CFXA 4O81A 2YAAA 5EDPA 2HWOA 3EKKA 2C5YA 2G01A 3DBDA 4HCUA 4W8DA 3ZHPC 5M44A 3MA6A 2CKOA 4U80A 1R1WA 2BAQA 2C6DA 4A06A 4GFMA 4D4RA 3K5VA 5ICPA 3KRRA 5EHYA 4HCVA 4DG2E 1OITA 3LFAA 3OW4A 3SGCA 1WBNA 2XK8A 5AA8A 2CGXA 2ERZE 1UWJA 3BGQA 3FY0A 3UZRA 1B6CB 4YTFA 3EN5A 3RPYA 3FZPA 5M51A 5I0BA 3W2OA 5EDRA 4XLIA 4OGRA 3RJCA 3OT8A 4C3PA 4ZY4A 2OIQA 4QT1A 3UC4A 1K9AA 5AP5A 4YPSA 4WSQA 4E6QA 5J7BA 4ZOGA 4M68A 2EB3A 5BX0A 3UDBA 1UV5A 5JK3A 2HZ0A 2C3JA 4K18A 5AP6A 4EJ7A 4HPUE 5L2SA 3PIYA 3PYYA 2ZV2A 4L8MA 4M69B 3C0GA 5HESA 2ZDUA 3Q52A 4QMPA 2VTRA 4K9YA 4KS7A 3DJ6A 2CCHA 3PY3A 5HE0A 1YHVA 4X3FB 1UU3A 3QGYA 3C5UA 4MF1A 3V5JA 4FV6A 5LARA 4ZLOA 3PA5A 4EK4A 1ZLTA 3RPRA 3KVXA 3BGZA 1YHSA 3F5UA 4J99A 3ULZA 4Y72A 5L2TA 1A48A 3AOXA 4PPBA 3TT0A 4AXAA 2YM5A 3FL5A 1XR1A 5CEPA 4ZTRA 4RBLA 1Q8WA 2R3KA 2BDWA 1U5QA 4L68A 3L8PA 5LCKA 3TKHA 3AC3A 3H30A 3CKWA 5LMBA 2VWVA 4TT7A 5HD7A 5M4FA 2VV9A 3NUYA 2O3PA 4FC0A 5HG9A 4GK4A 3BEGA 4RVTA 4PMPA 4C58A 3VNTA 4FBXA 5GHVA 3MDYA 3CLYA 2G2HA 4DEHA 4KBCA 5HBJA 2V0DA 3UQCA 4Z3VA 1PY5A 2HXLA 3DDQA 4O0WA 4WD5A 2XK9A 3DFCB 3ODZX 4KAOA 4W9XA 1LUFA 3HP5A 3PY0A 5HNIX 4F1MA 4HYSA 3AMAA 2C68A 4DFXE 3GOPA 3NAYA 1RQQA 3OY1A 2B7AA 4ZTMA 3H0ZA 4E6AA 4UMTA 4L43A 4QQCA 4R7HA 2EU9A 1OL1A 2WU7A 2ITNA 3R1NA 3NZ0A 3PSDA 3R9HA 3ZMMA 2AC3A 2WU6A 1NVRA 4YNEA 3D5UA 4DG0E 3UG1A 4ITJA 4XRJA 3TNHA 3NUXA 2OZAA 3E88A 3HMIA 2Z7QA 2Z02A 2CSNA 4IANA 4FEVA 3C4FA 2JLDA 4IX3A 2CNVA 1CSNA 4NKAA 1H24A 1OPKA 3SW4A 1YW2A 2HAKA 3FMEA 1YWRA 4D9TA 4GT5A 3AT2A 2VTHA 3ENMA 4B0GA 4H05A 4F70A 3VVHA 3RMFA 4BKZA 2UZDA 2RGPA 1UWHA 4FNYA 2SRCA 3ZRLA 4IM2A 4CFVA 5A54A 2Y6OA 2QHMA 5DT4A 2GNJA 3WZEA 3SV0A 3EYGA 5KBRA 4EEVA 3TNQB 2FSLX 3ORIA 4J7BA 4ACHA 3LZBA 3A7IA 3QALE 5E91A 3CD3A 3PJ3A 3FDNA 3A8WA 4ZMFA 4H3BA 4QRCA 4XEYA 4GJ3A 4F99A 4FYNA 5HQ0A 3UE4A 4C2WA 3IS5A 4K11A 1OBGA 4EUUA 4O2PA 4FNWA 4JBOA 4EH8A 4EH5A 4PPCA 2W06A 2WTIA 3KFAA 3WIKA 4X2JA 1YXVA 3DQXA 3HV4A 4BF2A 3ZO4A 1CKJA 2J0KA 2ZB1A 4WA9A 3E3BX 2G2FA 3QKLA 5ETFA 4N6ZA 1M52A 3O7LD 4FSYA 4Z55A 2CCIA 4I41A 5L4QA 3I6UA 3W18A 2J0LA 3MV5A 3MVJA 2UW0A 5IQHA 1V1KA 1ZY4A 3IW7A
