2OJIA

Crystal structure of erk2 in complex with n-benzyl-4-(4-(3-chlorophenyl)-1h-pyrazol-3-yl)-1h-pyrrole-2-carboxamide
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
344
structure length
344
Chain Sequence
RGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 1
publication title Flipped Out: Structure-Guided Design of Selective Pyrazolylpyrrole ERK Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 105
structure length 344
sequence length 344
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2007-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2ojiA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2ojiA01
1ZYSA 2PWLA 2XB7A 3P7AA 5CSXA 2C6LA 3UIUA 2ZAZA 2ONLA 4JIAA 3MJ1A 5HX6A 2X81A 4BB4A 4MYGA 3UZRA 3RCJA 2W4OA 5BVOA 4RJ5A 2WEVA 4AA0A 2ZMCA 1SYKA 3DT1A 4XG2A 3R8LA 3QAME 3POOA 5IUHA 4UXLA 4H05A 4QTBA 3OZ6A 4EOSA 5AA8A 2XKFA 2R3MA 1ZOHA 4ENYA 4ZSJA 1Q8YA 4FZ7A 4GCJA 1VZOA 1BI8A 2IW8A 3DKOA 4D58A 2QOOA 3P5KA 5H9BA 3ZO1A 3HRBA 4QOXA 1ZYDA 4JI9A 4O1OA 2V7AA 3UMXA 3FI3A 3SW7A 4HZRA 4X2JA 1GZ8A 4WSQA 4YBJA 2E9UA 4DFYA 4RIWA 2UW3A 2Y4PA 1DAYA 4XG3A 4EOPA 5CANA 4I5CA 5IMEA 2C6MA 2HK5A 2OJJA 4FTCA 1Q5KA 4LUEA 1V1KA 2R3OA 2WPAA 3LJ1A 5JFVA 4FEUA 2XNMA 3DGKA 5FXQA 4E5AX 4AT4A 2P2HA 3R8VA 2XIRA 2JIVA 3HMMA 5J9LA 3ZBXA 1GZOA 3C13A 4PNIA 4L3LA 2LAVA 5AP7A 3AT2A 1PMEA 3PUPA 4NFNA 3R83A 3PG3A 1CM8A 3P7CA 3DS6A 3IONA 3LQ8A 3P23A 4ZTLA 1U54B 2WQEA 3OXIA 3QTWA 1M7QA 5IMXA 4L52A 2I7QA 2A19B 3HAVA 2DS1A 1H25A 3G9LX 3D15A 2YM5A 1XWSA 3D14A 1BUHA 4MD7E 2QOBA 4CMOA 3OXZA 3W8LA 2XUUA 3BHHA 2C3IB 3Q52A 2XK3A 4O0XA 1H1QA 4QP6A 2OI4X 2FUMA 4MNEA 2YERA 4RLKA 4O1PA 4FSTA 4GMYA 4AACA 2NP8A 4LUDA 2OFVA 3QUPA 2WTJA 3FKOA 3GGFA 2I0YA 4H1MA 2PVJA 3FHRA 5KCVA 3UGCA 1IA8A 2VX0A 1OKZA 4QMQA 3W18A 3BI6A 3OY3A 5C01A 2VTOA 2OF4A 3NW7A 2BROA 4J97A 3SAYA 2X7FA 4WUNA 4EH5A 3F66A 3QTSA 4QMWA 4ZSEA 5B0XA 1VEBA 2ITZA 5AP4A 4QRCA 3TN8A 4AW2A 4I5HA 1UKIA 5I5ZA 2ERZE 2WOTA 2WXVA 3MA6A 5HBHA 5L2TA 3ANQA 2GQGA 2XIZA 3DK3A 3UVPA 3R9NA 4HVIA 3OD6X 2I0HA 3DCVA 5FQDC 3QGYA 2HZNA 4N6ZA 2CGXA 2ITYA 4QMUA 4F6WA 2RKUA 3KA0A 4U8ZA 2BUJA 2XNEA 5CVGA 2VX1A 4J53A 2CNUA 5EM6A 3KRWA 2WMQA 4NJ3A 4R3RA 2Z2WA 2IVTA 1YOMA 3OCBA 5LMKA 1VJYA 1P5EA 4PWNA 3WARA 4JDJA 5K5NA 3QD0A 4U80A 4CZTA 1YDTE 4USFA 5CVHA 4WD5A 3VHKA 3PA5A 4UWCA 4KIOA 4QYGA 1J1BA 4M84A 4S32A 5AADA 5M51A 4FT7A 4P5QA 4YO6A 1UU3A 4KSPA 1GJOA 3NCGA 4RGJA 4R77A 4IBMA 4RVLA 4IDVA 5CF5A 3PVUA 3JUHA 5M55A 3NZ0A 5AR3A 3JR1A 3VWAA 3DZOA 3EL8A 3ODZX 2EVAA 1MRYA 1UA2A 3EN9A 4RFZA 4WRGA 3ACJA 3FYJX 3MGYA 3O2MA 4LGGA 3VUKA 4F9BA 4GVJA 4M97A 2J0JA 2WB8A 2VZ6A 4FV7A 3DBEA 3OWLA 3ZDUA 3BHTA 2G2IA 4ACGA 4JAIA 3QUDA 5AUVA 4GYIA 3CIKA 4EOOA 5M4FA 4ORKA 1J91A 4O6EA 3DDQA 4KS8A 4E4XA 4CLJA 5B2LA 3RMFA 2G1TA 2I6LA 3QTIA 2PVRA 4W9XA 4D55A 3W8QA 1XHAA 2ZV8A 3QCXA 4Q9ZA 5A6NA 2OO8X 1LR4A 3D0EA 1J1CA 5AP1A 4O7VA 2J4ZA 2W1GA 3JVRA 3M11A 4FVRA 2HOGA 2ZJWA 3AD5A 4GUEA 4BR3A 4Z3VA 5A9UA 4MXOA 4MCVA 1XKKA 3CPCA 4BIDA 5KMMA 4YJUA 4LOQA 3KXHA 1JBPE 3F5PA 3PY1A 5EW9A 3Q4CA 4ZJJA 1R3CA 2QG5A 1Q97A 4FI1A 3Q60A 2NRUA 2XJ2A 4I6BA 2YIYA 2X2MA 3C4XA 4FKGA 1SVGA 3NUUA 4EYMA 1XBBA 4DLIA 3O8PA 5HCYA 4DG3E 3IW7A 3LOKA 1M14A 3R7EA 1U5RA 2WELA 2ZVAA 5AEPA 3Q53A 4UXQA 1Y91A 1OL5A 3ZSIA 5LVMA 5FG8A 2O63A 4QNYA 3ERKA 2ERKA 4PTEA 4U3ZA 5I4NA 2Z7RA 4NIFB 1UNHA 1GY3A 5ICPA 3QCYA 5CS6A 5DLSA 4YURA 2W9ZB 4XNEA 3UO4A 4EQUA 5HHWA 4BF2A 3MI9A 5IPJA 4PV0A 1H28A 2AYPA 2J9MA 3ENMA 5EH0A 4C3FA 4UBAA 1TVOA 5BYZA 1TQMA 2OIDA 3RAKA 3NUSA 3WZUA 3SG8A 5LQFA 5JFXA 4U9AA 5CY3A 5IA4A 4L44A 4TWCA 3H9RA 1Z57A 3LXLA 5DIAA 3ZH8A 4QP9A 3Q9WA 4YJPA 3FC1X 1ZOGA 4BTJA 1R1WA 4RIYA 4M8TA 2YCFA 4DEGA 2JDTA 3P1AA 3VRYA 4JQ8A 2XNOA 2EUFB 1F0QA 3H10A 4O27B 3UOHA 4EK6A 5HOAA 3R63A 3IK3A 1SMHA 2XEYA 5CSPA 2PSQA 4RWJA 4RSSA 3SRVA 4XG4A 3W32A 1SVEA 3CD8A 3QRTA 2YZLA 4O0WA 2C47A 3FSFA 4L8MA 1IAJA 3KXGA 4EI4A 4QMTA 3TTIA 3PXRA 5AP0A 3GU8A 2OFUA 5L2WA 3Q96A 2BAKA 4FVPA 2QHNA 4KAOA 3I5NA 3HV5A 3COHA 5CU6A 3ZO2A 5CEMA 3PPJA 3CR0A 3L8PA 4ITHA 3TV4A 3LMGA 4EUUA 5GJFA 2PVLA 3CJFA 3OF0A 5HKMA 2ZB0A 5L6WL 1YRPA 4AGUA 4W4XA 4B7TA 3W16A 3QGWA 4RJ6A 4TTHB 4TWPA 3VS6A 3C5IA 1TQIA 1QCFA 1WFCA 2W9FB 4IZAA 4BZNA 2W05A 4YLLA 5LVPA 4FT9A 1GZNA 2GU8A 4DF3A 3LM0A 3KU2A 5AUZA 3BLHA 3Q5ZA 2R3NA 4RVMA 1PXPA 4K0YA 3V5TA 3F3VA 3P4KA 3IO7A 3RNIA 4XUFA 4IWDA 5E8SA 5KBRA 5C9CA 1OVEA 3V01A 1PMVA 4FSYA 4D1ZA 4XYFA 3F88A 5BUEA 5F1ZA 5IF1A 2O65A 3MFTA 3QHWA 2OXYA 4TZRA 4ANNA 4AU8A 4E4MA 4EEVA 2XNBA 2XBAA 3W10A 4EHVA 4AZWA 5CI6A 2XIYA 5I3OA 4E4LA 4I20A 3C1XA 4XV1A 3UVQA 3U54A 4DBXA 3QD4A 4FICA 5CALA 3S0OA 4KWPA 1B6CB 2W5BA 3NUPA 3Q9ZA 4XV2A 5DA3A 4UWBA 3MIYA 4BRXA 2OZOA 5K3YA 1WBNA 5JZNA 1OL2A 5AJQA 3LPBA 2VAGA 5FRIA 3RI1A 4BDCA 3UOKA 1R0PA 3EN7A 1ZLTA 4C7TA 3VN9A 2RFEA 4ZMEA 4NM3A 1OITA 4PNKA 3HDNA 3FJQE 4IANA 5KBQA 3SXFA 3SGCA 3AMYA 4NW6A 4FGBA 1DS5A 2R3GA 5AUTA 2I0EA 2CCHA 4A4OA 4WHZA 3ZEWA 1G3NA 1QPDA 3LHJA 3P08A 2A1AB 2JKMA 2BVAA 2WMUA 2XRWA 3IW6A 2A2AA 3FMMA 4TXCA 2GNHA 2VTLA 3EFLA 4X3FB 4D2SA 2HW7A 4IB0A 5LMKC 3OP5A 2HXQA 3RZFA 