2OJIA

Crystal structure of erk2 in complex with n-benzyl-4-(4-(3-chlorophenyl)-1h-pyrazol-3-yl)-1h-pyrrole-2-carboxamide
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
344
structure length
344
Chain Sequence
RGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 1
publication title Flipped Out: Structure-Guided Design of Selective Pyrazolylpyrrole ERK Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 105
structure length 344
sequence length 344
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2007-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2ojiA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2ojiA01
4JIAA 3ZLXA 1IA8A 4XEYA 2W4JA 5E8ZA 3S2PA 4QMNA 2PWLA 5KHXA 1DI9A 2VTPA 3I1AA 4FGBA 3DB8A 3O2MA 1RDQE 4CGAA 2B54A 2YIWA 3RAKA 3DBFA 2BFYA 4DFLA 4KS7A 3W55A 5M4UA 1Y6BA 2XKDA 1PXOA 3VO3A 2FH9A 5JH6A 3A60A 3WF9A 2VRXA 4FKRA 3M2WA 2O0UA 3KF4A 1H27A 2HZNA 5AV4A 3BLRA 2P33A 5A4QA 3C0GA 3DBEA 2QOHA 3OUKA 2OJGA 4MCVA 4Y5QA 5D9HA 5HX6A 4E5AX 4DE4A 4BCKA 3O71A 3UE4A 4B7TA 3POOA 1KOAA 3MGYA 2VV9A 4TYJA 2XK9A 2C1BA 3TV4A 1RW8A 3I6WA 2OZAA 3G9LX 3NW7A 5F94A 4EHEA 4X3FC 1GZ8A 4IZAA 3ZLWA 5BYZA 3HGKA 2AYPA 3BLQA 3FZRA 4QMVA 5CXHA 1CDKA 1E9HA 2JDRA 3VNTA 1Q8TA 5HEZA 4BDHA 4FT7A 3WZKA 3U6IA 3QGYA 3NWWA 2X9FA 4MQ2A 3CTJA 5D41A 4FZ6A 4GU9A 3ZFMA 2OGVA 4XG2A 4MX9A 3O17A 3O8TA 2GNIA 1ATPE 5TKDA 3KMWA 4O86A 4BRXA 3NIZA 2GQRA 3TNWA 3S1HA 2RFEA 4F64A 2IVSA 5TE0A 4BTJA 1Y8GA 5CSVA 4IMYA 3OXZA 3VUHA 2OZAB 4ZJIA 4FX3A 4BCQA 2EWAA 5JFVA 3FY0A 3GU6A 3TNPC 3LAUA 3RZBA 1PXKA 4AS0A 3IGOA 5CEIA 5HBJA 2LAVA 4KNBA 5I9YA 4CZUA 2G01A 4FNXA 4LQMA 4X6RA 4AOIA 4EQUA 3OS3A 4L44A 1U4DA 3QRUA 4G6OA 3IK3A 4W9WA 3D94A 3SXFA 2QG7A 4TXCA 4CYJA 5JMSA 4IVCA 4M66A 5HO7A 4DITA 3FXZA 3PUPA 5A4LA 4A4OA 4PL3A 4EOJA 4C58A 1OGUA 5DA3A 5FM2A 2WMAA 2ETKA 3R1QA 2GQGA 4JL9A 3BHYA 4XHKB 1FOTA 3PXRA 2YM5A 3AC3A 4RC4A 2BTSA 3KVWA 4C59A 4FV4A 4RJ7A 1GOLA 1ZY4A 3W8LA 5AR4A 2B9HA 1CKJA 4NTTA 4FEVA 4GRBA 4FKTA 4QPSA 5BVEA 3COIA 4N0SA 2X6EA 4I3ZA 5CEPA 3FMHA 3W8QA 3GC9A 3VS7A 2I0YA 1BX6A 5FTGA 3FDNA 4I6QA 5IMEA 5CEKA 5H8GA 2E2BA 2YZAA 1VEBA 2CGWA 5AUWA 5K5XA 2XNBA 1FQ1B 3F61A 4PDYA 2CSNA 3ZSIA 4APPA 2R3LA 2ONLC 2QOCA 2PTKA 4IVAA 4LGHA 4EOSA 1OVEA 4EI4A 3C1XA 2YM6A 3P86A 1WMKA 4MQ1A 5AR5A 4BCNA 1ZOEA 1OIUA 3K2LA 5EK7A 3CY2A 4WO5A 4O2ZA 2IJMA 4UY9A 3QYZA 3ZM9A 3OWPA 3FAAA 5BYLA 2R4BA 5DE2A 4JQ7A 2IVTA 5M09A 1QMZA 2ITUA 2REIA 2JKQA 4O0VA 3FI8A 2XUUA 2QKWB 2FYSA 5ANGA 5LQFA 2FSMX 5LXMA 1UU8A 3JVSA 1Y8YA 3NUPA 4MXZA 5HE1A 4D2PA 2OJJA 4GYGA 3F7WA 2FGIA 4MD9E 4YLKA 2H8HA 5I9WA 3UQCA 2F49A 2JD5A 3GCQA 4QP8A 1Y6AA 2W5BA 3MJ2A 4XCUA 4BN1A 4C7TA 3R7GA 3RGFA 4EH3A 5AP5A 4PV0A 1NT2A 3V6SA 5HTIA 2WO6A 3C4XA 3VBXA 2E9PA 2QO2A 3Q4TA 5TOZA 3C0HA 3IW8A 3PXZA 4UZDA 3LM0A 2VTQA 3TCPA 4C4EA 4BZNA 4F4PA 3KFAA 2XK7A 4FEQA 2Z7LA 3FLSA 4OR5A 3KN5A 4DEHA 4OLIA 2HWPA 3D5XA 2IZSA 3DB6A 2OF2A 3HRBA 4DTKA 1XHAA 4KSPA 4DH1A 3LQ5A 3C4WA 4KRDA 3OY1A 4TYGA 2HW7A 2C5YA 5ANJA 4KIOA 5CALA 3DT1A 5AR7A 3QQGA 3FLYA 4HPUE 4WD5A 4GKHA 3P0MA 2GS2A 1M17A 4FV0A 4IWOA 4NFNA 3ACKA 3PIZA 4DA5A 4WOVA 5CU6A 2XM9A 2X7GA 2C30A 2WMBA 3GC8A 4RX7A 5EHLA 4P5QA 5HTBA 4AAAA 3ZUUA 3ZDIA 3EYGA 1UNGA 3L8XA 2YDJA 3DCVA 3HMNA 4UMTA 1J1BA 2OZOA 4AGWA 5BYYA 5J8IA 3GI3A 1PXIA 3OY3A 1XKKA 4C2WA 3K5UA 4MXCA 3NR9A 1JWHA 2Z7RA 5AX3A 4OGRA 4RVLA 3QQLA 4D1ZA 3MA3A 3QD2B 4G17A 3EQCA 1Q24A 1TQMA 4D0XA 4O82A 2C6OA 5CVHA 3G9NA 5EYKA 4GH2A 4BCHA 3U55A 3FE3A 4HGEA 4GSBA 1H08A 3AC4A 2XNOA 4IAIA 2J6MA 4BWXA 2ZYBA 4IW0A 2UW4A 1XWSA 2AC5A 1WBTA 5J7HA 1IR3A 4MBIA 3E8CA 4TNDA 3BU5A 2O63A 3UGCA 3PZHA 5BVNA 2VGPA 5JZJA 3H9FA 3Q5IA 3SXSA 2PY3A 1OUYA 3RP9A 4QT1A 2WTIA 1H1WA 3RPYA 4ITJA 1Q4LA 4LOOA 4RPVA 5L6PA 2X6DA 4QMYA 3HUCA 4ITIA 3LOKA 2V5QA 4CKJA 5ANOA 5BVDA 3QTQA 1H25A 3A8WA 3JY9A 3FQHA 3QKMA 2CCHA 4FIEA 4FNYA 4K6ZA 5DPVA 4J1RA 4DH8A 2DS1A 1PXNA 1Q3DA 2OU7A 2EVAA 3ID6C 3R0TA 2BCJA 3PSBA 3SA0A 4ALVA 4JLCA 2XP2A 3UC4A 3VJOA 4IIRA 4NIFA 3BHHA 4BKYA 4ASEA 3TIYA 1OKVA 3VAPA 2CNQA 4YZ9A 3C4ZA 4C38A 1B39A 2RGPA 3AQVA 1W84A 3S4QA 2YDIA 5J9LA 4CXAA 3IW7A 3AT3A 1F3MC 4JS8A 4C0TA 3E64A 3I6UA 4BBEA 1FGKA 1WBSA 4M3QA 3ORIA 4X2FA 5DRDA 3BV3A 4FF8A 3O0GA 3CY3A 4NKAA 3RWPA 3PA5A 3TDWA 3OMVA 3PP0A 3LFEA 4RQVA 1M2QA 3KRXA 1QPEA 3QCXA 2CMWA 2BZHB 3LE6A 1I09A 1MQ4A 3QKKA 4N6YA 4XUFA 2PVHA 5IEXA 2JKMA 5C01A 5AX9A 4DGLC 4AGDA 4QYFA 3RNIA 3DY7A 3L9MA 4ZS0A 3KA0A 4NIFB 2B1PA 3BHVA 2W1HA 2GNGA 1OIQA 3WIKA 4AW5A 2RSVA 4CMUA 1FBNA 2Z02A 2Y6MA 2PMLX 2HCKA 2QO7A 2IWIA 3AD6A 1YXTA 3EQDA 5IPJA 5FDPA 4MHAA 1R1WA 5HNGA 3DFAA 4XV3A 4LOQA 4DINA 4GL9A 2BZIB 4ID7A 4QP4A 5JFSA 4A06A 1P5EA 4QMWA 2RKUA 1SNUA 4JT3A 1A9UA 3QUPA 2BPMA 4TTHB 2FVDA 3E7VA 4C35A 1TKIA 5AA8A 3MY0A 4G1WA 2J7TA 4GK2A 4OUCA 3VVHA 2UW7A 1LUFA 2PZYA 1ZAOA 4DFUA 4U40A 3BBWA 4IB1A 2HK5A 2W96B 4O0YA 4MBLA 1M2RA 3FYJX 4OT6A 4QQ5A 5M53A 4FMQA 3PXQA 4DEEA 3C0IA 4F1MA 1W7HA 5HNBA 4BB4A 3BWJA 2P4IA 3MV5A 1FPUA 3F7ZA 4F9WA 3KXNA 3LFNA 5CEMA 