chains in the Genus database with same CATH superfamily
4EI4A 2X2LA 4D5KA 2PVLA 2QG5A 3PG3A 3QCYA 4L7FA 3GI3A 4Q9SA 3MH1A 3COMA 1BUHA 2R3RA 4QEBA 3ZM4A 5A4TA 1H1RA 5KMIA 3E8NA 4GVJA 4JDJA 1PMUA 5BQ0A 5JEBA 4FR4A 3MFTA 5EI8A 4DH3A 1OGUA 4AZSA 5I9YA 5JN2A 4IFGA 3FYJX 3R2YA 4M12A 1FMKA 4KNBA 3R8UA 2CLXA 2QURA 3FLSA 3R02A 4UYNA 3FUPA 3MPTA 2E9NA 4FKVA 5H9BA 3ZEPA 1QPDA 2XNPA 1ERKA 5FEDA 4E3CA 3A60A 2FSMX 3O71A 4JDHA 4L6QA 4R7IA 3WYXA 5L6PA 2BRBA 2XKDA 3BEAA 3ALNA 3CJGA 4JBVA 4FTKA 5G6VA 1NW1A 4M97A 3BE2A 5DR2A 4RWLA 3ZLYA 3OEFX 4ANOA 2WD1A 4XJ0A 4BI0A 4PP7A 5GINE 4L42A 2IJMA 5GIOE 4ZJIA 4AFEA 5FM3A 5DI1A 1CMKE 1YI4A 4GU9A 1YRPA 5CU2A 5E1EA 4DEAA 2VTPA 4J1RA 3PXYA 5C01A 4OT6A 1QPJA 4AOJA 4KKGA 2XK7A 4X7QA 4FKIA 3CE3A 1U59A 4Y5QA 4BDEA 4QMTA 2GHLA 3ALOA 4EYMA 2YCRA 3OCTA 4M8TA 5CSXA 3QQJA 3VQHA 3TM0A 2PVJA 3BPRA 4QTEA 4DHZA 2VD5A 4GT3A 3TDVA 2X39A 4QP2A 3KULA 4MAOA 5BYZA 4Y85A 5CAQA 2OZAB 3BHUA 4QYEA 1STCE 3W8LA 4FGRA 4ENYA 4F6UA 2YDJA 4DFNA 5ANKA 2VTQA 4QQJA 1JLUE 2DWBA 3EN4A 2QOKA 1GOLA 3W2CA 4H39A 1QPEA 4KSQA 5DHJA 5A4CA 5IH5A 4KIPA 4FV2A 3EOCA 3VBTA 2GMXA 3PSBA 4U42A 5I5ZA 4MUQA 1U54A 5F94A 4C33A 3UO5A 5GNKA 4RWJA 5CXHA 2X9EA 3ZSHA 4K0YA 4EBVA 3GU6A 3V6SA 3W2SA 3W1FA 4CEGA 5EM6A 3PJ2A 5GZ9A 5IA0A 4AQKA 4ZP5A 2F7ZE 2BFXA 2R3FA 2C5VA 2XCHA 4A4XA 2XIXA 5M53A 4JLCA 1PKGA 1H01A 3FLYA 4HZRA 4MKCA 4ASZA 4Z7HA 4I4FA 4DE4A 4YO4A 4ZZOA 4LRKA 2QQ7A 4UY9A 1BLXA 4R7BA 1VLRA 3W2RA 4BC6A 1EH4A 3TMOA 4JVGA 3ORPA 2ONLA 3R8PA 3QFVA 1GNGA 3DY7A 1GIIA 2W0JA 3E8CA 4DFLA 3PVUA 2OJIA 1XH4A 4I5PA 2I0EA 3LXKA 3NR9A 1XHAA 2NPQA 3NW6A 4W8EA 4TTHB 5A9UA 4PMMA 3PPJA 5AV4A 2QLQA 3QTWA 2YCQA 1KE5A 1E1VA 4FTUA 3EQDA 4Y83A 5K4JA 3SXFA 2XJ1A 3OF0A 3OVVA 3HKOA 5KMJA 3LMHA 4EH9A 2WTCA 4RIWA 3KL8A 2J0MB 5JKGA 3NGAA 4XBUA 1XKKA 3RWQA 1YOLA 3R9OA 3HV3A 4BDDA 2O2UA 4FKGA 