2YLEA 2UVZA 3FE3A 2YCQA 5FEDA 5EHOA 5JFWA 3SOCA 4HGTA 3IECA 3D5VA 3EN6A 1IASA 2VO6A 4DG0E 4XG8A 4DE4A 4TYGA 3VVHA 3A60A 3VUDA 4F08A 5C8NA 2OW3A 2FSLX 2P2IA 3ORIA 3CY2A 4JBPA 3IW8A 5C8MA 3AT3A 1CDKA 4TWNA 2R7BA 2CN8A 5E8WA 4AZEA 5A6OA 2BAJA 2YM3A 2VTSA 2VGOA 4HPTE 3LMHA 2Q0NA 2PVMA 5LCKA 4TYEA 3H4JA 2BRBA 4R1VA 4AX8A 4DYMA 3KVWA 3MJ2A 4YSMA 1GAGA 2X2LA 3WOWA 3BQCA 2PZRA 3F3WA 4FKVA 3C51A 3C5UA 3G0FA 1M2RA 4FG9A 4NU1A 4ANOA 2RG6A 3P78A 4IM0A 4J7BA 4LRMA 3UNJA 4QMYA 3RAWA 5CEOA 3DK7A 5I3RA 5LCJA 3LLTA 4C59A 3DZQA 2CLQA 3PSDA 4QD6A 3OFMA 3PJCA 3MVLA 2W1FA 1E1VA 2Y9QA 3LXPA 4YNOA 4I6FA 3E8EA 3K3JA 1M2PA 2VX3A 4QMMA 4XG6A 4CT2A 3PJ2A 4AP7A 4O84A 4U5JA 1FINA 5H8EA 3RHXA 1JKSA 2YDKA 5AX3A 1ATPE 4PDYA 4H58A 3PDTA 3VQUA 5M06A 3ZO4A 2BCJA 1URCA 3QTQA 1YI4A 3D7TB 2PVNA 1CKIA 4FL3A 4ANQA 3RVGA 2W0JA 3NUAA 2DUVA 4IADA 4GKHA 4ZTNA 5HD4A 3ZO3A 3P7BA 4GU6A 5EM5A 1O6YA 3HEGA 3CTQA 3HNGA 1Q99A 2R3KA 3OWKA 4O21A 4DH3A 1YHSA 3ANRA 3OUKA 2X9FA 2XK6A 3MH2A 1A06A 2OIBA 4AE6A 5LMAA 2XMYA 4CRSA 2WMRA 3KK8A 3LIJA 2Y8OA 2YJRA 3LFEA 3QQKA 2PUNA 4UMRA 3KKVA 3DNDA 1KV2A 4AT5A 1WAKA 4O7WA 5IQGA 2ITNA 5GIPE 2A0CX 3RM7A 3GC9A 4ITIA 3QHRA 3R9DA 3I60A 4KKGA 4L68A 5HEZA 1WBSA 2R3RA 4FTLA 4DFBA 3RK9A 3UODA 3FZTA 3JS2A 3QX4A 4U0IA 4C34A 5I0BA 2F7XE 3B2WA 5M44A 1ZRZA 4UYNA 4FSQA 5F95A 5IEYA 3ATSA 4N0SA 2FSTX 4AZTA 3AC2A 4YJQA 5G1XA 1WVXA 4IAAA 4D1SA 2GMXA 3LLAA 2QURA 5J5TA 4RIWB 2PUPA 3PVBA 5GJGA 2PZYA 3QQLA 1PXOA 3PJ3A 4YZNA 4QP2A 2QI8A 2NNWB 3WILA 4IVBA 2C6IA 3HMPA 4Z7GA 4G34A 4XV9A 4GL9A 3NAYA 2XNNA 3HRCA 3V5QA 2WQNA 4JOAA 3GCVA 4L3JA 1M7NA 4O6LA 4EH8A 4PTGA 3KMWA 4AT3A 4IAFA 2YM4A 3QYZA 5HG9A 4I21A 3T3VA 4CG9A 4FKSA 3I5ZA 4G2FA 3V5PA 1ZYLA 4LMUA 2W1ZA 4O0UA 3QRUA 3MV5A 4NM7A 3MWUA 5DFPA 3C50A 4C4JA 4CQGA 4BCIA 3KF7A 3RP9A 4BDGA 1QPCA 3S1HA 2R9SA 2EXEA 3IW5A 1LEWA 4QP4A 1K2PA 2C6KA 4RJ3A 4G9CA 5L2QA 3LFNA 4AN2A 5FXRA 2O5KA 2W06A 3C0HA 2WMVA 2C0TA 4MNEB 4BTFA 2F57A 2XK7A 3QWJA 2X4ZA 1YHWA 3ODYX 4EH6A 3NUYA 3TM0A 3AGMA 4RZVA 1WBOA 2ZDUA 4FIGA 4K18A 3VS7A 5HG8A 3CBLA 3PXQA 2VTQA 4X2GA 5A4EA 3UO5A 3F7ZA 3M2WA 2J5EA 3IKAA 4BCKA 5IISA 5DEWA 3CQEA 2BKKA 2PZ5A 4GFGA 1V0BA 4I0TA 5AFVA 3AQVA 3QTXA 4ALWA 3Q6UA 4EOIA 2BMCA 5AM6A 3RPRA 4U6RA 4H1JA 2PVFA 3EFJA 3GU6A 3DY7A 4QPSA 3R22A 3VBQA 5A4TA 4FX3A 4Y95A 4BTMA 3KK9A 3SA0A 3F5XA 4PP9A 4FIJA 3A4OX 3WF5A 3ZUTA 2FB8A 3O0GA 4O7YA 1OM1A 4R5SA 4YSJA 2ZB1A 4FE2A 2R3FA 3F5UA 3Q3BA 5JGDA 3KQ7A 4Z9LA 5AP3A 4UMUA 4JT3A 4CFXA 3LMIA 5IU2A 2BFYA 4IW0A 3IGGA 4R5YA 4RIXA 5T3QA 3RPOA 4UX9A 4WNOA 2UZBA 2BRHA 3G6HA 3NEWA 5DHJA 3FBVA 4JG6A 3RWQA 3CY3A 3SD0A 4CMTA 2BFXA 2X4FA 1URWA 2VV9A 3C4FA 2C30A 3KXMA 3PRFA 5B2MA 4KABA 3C0IA 2BRNA 3Q04A 3QZIA 3REPA 2NO3A 5KNJA 3NAXA 2E9PA 4QMSA 4MBLA 5DYJA 4I22A 1Q8UA 3O7LB 4C4IA 3WF8A 4BGQA 4YC6A 2GTNA 2QU6A 4AGWA 2J0MB 4ZEGA 2DWBA 3U51A 1J7UA 3SX9A 5ETFA 4BGHA 5KMNA 3ZYAA 3RGFA 2W4KA 2XYUA 1NVSA 4XP0A 5LWMA 4DN5A 1F3MC 4U81A 3MFSA 3AGLA 5CAQA 5AAFA 3V6SA 4I24A 1XBAA 4FSZA 1JKTA 1W82A 2OXDA 5AMNA 4DFUA 2P3GX 4KBKA 4DGLC 2VGPA 3P86A 3QD2B 4YZCA 2QOHA 4EH4A 3OBJA 4TW9A 4BDJA 3ORTA 3PXFA 5IH5A 5DEYA 3PA4A 4EBWA 1A48A 2QD9A 1XO2B 4QP1A 3I7CA 4ZIMA 5GHVA 1OIQA 4IC8A 4C02A 3RWPA 4UN0C 3DFCB 4Q9SA 2I0VA 3HVCA 2B9JA 3TKIA 4OTHA 5T68A 2BZJA 4G3FA 3GOKA 3ZS5A 3A99A 5IUIA 5D11A 1H1PA 3OCTA 5CSWA 4CVAA 2OICA 1AGWA 1HCKA 3QLFA 4I94A 4K33A 2CDZA 2FSMX 3EQDA 2V62A 3C7QA 4OLIA 3OTUA 4FV4A 3TUCA 4FEWA 1JAMA 2R3LA 2VO0A 2PYWA 3IPHA 3Q4ZA 5AUYA 5M53A 4JDIA 4Q2AA 2IN6A 1J7LA 4UB7A 3AD6A 3MH1A 3WBLA 5L2IA 2JKKA 3UDBA 3PY3A 3G2FA 4M14A 4YGAA 3E7VA 3CGFA 3THBA 2J90A 5L8JA 1ZAOA 4CFFA 3UQCA 3VBWA 2OJIA 4CKIA 3MY0A 2VWZA 4WT6A 4PL3A 1S9JA 2WMBA 2OZAB 2W1CA 3F9NA 4H36A 5HU3A 4C37A 3R30A 5L6OA 1E1XA 4FL1A 4RIYB 4NL0A 4FV0A 2V7OA 4U44A 3W2QA 2EU9A 3N9XA 3D4QA 2OH0E 2HELA 4NTSA 3IGOA 2FYSA 4F1TA 2VTTA 4GT3A 4KIKA 3EMGA 4RA5A 5K9IA 5KZIA 4F6SA 3KCKA 4IVCA 4NK9A 2Y4IC 3SRVB 4J98A 5I9VA 2UW9A 5KKRC 5JSMA 4F64A 2JD5A 1I44A 5C26A 3H9OA 3R71A 4LRJA 4MWHA 4UZHA 5GINE 4O38A 1OKVA 3OT8A 3Q32A 3EQRA 4QMOA 1R78A 4CZYB 4BBFA 4BI1A 2IPXA 2UVYA 4BIBA 3W55A 5IDPA 2H34A 5ETCA 5AR2A 4E73A 2C1BA 3EN4A 4OAUC 4B4LA 4PUZA 1FVRA 3TKUA 5EDRA 3FLWA 5DBXA 4I6QA 5AV4A 3M42A 1YOJA 5AR5A 3WI6A 2WMTA 5DR6A 3QQHA 2GFCA 4LV8A 3LCTA 4QPMA 4EUTA 3FXWA 4XG7A 5I9XA 1OPKA 4IEBA 2Y7JA 5E8VA 2C3LA 2VWYA 4H3BA 3RKBA 1OL6A 3TT0A 5EKNA 1XQZA 2HCKA 4QQTA 3ORNA 4L3PA 3ZFXA 2ETKA 3MH3A 1QL6A 4JG7A 3KEXA 4FKWA 3LCKA 2OBJA 2QOCA 4F1OA 4JVGA 2CPKE 2JKQA 2HWOA 3DOGA 4G9RA 4FTQA 5HESA 4E93A 3FZ1A 3GNIB 4ZZNA 3GU7A 2BKZA 3UBDA 1FMOE 4FKLA 1WBPA 2J5FA 3L8XA 1SNXA 2O0UA 4AF3A 1PXNA 4D2WA 1RE8A 3HDMA 4MF0A 2PZPA 4BICA 4C35A 5CXZA 3K5VA 3QTZA 5AIRA 4F63A 5HCXA 3HAMA 2V55A 5CTPA 3ACKA 4GV1A 2J51A 3WF9A 4B0GA 4D2PA 3E62A 2PTKA 5J1WA 3WF7A 4CTBA 3N4TA 1Y8YA 4DITA 4FZDB 2VNWA 3V51A 3Q4TA 4DH7A 2ETMA 4QP8A 5E4HA 4ZLYA 3KN6A 3L8VA 1ZY5A 4F7NA 3DLSA 2XJ1A 4MEDA 4M69A 1IG1A 2C5VA 2E2BA 3PXYA 4ARKA 5B2KA 5LWNA 3VUHA 3PE2A 4CKRA 4O7TA 2JDOA 2IZTA 4D2TA 5D10A 5ANGA 4O7ZA 3UNKA 2CKPA 2QO2A 2ZM3A 4ZSGA 2R2PA 4TWOA 