3QXOA 3G0EA 4IHPA 4RA5A 4X3FB 4DEGA 1BI7A 4EK4A 2BVAA 5DR2A 1OBGA 4D4YA 2UVZA 2UZLA 3TJCA 2ZV8A 5AUTA 5KBQA 3FXWA 3JR1A 3BQCA 4U42A 1GZKA 4H58A 4S30A 4AN9A 2RFDA 4DCAA 3P4KA 3HUBA 1Q99A 1YHWA 4QYHA 4ZS4A 4ANSA 2OI4X 2YWVA 4WSYA 1WBPA 3VBVA 3OT8A 4EONA 4EOMA 3TTIA 5CSPA 3VN9A 5AP3A 2I0VA 2F9GA 3MFSA 4YTCA 4WG3A 5A3XA 3D15A 2B53A 3U4WA 3UC3A 4UMPA 5FEEA 1H1SA 5E8YA 3DXNA 2NNWB 4FSYA 3HX4A 3UP2A 3PIYA 4A4LA 1TQPA 3ALNA 1BLXA 2VO6A 1AD5A 4YZBA 2JKOA 4DAWA 4FVPA 4BCMA 3SDJA 3RCJA 4QMUA 4AQCA 1KWPA 2EXMA 2RIOA 3EKNA 3MYGA 4IANA 3FMDA 4M67A 5KBRA 2VTMA 4I4EA 4O7TA 3QQJA 5M4IA 3A7FA 3CGOA 4L7SA 5JGAA 2YM4A 3A8XA 5KMIA 3KCFA 4A9TA 3QF9A 5EQEA 2R3HA 3AOXA 3ZYAA 4GV1A 4D2VA 5A4CA 4PWNA 1Y57A 2J0IA 1P2AA 2PMIA 4JRNA 4RC2A 2BAKA 2XKCA 5AJQA 4DHFA 5EHOA 3BYOA 5HG7A 2VWYA 3ZCLA 5DMZA 4YC3A 4ZTMA 3ZC5A 3E63A 4PTCA 5E8VA 2OXDA 4OTDA 1PKGA 2BALA 3G6GA 4FT0A 3KC3A 4KBAA 2YM7A 3SQQA 3PWYA 4QYGA 4FZAB 5EYCA 4ANQA 4E26A 2YABA 3L9LA 5CQWA 3ZTXA 1K2PA 3COHA 3EL8A 2ERZE 5FUTA 2VO3A 4H3QA 4APCA 3G6HA 2IZTA 1ZOGA 5DRBA 4ANLA 2QC6A 5C4KA 2ETRA 2VTIA 2XS0A 2YEXA 3IDBA 3VBWA 3PZEA 5L2WA 3H9OA 5HO6A 4CMOA 2H9VA 2OKRA 2YZLA 3LVPA 4UV0A 2HXLA 1OL2A 4I94A 3REPA 1YXUA 5CVGA 5K4JA 1P4FA 4D1SA 5IMXA 1HOWA 2X0GA 1PY5A 1YHSA 3KCKA 3UO4A 3COMA 1DI8A 3NMUF 3GU8A 4M8TA 2W7XA 4PRJA 5I9ZA 3IW4A 2VX0A 5J5SA 3DLSA 3TUBA 2QD9A 3D7TA 3P08A 3QL8A 3RINA 2EXEA 4CZTA 1JVPP 1PKDA 5C27A 4EUTA 2IPXA 4EH9A 3RK5A 3Q5ZA 4D0WA 3OW3A 4EC9A 2QHNA 2A2AA 1ZYJA 3H10A 4XOYA 3UIXA 1KE9A 1CTPE 3A7GA 5AIKA 2JDSA 4FTOA 5HG5A 3P9JA 3UJGA 1AQ1A 3VUKA 2BRGA 3R00A 3RKBA 4AP7A 4HVSA 4A9YA 4EH8A 3KN6A 4IAFA 4C37A 2R3FA 3EYHA 4QYEA 3OOMA 3K3IA 3PVUA 4YJQA 3ODZX 3QRIA 5FQDC 3SG8A 1U54A 4XG9A 1H28A 4NH1A 4F08A 3HP5A 1QCFA 1MQBA 2DUVA 4L67A 2C47A 3D7TB 1A48A 3ENMA 3HMMA 3DDQA 3P7CA 2JIVA 5CLPA 1FINA 4MH7A 2HAKA 3I7CA 2R3JA 2C6LA 5CENA 4B8LA 4ZY6A 3QTSA 2R0IA 2BIYA 4J99A 5I5ZA 1YOMA 3V51A 3KB7A 3AD5A 4U44A 3F82A 1DAWA 2ITTA 2VAGA 3L8VA 1M7QA 3FWQA 2OF4A 3NEWA 1J1CA 3PE1A 1XBBA 2PK9A 3SD0A 3C4FA 4ERWA 5J1VA 4FTMA 3R9OA 4Y46A 5CF8A 3HV3A 2PULA 4N6ZA 4K9YA 4Z9LA 1CKPA 2Y4IC 2Q0BA 4E6AA 4YTFA 1K9AA 3NRMA 4RJ8A 3V3VA 1U54B 4I1ZA 3DXQA 5FGKA 5C4LA 3OTUA 4IZYA 4LUEA 2JDOA 4LRJA 5KO1A 1GY3A 3IW5A 3EZRA 4OW8A 3R2YA 3QQFA 3PFQA 4ACGA 4J53A 3W2SA 4GYIA 3ZH8A 3MFUA 5CAQA 3NNVA 2YN8A 2VGOA 4LOPA 3RAIA 4RGJA 5HE0A 2PUUA 3UIMA 3HYHA 2VNWA 4NM7A 3NAXA 3CPBA 1G8AA 4FKLA 3LQ3A 5E1EA 3DXPA 5D1JA 4CD0A 2PZRA 5BPYA 3Q6UA 3JUHA 1YWRA 2W1ZA 2WIPA 3R30A 4LGDA 3VS3A 4EK5A 3KULA 4ZAUA 5L8LA 2JITA 3LCDA 5A4EA 3P78A 4LG4A 3TEIA 4ANNA 1YOLA 4O83A 5FP5A 3FXXA 4R5SA 1SVGA 4HW7A 4F6UA 2PE1A 4TNBA 4Y72A 3C4CA 4ZSLA 2QI8A 3EMGA 3EN5A 5GIPE 3KGAA 4FIIA 5H2UA 4ZTSA 4UZHA 4FTQA 2WQBA 3UDBA 3UQFA 4AN2A 3AT2A 4CLIA 4C4GA 4WRGA 3HAMA 4GU6A 4L45A 2EU9A 1UNLA 4RVKA 5AR2A 1YXSA 5M08A 4QPAA 3OCBA 3QAME 3ZFXA 2JAVA 3QU0A 4U3YA 5DHJA 1UU7A 3DDPA 3HDNA 4NT4A 5K3YA 3NX8A 2YWPA 4KA3A 2UZBA 3F9NA 3GENA 4PMPA 3RHKA 1OIYA 3AMBA 4CEGA 4GVAA 3KULB 4ACHA 2J0LA 3MFRA 2XK8A 5LCJA 5EW9A 4F7JA 4MK0A 4L53A 2BUJA 1BI8A 3WARA 2X7OA 5CU0A 3HA6A 3ZRKA 3SXRA 2G2FA 4NW6A 3K5VA 4QMPA 4BYJA 3IW6A 3U6HA 4IM3A 1BYGA 5AP6A 2IZUA 3HZTA 5L6OA 4TPTA 3CQUA 2W99B 5GJFA 4NFMA 3BI6A 4D9TA 2VTHA 2W1CA 2ZDUA 4IQ6A 4UXLA 5G6VA 5AADA 3DK3A 3AMAA 4O2PA 3Q9WA 4ASXA 3MH2A 3WF8A 2YIYA 4U97A 2B0QA 2ZM1A 2NRYA 3OCGA 3PY3A 1NXKA 3GP0A 5AV2A 5BVFA 5M4CA 1WFCA 4FTKA 4G6LA 4X2JA 1NA7A 4QP1A 3I81A 3VS2A 5AP1A 2BR1A 3MBLA 4I21A 5EM5A 2QOFA 4BCPA 5J9YA 3LLTA 4FTCA 3PJCA 1JPAA 2WTCA 3DOGA 5HVJA 3KQ7A 4O91A 4UWBA 4GUBA 5HE2A 3BIZA 3FPQA 2X4FA 4QP7A 3OEZA 5D7AA 2ZDTA 3V5TA 4AU8A 4C02A 4TN6A 4O0WA 4CKIA 3BHTA 3BZ3A 3MVHA 3GT8A 4CYIA 2QLQA 3GOKA 4ITHA 5EG3A 2FA2A 3SG9A 3UOJA 2I0EA 1WCCA 2QR7A 4JBQA 3TI1A 3IG7A 3R73A 2ACXA 4JOAA 2I6LA 4YZNA 5HVKA 3FYKX 5CU3A 4ZTNA 5IDPA 1XJDA 4FE2A 1WBNA 2V55A 4PTEA 5JEBA 5K0XA 3PDTA 3DTCA 4G34A 3BGPA 4NCTC 3T8OA 1RE8A 5M55A 5IU2A 3U9NA 2PYWA 1YXVA 2ZM4A 5EFQA 4USFA 3EWHA 4AE9A 5EM7A 2O5KA 4E5WA 2C6MA 5CVFA 4IVDA 4JX7A 3MDYA 3A7JA 4L8MA 3LXPA 4R3RA 4FICA 4LMUA 3BEGA 2XH5A 1XH8A 4PDSA 2G2HA 3OC1A 2PE0A 2HIWA 3ZBXA 2FSLX 3EH9A 5LOHA 1ZZLA 1YW2A 2XIXA 4RIXA 4FIGA 4RX9A 4X0MA 3H0YA 4Q5EA 3ZS5A 3PRFA 5DG5A 5CF6A 2R0UA 3ZO1A 4FKVA 2ZAZA 2YIXA 1PMNA 1ZMVA 4JDKA 3R63A 5LMAA 4B99A 4F7LA 3KXGA 4R5YA 1JAMA 3O7LD 4QNYA 3AC1A 3BELA 4TWPA 4BHNA 5M44A 2IW6A 3LFBA 4GVJA 2OO8X 2X8EA 4FKGA 2O65A 4FL2A 5D11A 4WRSA 4G9RA 5EKNA 4FIFA 4O7VA 4JX3A 2OFVA 5AWMA 3LQ8A 3D0EA 1YVJA 4EOKA 2QOIA 3RAHA 3BRBA 3ZC6A 5FEQA 4AA4A 4ASDA 4A9UA 5JKGA 4RZWA 3R2BA 2JDTA 4FZ7A 4RIXB 4ORKA 4X2NA 2BRBA 4BFMA 2VZ6A 2R5TA 3I79A 3II5A 3UZPA 3PSDA 2YA9A 5CAOA 5ICPA 1IEPA 5KMOA 4GCJA 4C3RA 5BUIA 3ORKA 2ZMDA 4KAOA 2CPKE 4AA0A 3GCPA 3T9TA 4TRLA 1O6YA 1MP8A 3MS9A 5E9EA 2H6DA 2YACA 4QOXA 4YC6A 4R7BA 3RAWA 3UTOA 1IAJA 4LM5A 4Y85A 1OL1A 2HZIA 2QU5A 3GCSA 5CEQA 3U9CA 3V5PA 2C5VA 2WEIA 3CC6A 4DLIA 5DR9A 3RM6A 4WG5A 4HNIA 2E9UA 4OT5A 4FZDB 4O0SA 