2QO9A 3IGOA 3ZSGA 5HIDA 3OWPA 4D2SA 3OHTA 3QCSA 3HL7A 4U0IA 4LYNA 3NSZA 3GC0A 5ETIA 3R28A 4YTIA 3LIJA 3RPOA 2YLFA 3ELJA 2Z8CA 3VBXA 4DDIA 3K5UA 4N57A 3LM0A 1APME 3JPVA 3RCJA 3U6JA 3AD5A 4LV5A 3EIDA 1R0EA 4N0SA 1M2QA 1P4FA 4RWKA 3GCSA 1R0PA 4AACA 4FX3A 3V5TA 4O0RA 1P4OA 2AEGA 4L46A 1BL7A 1G8JA 3KGAA 2FH9A 1H1PA 3ZDIA 4WKQA 5AAGA 3DKCA 1TQMA 2HZ4A 2ITXA 3ENHA 4E26A 3F3ZA 3NW5A 3QZIA 2W99B 3WILA 4DEBA 4ZLZA 5TO8A 3C50A 3HNGA 5DFPA 2YEXA 3AC1A 2X81A 2C6EA 2YLEA 5FXSA 4NCTC 3EN6A 4R3PA 2YJSA 1BI8A 5E8TA 2WELA 2QKWB 4TN6A 4F1OA 3W0NA 4I6FA 2CNUA 5FEEA 4FKTA 1G5SA 2YITA 3V8TA 2J50A 3A99A 3KCFA 3SXRA 3KREA 3BU3A 3MESA 3WF7A 5FTQA 2WQEA 4KS8A 5DR9A 2F7XE 2YIWA 2C69A 3T9TA 3QX4A 4YNOA 5J8IA 3TV7A 4MWHA 2BZKB 2QU6A 3D15A 4X0MA 1H1QA 2WOUA 3BHTA 3QQGA 1LP4A 3IKAA 4AE6A 1AQ1A 4IDTA 2PUPA 3PA4A 4WO5A 3U4WA 2Y4PA 4YJSA 4FV1A 4R1VA 1NT2A 1W8CA 4CD0A 4G5PA 2XCKA 3G90X 3RTPA 4QTBA 1PXLA 2REIA 3QHWA 3V51A 5D7AA 4OT5A 2A2AA 2PYWA 2X8EA 3PE1A 3D2IA 1J3HA 4JQ7A 4FZAB 4F7LA 3WI6A 3MFSA 4C4FA 3EFJA 3RNIA 3UPZA 3D83A 1YDSE 4QMLA 2O5KA 5L2IA 3L9PA 3BQCA 4NM0A 5M57A 2QODA 2VUWA 4DFUA 5HZNA 5IEYA 3Q5IA 3QXOA 4IACA 1BL6A 4RFMA 1Q8UA 1Z57A 4YSMA 3R9DA 3VF8A 4YHJA 4ZY5A 3VW8A 3QRTA 4FSUA 4EQUA 3AKJA 2ITUA 4YJUA 1OBDA 4GW8A 2JBPA 3R2BA 3TIYA 4BDFA 2QD9A 2Y6MA 3P5JC 4F6SA 2UW3A 2C5OA 4L3PA 1H0VA 4EH6A 1XH8A 3PUFC 3II5A 1VYZA 3OCGA 5AM6A 4D55A 5A4LA 3EQHA 4CV8A 2C6TA 2XYUA 4A9UA 4ZEGA 1P14A 5KNJA 4C02A 1RW8A 4O86A 4A07A 4Z16A 2VU3A 3L1SA 1UNGA 3ZUUA 4PTGA 4PL5A 2J4ZA 4IB0A 1Q62A 5HBEA 4E1ZA 3MB7A 3IQ7A 3VUMA 4IQ6A 4L00A 5E8VA 2XK6A 2OXYA 3G2FA 3Q9WA 3GBZA 1FGKA 1Q97A 4U7ZA 4WBBB 2YM3A 3VJOA 3UZTA 4A9YA 2QU5A 3LM5A 2QC6A 1H26A 1ZAOA 2UV2A 1O6YA 4X6QC 5HIBA 2VTMA 2OJGA 3V8SA 3EQCA 5FG8A 1ZYCA 2WPAA 1UKIA 3TXOA 4L45A 1ZRZA 5L8JA 4IB1A 3ORKA 4WNKA 4CT1A 5I4NA 3Q32A 3UP2A 4B8LA 3COKA 3LLAA 4QMWA 4YBJA 4XMOA 2QOFA 4TXCA 5BVNA 4JJRA 1TVOA 5CU0A 2JBOA 3U8WA 3V01A 4FOCA 4C2VA 5DE2A 1B39A 5IG1A 