5HVYA 4R78A 3VO3A 4F9AA 2IZRA 3R7OA 3ZOSA 4UALA 4AOIA 5AP2A 2ZV7A 3BBTB 5EI2A 4MX9A 4AW1A 3FSKA 2DYLA 4A4XA 4IIRA 3ZRMA 4IACA 2OG8A 3LFCA 2YACA 4Q5HA 3WF6A 4Q5EA 2UVXA 4AGDA 5AR4A 2CKQA 3QQJA 3QX2A 4EJNA 5AR8A 3OUNB 1YXSA 5EM7A 2R3IA 3VF8A 3DFAA 5EOLA 1H26A 3FUPA 5BVDA 3QWKA 5TT7A 3WIGA 4Y5HA 2UW7A 5HNIX 2H6DA 2IVVA 2WMWA 3BX5A 4UZDA 3R9RA 3Q4UA 1BYGA 5DRDA 1WVYA 1SNUA 4LOOA 4FTJA 3RK5A 3DXQA 4CG8A 5CENA 3Q9XA 3LM5A 3CCNA 3HV3A 2HZ0A 2WQOA 4HNFA 4YLJA 5M09A 4F1MA 3G6GA 1H1SA 4JIKA 4DFLA 3LQ3A 3ZC6A 4KBCA 3MESA 3ZSGA 4FGRA 4BCNA 3A62A 3QD3A 2GS6A 2C5YA 3LFSA 4BDKA 3ZZEA 3PP0A 4N57A 3TZ8A 4FSNA 3QKLA 4BCHA 3BYMA 4ZY6A 5EI8A 5HE3A 4D4VA 1WBVA 3SW4A 3NYOA 4P7EA 3GEQA 4O0RA 4CT1A 2E9VA 2B55A 3T8OA 2BIKB 3FDNA 3HP5A 3GBZA 4J52A 4CZUA 4H3QA 5C4KA 2EB2A 1WCCA 5FP5A 4FTKA 4M0ZA 4QMPA 3HYHA 5I9ZA 4F65A 3VUMA 5CU0A 3BGZA 3TNPC 4J1RA 3SG9A 1XBCA 5HLNA 1ND4A 2XVDA 5J95A 4JBQA 3NGAA 4BDAA 4CFVA 5KMOA 3ET7A 4EHGA 4OT6A 1IR3A 4K8AA 2JAMA 3OW3A 4E5WA 1UVRA 4LOPA 1SVHA 4RJ7A 3EQIA 4LV5A 4ANLA 1Q8TA 3R7VA 2CN5A 4RIOA 2C0OA 4DGNA 4WIHA 4YU2A 4EORA 3NSZA 4EH2A 3SC1A 3U9NA 3HMOA 4TNDA 4RA4A 1Q8ZA 5D7VA 4FC0A 3NW6A 2B53A 2UW8A 1YWVA 2RFNA 3LFQA 3W1FA 5EKOA 3S95A 4BHZA 1Q3DA 2PZIA 2RG5A 4ERKA 1KWPA 5A3XA 4NFMA 4R3PA 5FM3A 4YTHA 3MY1A 4JL9A 3ZRKA 3BV2A 4N70A 2WAJA 4HYSA 4O83A 3R7IA 4XMOA 3EYHA 4O0VA 4XOYA 1RDQE 1JKKA 1JOWB 1NVRA 3NDMA 4FKOA 4IX6A 4E26A 5IA3A 3MB7A 3O71A 3ORXA 1UV5A 3U8WA 5AM7A 4ERWA 1U46A 3F3ZA 2C6EA 3CGOA 4HGLA 2XK8A 1PW2A 2X9EA 2PL0A 2YM6A 4ZLZA 1NXKA 3SOAA 5C4LA 2FVDA 4CV8A 3ORZA 4I5PA 4O0SA 4X2FA 4LFIA 3ZLSA 4A4LA 4C0TA 4F4PA 5CF6A 3OG7A 4AXAA 2V22A 2ZM1A 1GIHA 3CEKA 4DG2E 4E5BA 4GS6A 4M0YA 4WUAA 4E20A 1W8CA 3BLQA 3EQPA 4KA3A 4XP2A 3TWJA 3W33A 4HVGA 1PMUA 3CE3A 4EOKA 5CEPA 1OBGA 4X2KA 3DKFA 1JPAA 2QC6A 4FZ6A 2Z8CA 4BDIA 3FY2A 4M68A 3PTGA 1STCE 3PRIA 5D12A 5KZ0A 1U4DA 2ESMA 4YHTA 4UYAA 4EOJA 4C4HA 4AZFA 4FSRA 4GEOA 3OWPA 4M3QA 4C61A 4FEVA 2ITWA 3RTPA 3N51A 4BCPA 3QA8A 3UPXA 4AE9A 1YXTA 4DH5A 3KRRA 2VWUA 4XLIA 3ORMA 4DEEA 1H07A 2HAKA 2XK4A 2O2UA 3GU5A 5HTIA 5FUTA 2W17A 3WZKA 3AXWA 4IWQA 4NCTC 2J2IB 2R0IA 4F0FA 1R39A 1P4OA 4XBUA 3ULZA 4XX9A 2YISA 3Q5IA 1OUKA 4EQMA 2P0CA 3MW1A 4USDA 3TUDA 5AWMA 3G90X 3H3CA 2X7GA 1FPUA 2BHHA 3O17A 4G3GA 4NZWB 4PMSA 5AP6A 1BMKA 3VBYA 4EK5A 2YM8A 4BKYA 4PF4A 1UNLA 3R7GA 4QT1A 3ZBFA 5DPVA 3VJNA 4BCOA 2ZOQA 4YPDA 3FC2A 3S3IA 4Y83A 1JNKA 4AN9A 5HO7A 2JGZA 1PRYA 4K9YA 4KNBA 4Y46A 5ANDA 2I40A 4EC8A 2G2HA 1MP8A 1O6LA 2YIWA 3QCSA 3P9JA 4FTRA 4L7FA 2Q83A 4LG4A 2OIQA 5CSHA 2UZLA 3UPZA 2C6OA 5IG1A 2OU7A 4FV3A 3ZEPA 3DDPA 5BX0A 1DAWA 4L53A 4FKIA 4M67A 4EZ5A 3MB6A 5IQIA 3L9NA 3KRXA 2BZHB 3EWHA 2X1NA 2PHKA 2PVKA 5EHLA 4O7LA 3PXKA 3OBGA 1MRVA 1LEZA 3EJ1A 3LFBA 4GG5A 1UU7A 4OTIA 3UO6A 4RX9A 2V5QA 3V8WA 2QO9A 3WE8A 4UV0A 4CSVA 4G6LA 2C5NA 3F2RA 2HW6A 5LARA 2XCHA 4HGEA 5K4IA 1M2QA 1QMZA 3MY5A 4BCJA 4RWLA 4IJ9A 2J0IA 5KX8A 4FT0A 4DCEA 2UZVA 3E93A 4FTOA 3T3UA 3UVRA 3MIAA 2GHGA 4RWKA 2R64A 5BQ0A 5LXMA 1LPUA 3R8ZA 4IJPA 4ZS4A 4WA9A 2YM7A 4OBQA 1H00A 3KY2A 4C8BA 5HCZA 3TACA 5ACBC 4A9RA 1VR2A 2Z60A 4FNWA 1E9HA 4DGMA 2R3HA 3A8WA 5HE0A 1Q41A 4RX5A 3HV6A 2GHMA 2Y6MA 3E8DA 3R2BA 3COIA 2W7XA 4FIHA 3UOJA 4CEGA 4W8EA 4JRNA 4AW5A 4FYNA 2C6TA 1U54A 3R00A 3ATTA 3DQWA 2G01A 4DGGA 3VS0A 4F9YA 4H39A 2CMWA 3R21A 5CQUA 2JFMA 2RFDA 3COMA 2KULA 4R7BA 4GKIA 3R1SA 2XA4A 5C8KA 5E8ZA 4O2ZA 3TDVA 2YFXA 3FI8A 5TF9A 4KS7A 4JR3A 2Z7QA 1XH4A 4MAOA 5DGZA 3FKNA 2IG7A 1DI9A 3GI3A 4ZJVA 2FSOX 4FR4A 3BRBA 3KGAA 2HY81 4M13A 3KULA 2J0LA 3PP1A 3KXNA 1JSTA 4BDFA 3F5GA 4GJ2A 5HI2A 2UUEA 3EQBA 2FO0A 2QHMA 4U40A 4IAYA 4PL5A 4EQCA 5IKWA 2ITTA 5FP6A 1FGKA 1K3AA 5HG7A 3VQHA 4I93A 4L43A 4M15A 5ANEA 4D5HA 2PMLX 3I6WA 4HVDA 5E1EA 1XJDA 5TR6A 3BU3A 4YMJA 2QR8A 3DB8A 4LL5A 4WG5A 3HX4A 4MK0A 4A9TA 4DEAA 5DH3A 4CRLA 2Z7SA 5HO6A 5HORA 4KIKB 2J0KA 5KE0A 4QPAA 5IH4A 1KE7A 4ZTSA 5A14A 3D2IA 3ZUUA 5K5XA 2FGIA 2JIUA 2VWWA 3EQHA 3H30A 3O23A 5F94A 5FBNC 3BWFA 3RALA 5EOBA 1PMNA 4BC6A 4WG4A 3AT4A 3HZTA 1KE5A 1OIUA 3PJ8A 2VNYA 3MFUA 3O7LD 1OPLA 1ZYJA 3OY1A 4O7RA 2QLUA 1Q4LA 5D1JA 4AOJA 2SRCA 4XG9A 3TCPA 3D94A 4UMPA 4GU9A 3R8MA 3UG1A 3GCUA 4CCUA 2ZV2A 3QA0A 3EQCA 4YJTA 4U97A 4GK3A 2YWVA 3R01A 4XLVA 4IWOA 2BAQA 4K6ZA 4O96A 3ZC5A 3AOXA 3VS4A 3LKMA 3OCSA 3QL8A 3K54A 3DTWA 1VYWA 4EONA 4R7HA 3KRJA 3UP2A 1CSNA 2WGJA 3BE2A 3BYOA 5EQYA 3TUBA 4CFMA 3QFVA 5HX8A 3NPCA 1M52A 4L00A 2IWIA 2F49A 4TYJA 3UP7A 4DFNA 4IH8A 4I41A 4MKCA 3QXOA 4BIEA 4YC3A 2X6DA 2GNFA 3EZRA 4FNZA 2WMSA 4ZZMA 2ITVA 1TKIA 3ROCA 1PHKA 2C6DA 2R3QA 4QYYA 4MXAA 4DA5A 4J96A 4CQEA 5J79A 4OTWA 2ZDTA 3MBLA 3PWDA 4AZVA 3FMJA 5IEXA 4WG3A 5TO8A 2REIA 5T6KA 3BBWA 1NA7A 3U6IA 3EQFA 3MPTA 4AZSA 3DB6A 3W2PA 4EOQA 5F9EA 5M07A 1YHVA 3B2TA 4FIEA 4M66A 2EB3A 3D2KA 4IM2A 3UIBA 1YWNA 4FKUA 4QQJA 4R1YA 3MFRA 2HXLA 3FMEA 4X6RA 5J8IA 3FQSA 2VTAA 3A7JA 4MWIA 4D0XA 5BVNA 5AAGA 5AV2A 4NM5A 2OJ9A 4RQVA 3BHUA 3FL4A 5CWZA 1KE6A 5HVJA 4BY9E 2VO7A 1QPJA 2HYYA 2VO3A 3FL5A 4M69B 1H0VA 4W9WA 3CXWA 3ZCLA 3TIZA 4RRVA 4HYIA 4J8NA 2WNTA 3FQHA 3HGKA 1PXIA 3NYNA 4KD1A 4TPTA 