4CFFA 3IS5A 4ZJVA 3OHTA 3RJCA 3ZMMA 4IWPA 4YGAA 3F3ZA 3SVVA 4NSTA 5J9ZA 4X7QA 3QALE 3ZO2A 4FODA 4IVBA 2UW6A 4OTRA 4QMSA 5EW8A 3RI1A 4B4LA 2NP8A 5ETFA 3V5WA 2J2IB 1FMOE 2VTJA 3ZZEA 2PVJA 4AX8A 3CE3A 1T45A 4J52A 3EQFA 4QMXA 4C3PA 2JFMA 3RPRA 4EH6A 3B2TA 1JBPE 3LXLA 3I0QA 4IFGA 3BV2A 3QQUA 1Y91A 3SX9A 5GNKA 5J95A 3MJ1A 5BMSA 4AG8A 2JIUA 2GCDA 2CLXA 4PL4A 4AE6A 1KV2A 4W8DA 2PVFA 3VIDA 4E4MA 4I0RA 4ZOGA 3HDMA 3R8UA 3OVVA 4L7FA 3QCYA 3QUDA 3PE2A 4XNEA 3FV8A 4C34A 4RX8A 3OEFX 1EH4A 3AD4A 4JIKA 2HY81 2BDJA 4IM2A 4NZWB 4EHGA 4MXAA 4UYNA 4EH5A 1G3NA 3MH0A 4LI5A 2Y4IB 5K0KA 4BIEA 4KKHA 1CSNA 3HVCA 3ZLYA 4IZ5A 2VO7A 3RK7A 4PPBA 3VUTA 4EOPA 4KD1A 4DT9A 3UMWA 5K5NA 4M14A 2XK6A 3DZQA 5M06A 3FEGA 3N9XA 2NRUA 2R7IA 5FM3A 4CRLA 3FZSA 3MY5A 2PVMA 4K77A 5LMKC 2GHMA 1YI3A 4ZXTA 1NVSA 4YJOA 2YAAA 4DFYA 5IZFA 5I9XA 3E88A 4TYHA 4Q9ZA 2BRMA 3TL8A 2CGXA 4YZCA 2OK1A 2LGCA 3E5AA 3UQGA 2GQSA 3DGKA 3E93A 2VUWA 4CTCA 4HGLA 1J3HA 1ZMWA 3B8QA 4EEVA 4XBRA 5HESA 3KXZA 4L46A 2X81A 4CG9A 2IW9A 2CN5A 3GFWA 3D83A 4N57A 2X39A 4S31A 3CJGA 4CFUA 2OBJA 4E7WA 3QD4A 4DH5A 4XLIA 3G5DA 3T3UA 3ULZA 4BBMA 4F7NA 1PRYA 4NK9A 4WSQA 4J7BA 4L3JA 3F2NA 4PNIA 2J9MA 4IB0A 4YPDA 3KXMA 4GW8A 4ZY5A 3CKWA 2ZV9A 1H1PA 2YCFA 3IECA 2JDVA 3PTGA 4FOCA 3KXXA 4RJ5A 4NUSA 3HL7A 4FEXA 3TZ7A 4TYHB 4J97A 2C0TA 2X8IA 3QRTA 5F1ZA 5GZ8A 1APME 3Q4ZA 1FVRA 5AR8A 1OKZA 2Z7QA 3CXWA 3DK7A 2XRWA 2IN6A 3DFCB 3VS1A 5BVOA 4LFIA 4RJ4A 3ZZWA 4X3JA 3NSZA 4E20A 3D5UA 2XF0A 3O50A 4XH6A 3U4UA 2P2IA 2QOKA 2WTWA 4J96A 3GXLA 3ORNA 4JG8A 4ZTHA 4FSWA 4E3CA 2B9JA 3QXPA 4WNPA 4CCBA 3ZDUA 1PW2A 4IH8A 3MW1A 2BHHA 4YBKA 1UV5A 5LVNA 2Z7SA 2QNJA 3DKCA 4OTFA 2C5NA 4JXFA 4F9AA 3CTHA 2XM8A 2R3RA 4UB7A 3GQIA 3WE4A 1M14A 3KY2A 3BYSA 3F3TA 1Q41A 2QLUA 4BDDA 4MBJA 3JVRA 2W17A 4A07A 2ITXA 3Q6WA 3IDPA 3LFAA 4DFZE 2RFSA 4PDOA 2BRNA 2ITVA 3QTIA 1RJBA 5CT7A 4I22A 2WTKC 1JOWB 2FSTX 2UZEA 2A0CX 3FQEA 3HV6A 3FI4A 2I0HA 4V0GA 5HI2A 5B7VA 3R8MA 5LARA 3GCVA 4MYGA 5CNOA 2G2IA 4P5ZA 3QTXA 2WMTA 4FG9A 3C7QA 3R7YA 3OOGA 1YQJA 3LJ0A 1CKIA 5C9CA 3DJ5A 3MPAA 3O8PA 4P4CA 4BDAA 3WZJA 1YRPA 4RFYA 5BUJA 3E3BX 4MF0A 4H1JA 1BL6A 3DBDA 4NCTA 5F20A 4BBFA 4C8BA 2VWIA 2VWWA 1OBDA 2R3KA 2W5AA 1LP4A 2Y8OA 3BYUA 3MIAA 4G16A 2XKFA 4YNOA 4C33A 5IEVA 2QU6A 4EJ7A 3RMFA 4O7WA 1GIHA 2VWBA 2Z2WA 4O0RA 4ALWA 1YDRE 4CFNA 4NL0A 1REKA 4YLJA 4I0SA 1MUOA 4YLLA 1W82A 4XG6A 4OTPA 1S9JA 1PMUA 3PG3A 2JIIA 4IX4A 4V0GB 4W4YA 4XS2A 3VF9A 2HXQA 1VYZA 2V0DA 1GIJA 5FTQA 5LCKA 4QPMA 3RM7A 3Q4CA 2VD5A 4Z7HA 1ZYSA 3PVBA 3FC2A 3LFQA 5EYDA 3QGWA 4OTGA 1H01A 4U5JA 1SMHA 1JLUE 2WMXA 2XK3A 5CYIA 4CFVA 4CV9A 1IAHA 3NUXA 2ZB1A 4RWLA 2W1IA 1DS5A 4TW9A 4JI9A 5BMMA 2C5OA 4E93A 1X8BA 5EI2A 3FSFA 2R3GA 5IISA 5AIRA 4BI0A 2XMYA 4DFNA 4EWQA 5DFPA 3VUIA 4Y73A 4BCOA 4Z3VA 4FV5A 4H3BA 2V7AA 2UUEA 3PXYA 1LEWA 4F63A 2VX1A 3IDCA 1DM2A 4PTGA 4DEIA 4D1XA 4G5JA 3A99A 2C1AA 3AMYA 3OTVA 1NW1A 2GNLA 1H4LA 1P14A 2JBOA 3ELJA 2OJIA 4YSJA 1YDTE 1F0QA 4DEAA 4FV6A 3CTQA 4ZSAA 4I6HA 2X8DA 4R77A 5AUXA 1I44A 3QX2A 1U46A 5ANKA 3ZUVA 4DEDA 3D2IA 5DBXA 3HMPA 3JXWA 4PL5A 5DEYA 3NUNA 4I5MA 3WYYA 3D14A 4BDJA 4CFWA 4DYMA 1V1KA 3H0ZA 3KF7A 5FDXA 4AF3A 4I93A 4JAIA 3ZO4A 2O8YA 3F66A 5DR6A 4BKZA 2P55A 3Q96A 3F3VA 4EQMA 4X3FA 5IG1A 3S0OA 1OI9A 1ZWSA 3VBQA 5CANA 3A61A 3KRWA 4M15A 2C6IA 1ZARA 2W9FB 3CEKA 3FJQE 4GG7A 4JG7A 1B6CB 4YJPA 3PJ3A 4KRCA 3EKKA 4KABA 3ZM4A 4ZJJA 4XG7A 2F57A 3EB0A 4CKRA 1GNGA 4CFMA 2WQEA 5F4NA 4WA9A 2QKRA 3TNIA 4C4JA 5I9UA 4MXYA 2WB8A 3P79A 2CLQA 3KKVA 4V05A 3TTJA 3RVGA 3UPXA 4BDKA 4FV1A 2H34A 3EN6A 4JBVA 3FSKA 2VTSA 5EDRA 4FV3A 3F3UA 2QCSA 3I60A 2AUHA 3PA4A 4C57A 4XBUA 1KOBA 5IUIA 2ZM3A 5FXRA 4D2TA 3HKOA 2XJ1A 2XNEA 3R7EA 5DWRA 4PMMA 5IH4A 4HCUA 1J7UA 4BWKA 4MNFA 3SV0A 2AC3A 3TACA 4TWCA 1YWNA 3PJ8A 1E1VA 2C68A 3M1SA 1VZOA 2GNHA 3VJNA 3SLSA 4FTLA 3LJ2A 5AM7A 2GU8A 2PZPA 4MVFA 3EQPA 2X7FA 4EKKA 3FMLA 4GIIA 4BL1A 2Q83A 2VTNA 1XH6A 3NPCA 4FVQA 4Z7GA 2CNVA 3MY1A 3HV4A 5BUEA 3O96A 5CSWA 4W9XA 4O7LA 2F2UA 4RVMA 5EM8A 3UYSA 2GNFA 3OD6X 1UWJA 4UALA 4EOQA 3FZ1A 3QWJA 1ZOHA 4AZEA 2QO9A 3VS4A 5DH3A 1OITA 4QMLA 3DV3A 3OBJA 4UWCA 2V62A 4O6LA 3C9WA 4IDVA 5HCYA 5EHYA 4JDHA 4NYEA 3ZOSA 2F2CB 2UW5A 5E92A 1KV1A 4PDPA 4F65A 3R21A 4RA4A 5C1QB 4WKQA 4BZOA 4R6VA 2YCSA 3Q52A 3H9RA 5L8KA 2ONLA 3GU4A 1NY3A 1Q8ZA 3LCSA 3DAEA 3ET7A 2VTAA 4S33A 3UNKA 4EC8A 1VR2A 3QTZA 4IC8A 1IASA 3SHEA 3HV7A 5JFXA 2PSQA 2RFNA 2XVDA 4ZSJA 4U3ZA 4F1OA 3QYWA 3ZLSA 4ZTLA 4ZY4A 4FTUA 4F6WA 5DEWA 3B8RA 5FLFA 3H3CA 5AAEA 3VBYA 2WMRA 2ITYA 4MD7E 4KSQA 2NO3A 1FGIA 5HX8A 1O9UA 3EQHA 3R04A 5A6OA 3P1AA 3Q4UA 2X2LA 3CJFA 3QHWA 4RT7A 4YJVA 4DCEA 4YURA 2XBAA 5L2QA 4F0IA 3NW5A 4J8NA 2J0MB 4BTKA 3QFVA 4PF4A 1M52A 4CFXA 5KKRC 2VTOA 4FV8A 3VHEA 3VS5A 4BKJA 3MB6A 2C6EA 5HD7A 3NVMB 3VS6A 5HE3A 4L6QA 4D2RA 4GK4A 4E6DA 3EFJA 2W05A 3SOCA 1DAYA 1R78A 3WF7A 5FP6A 2WELA 3EFLA 4F09A 3R9HA 2XIRA 4HJOA 4J98A 4X2GA 3R8PA 4DG2E 2XNNA 4QTCA 2QQ7A 4XG8A 3V5JA 5IDNA 4FVRA 4XG3A 1HCKA 3D4QA 3MESA 2BZKB 2HW6A 