1WBVA 4LRMA 4R5SA 3HAMA 1REKA 2C4GA 3E7VA 2VTOA 4G3CA 5CF6A 3UZPA 1DM2A 3ZO1A 4OTQA 4TWCA 5J9ZA 3CGOA 3NYNA 3Q96A 1OKYA 2PE0A 2FSOX 5AR5A 4HW7A 4NW5A 4FZ6A 3CS9A 5IQFA 3GCUA 4JQ8A 4XP2A 2B9HA 5JQ5A 2WMAA 2C6KA 4OW8A 4BCPA 4BTMA 2OIDA 4DGMA 4BDIA 3O50A 3QKMA 3UVQA 2ZOQA 5EHLA 5EM5A 4EOPA 5CX9A 4Z7GA 3CJFA 3F9NA 4QPSA 4WOVA 4ALWA 3R7VA 5LVMA 2BFYA 3FEGA 3VQUA 2QOCA 3O7LB 2WTWA 2Y0AA 3UYSA 4DA5A 1YVJA 5B0XA 4HVSA 1Y57A 2ZYBA 3EFWA 2C30A 4FI1A 5A3XA 2WTKC 5KKRC 3FMNA 3KN6A 2E9PA 4S30A 5HE1A 2H6DA 4FVRA 4ZSGA 5IA3A 1J91A 2QKRA 4FSNA 4C37A 4HNFA 3CP9A 4K2RA 5FP5A 1PMVA 5ETAA 1H27A 3EFKA 4HJOA 2CGUA 4D2TA 1QPCA 5AFVA 3OZ6A 3I60A 5IISA 5KX8A 3CIKA 3L8VA 5E9EA 1OIQA 1Y8YA 2W1ZA 5CVHA 1G8AA 2JDTA 2ITQA 4HGTA 2XIYA 1WVXA 5DPVA 2PPQA 3OP5A 4IZ5A 3F5PA 3I1AA 2FSTX 4FT0A 4O6LA 3L8XA 3TIZA 5B2LA 4YZ9A 2Q0BA 4CG9A 4Y73A 3GU4A 4I93A 3TNWA 4F08A 4Z9LA 3PUPA 2JIIA 2W1GA 4LUEA 4TWNA 2E9OA 3R7YA 4E73A 3IPHA 4ZLYA 4OAVB 3H3CA 4BJJA 3NNXA 3RK7A 4MXOA 2WIPA 3EHAA 1PYXA 2VO0A 4FKRA 4QMZA 3JS2A 3ZTXA 5JFVA 5KMNA 1S9IA 3BE9A 3QLFA 4BZNA 3B2TA 4FYOA 4PDOA 2UW6A 3CQWA 1W83A 4WBOA 2PVKA 2XNEA 4YJVA 4YPDA 2CKQA 3TUDA 5CENA 4F1TA 2XIRA 3UP7A 5AA9A 4E6DA 5BYYA 1WBOA 3F2RA 3MIYA 4L3LA 3VN9A 5HLWA 4IAFA 5EK7A 2VTJA 3WBLA 4Q2AA 5AIKA 5T3QA 2X4ZA 4GT4A 5IA5A 4EH7A 3PSCA 4MD9E 5CAUA 4TPTA 4DFBA 5F20A 3G9NA 4KABA 3F7ZA 5D12A 2ITTA 4ZSEA 5HNGA 3TTJA 4C57A 3NUSA 3P9JA 3GENA 4BTJA 5CEQA 4ENXA 3VBWA 1Y8GA 2XK4A 2Z60A 3OY3A 4ASDA 3MVHA 3OTVA 4XG3A 4X2NA 2W4JA 3LFSA 3QWJA 4IMYA 1GAGA 1WMKA 4QYYA 4D2PA 2HY0A 5ANIA 4EQMA 5J5SA 5LVPA 4P5QA 4ZMEA 1H8FA 1MQ4A 4EOQA 3FC1X 4OLIA 5BPYA 2X7FA 4ZJJA 4DFYA 2VX1A 4L52A 1GIJA 2WMTA 3NW7A 3P0MA 4PL3A 2YIRA 3BLQA 5ANDA 4EYJA 3LQ3A 2C6IA 3BGPA 3DKGA 2P2IA 1FGIA 2VTLA 3JXWA 1OMWA 4FTAA 3LAUA 3RAHA 4MBLA 4BKYA 3PE2A 2J5EA 4KIKA 4RVMA 4EH4A 3BRBA 3LCDA 2R3LA 2XKFA 2JEDA 3BCEA 4CLIA 4CGAA 3GU7A 4ZZNA 1DI8A 2P4IA 4CRSA 2PVNA 3U9NA 5ANOA 1ZWSA 2C0TA 4LOOA 4AE9A 3O96A 3KA0A 