4XHKB 1JSUA 4FK3A 3H9FA 3FXXA 3TV7A 5DNRA 3ZLYA 2WTDA 3CKWA 5CYIA 3VS2A 2VUWA 1MQ4A 3BZ3A 4PL4A 1DM2A 3JY0A 3WZJA 3EZVA 1RQQA 1W84A 5KUPA 5DI1A 3SV0A 2C5XA 1GOLA 3NVKI 2JLDA 4EOMA 5LVOA 4IZ7A 4YZ9A 2JBOA 4F7LA 1FBNA 5GZAA 3GFEA 3KXXA 5CXHA 3R8PA 3MSSA 1IA9A 4EC9A 4FOBA 4FMQA 4YUQA 1I09A 1YXVA 5FBOA 3TNIA 4Z7HA 3DBQA 2XF0A 2VTPA 4RFMA 4YZDA 4ZXTA 2JKOA 3GVUA 3LZBA 3HLLA 1W98A 4FBXA 4FK6A 5TKDA 4A7CA 3FY0A 4BBEA 1YI3A 1G8SA 4OBPA 1V0OA 4OAVB 1BI7A 2C3JA 2IZSA 3ORPA 4UMTA 5BPYA 2RSVA 3AMBA 3HA6A 3C4CA 4KIQA 4IE9A 1L8TA 3PE1A 4X2NA 5M4UA 4RBLA 4IX5A 1UWHA 4DAWA 4QQ5A 4FTMA 5EW8A 4ZS0A 3OMVA 1GIJA 3ETAA 3GCSA 1FMKA 3E87A 3KMUA 3DBDA 1H4LA 3F61A 4L6QA 2AC5A 5DR9A 5LOHA 3R9HA 3SVVA 3I6UA 2QLQA 3NNWA 4F7JA 2PVHA 4WOVA 3E7OA 5AV3A 1A9UA 1X8BA 3CKXA 4FIIA 5EQPA 4KSQA 2UZDA 4BDDA 5JEBA 1OIRA 3ENHA 4IHPA 3SDJA 5BUJA 3QALE 2VRXA 4DBNA 4F70A 1TQPA 2XCKA 3DJ7A 4W4VA 5E9EA 4PTCA 4A06A 2JDSA 3D5WA 2B9HA 3NRMA 4YZBA 2F7ZE 2YCRA 2GTMA 3U4UA 5GZ8A 5E1SA 2QOIA 1ZMVA 3T9IA 4JLCA 4OTDA 4RC4A 4I4FA 5HG5A 5HE2A 3O96A 5JRSA 4D2VA 4AQCA 4FA2A 3EOCA 4KUJA 4FOCA 3FI2A 3VHEA 2AC3A 4KBAA 3LE6A 2XJ0A 5C27A 2JDVA 2CCIA 3WZEA 5J5SA 1YI6A 4L45A 1LP4A 1H1WA 2YABA 4OTRA 2ETRA 2QONA 4RVKA 3DTCA 4S33A 3NNUA 3CD3A 3KF4A 4IXPA 5D7AA 3R04A 4FT3A 2JITA 1OL7A 4YLKA 5JK3A 5E91A 2F4JA 4AA5A 5TE0A 1GIIA 4P90A 2EXCX 5CZHA 1UU8A 4J71A 1WVWA 3QLGA 4GUBA 2C68A 4X0MA 5K0KA 4C38A 2XNGA 5B7VA 2ITPA 3PJ1A 3PA3A 2A4LA 2YCSA 3MDYA 1OGUA 3WIKA 5CU3A 4NJDA 3TZ9A 4BYJA 4DTBA 4D28A 3QZGA 4YR8A 2PE0A 4BHNA 5CZIA 2VTIA 3VS3A 3Q9YA 3W2SA 4GVAA 3R0TA 2XKDA 3R28A 4I23A 2UZTA 1OZ1A 2PMNX 5ETAA 3H0YA 5HNGA 1PF8A 4AOTA 4C3PA 4CD0A 5EQEA 5IEVA 3GC0A 3QU0A 4NT4A 3ZM4A 3L9PA 2HWPA 1IAHA 1KE9A 4OTQA 3NR9A 4X3FA 5J87A 4BZOA 3DBFA 3I79A 3CSVA 3UYSA 2BPMA 3G9NA 4ANBA 4V0GA 3GFWA 4EHZA 1FVVA 1XH8A 4XRJA 2JC6A 4C4FA 3E64A 4TNBA 3HKOA 4E6DA 5DN3A 2OWBA 2QU5A 5FDXA 3DLZA 3OC1A 4R7IA 5J7HA 5KHWA 4B8MA 4G5PA 2LGCA 4E6AA 3S2PA 5JMSA 2ITUA 4BI0A 4XEYA 4YP8A 3NVMB 4BWKA 5GIOE 3II5A 4JQEA 3IOKA 4L9IA 1UU9A 3OTVA 2O64A 4X6QC 3FV8A 5AAEA 3DKCA 2KTYA 3ZRLA 1ZXEA 2WOUA 5DT0A 3DAEA 4ITJA 3QKKA 4IVAA 3U4WA 5JGBA 3JPVA 2ITXA 2GCDA 4BTKA 4QQCA 1PXMA 2XP2A 2UZEA 1BL7A 5C03A 5EDPA 3NYXA 2C1AA 4I92A 3RBWA 3V04A 1SZMA 2WTWA 1F5QA 5GZ9A 5IH6A 2H96A 4LGDA 4DHFA 3VRZA 3CC6A 3RNYA 4QP3A 2GPHA 3ZONA 4QYEA 4D4RA 4ASEA 5M56A 2G2FA 3OS3A 4RMZA 3G33A 4G16A 3RPYA 2PE2A 4PMTA 5EYMA 2P33A 2XS0A 5G6VA 2F2CB 3E5AA 5CNOA 2YN8A 4JR7A 5H8BA 3HUCA 3MN3A 4ALUA 4CV9A 3H0ZA 4JS8A 4ZY4A 3AD4A 2QNJA 3MPMA 4TL0A 4BCQA 1ZARA 5JQ8A 1KOAA 3D7TA 3PSBA 4AAAA 5AA9A 3Q2JA 3BE9A 2W1HA 2GS7A 3EB0A 4HYUA 3PLAE 4EOLA 3TZMA 1ZOEA 1OMWA 2HZ4A 2OGVA 1XH7A 4EKKA 3GCQA 2W1EA 4FSWA 5J9ZA 4QNAA 5EFQA 3QF9A 3VBVA 3AC8A 4IZ5A 3RHKA 3ZMMA 4C4GA 5L6PA 3GP0A 3NLBA 4EZ3A 2WFYA 1JLUE 5E8UA 5IA2A 3BKBA 4FKPA 4I5MA 3EIDA 3KCFA 1L3RE 4NCTA 1Q24A 3PIZA 3FPMA 3LAUA 3PXZA 4YBKA 4EBVA 2W1DA 3LXKA 4QTEA 3LCDA 2YDIA 1ZY4A 2BDWA 2X8DA 4IX4A 1Z9XA 3O8TA 5JH6A 3HP2A 4HCVA 5EYKA 5E92A 4C3RA 2WQBA 3UOLA 1H08A 2C4GA 4IB5A 2O8YA 1YXUA 3LCOA 4FKJA 2QKWB 3QZHA 4V04A 3FWQA 2UW6A 1KUTA 1FVTA 3MTFA 4PDPA 2B54A 3QZFA 5FTOA 5BUIA 4CMUA 4D9UA 5CASA 5I9YA 2VWBA 5F4NA 2PU8A 3KREA 1PJKA 4FTIA 2EWAA 1UWJA 3F3UA 3IW4A 4O81A 4MF1A 3D5XA 5CAPA 3W2CA 3Q2MA 3FYKX 4IB1A 3A7FA 1Y6BA 2E9OA 2NRYA 4IQ6A 4C36A 2CNQA 2X39A 2CKEA 3QTRA 3TI1A 3P0MA 2R0UA 2QOFA 1MQBA 1PXJA 3G15A 2CGWA 1REKA 3RJCA 2QVSE 3OOMA 3MVHA 3PVWA 4S31A 5K0XA 4FODA 5IQBA 4DFZE 4FIFA 1JKLA 4FNYA 4MD9E 3TV6A 3S4QA 3GC7A 5FTQA 2IW9A 3BYSA 4NUSA 4HVHA 3NS9A 4FTNA 1PKGA 1OKWA 3GU4A 4DT9A 2WIPA 4F99A 3UMWA 2XBJA 3LJ2A 1MRUA 2YDJA 2WTCA 2XRUA 1PXKA 3GXLA 3NUXA 4CLIA 4MXXA 4AWIA 3FI4A 3SHEA 4YTCA 2OKRA 2DQ7X 1VYZA 2Y0AA 3MVJA 3V8TA 4UY9A 2OJFE 4AGCA 4S34A 3BGPA 3E3PA 3G51A 5BYYA 1IEPA 2VTRA 3FEGA 3NYVA 4O22A 4CCBA 3FZRA 4B8LA 4FEQA 3KULB 5KO1A 1RW8A 4O7SA 2BALA 3I81A 4TYIA 4JX7A 4E7WA 4YTFA 4F0GA 2F2UA 3R02A 3TDWA 2WQMA 4Y8DA 4G6NA 4NTTA 2GNJA 3TL8A 2YHVA 4PPBA 2OLCA 1LUFA 1IRKA 4LQMA 3FLYA 5D9HA 4S30A 2H9VA 4DINA 2XIKA 4EH3A 2AUHA 3FMLA 4XBRA 4DGOA 1YXXA 3DU8A 4MNFA 4X21A 3UJGA 2PMOX 4BCGA 5HQ0A 3I4BA 4D1XA 3D83A 3QKMA 4GW8A 4BBMA 1ZMWA 3KB7A 2PMIA 4IAIA 4FV5A 4CNHA 2BHEA 3W2RA 3GT8A 2HZIA 4TYHA 5EK7A 3UG2A 4D5KA 4R3CA 4C33A 3EYGA 5CNNA 5EYDA 3FKLA 3BCEA 4USEA 3LFDA 4P5ZA 2OF2A 4RWIA 3D7ZA 4E1ZA 5CAUA 2WEIA 5DVRA 1W7HA 5HTBA 4I6HA 1UNGA 2CLXA 4Y72A 3V6RA 5IQFA 2OK1A 4HOKA 4QO9A 2QODA 2J6MA 4WNPA 3VJOA 1P14A 4DEIA 4P4CA 3QQUA 2Y6OA 4X3FC 3BQRA 4NH1A 2VWXA 3GENA 3R73A 4V01A 5KMIA 2VTHA 1XH5A 3A7IA 4WO5A 4RX8A 3U6HA 4YHJA 3QC4A 5M08A 4N4SA 5HIEA 4JAJA 2W1IA 4QTDA 2Y4IB 1AD5A 1GNGA 2BILB 4FG7A 5LVLA 3TEIA 3WZDA 3MH0A 5KKRB 1V0PA 1B39A 3HA8A 2R5TA 4KINA 4KRDA 4UEUA 3LVPA 3KFAA 2YEXA 3OXTA 4FZFB 4PRJA 4QMVA 4ZMFA 3R7UA 4FUYA 3UZTA 5CT7A 1RJBA 4FYOA 4YHFA 3ID6C 3VUGA 4YJNA 4IWPA 4F9CA 3ALNA 5ITAA 3OROA 3UE4A 5HIBA 4AN3A 3WYXA 3FMHA 4L67A 5ETIA 4II5A 2CHLA 3OEZA 4OTPA 1GZKA 4I3ZA 3RPSA 1YVJA 4IB3A 3RK7A 3BHYA 5HTCA 3EH9A 1OPJA 3AC4A 2GNLA 2Z7LA 3FXZA 2WZJA 3KN5A 