2WOTA 2YLFA 4CG8A 2RL5A 3VF8A 4ASZA 2OW3A 5CY3A 4HPTE 1NVQA 2QOOA 3OP5A 2PPQA 3QUEA 4J71A 5JFWA 3OXIA 2IG7A 1O6KA 3QZGA 3TUDA 2BROA 4FG8A 4LYNA 4GIHA 3Q32A 4YJTA 3FZOA 4QD6A 4GKIA 3TXOA 4EJNA 4AFEA 3VRYA 4XJ0A 3NZ0A 3LKMA 3UNJA 4K2RA 5CZHA 5CU2A 3NIEA 4FK6A 5CNNA 3SRVA 3HMIA 3D9VA 4IWDA 4O27B 4RWKA 4QRCA 3F88A 4IZ7A 5IKWA 3ZONA 4NW5A 5A14A 3QZIA 4V04A 5HQ0A 2WKMA 2VX3A 4Z55A 2X2KA 1MRYA 3BYMA 1JQHA 4JRVA 4EZ3A 4YTIA 2HZ0A 3I7BA 2R3MA 3GU7A 3VBTA 4ZMFA 3DAJA 2CKEA 2G1TA 2HELA 2J0JA 3PWDA 3EL7A 1YXXA 3CR0A 3F5PA 3KK9A 4RIOA 3SOAA 3T3VA 4X21A 3TV7A 5I9VA 4ZMEA 3BPRA 1H00A 1PXMA 3LHJA 4E5BA 1R0EA 3G90X 4OTWA 4E4NA 4HVHA 2WTJA 4BWPA 3DK6A 5ANEA 5HG8A 1SVHA 3FMMA 4PUZA 3UO6A 2WTKB 1YHVA 3RBWA 3L1SA 3UZTA 5A6NA 4FSMA 3VHKA 4DBNA 4IJ9A 2W5HA 3SRVB 4UBAA 1M7NA 5CAUA 2X4ZA 1Q8YA 3R9NA 3F2AA 3MI9A 4RIYA 4FT5A 4O0TA 4XP2A 3ZHPC 3M42A 2WMSA 4WHZA 2CHLA 3NYNA 5I3OA 4TYEA 4KINA 4IE9A 4YC8A 4FBXA 3UYTA 4AA5A 3UMXA 4AOTA 4G31A 5E1SA 3VUGA 4EH7A 2CJMA 4DGOA 3G2FA 3WZUA 3Q2JA 1TVOA 2KTYA 2XCHA 5HD4A 5FRIA 4U79A 5ETCA 4RMZA 2JGZA 3VS0A 1W83A 4MWHA 4DBXA 3CP9A 3DKFA 5HU3A 4YJRA 1XBCA 4NTSA 3O7LB 3NGAA 4XV1A 4CQEA 5J79A 5EQPA 5LWMA 3NUYA 2OICA 4JBOA 1OB3A 4AZFA 3KEXA 3BEAA 2Y7JA 3QZFA 4IADA 2OLCA 5HLPA 2WMQA 2WIHA 4M69A 4RIYB 1REJA 3VW6A 4AT3A 2YLEA 5DVRA 4EZ5A 4HYHA 3FLZA 3WOWA 5LVLA 2BAQA 4FIHA 3UOKA 2IW8A 4B6LA 4NM0A 4O7SA 4GG5A 2HZ4A 4U9AA 2IVUA 4IBMA 1BL7A 4QMTA 3FMEA 4AXAA 1V0BA 3NYXA 4JJRA 3U54A 5HIDA 3BE2A 4LRKA 3P23A 3ORPA 5DT4A 2W1FA 5IUGA 4FEWA 3KL8A 1KUTA 4M7IA 4PP9A 2VWUA 3WIGA 1XH9A 5E4HA 1YOJA 3TV6A 1W8CA 2DYLA 3R8ZA 3WILA 4FR4A 3C5IA 3E62A 4DFBA 1ZRZA 4F9CA 3W33A 4M69B 3FUPA 5FWKK 2C6DA 4IEBA 5IH5A 5CS6A 4D5KA 2PL0A 5CI7A 5IQAA 4MXOA 3WF6A 1JSUA 3PXFA 3E8NA 1PMVA 3N4TA 1UNHA 3NS9A 3Q53A 3CS9A 4M0ZA 1S9IA 2GS7A 2VN9A 4QYYA 5HZNA 4E1ZA 3ORMA 1SZMA 3UG2A 4R7HA 2GPHA 3QBNA 4Q2AA 1P4OA 5BVWA 4DF3A 4E73A 4RWJA 1KSWA 3UP7A 2OFUA 5JQ8A 3GU5A 3PY0A 2QOLA 4GFOA 3U87A 4BY9E 5E8UA 2YHVA 3F69A 5H8BA 3Q9YA 3QCSA 3ZU7A 4E4LA 1OPJA 3ORXA 3IONA 4O6EA 5J1WA 3PXKA 1ERKA 5AP7A 4YPSA 4TWOA 3IOKA 1YI4A 2XNGA 5HICA 2W1EA 5HO8A 4HYSA 3DBCA 3DJ6A 2XYNA 4M68A 5AUZA 3ZSGA 4EK3A 1SNXA 2JFLA 5AFVA 5GZ9A 1BUHA 3LFDA 2CKQA 4CVAA 2DWBA 3AC2A 4PQNA 1NVRA 3MVJA 2UZTA 4R8QA 4I23A 5IQGA 1PXJA 2IO6A 4EOLA 3KMUA 4YO4A 4IDTA 4UYAA 4RLKA 3BYVA 3KMMA 4FSQA 2BDWA 4ZLOA 4BCFA 3ATTA 1IA9A 4ZSGA 4W4WA 2UZUE 4PMSA 1G5SA 1ZZ2A 3BX5A 4QQJA 5AP4A 4DFXE 4GK3A 4HVDA 2BIKB 4AGCA 2X9EA 1KE7A 3D7ZA 2O3PA 3FLWA 4FKQA 2YAKA 3ENHA 5GZAA 4WNOA 5EQYA 3Q60A 2H96A 3DLZA 5FXQA 4JVGA 3WYXA 4LL5A 4B8MA 3HMOA 1PMEA 3G33A 4FUXA 4L00A 4EUUA 4H36A 4U7ZA 2GTMA 2UZVA 5DNRA 4BGGA 2C6KA 2OJ9A 1B38A 4C61A 3NCZA 3TZ8A 4ANBA 3L9PA 3NNUA 3P7AA 3E8EA 4ZTRA 2UW8A 3C51A 4C2VA 2WGJA 3LLAA 2R9SA 2XNPA 4FKPA 3POZA 1GZNA 3A62A 4I4FA 4WUNA 4HCTA 1LR4A 1OKWA 4AZTA 2BTRA 4GJ3A 1ZYCA 4S2ZA 4WG4A 5LMBA 4ACCA 2XIZA 3FMKA 3MWUA 5EI8A 4EK6A 4AZWA 2YM3A 5C8KA 2SRCA 4IAKA 4K33A 5F9EA 1FVTA 3PSCA 3CBLA 4FT3A 2UZDA 2OSCA 1PXLA 1UU9A 2WEVA 4USDA 4UMQA 1SM2A 1H24A 3QZHA 3MN3A 3ZBFA 4E6CA 4AGUA 4YTHA 4O84A 3TDVA 3Q3BA 1H8FA 4F70A 2R3NA 4ONAA 2YIRA 5M56A 5IEYA 3R9RA 3EN7A 2YCRA 3LCOA 1Q3WA 4BHZA 4MNEB 4A9RA 3WBLA 3RPOA 3HV5A 4DN5A 5A46A 4HZSA 3R8LA 3PPKA 3BQRA 4OAUC 3EN4A 3KU2A 2ZV7A 3LW0A 3NLBA 4GT4A 5HKMA 3COKA 3TKIA 4TT7A 5KKRB 3R28A 3MVMA 4ALUA 4CNHA 2J50A 4JDJA 5CAVA 1UKIA 4JNWA 4A9SA 2GDOA 4QNAA 4CMTA 3QA0A 3O8UA 4KBKA 2X1NA 5JT2A 4I0TA 3SGCA 4R7IA 3MB7A 4DLJA 4MTAA 4FL3A 4A7CA 1ND4A 1ZYDA 2YCQA 3KRJA 2R3PA 3NVKI 3RHXA 2PMNX 3QQKA 5GINE 2C3KA 3H4JA 4YZDA 4BC6A 1OKYA 4F9YA 3TIZA 4LV8A 4O0XA 1JSTA 2E9OA 5A9UA 3DNDA 4D2SA 4O7ZA 4EBWA 2FO0A 5TT7A 5L3AA 4FV2A 4RLLA 2A27A 5K4IA 1VYWA 4FYNA 4L3LA 2OIBA 4U8ZA 5D7VA 3F6XA 5L8JA 3ZFYA 4C36A 5I4NA 5M57A 2PVNA 3FHRA 4OTHA 4TY1A 4KUJA 3R1SA 4KIQA 4O96A 1YWVA 5BX0A 4QTDA 4O22A 5KHWA 4XRJA 3GFEA 4XRLA 3TT0A 2XIKA 1QL6A 4CCUA 2C3IB 2B9IA 4RFMA 4D9UA 4QMQA 2BDFA 3V8TA 3ZRLA 4U0IA 1Z5MA 2QOQA 3BE9A 3EQBA 3R7VA 3VRZA 2Y0AA 4U81A 4I5PA 2I7QA 3ZXZA 1UU3A 5BVKA 5LVOA 3ORZA 3EQIA 2PMOX 3RZFA 4MXXA 5I3RA 4ACDA 1KE8A 3LJ1A 4M12A 2PHKA 4FKSA 2X2MA 4RC3A 5EW3A 4MKCA 5ACKA 4KIPA 4BI1A 4XP0A 3GC7A 4EHZA 3EZVA 1T46A 3K54A 4AACA 2G15A 2WQMA 1GJOA 3PA3A 3ANRA 4WUAA 2GTNA 3BU6A 4IAAA 3R9DA 2BZJA 1UWHA 2ITOA 3UOHA 4YP8A 4IJPA 4UXQA 5HVYA 2E9VA 3C5UA 2F7XE 2QG5A 4FTIA 2PU8A 2XA4A 5EM6A 5AUVA 4EK8A 2W4OA 2XK4A 5H8EA 1BKXA 4S32A 2PVRA 5LWNA 2B55A 5JN2A 4DH3A 4MAOA 4F7SA 3V04A 4QO9A 4O1PA 4FIJA 4U41A 3DS6A 4P90A 3QTWA 2WTDA 4DTBA 2XB7A 4EQCA 5C03A 4GUEA 1XQZA 1Q97A 2WMWA 1RQQA 4FKWA 5GIOE 4G2FA 5LJJA 4E6QA 3HAVA 4F9BA 3FL5A 3HLLA 3LXKA 4XG4A 2WHBA 3C13A 4K18A 5IQCA 1YI6A 3TZ9A 4MD8E 3LM5A 2UW3A 3EN9A 4EWHA 2BHEA 4I5HA 4BDGA 4KKEA 2JKKA 3SW4A 4ACMA 4K8AA 2XYUA 3T9IA 1MRUA 1OECA 3UG1A 1XH7A 1OZ1A 2R7BA 3ANQA 3OUNB 4AZSA 5HCZA 1PF8A 3KK8A 5T3QA 5CEOA 3UIUA 4YZMA 3F5UA 4AW0A 4FKIA 2Q0NA 3PJ1A 4MWIA 3BLHA 3ATSA 3I5ZA 4W4VA 4LRMA 3DAKA 