4H1JA 2PULA 4OBOA 5FBOA 4UBAA 4O21A 3FZTA 3PPKA 4PP9A 2XALA 3DCVA 4I22A 2Y4IC 5DVRA 4XG7A 3C4XA 5AUZA 1ZOHA 5EQPA 3TKUA 3PZEA 5BNJA 4R8QA 3CQEA 4TYHA 4GYIA 5D7VA 5HI2A 4BDCA 4BVUA 3QRJA 4MX9A 4XP3A 1OECA 4ID7A 3WARA 4O4CA 5HORA 4V0GA 3PVGA 4U45A 3MY1A 5JRQA 1WBPA 3HEGA 2GHMA 3NLBA 4F9YA 3QD0A 3R8LA 5HTBA 3KMUA 3K2LA 3KXZA 3PG1A 4H1MA 4CFNA 1CDKA 4DHFA 3OD6X 1ZYJA 2XUUA 3OUKA 3Q2MA 3WF6A 4IWQA 4BDKA 3PZHA 4FT7A 3R8ZA 4DN5A 4XBRA 3PLAE 4L9IA 2UW4A 3BI6A 5EG3A 4FKUA 4O0YA 1F5QA 5L8KA 4F9CA 4DLJA 3LFNA 3EN7A 3W32A 4BCNA 5CI6A 4D1ZA 1V0PA 5CU3A 4DDGA 2C6MA 3H9FA 5I9VA 4XG4A 3D2KA 3FLQA 3I5NA 4BCJA 2YIQA 2IZTA 4BGQA 3PWDA 1TFFA 2NNWB 4CMUA 1BI7A 3CGFA 5IMEA 4I6HA 4AN9A 3LFDA 4JL9A 5DA3A 3TNIA 3HVCA 3TZ9A 2QVSE 4X3FC 5EI2A 3NUAA 2VWXA 5AIRA 4USEA 3PP1A 3S1HA 2PUNA 1WBSA 1XQZA 4IWDA 1UU8A 3N4TA 2F57A 5L8LA 1OIYA 2BTRA 1SZMA 3TYKA 4F63A 3D7ZA 3R7OA 4BYIA 2VX0A 2X2KA 4RJ7A 3O23A 3P1AA 4NTSA 5IUGA 2C0OA 1Y6AA 5AV1A 2C3LA 3CPCA 3G5DA 3R00A 4UZDA 3D5XA 4JDKA 3F7WA 4IZ7A 5KMMA 1Y6BA 1JBPE 3TZMA 5E4HA 2PMLX 5C26A 2ETKA 3RP9A 5IPJA 2XRUA 2HENA 4G6LA 2VWUA 4QTDA 3GXLA 4I5MA 5JFXA 3ORMA 3BWFA 3W33A 1PXMA 4EQCA 2BAJA 3RM7A 4EL9A 3HX4A 5AUUA 3HP2A 4ERKA 3NUUA 4QYFA 4MNEB 1H1SA 3F3UA 3Q6WA 5AR4A 3VUGA 4J52A 4AZEA 4O4BB 4EOMA 2WOTA 4LOQA 3V5PA 2PWLA 3UOJA 2OF2A 2BHHA 3FYKX 3R9NA 4NFNA 4DBNA 5B2MA 5IQIA 3GQLA 3P4KA 3C0HA 1YOJA 5HEZA 3ATSA 2ITYA 3ZONA 1G3NA 2WMBA 2YERA 3FWQA 4OTFA 3FZOA 3R0TA 3MH0A 3RK9A 2PZYA 4PMSA 2LAVA 5CU6A 4O91A 4M0YA 4MBJA 5HVYA 4CVAA 3M1SA 4IM3A 3ZO2A 5KE0A 4M15A 4DEEA 5IA2A 3BYMA 4EK8A 1ZMUA 4XV9A 4DEGA 2JIUA 3QYWA 2CKPA 4DGOA 1Q4LA 4FV7A 3AD4A 4DH8A 3SVVA 4YUQA 4F78A 2BDJA 3HA6A 5HG7A 4O7VA 5AUVA 2UW7A 4OR5A 5C27A 4RJ4A 5EQYA 3ZFMA 3QC9A 4EHVA 3DV3A 3QTUA 3E8EA 4GUBA 4QMOA 3SXSA 3LVPA 4FKJA 4XYFA 5EW3A 3ZOSA 4AZWA 3EH9A 4I1ZA 1Z5MA 4D1SA 3PXFA 4QQ5A 4DTAA 4FSTA 4FA2A 1W2FA 3CTQA 3E7OA 3FMKA 4C34A 1PF8A 2YZLA 1OGYA 3CSVA 5EFQA 4PDSA 2RKUA 4AOIA 1YWVA 4EK6A 