2BR1A 3B8RA 4HYHA 2WKMA 4WRSA 3V8SA 2UZWE 4I4EA 3OT3A 3GC8A 1KV1A 4FTAA 3AC1A 4MD8E 4YC8A 1PY5A 2O3PA 2OJGA 3E88A 4LM5A 4GG7A 3R8UA 2B52A 3B8QA 2FA2A 2XYNA 3U87A 4MVFA 3TNHA 3PFQA 4J95A 5IZFA 1Y8GA 4IC7A 1T46A 4ZP5A 4AW0A 4E8AA 4NM0A 4PPAA 4WNKA 3IG7A 5L8KA 4RG0A 4A07A 3TG1A 2B7AA 3UC4A 1P2AA 5LMBA 4F9WA 2NPQA 4XOZA 3BELA 3LW0A 4FTTA 5JT2A 4HZSA 4P2KA 2B0QA 3ITZA 2UW5A 2WD1A 1FGIA 3QBNA 2OZAA 4XH6A 4WBOA 5AIKA 5D41A 3W2OA 2ONLC 3VNTA 4YO4A 4JBOA 4E6CA 4WNMA 2IO6A 3FQEA 3O50A 2YAAA 4FT5A 4C58A 2XH5A 3LXNA 3FMKA 3A61A 2QO7A 4FZAB 3HMIA 4RT7A 2HIWA 4ZK5A 4CYIA 5JZJA 3HMNA 3IDBA 2BZIB 1U59A 4QYHA 1KSWA 1HOWA 4R8QA 3BYVA 1APME 1Y57A 1R0EA 3BEAA 4MBJA 4QP7A 4RVTA 5BVFA 5JKGA 2XM8A 1NT2A 2W5AA 3DJ5A 3BGQA 5LVNA 5HIDA 2XEZA 2QKRA 4YJRA 5A4QA 4FV6A 3CTJA 1OI9A 4IZYA 5AUUA 2E9NA 4JG8A 4FSUA 4Y85A 4ZSAA 4O82A 4C57A 3RPVA 4RIXB 5AV1A 4GRBA 1H24A 5ANIA 3VBTA 2Q0BA 1FOTA 3RZBA 4APPA 4BDEA 5CU2A 3TJDA 2RFSA 3UNZA 4U3YA 2Z02A 4U7ZA 4A9YA 4QTCA 3GB2A 3QTUA 5F20A 4H3PA 3JYAA 3RINA 3UIXA 3ZFYA 3BIZA 4FG8A 5HE1A 2ITOA 3TNQB 3VS1A 3QYWA 4JX3A 2BTSA 4UWYA 5FGKA 3ULIA 4U45A 5HD7A 4HNIA 2GFSA 4A9UA 4DC2A 3DNEA 4RC3A 4WKQA 5C1QB 2CJMA 4G5JA 3HUBA 4GT4A 5HBJA 3UQFA 1XR1A 4NSTA 3ZLWA 4V05A 3TZ7A 4HVSA 1W0XC 2YA9A 5FEQA 4TRLA 5GJDA 2WU7A 2PUUA 4DEHA 4PMPA 5J9YA 4IVDA 2W4JA 3BPRA 4J8MA 1H27A 1P4FA 4L42A 1OB3A 3F6XA 3FAAA 1Q3WA 3V5LA 4E3CA 2GQRA 2X2KA 3R2YA 4NEUA 2W99B 4K2RA 4GSBA 5HVKA 3NWWA 1KOBA 3LFAA 3RCDA 3ZU7A 4O0TA 1OIYA 2WMAA 3HL7A 3I0OA 1NVQA 2EXMA 4JRVA 2PVYA 5DOSA 4B99A 4IAKA 4DTAA 5CF4A 2G15A 3O8UA 4OTFA 5A4LA 5IA1A 3MVMA 2R3PA 1YDRE 4E6QA 1NW1A 4BZDA 2VD5A 5DMZA 4WBBB 4MH7A 4O2PA 2QOKA 3V5JA 2I1MA 4U43A 4CTCA 4MHAA 3LJ0A 5J1VA 5AP5A 4G17A 4NKAA 4FV2A 4CXAA 3PG1A 3C4ZA 5EW3A 4F09A 5CF8A 4EK3A 3OWJA 3FMDA 2PULA 3CQWA 3NIZA 4OUCA 5ACKA 4HJOA 4DCAA 1OKYA 3PPKA 2VN9A 3EL7A 4EWHA 4EWQA 1BKXA 1W83A 1M17A 5HICA 4G31A 2J50A 4RJ4A 1G8AA 2CKOA 4BYIA 3PZEA 3MPAA 4EJ7A 2PUIA 2V0DA 4HGSA 2W5HA 2VTMA 2VWIA 3V5WA 4EH7A 5I9WA 2R7IA 4V0GB 4FTUA 5E8TA 5AX9A 3ZTXA 4ANMA 5CEKA 1G5SA 5FTGA 4U42A 4I0RA 4ASXA 5LJJA 4N6YA 4NKSA 3BHVA 2X0GA 5HLPA 5L4QA 2IVSA 5EYCA 5M4IA 5FWKK 4PY1A 4AG8A 3VS5A 4FEXA 4M7IA 1XH9A 3DBCA 3E92A 2PPQA 3ZFMA 2VTJA 4FL2A 2XNPA 2X8EA 3PZHA 4LL0A 3CS9A 3PIXA 2IZUA 4QYFA 5DG5A 4QMNA 1CKPA 3CJGA 3IDPA 5EI6A 2ZM4A 3P79A 4XRLA 4QMZA 3SLSA 3RM6A 4E4NA 2BRMA 2W96B 5DRBA 5KMJA 4O86A 1U5QA 2YIXA 4ZJIA 3EFWA 3OW4A 1YKRA 4YTIA 4ZAUA 3QUEA 4F7SA 3DK6A 1ZZLA 4QMXA 1PXLA 3PWYA 5L2SA 2WTVA 4RZWA 4ZY5A 4PMMA 5K4JA 3FLSA 4PPCA 2UW0A 3QRKA 5J7BA 5E8XA 4ZTMA 4AA4A 4CFNA 3HECA 4I1ZA 2GHLA 4KB8A 1HCLA 4L46A 4ASDA 2A27A 4XJ0A 1REJA 4DTKA 3UQGA 4BI2A 3A2CA 4EHEA 4NYEA 2PK9A 1ZZ2A 3MS9A 5CT0A 5FXSA 3TJCA 2GQSA 2R3JA 3PLSA 4PQNA 3R7YA 5HO8A 5AR7A 3BWJA 4GFOA 3EN5A 4MXCA 5ANKA 4EH9A 1BX6A 1FQ1B 5L8LA 2ACXA 2XKEA 2P4IA 2XZSA 3EKKA 4G1WA 4J99A 5H3QA 1H8FA 5BMMA 3G0EA 2B1PA 4EYJA 2C3KA 3BEGA 4MTAA 3F69A 3DPKA 3O51A 3UIMA 4S2ZA 3ZLXA 4OR5A 4CFUA 5E8YA 5HZNA 3MA3A 1SM2A 2X6EA 4KKEA 4YJVA 3DQXA 4EL9A 4GIIA 5HNBA 4ZZOA 1XH6A 2CSNA 4ZSLA 3ZXTA 2C5OA 5CAVA 3U6JA 2GSFA 3KL8A 1QPEA 5ANJA 1O9UA 3G5DA 4KIPA 5EM8A 4HCTA 2YJSA 4YZMA 2UZOA 5JGAA 3C0GA 3A4PA 4L7SA 3ZUVA 4YPSA 4D4YA 3DJ6A 2B9FA 3NNXA 4GT5A 4G3DA 4W4WA 5JFSA 3HV7A 5FEEA 5AV0A 3L9MA 5BVWA 4APCA 3A7HA 3MTLA 2BDFA 2UW4A 3E63A 5GNKA 3DV3A 1DI8A 2QCSA 4JDKA 3PY0A 4OW8A 3BU5A 2XM9A 1ZMUA 3FHIA 5BVEA 5BVKA 3R9OA 1Z5MA 2WIHA 3U55A 3TTJA 3GQIA 2JDRA 5ANOA 4RJ8A 4G3CA 1MUOA 3GQLA 2WTKC 2JEDA 3CQUA 3TKHA 3FLZA 3SQQA 1Y6AA 1WBWA 2JIIA 4FKTA 5HLWA 5HU9A 5CSVA 1ZWSA 5KMKA 3VAPA 2X7OA 4BL1A 1WMKA 3I1AA 4LMNA 1NY3A 4JNWA 3POZA 5EHYA 4ENXA 3I7BA 4GIHA 3ZDIA 5KHXA 3AC5A 3TNWA 3Q6WA 4NIFA 4C2WA 3GCPA 1CKJA 2X8IA 3RAHA 5CI7A 4GFMA 4UMQA 2GNGA 4MQ1A 2P55A 4ZTHA 4RFYA 4BKJA 3K5UA 3R6XA 4LRKA 4ZTQA 4W8DA 1KE8A 2RL5A 5DR2A 4BGGA 1YOLA 3VUTA 2GS2A 3PPZA 2YWPA 5DT3A 2ITQA 3LFFA 3FPQA 3K3IA 4IFCA 4IDTA 3SKCA 3DAJA 1OL1A 1WBTA 3A8XA 4Y5QA 4EKLA 4DT8A 4I0SA 4GYGA 5CU4A 2XIXA 1OBDA 4HCUA 2VWVA 3EQGA 1ZYCA 1JSVA 2HENA 3ORKA 3L1SA 3PVGA 4IAZA 2YLFA 1H0WA 4JJRA 5AUWA 5H2UA 3WE4A 3N4UA 4O7NA 3GOPA 3MYGA 3ZXZA 5IQAA 4IM3A 4DEDA 5M57A 4PDOA 1CTPE 4RPVA 1UKHA 3AC3A 4BVUA 2JAVA 4OBOA 1T45A 4XS2A 3C4WA 5TOZA 3DXNA 4F0IA 1OECA 3CPBA 3DA6A 3F82A 4FKRA 3M1SA 2GDOA 3ZHPC 3FMNA 3QRJA 5HGIA 5JRQA 2G9XA 1K9AA 4DLJA 4HW7A 3KXZA 1YDSE 4ZOGA 1H1RA 3PYYA 1AQ1A 2BTRA 5CAOA 5IUGA 3ZSHA 3A7GA 3IDCA 4MBIA 2UZNA 2ZYBA 3ROYA 3UZPA 2VTNA 4PDSA 4CGAA 2H8HA 5BYLA 2RIOA 2YITA 3OEFX 3C4EA 4FV1A 4C62A 4DH1A 2OH4A 2C69A 4KRCA 4GK4A 1Q62A 3ORLA 3VULA 2JBPA 3QRIA 4G3EA 3ZM9A 3FLQA 4K77A 2OXXA 2XK9A 3CTHA 5FLFA 4TN6A 4TKSA 4DH8A 4RQKA 4JQ7A 3PSCA 2RGPA 4TYHB 3HV4A 3CP9A 3SXSA 2QG7A 3FLNC 2CGVA 2HY0A 2C0IA 3QQFA 4W4YA 3F3TA 3NUNA 3E8NA 4RX7A 4BDBA 3V3VA 4B6LA 4OT5A 1BL6A 4L01A 5A46A 5AUXA 5BNJA 3TXOA 3D5UA 4ZTRA 3DKGA 2WU6A 4A9SA 2OSCA 5HBEA 4CFWA 4B9DA 2VU3A 3JY9A 3R1NA 3OCGA 4DFXE 4QMLA 1JQHA 4U79A 2XKCA 3F2NA 4ONAA 5H8GA 3COKA 2YIRA 4U41A 4JBVA 3FZPA 4TT7A 1S9IA 3ALOA 4K11A 4ALVA 2YZAA 4D9TA 4RC2A 