3QLGA 5H3QA 2FB8A 4OAVB 3S3IA 2B9FA 3OG7A 3MIYA 2WFYA 4UMRA 4FOBA 4H39A 4L52A 3MH3A 4F1TA 3GEQA 3OCSA 3E7OA 4F99A 5JK3A 4GJ2A 2W1GA 3LCTA 5KZIA 4YBJA 2UZOA 2GFSA 3VULA 1OIRA 4ENXA 2ITZA 5EKOA 3GB2A 4HGSA 4EZ7A 3EQRA 4L3PA 2WXVA 4RBLA 3SAYA 4USEA 3OF0A 1YKRA 2HY0A 4QQTA 3MPMA 4CT1A 3ZEWA 3WZDA 4N70A 5JQ5A 3QX4A 3UO5A 3V5QA 3OFMA 4PNKA 3AC8A 4H3PA 1GZOA 2OIDA 3AGMA 5E7RA 5C26A 5KCVA 5CWZA 3LFCA 1ZYLA 2RG5A 2WOUA 5JGDA 2P0CA 5L2TA 5AAGA 4YR8A 4U6RA 2YISA 4ZZMA 5IUHA 1W0XC 1WAKA 3UBDA 3BCEA 3AGLA 3M11A 1JKKA 3A2CA 2R64A 1URWA 3FLNC 4PMTA 5GJGA 3ROYA 5LVMA 5IA5A 4C62A 1J7IA 3IQ7A 4D28A 3I5NA 5DYJA 5KMMA 1H1RA 5JGBA 4IX6A 5G1XA 3SKCA 4IX3A 3S00A 3OW4A 4FYOA 4RG0A 4NM3A 3ORTA 4R1VA 2C4GA 2QONA 4LGGA 5IA0A 3ODYX 4D55A 4BF2A 4K11A 5KMKA 2XBJA 4FTRA 2C3JA 2C5XA 4FA2A 4K0YA 4BCIA 4A4XA 5L4QA 4IAYA 3K3JA 3QTUA 5BNJA 3TJDA 5ITAA 1ZY5A 2W1DA 3EQGA 5C8MA 1ZMUA 2W06A 3D5VA 4I6FA 4IC7A 5EOBA 4BCJA 5HIEA 3DZOA 4ZK5A 5I0BA 4ERKA 1L3RE 2PZIA 2OH0E 2Z60A 3DJ7A 4XV9A 2ITNA 2ITPA 2XJ0A 3F5XA 3R02A 4ZLZA 3TKUA 4FK3A 2WD1A 2VWZA 3NDMA 5A54A 3NAYA 2YJRA 3OXTA 3IGGA 5AUUA 5IQHA 5ETAA 4EOOA 4NJDA 4FGRA 2VNYA 5E8SA 5ETIA 1Z9XA 5HHWA 4O7NA 5B2KA 3CIKA 1Q61A 3V8WA 4BGQA 2VTRA 5HU9A 3LFFA 4IXPA 1CMKE 3R1YA 3QRKA 3QCQA 4GT3A 5BQ0A 3PPJA 5HG9A 3DQWA 3W32A 2C3LA 2OJFE 3PPZA 4I24A 3QRJA 4Q9SA 4RIWA 3UODA 4H05A 4BDFA 1OMWA 4FSTA 4IAZA 1QPCA 3EJ1A 4LUDA 3Q2MA 5CQUA 2B4SB 1CM8A 3R8VA 4BTMA 1KE5A 4FTNA 1OL5A 2QR8A 3BHUA 4FG7A 4FTTA 2J51A 3NNXA 4GFGA 4G6NA 4GFMA 2XZSA 1G8SA 4DG3E 2JEDA 2PUPA 1WVXA 4G3FA 4AN3A 1OM1A 2A19B 2C0OA 4FKJA 4MF1A 4BGHA 3BBTB 2OH4A 3FZPA 4IACA 4ANMA 4DGNA 2Y6OA 4LV5A 1JKTA 5CX9A 3CD3A 1E1XA 4NEUA 4EYJA 3LZBA 4WNMA 4O0UA 2J0KA 4UEUA 5IQEA 1KE6A 3IKAA 2EB3A 3MTLA 1M2PA 4HCVA 4QMOA 2CKPA 5FG8A 1R39A 4CQGA 3WI6A 5AMNA 4ANOA 4RIWB 3I0OA 4BDIA 5CF5A 3V6RA 1Z57A 4CRSA 2ESMA 2R3IA 1LPUA 4P7EA 2R2PA 1Q8UA 1WBVA 1GIIA 5KE0A 5E8TA 4GMYA 4B0GA 4RVTA 4YJUA 4FV7A 3PRIA 5IQIA 4G9CA 5HLWA 5DI1A 3QTRA 4BTFA 4U45A 4YO6A 3KREA 5IQBA 3KRRA 5CU4A 5CZIA 1XH5A 3FL4A 4BIDA 5M4FA 2XNMA 4AT4A 3EIDA 3DKOA 4G3GA 2CGUA 3KXHA 4BDBA 3U6JA 4LMNA 4JG6A 4MEDA 5HCXA 3HECA 5IA1A 2CKOA 3VC4A 4EL9A 2BAJA 3CQEA 2WZJA 5H9BA 4ZZOA 3WZEA 4JR7A 2FUMA 4FNZA 4CZYB 2ZB0A 4R1YA 3JS2A 4C3FA 4X2KA 4FKUA 4S34A 4FUYA 2PVYA 1U5QA 3DBQA 2OXYA 2UVYA 3HP2A 3RPVA 4YNEA 4HVGA 3S95A 5HIBA 2XEZA 4Y8DA 5M07A 4D2WA 4HGTA 3OBGA 3OCTA 2JC6A 5E91A 2A1AB 5CF4A 3UPZA 5B0XA 5KMLA 1STCE 3FPMA 4H1MA 4RJ3A 4KB8A 5AR3A 5B2MA 4O38A 4BCGA 5CI6A 1UVRA 5J87A 2XIYA 4JR3A 5A4TA 3CSVA 3DQXA 4C4IA 4RFZA 2CCIA 1XR1A 4IWQA 5FTOA 3CCNA 2BKKA 3TM0A 3AC5A 3G0FA 3JPVA 5AEPA 2WQNA 4FSZA 2QURA 3R71A 3GQLA 1R0PA 3OT3A 3RCDA 3ZSHA 3PG1A 1U5RA 2GFCA 4JQ8A 3W2PA 4E4XA 3B2WA 3IOPA 2JAMA 2BKZA 1OUKA 5EI6A 5LMKA 2XRUA 2OXXA 4J8MA 2RF9A 3Q04A 2VWXA 2WU6A 4KS8A 3FBVA 3MFTA 3QQHA 4FSRA 3G51A 4U43A 3QC4A 3UVQA 4HVIA 3C50A 3GVUA 2UVXA 3GGFA 3NW6A 4FEUA 4ARKA 1U59A 3VUDA 4E8AA 2BFXA 2PE2A 3PYYA 3ITZA 3KVXA 5IH6A 3HNGA 3RPSA 3FI3A 1FMKA 4PPCA 2W0JA 4QMMA 4TWNA 4UWYA 4XP3A 4XYFA 3ERKA 2C6TA 3OROA 4QTEA 5TR6A 3FQSA 4O1OA 5ANDA 5M51A 4NM5A 1Q62A 2YFXA 5AUYA 2Y4PA 4JAJA 4TL0A 3ETAA 2PUIA 4WBBB 3FKLA 2ZV2A 3P7BA 5CSXA 4R78A 5FXSA 2A4LA 3IPHA 3QKLA 5KZ0A 1H1QA 4AOJA 3QC9A 5DIAA 2IZRA 3AG9A 3CD8A 5JRSA 4RX5A 3CKXA 4F6SA 5AM6A 5EYMA 5K9IA 3QWKA 4RWIA 4M97A 4W4XA 2YM8A 3CGFA 4FSNA 2CGVA 5EH0A 4KWPA 3WF5A 2UW9A 2VTTA 3QD3A 4R3PA 5D12A 4BZDA 4D4SA 1JKLA 2W4KA 3CPCA 3C4EA 4XX9A 4NU1A 3W2QA 3LFSA 5B2LA 4BIBA 5HTCA 3ZO3A 1ZXEA 3TZMA 3EHAA 3L8PA 1AGWA 1QPJA 3V01A 5IQFA 3PY1A 2XCKA 5HNIX 3ZRMA 5L2IA 1JSVA 4YMJA 4OTQA 2R3QA 4QMZA 4QP6A 3OWLA 1L8TA 2IVVA 3F2RA 1JNKA 4YHFA 3THBA 4U80A 2WAJA 5CASA 3E3PA 2BMCA 2GHGA 4RSSA 2B52A 3PJ2A 3O51A 3PVGA 3R1NA 4OBOA 5D10A 4YU2A 4FTAA 4XMOA 5AP0A 3W18A 4EORA 2ITWA 3GCUA 4IFCA 4FTJA 5DN3A 5AAFA 5T68A 3R22A 2XEYA 1H26A 2XJ2A 3RTPA 3L9NA 4ZEGA 2J5EA 2WMVA 4O21A 3ZUTA 4O81A 4V01A 3V8SA 5AV3A 5L6WL 2F7ZE 1MRVA 2HENA 2PVKA 5CSHA 4FC0A 4M0YA 4P2KA 3N4VA 2GS6A 2HOGA 3E92A 1PHKA 3MVLA 1WZYA 4I20A 4KIKA 3ULIA 5CAPA 1BMKA 4RJ6A 3NUUA 3HRCA 3R7OA 2CNUA 1URCA 4G3DA 3LCKA 3N51A 2J5FA 3R83A 1WBOA 2VO0A 3IO7A 4O7YA 4LL0A 2XKEA 4ZP5A 2ERKA 5KX8A 5AA9A 1H0VA 1OPLA 2BRHA 4CTBA 2EB2A 2P3GX 4IB5A 5EDQA 3VW8A 5CXZA 4YHTA 4BVUA 4C4FA 4QP3A 3EFKA 4QTBA 4F0GA 1XO2B 4YHJA 2ZOQA 4G3CA 4YUQA 3GOPA 4FT9A 4QTAA 4TZRA 3W10A 4AUAA 4II5A 3QD0A 3FKNA 2RG6A 3QA8A 4D58A 2O2UA 3MA6A 1SVEA 3NYOA 5IF1A 2ZMCA 3DU8A 4FNWA 3NUSA 3EOCA 3SW7A 1H07A 3MPTA 3FMJA 2YITA 4IB3A 4KIKB 4FSUA 5J7BA 3H30A 4I92A 4N4SA 1W98A 3JYAA 3UNZA 4HZRA 5T6KA 1OPKA 3FI2A 4PPAA 4KBCA 3A4OX 2PVLA 3BWFA 4FL1A 5IA2A 2WU7A 5KNJA 5IQDA 3WE8A 3ORLA 3PVWA 2PUNA 3JY0A 3R7IA 4FV9A 3OZ6A 5ANIA 2BILB 3FHIA 3TN8A 4Y83A 3HRFA 5GJDA 3MH1A 3ACJA 2V7OA 3HEGA 4UMUA 1OL6A 3O23A 3TUCA 5HBEA 1UKHA 3HA8A 5DGZA 3LPBA 4ZLYA 1LEZA 3BGZA 4QP2A 4W8EA 4CSVA 4NKSA 5FBNC 4CLJA 4RQKA 5JSMA 4Y5HA 2YDKA 3GNIB 3DPKA 2QOBA 4IM0A 3LMGA 