1VZOA 3ET7A 5AADA 3FI3A 1W7HA 3EKNA 2G15A 2OIBA 4NH1A 3V3VA 3FMMA 3DGKA 2NP8A 5HVJA 1XO2B 3ZU7A 4DHJA 4S33A 3A7JA 2ZV9A 4IB5A 4BTKA 4C4IA 2R3HA 4ANMA 5TF9A 3AXWA 4RX8A 5EM7A 4YSJA 2PZ5A 3UNKA 2I40A 1Q24A 3LLTA 2XMYA 3MSSA 2YWPA 4YLJA 3SD0A 4RSSA 3UIMA 5KHXA 1XMMA 3BLAA 3C4EA 4YJPA 4NWMA 1XJDA 4CV9A 4YJRA 3LKMA 1WCCA 3RNYA 4FICA 4LQMA 4X6RA 3U9CA 3R9RA 1PXNA 4A4OA 4DITA 3I5ZA 5D11A 4HGEA 4MK0A 2B9IA 3MN3A 4BDJA 3BL9A 1W2DA 2BROA 3G51A 4J96A 3FXWA 4EC8A 5IH6A 1J7UA 2UUEA 2VNYA 1IAJA 1IR3A 3V5WA 1F3MC 4IB3A 4IZYA 5JMSA 1MP8A 3BYVA 4U9AA 3O8UA 4IVBA 2UZLA 4MXZA 4XG2A 3CY2A 3A2CA 4G16A 3T9IA 2XKCA 4P7EA 4IVAA 5T68A 2WO6A 3EWHA 4MH7A 4LV7A 5AX3A 3R04A 4NL0A 3DZQA 3NS9A 2YM8A 2DYLA 4M84A 3ZC5A 5LVNA 1AGWA 4R78A 3SG9A 2VWYA 3ZBFA 4E4MA 5GIPE 5GJFA 3LFFA 3WF9A 3UDZA 2W9ZB 5AR2A 4AXDA 4RQVA 3DXPA 1Q99A 2EXCX 4U43A 4X2GA 3RAIA 2XNBA 4O0SA 4DLIA 3E64A 4CQEA 2EXEA 1TZDA 4F65A 2PVRA 3D14A 2IW6A 2OWBA 2PTKA 1DS5A 2HXQA 2JFLA 2PVFA 2WQBA 3M42A 3QD2B 4OTDA 3RAKA 1K3AA 2WTDA 3UDSA 5BYLA 2IZRA 4JR7A 5F95A 3TTIA 4O0VA 4HVHA 3P23A 2YM7A 5C8KA 5HU3A 1O6LA 1LEWA 1SYKA 3HYHA 4RG0A 2A19B 3UVPA 4CZYB 5IH4A 3ML1A 3ZO3A 1M17A 2CPKE 4FEUA 4ZY6A 2PZPA 4II5A 4I94A 3SOAA 5IDPA 3MYGA 1M14A 3U6IA 4CXAA 4ITIA 4LMUA 3HRFA 3JVRA 5IQBA 2R9SA 4KBKA 4CLJA 1YI6A 3FL4A 4PNIA 4JIAA 3ORLA 3PJ8A 1XBAA 3I7CA 4K77A 4L01A 4OTGA 4RJ3A 3E62A 5J1VA 3FLZA 5E8YA 4NU1A 4YLLA 4CYJA 2J0JA 3MPAA 3ID6C 3S2PA 2OK1A 5AP4A 3OMVA 2GNGA 3D4QA 2I0VA 3BYUA 4BCGA 4C4EA 5I9ZA 4LG4A 3OROA 5BUIA 1UU9A 3ZLWA 3C1XA 3VWAA 3HUCA 1VJYA 2BVAA 4YZBA 4TYIA 4ACMA 4FUYA 4AP7A 1WVYA 4MEDA 5E8SA 3NPCA 3FQEA 2QOQA 5HTCA 3FHIA 3I6WA 4I4EA 2JAMA 3DBCA 3UOHA 5CVFA 5AM7A 4QTCA 4AZVA 5I9WA 5IKWA 2XNOA 4EOJA 3DFAA 1MRUA 2XM8A 3KY2A 4FOBA 3O5AA 4A9RA 4LDTA 2VAGA 3UODA 1E1XA 5GZAA 4NYEA 2I1MA 3PA3A 4HYIA 1F0QA 4O38A 4XH6A 3LCKA 3IW4A 2JKOA 2X0GA 3EMGA 3OFMA 4AAAA 3THBA 4XP0A 4CKIA 2GU8A 3QQUA 2GSFA 2GQSA 1FINA 3PY1A 4RX5A 2Z7LA 3MWUA 5HE3A 4BBEA 