4D2RA 4BDHA 4D0WA 2QR7A 3AG9A 3C9WA 1J3HA 1O6KA 2WMXA 5JN2A 4KKHA 4QTAA 2WO6A 1PYEA 5CVFA 4ACDA 2JFLA 4WSYA 3WYYA 3JXWA 3KC3A 3OHTA 5A54A 5I9UA 4FUXA 4BKZA 4BWXA 4JXFA 4ZLOA 5L3AA 4D4SA 5IQCA 2PE1A 2BZKB 3JVSA 3L8SA 4FNXA 4MXZA 5IQDA 1JVPP 1Q61A 4X7QA 3VF9A 4NW5A 2BRGA 4FV8A 3QC9A 4AFJA 3R1YA 4OTGA 3VBXA 4EZ7A 4RLLA 3U9CA 1PKDA 3NNVA 3NCZA 2IVUA 1OUYA 5CX9A 4YNEA 4K1BA 3UC3A 2R4BA 5FM2A 3E3BX 4YJOA 4G6OA 2ZV9A 4DEBA 5DWRA 3VC4A 3DXPA 3S00A 4PP7A 3KVXA 3ZZWA 4HPUE 2QOLA 3EKNA 3I0QA 3NIEA 4ACHA 4EK4A 4MQ2A 3IQ7A 2CNVA 4LGHA 1CMKE 2BDJA 2J7TA 3EFKA 1JWHA 1YW2A 3OVVA 4AFEA 4ASZA 4CKJA 3TIYA 3OOGA 4JDHA 4F6UA 5KMLA 3QCQA 3K2LA 4ANSA 4BCMA 5E7RA 1EH4A 3LQ5A 4GH2A 4LI5A 4ACMA 4FSMA 4GK2A 4PX6A 4AUAA 5IDNA 4ACCA 1BLXA 2UV2A 2UZUE 4Z16A 2F9GA 5DE2A 5EDQA 2GNIA 2YIQA 5M4CA 4ID7A 2RF9A 2FH9A 3T9TA 3NX8A 2QQ7A 5IA0A 2B9IA 2PY3A 3VW8A 4BFMA 4IX3A 5EG3A 3EHAA 3BV3A 4FKQA 4C2VA 3LCSA 5IQEA 1H01A 3NMUF 3NW5A 4BN1A 3BYUA 3F7WA 5DT4A 2IJMA 4OGRA 5CQWA 5A4CA 3UYTA 5FDPA 3F2AA 3IOPA 4NWMA 4TY1A 3RAIA 4FV9A 4C4EA 4BCFA 2WHBA 5BMSA 1PYXA 2YAKA 5FD2A 4BWPA 2IW6A 2CGUA 3UTOA 3L9LA 2WTKB 5E90A 4XCUA 3BU6A 1YWRA 1ERKA 4EK8A 5CEQA 3SXRA 2B4SB 4AS0A 4M12A 3QXPA 3D9VA 1Q8WA 3CLYA 4GJ3A 4R6VA 2BIYA 3KRLA 1B38A 3R1QA 4Z55A 4FF8A 4XP3A 3QQGA 3FZSA 3BLRA 3E8CA 2QOQA 3PIYA 4IMYA 5CEIA 3N4VA 3HRFA 1WZYA 2ZMDA 3GUBA 4MXYA 3FZOA 3IS5A 5IQHA 4O0YA 4O91A 5JQ5A 1J7IA 5CLPA 4X3JA 3AMAA 2WTIA 3DAKA 3ELJA 4YJSA 4XV3A 1YQJA 4FVQA 4LYNA 3KMMA 4IFGA 4CYJA 3VIDA 5IA5A 2F7EE 4Y73A 3VUIA 3VW6A
chains in the Genus database with same CATH superfamily
1ZYSA 2PWLA 2XB7A 3P7AA 5CSXA 2C6LA 3UIUA 2ZAZA 2ONLA 4JIAA 3MJ1A 5HX6A 2X81A 4BB4A 4MYGA 3UZRA 3W0MA 3RCJA 2W4OA 5BVOA 4RJ5A 2WEVA 4AA0A 2ZMCA 1SYKA 3DT1A 4XG2A 3R8LA 3QAME 3POOA 5IUHA 4UXLA 4H05A 4QTBA 3OZ6A 4EOSA 5AA8A 2XKFA 2R3MA 1ZOHA 4ENYA 4ZSJA 1Q8YA 4FZ7A 4GCJA 1VZOA 1BI8A 2IW8A 3DKOA 4D58A 2QOOA 3P5KA 5H9BA 3ZO1A 3HRBA 4QOXA 1ZYDA 4JI9A 4O1OA 2V7AA 3UMXA 3FI3A 3SW7A 4HZRA 4X2JA 1GZ8A 4WSQA 4YBJA 2E9UA 4DFYA 4RIWA 2UW3A 2Y4PA 1DAYA 4XG3A 4EOPA 5CANA 4I5CA 5IMEA 2C6MA 2HK5A 2OJJA 4FTCA 1Q5KA 4LUEA 1V1KA 2R3OA 2WPAA 3LJ1A 5JFVA 4FEUA 2XNMA 3DGKA 5FXQA 4E5AX 4AT4A 2P2HA 3R8VA 2XIRA 2JIVA 3HMMA 5J9LA 3ZBXA 1GZOA 3C13A 4PNIA 4L3LA 2LAVA 5AP7A 3AT2A 1PMEA 3PUPA 4NFNA 3R83A 3PG3A 1CM8A 3P7CA 3DS6A 3IONA 3LQ8A 3P23A 4ZTLA 1U54B 2WQEA 3OXIA 3QTWA 1M7QA 5IMXA 4L52A 2I7QA 2A19B 3HAVA 2DS1A 1H25A 3G9LX 3D15A 2YM5A 1XWSA 3D14A 1BUHA 4MD7E 2QOBA 4CMOA 3OXZA 3W8LA 2XUUA 3BHHA 2C3IB 3Q52A 2XK3A 4O0XA 1H1QA 4QP6A 2OI4X 2FUMA 4MNEA 2YERA 4RLKA 4O1PA 4FSTA 4GMYA 4AACA 2NP8A 4LUDA 2OFVA 3QUPA 2WTJA 3FKOA 3GGFA 2I0YA 4H1MA 2PVJA 3FHRA 5KCVA 3UGCA 1IA8A 2VX0A 1OKZA 4QMQA 3W18A 3BI6A 3OY3A 5C01A 2VTOA 2OF4A 3NW7A 2BROA 4J97A 3SAYA 4LDTA 4BJJA 2X7FA 4WUNA 4EH5A 3F66A 3QTSA 4QMWA 4ZSEA 5B0XA 1VEBA 2ITZA 5AP4A 4QRCA 3TN8A 4AW2A 4I5HA 1UKIA 5I5ZA 2ERZE 2WOTA 2WXVA 3MA6A 5HBHA 5L2TA 3ANQA 2GQGA 2XIZA 3DK3A 3UVPA 3R9NA 4HVIA 3OD6X 2I0HA 3DCVA 5FQDC 3QGYA 2HZNA 4N6ZA 2CGXA 2ITYA 4QMUA 4F6WA 2RKUA 3KA0A 4U8ZA 2BUJA 2XNEA 5CVGA 2VX1A 4J53A 2CNUA 5EM6A 3KRWA 2WMQA 4NJ3A 4R3RA 2Z2WA 2IVTA 1YOMA 3OCBA 5LMKA 1VJYA 1P5EA 4PWNA 3WARA 4JDJA 5K5NA 3QD0A 4U80A 4CZTA 1YDTE 4USFA 5CVHA 4WD5A 3VHKA 3PA5A 4UWCA 1ST0A 3VONA 4KIOA 4QYGA 1J1BA 4M84A 4S32A 5AADA 5M51A 4FT7A 4P5QA 4YO6A 1UU3A 4KSPA 1GJOA 3NCGA 4RGJA 4R77A 4IBMA 4RVLA 4IDVA 5CF5A 3PVUA 3JUHA 5M55A 3NZ0A 5AR3A 3JR1A 3VWAA 3DZOA 3EL8A 3ODZX 2EVAA 1MRYA 1UA2A 3EN9A 4RFZA 4WRGA 3ACJA 3FYJX 3MGYA 3O2MA 4LGGA 3VUKA 4F9BA 4GVJA 4M97A 2J0JA 2WB8A 2VZ6A 4FV7A 3DBEA 3OWLA 3ZDUA 3BHTA 2G2IA 4ACGA 4JAIA 3QUDA 5AUVA 4GYIA 3CIKA 4EOOA 5M4FA 4ORKA 1J91A 4O6EA 3DDQA 4KS8A 4E4XA 4CLJA 5B2LA 3RMFA 4DHZA 2G1TA 2I6LA 3QTIA 2PVRA 4W9XA 4D55A 3W8QA 1XHAA 2ZV8A 3QCXA 4Q9ZA 5A6NA 2OO8X 1LR4A 3D0EA 1J1CA 5AP1A 4O7VA 2J4ZA 2W1GA 3JVRA 3M11A 4FVRA 2HOGA 2ZJWA 3AD5A 4GUEA 4BR3A 4Z3VA 5A9UA 4MXOA 4MCVA 1XKKA 3TYKA 3CPCA 3AKKA 4BIDA 5KMMA 4YJUA 4LOQA 3KXHA 1JBPE 3F5PA 3PY1A 5EW9A 3Q4CA 4ZJJA 1R3CA 2QG5A 1Q97A 4FI1A 3Q60A 2NRUA 2XJ2A 4I6BA 2YIYA 2X2MA 3C4XA 4FKGA 1SVGA 3NUUA 4EYMA 1XBBA 4DLIA 3O8PA 5HCYA 4DG3E 3IW7A 3LOKA 1M14A 3R7EA 1U5RA 2WELA 2ZVAA 5AEPA 3Q53A 4UXQA 1Y91A 1OL5A 3ZSIA 5LVMA 5FG8A 2O63A 4QNYA 3ERKA 2ERKA 4PTEA 4U3ZA 5I4NA 2Z7RA 4NIFB 1UNHA 1GY3A 5ICPA 3QCYA 5CS6A 5DLSA 4YURA 2W9ZB 4XNEA 3UO4A 4EQUA 5HHWA 4BF2A 3MI9A 5IPJA 4PV0A 1H28A 2AYPA 2J9MA 3ENMA 5EH0A 4C3FA 4UBAA 1TVOA 5BYZA 1TQMA 2OIDA 3RAKA 3NUSA 3WZUA 3SG8A 5LQFA 5JFXA 4U9AA 5CY3A 5IA4A 4L44A 4TWCA 3H9RA 1Z57A 3LXLA 5DIAA 3ZH8A 4QP9A 3Q9WA 4YJPA 3FC1X 1ZOGA 4BTJA 1R1WA 4RIYA 4M8TA 2YCFA 4DEGA 2JDTA 3P1AA 3VRYA 4JQ8A 2XNOA 2EUFB 1F0QA 3H10A 4O27B 3UOHA 4EK6A 2XALA 5HOAA 3R63A 3IK3A 1SMHA 2XEYA 5CSPA 2PSQA 4LV7A 4RWJA 4RSSA 3SRVA 4XG4A 1VLRA 3W32A 1SVEA 3CD8A 3QRTA 2YZLA 4O0WA 2C47A 3FSFA 4L8MA 1IAJA 3KXGA 4EI4A 4QMTA 3TTIA 3PXRA 5AP0A 3GU8A 2OFUA 5L2WA 3Q96A 2BAKA 4FVPA 2QHNA 4KAOA 3I5NA 3HV5A 3COHA 5CU6A 3ZO2A 5CEMA 3PPJA 3CR0A 3W0NA 3L8PA 4ITHA 3TV4A 3LMGA 4EUUA 5GJFA 