3TWJA 3UVRA 4OBPA 2G9XA 2I40A 2PZ5A 4XV2A 5CT0A 5DLSA 5GHVA 3SC1A 4FZFB 2F7EE 1V0PA 3DNEA 3E87A 3G15A 3LMHA 5KMJA 1Q5KA 4J95A 2UZWE 2YIQA 3D2KA 4G3EA 4G5PA 2UV2A 4RRVA 4UX9A 2JLDA 3MTFA 2I1MA 2F4JA 5FEDA 1WVWA 3LMIA 5DT0A 3BGQA 3NCGA 4ZZNA 3GC0A 4AW1A 4DT8A 4DTAA 1PYEA 3VWAA 4PP7A 4EKLA 2WNTA 3Q9ZA 2KULA 3MSSA 3A7IA 2OWBA 3AXWA 3NYVA 1H0WA 4I5CA 4NWMA 5AP2A 1SYKA 5AV1A 3FKOA 4EBVA 3FC1X 4EHVA 4YSMA 5KMNA 3F3WA 4FI1A 4QQCA 4I6BA 3R01A 4HNFA 5E8WA 3I4BA 3PP1A 3BKBA 4M13A 4WIHA 1F5QA 4DGGA 4DGMA 5L2SA 4B9DA 3OWJA 4ENYA 1ZLTA 5JZNA 4TYIA 2DQ7X 2W9ZB 2WMUA 3GBZA 4YJNA 2GHLA 5HLNA 3LIJA 3W16A 4BICA 4Z16A 2JBPA 2VWVA 4PY1A 4EOIA 1XH4A 1PYXA 3CQWA 3OWKA 4EH4A 1YDSE 5HORA 5J5TA 2ZVAA 5IA4A 3ZEPA 4M84A 2VTLA 5FBOA 2Y9QA 4DG0E 3UIBA 5HBHA 4JQEA 4HOKA 1K3AA 2VU3A 3V5LA 5JRQA 5ACBC 5CTPA 1PXPA 3NNWA 2C0IA 3R7UA 1J91A 3VQUA 2V22A 4DEBA 4BDEA 3ZXTA 4Y95A 1VJYA 4CT2A 4UN0C 5EDPA 4XOZA 3ROCA 4DH7A 3FMNA 4RZVA 2HWOA 4BR3A 3W2RA 4DC2A 4JBPA 4WT6A 2EXCX 3U51A 4L68A 5FD2A 4PX6A 1QPDA 2OG8A 4D4VA 3F5GA 1IRKA 3PIXA 4FKOA 1R3CA 4AW2A 4AFJA 3R6XA 4XLVA 2WQOA 2CN8A 3AT4A 4OTIA 4R3CA 3W2CA 3EFWA 2YJSA 4HYUA 4X6QC 4EH2A 2E9NA 1OL7A 3W1FA 4KKGA 2WPAA 3A4PA 4QP9A 3VQHA 3N4UA 4GEOA 2FSOX 1WBWA 5F95A 2QHMA 2ZJWA 4F0FA 4WNKA 3RNYA 2C69A 2R3OA 3ALOA 4IX5A 5KUPA 2EUFB 3UOLA 5HGIA 2GNJA 3UVPA 4TKSA 2GSFA 3W2OA 2Z8CA 3FZTA 4WBOA 5TO8A 4BYIA 4BI2A 4JDIA 3DTWA 4ZTQA 1PJKA 3FY2A 5E90A 1J7LA 4I41A 4K1BA 3TNHA 4BDCA 3TNQB 4L01A 2ITQA 4CV8A 5LVPA 5IA3A 4L42A 1O6LA 3CLYA 4MNEA 5EOLA 4D4RA 4ZIMA 4NJ3A 2J4ZA 4GS6A 5TF9A 4EYMA 2OIQA 4O7RA 3PLSA 2NPQA 1A06A 2B7AA 4HYIA 4AZVA 2UW0A 3RWQA 2YERA 4GT5A 1XBAA 1HCLA 3L8SA 2HYYA 2WTVA 3DA6A 3U8WA 3FLQA 2P2HA 1TQIA 5DT3A 2CDZA 3Q9XA 4Q5HA 2O64A 3VUMA 3KRLA 1JKSA 3TKHA 2QODA 2ETMA 3E8DA 4L9IA 1GAGA 4C4HA 3DKGA 3LXNA 4AT5A 3NUAA 2QVSE 4OBQA 5E8XA 3GUBA 1IG1A 1UA2A 4L43A 3PLAE 3RK9A 2UZNA 3BU3A 3QHRA 2GMXA 3D5WA 4YJSA 3RALA 4D5HA 4AWIA 1FVVA 3A7HA 5AV0A 3QLFA 4ZSEA 1Q8WA 3TG1A 5C8NA 1WVYA 5DOSA 2J90A 3UZRA 5HOAA 3P5KA 1V0OA
chains in the Genus database with same CATH superfamily
4JIAA 3ZLXA 1IA8A 4XEYA 2W4JA 5E8ZA 3S2PA 4QMNA 2PWLA 5KHXA 1DI9A 2VTPA 3I1AA 4FGBA 3DB8A 3O2MA 1RDQE 4CGAA 2B54A 2YIWA 3RAKA 3DBFA 2BFYA 4DFLA 4KS7A 3W55A 5M4UA 1Y6BA 2XKDA 1PXOA 3VO3A 2FH9A 5JH6A 3A60A 3WF9A 2VRXA 4MUQA 4FKRA 4AAYA 3M2WA 2O0UA 3KF4A 1H27A 2HZNA 5AV4A 3BLRA 2P33A 5A4QA 3C0GA 3DBEA 2QOHA 3OUKA 2OJGA 4MCVA 4Y5QA 5D9HA 5HX6A 4E5AX 4DE4A 4BCKA 3O71A 3UE4A 4B7TA 3POOA 3BLAA 1KOAA 3MGYA 2VV9A 4TYJA 2XK9A 2C1BA 3TV4A 1RW8A 3I6WA 2OZAA 3G9LX 3NW7A 5F94A 4EHEA 4X3FC 1GZ8A 4IZAA 3ZLWA 5BYZA 3HGKA 2AYPA 3BLQA 3FZRA 4QMVA 5CXHA 4F78A 1ST4A 1CDKA 1E9HA 2JDRA 3VNTA 1Q8TA 5HEZA 4BDHA 4FT7A 3WZKA 3U6IA 3QGYA 3NWWA 2X9FA 4MQ2A 3CTJA 5D41A 4FZ6A 4GU9A 3ZFMA 2OGVA 4XG2A 4MX9A 3O17A 3O8TA 2GNIA 1ATPE 5TKDA 3KMWA 4O86A 4BRXA 3NIZA 2GQRA 3TNWA 3S1HA 2RFEA 4F64A 2IVSA 5TE0A 4BTJA 1Y8GA 5CSVA 4IMYA 3OXZA 3VUHA 2OZAB 4ZJIA 4FX3A 4BCQA 2EWAA 5JFVA 3FY0A 3GU6A 3TNPC 3LAUA 3RZBA 1PXKA 4AS0A 3IGOA 5CEIA 5HBJA 2LAVA 4KNBA 5I9YA 4CZUA 2G01A 4FNXA 4LQMA 4X6RA 4AOIA 4EQUA 3OS3A 4L44A 1U4DA 3QRUA 4G6OA 3IK3A 4W9WA 3D94A 3SXFA 2QG7A 4TXCA 4CYJA 5JMSA 4IVCA 4M66A 5HO7A 4DITA 3FXZA 3PUPA 5A4LA 4A4OA 4PL3A 4EOJA 4C58A 1OGUA 5DA3A 5FM2A 2WMAA 2ETKA 3R1QA 2GQGA 4JL9A 3BHYA 4XHKB 1FOTA 3PXRA 2YM5A 3AC3A 4RC4A 2BTSA 3KVWA 4C59A 4FV4A 4RJ7A 1GOLA 1ZY4A 3W8LA 5AR4A 2B9HA 1CKJA 4NTTA 4FEVA 4GRBA 4FKTA 4QPSA 5BVEA 3COIA 4N0SA 2X6EA 4I3ZA 5CEPA 3FMHA 3W8QA 3GC9A 3VS7A 2I0YA 1BX6A 5FTGA 3FDNA 4I6QA 5IMEA 5CEKA 5H8GA 2E2BA 2YZAA 1VEBA 2CGWA 5AUWA 5K5XA 2XNBA 1FQ1B 3F61A 4AXEA 4PDYA 2CSNA 3ZSIA 4APPA 2R3LA 2ONLC 2QOCA 2PTKA 4IVAA 4LGHA 4EOSA 1OVEA 4EI4A 3C1XA 2YM6A 3P86A 1WMKA 4MQ1A 5AR5A 4BCNA 1ZOEA 1OIUA 3K2LA 5EK7A 3CY2A 4WO5A 4O2ZA 2IJMA 4UY9A 3QYZA 3ZM9A 3OWPA 3FAAA 5BYLA 2R4BA 5DE2A 4JQ7A 2IVTA 5M09A 1QMZA 2ITUA 2REIA 2JKQA 4O0VA 3FI8A 2XUUA 2QKWB 2FYSA 5ANGA 5LQFA 2FSMX 2X0QA 5LXMA 1UU8A 3JVSA 1Y8YA 3NUPA 4MXZA 5HE1A 4D2PA 2OJJA 4GYGA 2X0PA 1W2DA 2FGIA 3F7WA 2H8HA 4MD9E 4YLKA 2F49A 5I9WA 3UQCA 2JD5A 3GCQA 4QP8A 1Y6AA 2W5BA 3MJ2A 4XCUA 4BN1A 4C7TA 3R7GA 3RGFA 4EH3A 5AP5A 4PV0A 1NT2A 3V6SA 5HTIA 2WO6A 3C4XA 3VBXA 2E9PA 2QO2A 3Q4TA 5TOZA 3C0HA 3IW8A 3PXZA 4UZDA 3LM0A 2VTQA 3TCPA 4C4EA 4BZNA 4F4PA 3KFAA 2XK7A 4FEQA 2Z7LA 3FLSA 4OR5A 3KN5A 4DEHA 4OLIA 2HWPA 3D5XA 2IZSA 3DB6A 2OF2A 3HRBA 4DTKA 1XHAA 4KSPA 4DH1A 3LQ5A 3C4WA 4KRDA 3OY1A 4TYGA 2HW7A 2C5YA 5ANJA 4KIOA 5CALA 3DT1A 5AR7A 3QQGA 3FLYA 4HPUE 4WD5A 4GKHA 3P0MA 2GS2A 1M17A 4FV0A 4IWOA 4NFNA 3ACKA 3PIZA 4DA5A 4WOVA 5CU6A 2XM9A 2X7GA 2C30A 2WMBA 3GC8A 4RX7A 5EHLA 4P5QA 5HTBA 4AAAA 3ZUUA 3ZDIA 3EYGA 1UNGA 3L8XA 2YDJA 3DCVA 3HMNA 4UMTA 1J1BA 2OZOA 4AGWA 2X0OA 5J8IA 5BYYA 3GI3A 1PXIA 3OY3A 1XKKA 4C2WA 3K5UA 4MXCA 3NR9A 1JWHA 2Z7RA 5AX3A 4OGRA 4RVLA 3QQLA 4D1ZA 3MA3A 3QD2B 4G17A 3EQCA 1Q24A 1TQMA 4D0XA 4O82A 2C6OA 5CVHA 3G9NA 5EYKA 4GH2A 4BCHA 3U55A 3FE3A 