5A4EA 2P3GX 2GPHA 3MH3A 1PMEA 2GCDA 2F4JA 5HG5A 1ZYLA 2CGVA 5KUPA 2IW9A 4WRSA 3NIZA 5HO6A 5A6NA 3PVBA 4IAIA 2R3QA 3U55A 1IRKA 1PYEA 3LXLA 1OL6A 4RWIA 3ZC6A 3MS9A 1H07A 4QMQA 4YR8A 2G9XA 3H4JA 4Q5EA 1FVRA 5HIEA 4G6NA 4OBPA 5BVWA 3DKOA 3C0IA 2FUMA 3VUHA 3VS3A 4W4YA 1PXJA 2G1TA 2PK9A 5HCXA 5ACBC 5CT7A 2OGVA 2O8YA 4P90A 5E8WA 4RA4A 4D9UA 1PHKA 3ZXTA 2Z2WA 4QOXA 4DINA 2OW3A 5J9LA 2GTNA 3VIDA 2PMOX 4O1PA 1KE7A 1TQIA 2YABA 4QP1A 4IJ9A 2Y7JA 4FSRA 4NCTA 5J9YA 2RL5A 4MNFA 5CSWA 1L3RE 3AC5A 3IOPA 3W0OA 4AXEA 4JG6A 3PIXA 4YZMA 5ITAA 4XRLA 4GIHA 3RPSA 4BCIA 3RAWA 4WUAA 2PY3A 1Q3WA 4JS8A 3Q5ZA 5JGDA 1OKZA 1OZ1A 4O0TA 5GJDA 4JQEA 1SNXA 4XLVA 1XBBA 5EW9A 3VJNA 3VUTA 4GVAA 2GS2A 2IVUA 3GC7A 3QWKA 3FI2A 3AMBA 3MVLA 4FGBA 1OB3A 3QCQA 4W4VA 3E5AA 3CTJA 3VS6A 3OOMA 4R77A 3T3VA 5KZ0A 4AOTA 4AT5A 2UZUE 4OUCA 4RFZA 4LGDA 3ZDUA 4RIYA 4EK5A 1KE9A 3TNPC 2I0YA 4PMTA 2PE1A 2CHLA 4R6VA 4UWBA 3VHKA 4QMNA 4FJVA 3ZUVA 2XNNA 4NJ3A 4FK3A 3IECA 4WNMA 4P5ZA 4AA5A 3BELA 5A14A 3OXZA 4FSZA 3FKOA 3NUPA 3MIAA 4FF8A 4NIFA 1XH7A 2WIHA 1OPLA 2X6EA 3E93A 4RIXA 4CNHA 4MXCA 2BUJA 3S0OA 2RFNA 5CNNA 5D41A 4D4VA 2V7AA 4FTMA 2CDZA 3Q3BA 4B8MA 2ZB0A 2O0UA 3VW6A 2HCKA 4RRVA 3EQRA 4CFFA 1A9UA 4FK6A 4RVLA 2GNHA 3D7TA 4O7SA 2YACA 2HOGA 1Q41A 2VRXA 3O17A 5K5XA 3DBQA 3ZUTA 4IWPA 1JNKA 2EVAA 4AW2A 3OW3A 5J79A 4I6LA 2W4OA 3L9NA 5DOSA 3C4ZA 5EOBA 4ZTNA 5BVDA 4QO9A 1PJKA 5FRIA 4FT9A 4BCHA 2XJ0A 5CT0A 5CYIA 5DBXA 4BIDA 5IMXA 3G6GA 3NRMA 4WIHA 3TV6A 3TWJA 4ZSLA 2VTNA 3ACKA 3ROYA 2JDOA 2BKKA 2X9FA 2LGCA 3ZM9A 1O9UA 1CTPE 2OO8X 2PVYA 3A62A 4NT4A 1OM1A 2EWAA 2JKQA 3QU0A 3DK7A 3JYAA 3PIZA 4EZ3A 5DNRA 4G6OA 4TWOA 3RCDA 4EWHA 4O7TA 2BZHB 3BX5A 5CXZA 2BKZA 3OCSA 4TW9A 3ROCA 2ZDTA 3HV5A 4FODA 5KBQA 3TUCA 3KXHA 5IF1A 1GJOA 3KULB 2C3IB 2IO6A 3GC8A 2VO6A 5K4IA 3MJ1A 3VULA 2ZV7A 2I6LA 4RMZA 1ZMWA 2ESMA 3RWPA 2HK5A 3EFLA 5DRBA 3WF8A 4JOAA 3LJ0A 3UO4A 5ACKA 5DEWA 4AA0A 3W2PA 2C5XA 3QQLA 4FIFA 4USFA 4AW0A 2XVDA 3NNUA 4FIIA 3SRVA 3QCXA 