2PVLA 3CJFA 3OF0A 5HKMA 2ZB0A 5L6WL 1YRPA 4AGUA 4W4XA 4B7TA 3W16A 3QGWA 4RJ6A 4TTHB 4TWPA 3VS6A 3C5IA 1TQIA 1QCFA 1WFCA 2W9FB 4IZAA 4BZNA 2W05A 4YLLA 5LVPA 4FT9A 1GZNA 2GU8A 4DF3A 3LM0A 3KU2A 5AUZA 3BLHA 3Q5ZA 2R3NA 4RVMA 1PXPA 4K0YA 3V5TA 3F3VA 3P4KA 3IO7A 3RNIA 4XUFA 4IWDA 5E8SA 5KBRA 5C9CA 1OVEA 3V01A 1PMVA 4FSYA 4D1ZA 4XYFA 3F88A 5BUEA 5F1ZA 5IF1A 2O65A 3MFTA 3QHWA 2OXYA 4TZRA 4ANNA 4AU8A 4E4MA 4EEVA 2XNBA 2XBAA 3W10A 2X0QA 4EHVA 4AZWA 5CI6A 2XIYA 5I3OA 4E4LA 4I20A 3C1XA 4XV1A 3UVQA 3U54A 4DBXA 3QD4A 4FICA 5CALA 4O4BB 3S0OA 4KWPA 1B6CB 2W5BA 3NUPA 3Q9ZA 4XV2A 5DA3A 4UWBA 3MIYA 4BRXA 2OZOA 5K3YA 1WBNA 5JZNA 1OL2A 5AJQA 3BLAA 3LPBA 2VAGA 5FRIA 3RI1A 4BDCA 3UOKA 1R0PA 3EN7A 1ZLTA 4C7TA 3VN9A 2RFEA 4ZMEA 4NM3A 1OITA 4PNKA 3HDNA 3FJQE 4IANA 5KBQA 3SXFA 3SGCA 3AMYA 4NW6A 4FGBA 1DS5A 2R3GA 5AUTA 2I0EA 2CCHA 4A4OA 4WHZA 3ZEWA 1G3NA 1QPDA 3LHJA 3P08A 2A1AB 2JKMA 2BVAA 2WMUA 2XRWA 3IW6A 2A2AA 3FMMA 4TXCA 2GNHA 2VTLA 3EFLA 4X3FB 4D2SA 2HW7A 1ST4A 4IB0A 5LMKC 3OP5A 2HXQA 3RZFA 2YLEA 2UVZA 3FE3A 2YCQA 5FEDA 5EHOA 5JFWA 3SOCA 4HGTA 3IECA 3D5VA 3EN6A 1IASA 2VO6A 4DG0E 4XG8A 4DE4A 4TYGA 3VVHA 3A60A 3VUDA 4F08A 5C8NA 2OW3A 2FSLX 2P2IA 1W2CA 3CY2A 3ORIA 4JBPA 3IW8A 5C8MA 3AT3A 1CDKA 4TWNA 2R7BA 2CN8A 5E8WA 4AZEA 5A6OA 2BAJA 2YM3A 2VTSA 2VGOA 4HPTE 1OGYA 3LMHA 2Q0NA 2PVMA 5LCKA 4TYEA 3H4JA 2BRBA 4R1VA 4AX8A 4DYMA 3KVWA 3MJ2A 4YSMA 1GAGA 2X2LA 3WOWA 3BQCA 2PZRA 3F3WA 4FKVA 3C51A 3C5UA 3G0FA 1M2RA 4FG9A 4NU1A 4ANOA 2RG6A 3P78A 4IM0A 4J7BA 4LRMA 3UNJA 4QMYA 3RAWA 5CEOA 3DK7A 5I3RA 5LCJA 3LLTA 4C59A 2XARA 3DZQA 2CLQA 3PSDA 4QD6A 3OFMA 3PJCA 3MVLA 2W1FA 1E1VA 2Y9QA 3LXPA 4YNOA 4I6FA 3E8EA 3K3JA 1M2PA 2VX3A 4QMMA 4XG6A 4CT2A 3PJ2A 4AP7A 4O84A 4U5JA 1FINA 5H8EA 3RHXA 1JKSA 2YDKA 5AX3A 1ATPE 4PDYA 4H58A 3PDTA 3VQUA 5M06A 3ZO4A 2BCJA 1URCA 3QTQA 1YI4A 3D7TB 2PVNA 1CKIA 4FL3A 4ANQA 3RVGA 4O4DA 2W0JA 3NUAA 2DUVA 4IADA 4GKHA 4ZTNA 5HD4A 3ZO3A 3P7BA 4GU6A 5EM5A 1O6YA 3HEGA 3CTQA 3HNGA 1Q99A 2R3KA 3OWKA 4O21A 4DH3A 3W0PA 1YHSA 3ANRA 3OUKA 2X9FA 2XK6A 3MH2A 1A06A 2OIBA 4AE6A 5LMAA 2XMYA 4CRSA 2WMRA 3KK8A 3LIJA 2Y8OA 2YJRA 3LFEA 3QQKA 2PUNA 4UMRA 3KKVA 3DNDA 1KV2A 4AT5A 1WAKA 4O7WA 5IQGA 2ITNA 5GIPE 2A0CX 3RM7A 3GC9A 4ITIA 3QHRA 4O4EA 3R9DA 3I60A 4KKGA 4L68A 5HEZA 1WBSA 2R3RA 4FTLA 4DFBA 3RK9A 3UODA 3FZTA 3JS2A 3QX4A 4U0IA 4C34A 5I0BA 2F7XE 3B2WA 5M44A 1ZRZA 4UYNA 4FSQA 5F95A 5IEYA 3ATSA 4N0SA 1W2FA 2FSTX 4AZTA 3AC2A 4YJQA 5G1XA 1WVXA 4IAAA 4D1SA 2GMXA 3LLAA 2QURA 5J5TA 4RIWB 2PUPA 3PVBA 5GJGA 2PZYA 3QQLA 1PXOA 3PJ3A 4YZNA 4QP2A 2QI8A 2NNWB 3WILA 4IVBA 2C6IA 3HMPA 4Z7GA 4G34A 4XV9A 4GL9A 3NAYA 2XNNA 3HRCA 3V5QA 2WQNA 4JOAA 3GCVA 4L3JA 1M7NA 4O6LA 4EH8A 4PTGA 3KMWA 4AT3A 4IAFA 2YM4A 3QYZA 5HG9A 4I21A 3T3VA 4CG9A 4FKSA 3I5ZA 4G2FA 3V5PA 1ZYLA 4LMUA 2W1ZA 4O0UA 3QRUA 3MV5A 4NM7A 3MWUA 5DFPA 3C50A 4C4JA 4CQGA 4BCIA 3KF7A 3RP9A 4BDGA 1QPCA 3S1HA 2R9SA 2EXEA 3IW5A 1LEWA 4QP4A 1K2PA 2C6KA 4RJ3A 4G9CA 5L2QA 3LFNA 4AN2A 5FXRA 2O5KA 2W06A 3C0HA 2WMVA 2C0TA 4MNEB 4BTFA 2F57A 2XK7A 3QWJA 2X4ZA 1YHWA 3ODYX 4EH6A 3NUYA 3TM0A 3AGMA 4RZVA 1WBOA 2ZDUA 4FIGA 4K18A 3VS7A 5HG8A 3CBLA 3PXQA 2VTQA 4X2GA 5A4EA 3UO5A 3W0SA 3F7ZA 3M2WA 2J5EA 3IKAA 4BCKA 5IISA 5DEWA 3CQEA 2BKKA 2PZ5A 4GFGA 1V0BA 4I0TA 5AFVA 3AQVA 3QTXA 3BL9A 4ALWA 3Q6UA 4BJJB 4EOIA 2BMCA 5AM6A 3RPRA 4U6RA 4H1JA 2PVFA 3EFJA 3GU6A 3DY7A 4QPSA 3R22A 3VBQA 5A4TA 4FX3A 4Y95A 4BTMA 3KK9A 3SA0A 3F5XA 4PP9A 4FIJA 3A4OX 3WF5A 3ZUTA 2FB8A 3O0GA 4I6LA 4O7YA 1OM1A 4R5SA 4YSJA 3NFGB 2ZB1A 4FE2A 2R3FA 3F5UA 3Q3BA 5JGDA 3KQ7A 4Z9LA 5AP3A 4UMUA 4JT3A 4CFXA 3LMIA 5IU2A 2BFYA 4IW0A 3IGGA 4R5YA 4RIXA 5T3QA 3RPOA 4UX9A 4WNOA 2UZBA 2BRHA 3G6HA 3NEWA 5DHJA 3FBVA 4JG6A 3RWQA 3CY3A 3SD0A 4CMTA 2BFXA 2X4FA 1URWA 2VV9A 3C4FA 2C30A 3KXMA 3PRFA 5B2MA 4KABA 3C0IA 2BRNA 3Q04A 3QZIA 3REPA 2NO3A 5KNJA 3NAXA 2E9PA 4QMSA 4MBLA 5DYJA 4I22A 1Q8UA 3O7LB 4C4IA 3WF8A 4BGQA 4YC6A 2GTNA 2QU6A 4AGWA 2J0MB 4ZEGA 4AXFA 2DWBA 3U51A 1J7UA 3SX9A 5ETFA 4BGHA 5KMNA 3ZYAA 3RGFA 2W4KA 2XYUA 1NVSA 4XP0A 5LWMA 4DN5A 1F3MC 4U81A 3MFSA 3AGLA 5CAQA 5AAFA 3V6SA 4I24A 1XBAA 4FSZA 1JKTA 1W82A 2OXDA 5AMNA 4DFUA 2P3GX 4KBKA 4DGLC 2VGPA 3P86A 3QD2B 4YZCA 2QOHA 4EH4A 3OBJA 4TW9A 4BDJA 3ORTA 3PXFA 5IH5A 5DEYA 3PA4A 4EBWA 1A48A 2QD9A 1XO2B 4QP1A 3I7CA 4ZIMA 5GHVA 1OIQA 4IC8A 4C02A 3RWPA 4UN0C 3DFCB 4Q9SA 2I0VA 3HVCA 2B9JA 3TKIA 4OTHA 5T68A 2BZJA 4G3FA 3GOKA 3ZS5A 3A99A 5IUIA 5D11A 1H1PA 3OCTA 5CSWA 4CVAA 2OICA 1AGWA 1HCKA 3QLFA 4I94A 4K33A 2CDZA 2FSMX 3EQDA 2V62A 3C7QA 4OLIA 3OTUA 4FV4A 3TUCA 4FEWA 1JAMA 2R3LA 2VO0A 2PYWA 3IPHA 3Q4ZA 5AUYA 5M53A 4JDIA 4Q2AA 2IN6A 1J7LA 4UB7A 3AD6A 3MH1A 3WBLA 1TZDA 2JKKA 3UDBA 5L2IA 3PY3A 3G2FA 4M14A 4YGAA 3E7VA 3CGFA 3THBA 2J90A 5L8JA 1ZAOA 4CFFA 3UQCA 3VBWA 2OJIA 4CKIA 3MY0A 2VWZA 4WT6A 4PL3A 1S9JA 2WMBA 2OZAB 2W1CA 3F9NA 4H36A 5HU3A 4C37A 3R30A 5L6OA 1E1XA 4FL1A 4RIYB 4NL0A 4FV0A 2V7OA 4U44A 3W2QA 2EU9A 3N9XA 3D4QA 2OH0E 2HELA 4NTSA 3IGOA 2FYSA 4F1TA 2VTTA 4GT3A 4KIKA 3EMGA 4RA5A 5K9IA 5KZIA 4F6SA 3KCKA 4IVCA 4NK9A 2Y4IC 3SRVB 4J98A 5I9VA 2UW9A 5KKRC 