4HGEA 4GSBA 1H08A 3AC4A 2XNOA 4IAIA 2J6MA 4BWXA 2ZYBA 4IW0A 2UW4A 1XWSA 2AC5A 1WBTA 5J7HA 1IR3A 4MBIA 3E8CA 4TNDA 3BU5A 2O63A 3UGCA 3PZHA 5BVNA 2VGPA 5JZJA 3H9FA 3Q5IA 3SXSA 2PY3A 1OUYA 3RP9A 4QT1A 2WTIA 1H1WA 3RPYA 4ITJA 1Q4LA 4LOOA 4RPVA 5L6PA 2X6DA 4QMYA 3HUCA 4ITIA 3LOKA 2V5QA 4CKJA 5ANOA 5BVDA 3QTQA 1H25A 3A8WA 3JY9A 3FQHA 3QKMA 2CCHA 4FIEA 4FNYA 4K6ZA 5DPVA 4J1RA 4DH8A 2DS1A 1PXNA 1Q3DA 2OU7A 2EVAA 3ID6C 3R0TA 2BCJA 3PSBA 3SA0A 4ALVA 4JLCA 2XP2A 3UC4A 3VJOA 4IIRA 4NIFA 3BHHA 4BKYA 4ASEA 3TIYA 1OKVA 3VAPA 2CNQA 4YZ9A 3C4ZA 4C38A 1B39A 2RGPA 3AQVA 1W84A 3S4QA 2YDIA 5J9LA 4CXAA 3IW7A 3AT3A 1F3MC 4JS8A 4C0TA 3E64A 3I6UA 4BBEA 1FGKA 1WBSA 4M3QA 3ORIA 4X2FA 5DRDA 4DHIB 3BV3A 4FF8A 3O0GA 3CY3A 4NKAA 3RWPA 3PA5A 3TDWA 3OMVA 3PP0A 3LFEA 4RQVA 1M2QA 3KRXA 1QPEA 3QCXA 2CMWA 2BZHB 3LE6A 1I09A 1MQ4A 3QKKA 4N6YA 4XUFA 2PVHA 5IEXA 2JKMA 1XMMA 5C01A 5AX9A 4DGLC 4AGDA 4QYFA 3RNIA 3DY7A 3L9MA 4ZS0A 3KA0A 4NIFB 2B1PA 3BHVA 2W1HA 2GNGA 1OIQA 3WIKA 4AW5A 2RSVA 4CMUA 1FBNA 2Z02A 2Y6MA 2PMLX 2HCKA 2QO7A 2IWIA 3AD6A 1YXTA 3EQDA 5IPJA 5FDPA 4MHAA 3W0RA 1R1WA 5HNGA 3DFAA 4XV3A 4LOQA 4DINA 4GL9A 2BZIB 4ID7A 4QP4A 5JFSA 4A06A 1P5EA 4QMWA 2RKUA 1SNUA 4JT3A 1A9UA 3QUPA 2BPMA 4TTHB 2FVDA 3E7VA 4C35A 1TKIA 5AA8A 3MY0A 4G1WA 2J7TA 4GK2A 4OUCA 3VVHA 2UW7A 1LUFA 2PZYA 1XMLA 1ZAOA 4DFUA 4U40A 3BBWA 4IB1A 2HK5A 2W96B 4O0YA 4MBLA 1M2RA 3FYJX 4OT6A 4QQ5A 5M53A 4FMQA 3PXQA 4DEEA 3C0IA 4F1MA 1W7HA 5HNBA 3W0QA 4BB4A 3BWJA 2P4IA 3MV5A 1FPUA 3F7ZA 4F9WA 3KXNA 3LFNA 5CEMA 3QXOA 3G0EA 4IHPA 4RA5A 4X3FB 4DEGA 1BI7A 4EK4A 2BVAA 5DR2A 1OBGA 4D4YA 2UVZA 2UZLA 3TJCA 2ZV8A 5AUTA 5KBQA 3FXWA 3JR1A 3BQCA 4U42A 1GZKA 4H58A 4S30A 4AN9A 2RFDA 4DCAA 3P4KA 3HUBA 1Q99A 1YHWA 4QYHA 4ZS4A 4ANSA 2OI4X 2YWVA 4WSYA 1WBPA 3VBVA 3OT8A 4EONA 4EOMA 3TTIA 5CSPA 3VN9A 5AP3A 2I0VA 2AQXA 2F9GA 3MFSA 4YTCA 4WG3A 5A3XA 3D15A 2B53A 3U4WA 3UC3A 4UMPA 5FEEA 1H1SA 5E8YA 3DXNA 2NNWB 4FSYA 3HX4A 3UP2A 3PIYA 4A4LA 1TQPA 3ALNA 1BLXA 2VO6A 1AD5A 4YZBA 2JKOA 4DAWA 4FVPA 4BCMA 3SDJA 3RCJA 4QMUA 4AQCA 1KWPA 2EXMA 2RIOA 3EKNA 3MYGA 4IANA 3FMDA 4M67A 5KBRA 2VTMA 4I4EA 4O7TA 3QQJA 5M4IA 3A7FA 3CGOA 4L7SA 5JGAA 2YM4A 3A8XA 5KMIA 3KCFA 4A9TA 3QF9A 5EQEA 2R3HA 3AOXA 3ZYAA 4GV1A 4D2VA 5A4CA 4PWNA 1Y57A 2J0IA 1P2AA 2PMIA 4JRNA 4RC2A 2BAKA 2XKCA 5AJQA 4DHFA 5EHOA 3BYOA 5HG7A 2VWYA 3ZCLA 5DMZA 4YC3A 4ZTMA 3ZC5A 3E63A 4PTCA 5E8VA 2OXDA 4OTDA 1PKGA 2BALA 3G6GA 4FT0A 3KC3A 4KBAA 2YM7A 3SQQA 3PWYA 4QYGA 4FZAB 5EYCA 4ANQA 3UDSA 4E26A 2YABA 3L9LA 5CQWA 3ZTXA 1K2PA 3COHA 3EL8A 2ERZE 5FUTA 2VO3A 4H3QA 4APCA 3G6HA 2IZTA 1ZOGA 5DRBA 4ANLA 2QC6A 5C4KA 4LDTA 2ETRA 2VTIA 2XS0A 2YEXA 3IDBA 3VBWA 3PZEA 5L2WA 3H9OA 5HO6A 4CMOA 2H9VA 2OKRA 2YZLA 3LVPA 4UV0A 2HXLA 1OL2A 4I94A 3REPA 1YXUA 5CVGA 5K4JA 1P4FA 4D1SA 5IMXA 1HOWA 2X0GA 1PY5A 1YHSA 3KCKA 3UO4A 3COMA 1DI8A 3NMUF 3GU8A 4M8TA 2W7XA 4PRJA 5I9ZA 3IW4A 2VX0A 5J5SA 3DLSA 3TUBA 2QD9A 3D7TA 3P08A 3QL8A 3RINA 2EXEA 4CZTA 1JVPP 1PKDA 5C27A 4EUTA 2IPXA 4EH9A 3RK5A 3Q5ZA 4D0WA 3OW3A 4EC9A 2QHNA 2A2AA 1ZYJA 3H10A 4XOYA 3UIXA 1KE9A 1CTPE 3A7GA 5AIKA 2JDSA 4FTOA 5HG5A 3P9JA 3UJGA 1AQ1A 3VUKA 2BRGA 3R00A 3RKBA 4AP7A 4HVSA 4A9YA 4EH8A 3KN6A 4IAFA 4C37A 2R3FA 3EYHA 4QYEA 3OOMA 3K3IA 3PVUA 4YJQA 3ODZX 3QRIA 5FQDC 3SG8A 1U54A 4XG9A 1H28A 4NH1A 4F08A 3HP5A 1QCFA 1MQBA 2DUVA 4L67A 2C47A 3D7TB 1A48A 3ENMA 3HMMA 3DDQA 3P7CA 2JIVA 5CLPA 1FINA 4MH7A 2HAKA 2IF8A 3I7CA 2R3JA 2C6LA 5CENA 4B8LA 4ZY6A 3QTSA 2R0IA 2BIYA 4J99A 5I5ZA 1YOMA 3V51A 3KB7A 3AD5A 4U44A 3F82A 1DAWA 2ITTA 2VAGA 3L8VA 1M7QA 3FWQA 2OF4A 3NEWA 1J1CA 3PE1A 1XBBA 2PK9A 3SD0A 3C4FA 4ERWA 5J1VA 4FTMA 3R9OA 4Y46A 5CF8A 3HV3A 2PULA 4N6ZA 4K9YA 4Z9LA 1CKPA 2Y4IC 2Q0BA 4E6AA 4YTFA 1K9AA 3NRMA 4RJ8A 3V3VA 1U54B 4I1ZA 3DXQA 5FGKA 5C4LA 3OTUA 4IZYA 4LUEA 2JDOA 4LRJA 5KO1A 1GY3A 3IW5A 3EZRA 4OW8A 3R2YA 3QQFA 3PFQA 4ACGA 4J53A 3W2SA 4GYIA 3ZH8A 3MFUA 5CAQA 3NNVA 3NFFB 2YN8A 2VGOA 4LOPA 3RAIA 4RGJA 5HE0A 2PUUA 3UIMA 3HYHA 2VNWA 4NM7A 3NAXA 3CPBA 1G8AA 4FKLA 3LQ3A 5E1EA 3DXPA 5D1JA 4CD0A 2PZRA 5BPYA 3Q6UA 3JUHA 1YWRA 2W1ZA 2WIPA 3R30A 4LGDA 3VS3A 4EK5A 3KULA 4ZAUA 5L8LA 2JITA 3LCDA 5A4EA 3P78A 4LG4A 3TEIA 4ANNA 1YOLA 4O83A 5FP5A 3FXXA 4R5SA 1SVGA 4HW7A 4F6UA 2PE1A 4TNBA 4Y72A 3C4CA 4ZSLA 2QI8A 3EMGA 3EN5A 5GIPE 3KGAA 4FIIA 5H2UA 4ZTSA 4UZHA 4FTQA 2WQBA 3UDBA 3UQFA 4AN2A 3AT2A 4CLIA 4C4GA 4WRGA 3HAMA 4GU6A 4L45A 2EU9A 1UNLA 4RVKA 5AR2A 1YXSA 5M08A 4QPAA 3OCBA 3QAME 3ZFXA 2JAVA 3QU0A 4U3YA 5DHJA 1UU7A 3DDPA 4AXFA 3HDNA 4NT4A 5K3YA 3NX8A 2YWPA 4KA3A 2UZBA 3F9NA 3GENA 4PMPA 3RHKA 1OIYA 3AMBA 4CEGA 4GVAA 3KULB 4ACHA 2J0LA 3MFRA 2XK8A 5LCJA 5EW9A 4F7JA 4MK0A 4L53A 2BUJA 1BI8A 3WARA 2X7OA 5CU0A 3HA6A 3ZRKA 3SXRA 2G2FA 4NW6A 3K5VA 4QMPA 4BYJA 3IW6A 3U6HA 4IM3A 1BYGA 5AP6A 2IZUA 3HZTA 5L6OA 4TPTA 3CQUA 2W99B 5GJFA 4NFMA 3BI6A 4D9TA 2VTHA 2W1CA 2ZDUA 4IQ6A 4UXLA 5G6VA 5AADA 3DK3A 3AMAA 4O2PA 3Q9WA 4ASXA 3MH2A 3WF8A 2YIYA 4U97A 2B0QA 2ZM1A 2NRYA 3OCGA 3PY3A 1NXKA 3GP0A 5AV2A 5BVFA 