3ZH8A 2Q83A 2AQXA 3UYTA 3VS0A 5EKNA 5JFSA 1U54B 2B1PA 5TT7A 5DH3A 2DS1A 3SOCA 4C4JA 4M7IA 4U6RA 3P7BA 1ST0A 2OJJA 4FEXA 5A6OA 3QYZA 2V7OA 2GQGA 4GK2A 1NY3A 2YJRA 4DGGA 5LVOA 4FG8A 4Y95A 3KRLA 4YLKA 2B52A 3A7HA 5HU9A 1H1WA 4AWIA 3AG9A 4RZVA 1YDRE 3UBDA 3EL8A 4UMPA 4MCVA 3WE4A 5M06A 3EQGA 2I7QA 4IAYA 2GFSA 4S31A 1GIHA 1L8TA 4RIOA 5IQCA 4FL1A 2XIZA 4OTPA 3U51A 2XEYA 3IONA 3L8SA 4D0XA 4BZOA 2XARA 5EDQA 3AC2A 5IDNA 4G9RA 3OC1A 3AMYA 2WQOA 3R21A 4IEBA 1Q3DA 1CKIA 4F9WA 4X2FA 3A4PA 5LMAA 3F2AA 5M56A 2OF4A 3BQRA 2DUVA 3E8DA 4YMJA 4IH8A 4JI9A 4EONA 4KSPA 2OJFE 4AUAA 4O83A 2OICA 3AQVA 1FOTA 4PQNA 2C0IA 1ZYSA 3I4BA 4JRVA 4RIWB 2IEWA 4RC2A 4V04A 3Q4ZA 4X21A 4ZK5A 4UMUA 3RBWA 5CAVA 4ORKA 5HNBA 4P2KA 5HX6A 4MXXA 3R7UA 4MHAA 3BWJA 2UZVA 3EYHA 4EHEA 5HHWA 1LPUA 1BYGA 3SKCA 4YP8A 4F6WA 5CF5A 2XP2A 3C4WA 4EOIA 3PDTA 2R0IA 1OUKA 1NXKA 4C4HA 4CSVA 3HV7A 3IDCA 2QCSA 3MY0A 4NM3A 2WTJA 3ZLXA 5CEMA 1W82A 4LUDA 4CYIA 2UZNA 2BPMA 2V55A 3F3WA 4BDHA 3Q53A 5LMKC 4XS2A 3DTWA 4GG5A 4KKHA 4XG6A 3UNZA 3U87A 4ZS0A 4MVFA 4F9AA 3NDMA 4HNIA 3H9RA 4JT3A 3W2QA 4CCBA 4E20A 4I0RA 3TN8A 4E5WA 3DXQA 5HG8A 1G8KA 4M0ZA 4ZTHA 5IA1A 1O6KA 2HYYA 4OTRA 4MD7E 3R1YA 2XIKA 3DOGA 4O0XA 4XV3A 3W0RA 2JITA 2Z7SA 4O7WA 1YQJA 2YIXA 2BRGA 2WMXA 4I23A 5T6KA 1Y91A 3R1QA 2A0CX 3IW6A 3U54A 4JG7A 3UJGA 3CBLA 3QC4A 4G2FA 2W5HA 3LHJA 3ANQA 2XANA 3DU8A 4QYGA 2XJ2A 4J98A 2QOBA 3BU5A 3MTLA 4MTAA 4E6CA 3QTRA 3NCZA 2UZWE 3DNEA 3QUDA 4U41A 1FQ1B 3K3IA 3DJ5A 2VO3A 4Y5HA 3LXNA 4ANBA 4G3GA 4DH1A 4LV8A 5EHOA 2FO0A 3KRWA 1OL7A 4CZTA 2ZVAA 4KB8A 2W1IA 2R3NA 3VRYA 5KO1A 3OUNB 4APCA 3FXXA 5E8UA 5HO7A 1WVWA 4F0IA 2X6DA 4I0SA 5HVKA 3C13A 4GV1A 3HMPA 5L2WA 1JKLA 2YISA 3DK3A 4R3RA 4YZCA 5AP2A 3GEQA 4GFGA 3KXXA 2YN8A 2W1CA 3RALA 3VS1A 5C4LA 3CPBA 4PDPA 4BI1A 3A7GA 3QTSA 2VN9A 5BUEA 3ORZA 3MH2A 2FVDA 4H3PA 5KMOA 1PMNA 3FPQA 4QTAA 4G5JA 5DRDA 4KUJA 4F64A 4YHFA 2FA2A 5E92A 4MQ2A 1QMZA 4HCTA 4BIEA 3ZZEA 5I9UA 5GZ8A 1Q5KA 4K6ZA 5BVEA 2Z7RA 4E4XA