5JSMA 4F64A 2JD5A 1I44A 5C26A 3H9OA 1XMMA 3R71A 4LRJA 4MWHA 4UZHA 5GINE 4O38A 1OKVA 3OT8A 3Q32A 3EQRA 4QMOA 1R78A 4CZYB 4BBFA 4BI1A 2IPXA 2UVYA 4BIBA 3W55A 5IDPA 2H34A 5ETCA 5AR2A 4E73A 2C1BA 3EN4A 4OAUC 4B4LA 4PUZA 1FVRA 3TKUA 5EDRA 3FLWA 5DBXA 4I6QA 5AV4A 3M42A 1YOJA 5AR5A 3WI6A 2WMTA 5DR6A 3QQHA 2GFCA 2X0PA 4LV8A 3LCTA 4QPMA 4EUTA 3FXWA 4XG7A 5I9XA 1OPKA 4IEBA 2Y7JA 5E8VA 2C3LA 2VWYA 4H3BA 3RKBA 1OL6A 3TT0A 5EKNA 1XQZA 2HCKA 4QQTA 3ORNA 4L3PA 3ZFXA 2ETKA 3MH3A 1QL6A 4JG7A 3KEXA 4FKWA 3LCKA 2OBJA 2QOCA 4F1OA 4JVGA 2CPKE 2JKQA 2HWOA 3DOGA 4G9RA 4FTQA 5HESA 4E93A 3FZ1A 3GNIB 4ZZNA 3GU7A 2BKZA 3UBDA 1FMOE 4FKLA 1WBPA 2J5FA 3L8XA 1SNXA 2O0UA 4AF3A 1PXNA 4D2WA 1RE8A 3HDMA 4MF0A 2PZPA 4BICA 4C35A 5CXZA 3K5VA 3QTZA 5AIRA 4F63A 5HCXA 3HAMA 2V55A 5CTPA 3ACKA 4GV1A 2J51A 3WF9A 4B0GA 4D2PA 2ZFYA 3E62A 2PTKA 5J1WA 3WF7A 4CTBA 3N4TA 1Y8YA 4DITA 4FZDB 2VNWA 3V51A 3Q4TA 4DH7A 2ETMA 4QP8A 5E4HA 4ZLYA 3KN6A 3L8VA 1ZY5A 4F7NA 3DLSA 2XJ1A 4MEDA 4M69A 1IG1A 2C5VA 2E2BA 3PXYA 4ARKA 5B2KA 5LWNA 3VUHA 3PE2A 4CKRA 4O7TA 2JDOA 2IZTA 4D2TA 5D10A 5ANGA 4O7ZA 3UNKA 2CKPA 2QO2A 2ZM3A 4ZSGA 2R2PA 4TWOA 5HVYA 4R78A 3VO3A 4F9AA 2XAMA 2IZRA 3R7OA 3ZOSA 4UALA 4AOIA 5AP2A 2ZV7A 3BBTB 5EI2A 4MX9A 4AW1A 3FSKA 2DYLA 4A4XA 4IIRA 3ZRMA 4IACA 2OG8A 3LFCA 2YACA 4Q5HA 3WF6A 4Q5EA 2UVXA 4AGDA 5AR4A 2CKQA 3QQJA 3QX2A 4EJNA 5AR8A 3OUNB 1YXSA 5EM7A 2R3IA 3VF8A 3DFAA 5EOLA 1H26A 3FUPA 5BVDA 3QWKA 5TT7A 3WIGA 4Y5HA 2UW7A 5HNIX 2H6DA 2IVVA 2WMWA 3BX5A 4UZDA 3R9RA 3Q4UA 1BYGA 5DRDA 1WVYA 1SNUA 4LOOA 4FTJA 3RK5A 3DXQA 4CG8A 4AXCA 5CENA 3Q9XA 3LM5A 3CCNA 3HV3A 2HZ0A 2WQOA 4HNFA 4YLJA 5M09A 4F1MA 3G6GA 1H1SA 4JIKA 4DFLA 3LQ3A 3ZC6A 4KBCA 3MESA 3ZSGA 4FGRA 4BCNA 3A62A 3QD3A 2GS6A 2C5YA 3LFSA 4BDKA 3ZZEA 3PP0A 4N57A 3TZ8A 4FSNA 3QKLA 4BCHA 3BYMA 4ZY6A 5EI8A 5HE3A 4D4VA 1WBVA 3SW4A 3NYOA 4P7EA 3GEQA 4O0RA 4CT1A 2E9VA 2B55A 3T8OA 2BIKB 3FDNA 3HP5A 3GBZA 4J52A 4CZUA 4H3QA 5C4KA 2EB2A 1WCCA 5FP5A 4FTKA 4M0ZA 4QMPA 3HYHA 5I9ZA 4F65A 3VUMA 5CU0A 3BGZA 3TNPC 4J1RA 3SG9A 1XBCA 5HLNA 1ND4A 2XVDA 5J95A 4JBQA 3NGAA 4BDAA 4CFVA 5KMOA 3ET7A 4EHGA 4OT6A 1IR3A 4K8AA 2JAMA 3OW3A 4E5WA 1UVRA 4LOPA 1SVHA 4RJ7A 3EQIA 4LV5A 4ANLA 1Q8TA 3R7VA 2CN5A 4RIOA 2C0OA 4DGNA 4WIHA 4YU2A 4EORA 3NSZA 4EH2A 3SC1A 3U9NA 3HMOA 4TNDA 4RA4A 1Q8ZA 5D7VA 4FC0A 3NW6A 2B53A 2UW8A 1YWVA 2RFNA 3LFQA 3W1FA 5EKOA 3S95A 4BHZA 1Q3DA 2PZIA 2RG5A 4ERKA 1KWPA 5A3XA 4NFMA 4R3PA 5FM3A 4YTHA 3MY1A 4JL9A 3ZRKA 3BV2A 4N70A 2WAJA 4HYSA 4O83A 3R7IA 4XMOA 3EYHA 4O0VA 4XOYA 1RDQE 1JKKA 1JOWB 1NVRA 3NDMA 4FKOA 4IX6A 4E26A 5IA3A 3MB7A 3O71A 3ORXA 1UV5A 3U8WA 3W0QA 5AM7A 4ERWA 1U46A 3F3ZA 2C6EA 3CGOA 4HGLA 2XK8A 1PW2A 2X9EA 2PL0A 2YM6A 4ZLZA 1NXKA 3SOAA 5C4LA 2FVDA 4CV8A 3ORZA 4I5PA 4O0SA 4X2FA 4LFIA 3ZLSA 4A4LA 4C0TA 4F4PA 5CF6A 3OG7A 4AXAA 2V22A 2ZM1A 1GIHA 3CEKA 4DG2E 4E5BA 4GS6A 4M0YA 4WUAA 4E20A 1W8CA 3BLQA 3EQPA 4KA3A 4XP2A 3TWJA 3W33A 4HVGA 1PMUA 3CE3A 4EOKA 5CEPA 1OBGA 4X2KA 3DKFA 1JPAA 2QC6A 4FZ6A 2Z8CA 4BDIA 3FY2A 4M68A 2IF8A 3PTGA 1STCE 3PRIA 5D12A 5KZ0A 1U4DA 2ESMA 4YHTA 4UYAA 4EOJA 4C4HA 4AZFA 4FSRA 4GEOA 3OWPA 4M3QA 4C61A 4FEVA 2ITWA 3RTPA 3N51A 3PUFC 4BCPA 3QA8A 3UPXA 4AE9A 1YXTA 4DH5A 3KRRA 2VWUA 4XLIA 3ORMA 3O5AA 4DEEA 1H07A 2HAKA 2XK4A 2O2UA 3GU5A 5HTIA 5FUTA 2W17A 3WZKA 3AXWA 4IWQA 4NCTC 2J2IB 2R0IA 4F0FA 1R39A 1P4OA 4XBUA 3ULZA 4XX9A 2YISA 3Q5IA 1OUKA 4EQMA 2P0CA 3MW1A 4USDA 3TUDA 5AWMA 3G90X 3H3CA 2X7GA 1FPUA 2BHHA 3O17A 4G3GA 4NZWB 4PMSA 5AP6A 1BMKA 3VBYA 4EK5A 2YM8A 4BKYA 4PF4A 1UNLA 3R7GA 4QT1A 3ZBFA 5DPVA 3VJNA 4BCOA 2ZOQA 4YPDA 3FC2A 3S3IA 4Y83A 1JNKA 4AN9A 3KIOC 5HO7A 2JGZA 1PRYA 4K9YA 4KNBA 4Y46A 5ANDA 2I40A 4EC8A 2G2HA 1MP8A 1O6LA 2YIWA 3QCSA 3P9JA 4FTRA 4L7FA 2Q83A 4LG4A 2OIQA 5CSHA 2UZLA 3UPZA 2C6OA 5IG1A 2OU7A 4FV3A 3ZEPA 3DDPA 5BX0A 1DAWA 4L53A 4FKIA 4M67A 4EZ5A 3MB6A 5IQIA 3L9NA 3KRXA 2BZHB 3EWHA 2X1NA 2PHKA 2PVKA 5EHLA 4O7LA 3PXKA 3OBGA 1MRVA 1LEZA 3EJ1A 3LFBA 4GG5A 1UU7A 4OTIA 3UO6A 4RX9A 2V5QA 3V8WA 2QO9A 3WE8A 4UV0A 4CSVA 4G6LA 2C5NA 3F2RA 2HW6A 5LARA 2XCHA 4HGEA 5K4IA 1M2QA 1QMZA 3MY5A 4BCJA 4RWLA 4IJ9A 2J0IA 5KX8A 4FT0A 4DCEA 2UZVA 3E93A 4FTOA 3T3UA 3UVRA 3MIAA 2GHGA 4RWKA 2R64A 5BQ0A 5LXMA 1LPUA 3R8ZA 4IJPA 4ZS4A 4WA9A 2YM7A 4OBQA 1H00A 3KY2A 4C8BA 5HCZA 3TACA 5ACBC 4A9RA 1VR2A 2Z60A 4FNWA 1E9HA 4DGMA 2R3HA 3A8WA 5HE0A 1Q41A 4RX5A 3HV6A 2GHMA 2Y6MA 3E8DA 3R2BA 3COIA 2W7XA 4FIHA 3UOJA 4CEGA 4W8EA 4JRNA 4AW5A 3PFYA 4FYNA 2C6TA 1U54A 3R00A 3ATTA 3DQWA 2G01A 4DGGA 3VS0A 4F9YA 4H39A 2CMWA 3R21A 5CQUA 2JFMA 2RFDA 3COMA 2KULA 4R7BA 4GKIA 3R1SA 2XA4A 5C8KA 5E8ZA 4O2ZA 3TDVA 2YFXA 3FI8A 5TF9A 4KS7A 4JR3A 2Z7QA 1XH4A 4MAOA 5DGZA 3FKNA 2IG7A 1DI9A 3GI3A 4ZJVA 2FSOX 4FR4A 3BRBA 3KGAA 2HY81 4M13A 3KULA 2J0LA 3PP1A 3KXNA 5BV3A 1JSTA 4BDFA 3F5GA 4GJ2A 5HI2A 2UUEA 3EQBA 2FO0A 2QHMA 4U40A 4IAYA 4PL5A 4EQCA 5IKWA 2ITTA 5FP6A 1FGKA 1K3AA 5HG7A 3VQHA 4I93A 4L43A 4M15A 5ANEA 4D5HA 2PMLX 3I6WA 4HVDA 5E1EA 1XJDA 5TR6A 3BU3A 4YMJA 2QR8A 3DB8A 4LL5A 4WG5A 3HX4A 4MK0A 4A9TA 4DEAA 5DH3A 4CRLA 2Z7SA 5HO6A 5HORA 4KIKB 2J0KA 5KE0A 4QPAA 5IH4A