5M4CA 1WFCA 4FTKA 4G6LA 4X2JA 1NA7A 4O4EA 4QP1A 3I81A 3VS2A 5AP1A 2BR1A 3MBLA 4I21A 5EM5A 2QOFA 4BCPA 5J9YA 3LLTA 4FTCA 3PJCA 1JPAA 1OGYA 2WTCA 3DOGA 5HVJA 3KQ7A 4O91A 4UWBA 4GUBA 3W0PA 5HE2A 3BIZA 3FPQA 2X4FA 4QP7A 3OEZA 5D7AA 2ZDTA 3V5TA 4AU8A 4C02A 4TN6A 4O0WA 4CKIA 3BHTA 3BZ3A 3MVHA 3GT8A 4O4BB 4CYIA 2QLQA 3GOKA 4ITHA 5EG3A 2FA2A 3SG9A 3UOJA 2I0EA 4LV7A 1WCCA 2QR7A 4JBQA 3TI1A 3IG7A 3R73A 2ACXA 4JOAA 2I6LA 4YZNA 5HVKA 3FYKX 5CU3A 4ZTNA 5IDPA 1XJDA 4FE2A 1WBNA 2V55A 4PTEA 5JEBA 5K0XA 3PDTA 3DTCA 4G34A 3BGPA 4NCTC 3T8OA 1RE8A 5M55A 5IU2A 3U9NA 2PYWA 1YXVA 2ZM4A 5EFQA 4USFA 3EWHA 4AE9A 5EM7A 2O5KA 4E5WA 2C6MA 5CVFA 4IVDA 3VONA 4JX7A 3MDYA 3A7JA 4L8MA 3LXPA 4R3RA 4FICA 4LMUA 3BEGA 2XH5A 1XH8A 4PDSA 2G2HA 3OC1A 2PE0A 2HIWA 3ZBXA 2FSLX 3EH9A 5LOHA 1ZZLA 1YW2A 2XIXA 4RIXA 4FIGA 3W0MA 4FRFA 4RX9A 4X0MA 3H0YA 4Q5EA 3ZS5A 3PRFA 5DG5A 5CF6A 2R0UA 3ZO1A 4FKVA 2ZAZA 2YIXA 1PMNA 1ZMVA 4JDKA 3R63A 5LMAA 4B99A 4F7LA 3KXGA 4R5YA 1JAMA 3O7LD 4QNYA 3AC1A 3BELA 4TWPA 4BHNA 5M44A 2IW6A 3LFBA 4GVJA 2OO8X 2X8EA 4FKGA 2O65A 4FL2A 5D11A 4WRSA 4G9RA 5EKNA 4FIFA 4O7VA 4JX3A 2OFVA 5AWMA 3LQ8A 3D0EA 1YVJA 4EOKA 2QOIA 3RAHA 3BRBA 3ZC6A 5FEQA 4AA4A 4ASDA 4A9UA 5JKGA 4RZWA 3R2BA 2JDTA 4FZ7A 4RIXB 4ORKA 4X2NA 2BRBA 4BFMA 2VZ6A 2R5TA 3I79A 3II5A 3UZPA 3PSDA 2YA9A 5CAOA 1W2FA 5ICPA 1IEPA 5KMOA 4GCJA 4C3RA 5BUIA 3ORKA 2ZMDA 4KAOA 2CPKE 4AA0A 3GCPA 3T9TA 4TRLA 1O6YA 1MP8A 3MS9A 5E9EA 2H6DA 2YACA 4QOXA 4YC6A 4R7BA 3RAWA 3UTOA 1IAJA 4LM5A 4Y85A 1OL1A 2HZIA 2QU5A 3GCSA 5CEQA 3U9CA 3V5PA 2C5VA 2WEIA 3CC6A 4DLIA 5DR9A 3RM6A 4WG5A 4HNIA 2E9UA 4OT5A 4FZDB 4O0SA 4CFFA 3IS5A 4ZJVA 3OHTA 3RJCA 3ZMMA 4IWPA 4YGAA 3F3ZA 3SVVA 4NSTA 5J9ZA 4X7QA 3QALE 3ZO2A 4FODA 4IVBA 2UW6A 4OTRA 4QMSA 5EW8A 3RI1A 4B4LA 2NP8A 5ETFA 3V5WA 2J2IB 1FMOE 2VTJA 3ZZEA 2PVJA 4AX8A 3CE3A 1T45A 4J52A 3EQFA 4QMXA 4C3PA 2JFMA 3RPRA 4EH6A 3B2TA 1JBPE 1G8JA 3LXLA 3I0QA 4IFGA 3BV2A 3QQUA 1Y91A 3PUFC 3SX9A 5GNKA 5J95A 3MJ1A 5BMSA 4AG8A 2JIUA 2GCDA 2CLXA 4PL4A 4AE6A 1KV2A 4W8DA 2PVFA 3VIDA 4E4MA 4I0RA 4ZOGA 3HDMA 3R8UA 3OVVA 4L7FA 3QCYA 3QUDA 3PE2A 4XNEA 3FV8A 4C34A 4RX8A 3OEFX 1EH4A 3AD4A 4JIKA 2HY81 2BDJA 3BL9A 4IM2A 4NZWB 4EHGA 4MXAA 4UYNA 4EH5A 1G3NA 3MH0A 4LI5A 2Y4IB 5K0KA 4BIEA 4KKHA 1CSNA 3HVCA 3ZLYA 4IZ5A 2VO7A 3RK7A 3AKLA 4PPBA 3VUTA 4EOPA 4KD1A 4DT9A 3UMWA 5K5NA 4M14A 2XK6A 3DZQA 5M06A 3FEGA 3N9XA 2NRUA 2R7IA 5FM3A 4CRLA 3FZSA 3MY5A 2PVMA 4K77A 5LMKC 2GHMA 1YI3A 4ZXTA 1NVSA 4YJOA 2YAAA 4DFYA 5IZFA 5I9XA 3E88A 4TYHA 4Q9ZA 2BRMA 3TL8A 2CGXA 4YZCA 2OK1A 2LGCA 3E5AA 3UQGA 2GQSA 3DGKA 3E93A 2VUWA 4CTCA 4HGLA 1J3HA 1ZMWA 3B8QA 4EEVA 4XBRA 5HESA 3KXZA 4L46A 2X81A 4CG9A 2IW9A 2CN5A 3GFWA 3D83A 4N57A 2X39A 4S31A 3CJGA 4CFUA 2OBJA 4E7WA 3QD4A 4DH5A 4XLIA 3G5DA 3T3UA 3ULZA 4BBMA 4F7NA 1PRYA 4NK9A 4WSQA 4J7BA 4L3JA 3F2NA 4PNIA 2J9MA 4IB0A 4YPDA 3KXMA 4GW8A 4ZY5A 3CKWA 2ZV9A 1H1PA 2YCFA 3IECA 2JDVA 3PTGA 4FOCA 2XARA 3KXXA 4RJ5A 4NUSA 3HL7A 4FEXA 3TZ7A 4TYHB 4J97A 2C0TA 2X8IA 3QRTA 5F1ZA 5GZ8A 1APME 3Q4ZA 1FVRA 5AR8A 1OKZA 2Z7QA 4DDGA 3CXWA 3DK7A 2XRWA 2IN6A 3DFCB 3VS1A 5BVOA 4LFIA 4RJ4A 3ZZWA 3W0SA 4X3JA 3NSZA 4E20A 3D5UA 2XF0A 3O50A 4XH6A 3U4UA 2P2IA 2QOKA 2WTWA 4J96A 3GXLA 3ORNA 4JG8A 4ZTHA 4FSWA 4E3CA 2B9JA 3QXPA 4WNPA 4CCBA 3ZDUA 1PW2A 4IH8A 3MW1A 2BHHA 4YBKA 1UV5A 5LVNA 2Z7SA 2QNJA 3DKCA 4OTFA 2C5NA 4JXFA 4F9AA 3CTHA 2XM8A 2R3RA 4UB7A 3GQIA 3WE4A 1M14A 3KY2A 3BYSA 3F3TA 1Q41A 2QLUA 4BDDA 4MBJA 3JVRA 2W17A 4A07A 2ITXA 2AEGA 3Q6WA 3IDPA 3LFAA 4DFZE 2RFSA 4PDOA 2BRNA 2ITVA 3QTIA 1RJBA 5CT7A 4I22A 2WTKC 1JOWB 2FSTX 2UZEA 2A0CX 3FQEA 3HV6A 3FI4A 2I0HA 4V0GA 5HI2A 5B7VA 3R8MA 5LARA 3GCVA 4MYGA 5CNOA 2G2IA 4P5ZA 3QTXA 2WMTA 4FG9A 3C7QA 4AQKA 3R7YA 3OOGA 1YQJA 3LJ0A 1CKIA 5C9CA 3DJ5A 3MPAA 3O8PA 4P4CA 4BDAA 3WZJA 1YRPA 4RFYA 5BUJA 3E3BX 4MF0A 4H1JA 1BL6A 3DBDA 4NCTA 5F20A 4BBFA 4C8BA 2VWIA 2VWWA 1OBDA 2R3KA 2W5AA 2ZFYA 1LP4A 2Y8OA 3BYUA 3MIAA 4G16A 2XKFA 4YNOA 4C33A 5IEVA 2QU6A 4EJ7A 3RMFA 4O7WA 1GIHA 2VWBA 2Z2WA 4O0RA 4ALWA 1YDRE 4CFNA 4NL0A 1REKA 4YLJA 4I0SA 1MUOA 4YLLA 1W82A 4XG6A 4OTPA 1S9JA 1PMUA 3PG3A 2JIIA 4IX4A 4V0GB 4W4YA 4XS2A 3VF9A 2HXQA 1VYZA 2V0DA 1GIJA 5FTQA 5LCKA 4QPMA 3RM7A 3Q4CA 2VD5A 4Z7HA 1ZYSA 3PVBA 3FC2A 3LFQA 5EYDA 3QGWA 4OTGA 1H01A 4U5JA 1SMHA 1JLUE 2WMXA 2XK3A 5CYIA 4CFVA 4CV9A 1IAHA 3NUXA 2ZB1A 4RWLA 2W1IA 1DS5A 4TW9A 4JI9A 5BMMA 2C5OA 4E93A 1X8BA 5EI2A 3FSFA 2R3GA 5IISA 5AIRA 4BI0A 2XMYA 4DFNA 4EWQA 5DFPA 3VUIA 4Y73A 4BCOA 4Z3VA 4FV5A 4H3BA 2V7AA 2UUEA 3PXYA 1LEWA 4F63A 2VX1A 3IDCA 1DM2A 4PTGA 4DEIA 4D1XA 4G5JA 3A99A 2C1AA 3AMYA 3OTVA 1NW1A 2GNLA 1H4LA 1P14A 2JBOA 3ELJA 2OJIA 4YSJA 1YDTE 1F0QA 4DEAA 4FV6A 3CTQA 4ZSAA 4I6HA 2X8DA 4R77A 5AUXA 1I44A 3QX2A 1U46A 5ANKA 3ZUVA 4DEDA 3D2IA 5DBXA 3HMPA 3JXWA 4PL5A 5DEYA 3NUNA 4I5MA 3WYYA 3D14A 4BDJA 4CFWA 4DYMA 1V1KA 3H0ZA 3KF7A 5FDXA 4AF3A 4I93A 4JAIA 3ZO4A 2O8YA 3F66A 5DR6A 4BKZA 2P55A 3Q96A 3F3VA 4EQMA 4X3FA 5IG1A 3S0OA 2XANA 1OI9A 1ZWSA 3VBQA 5CANA 3A61A 3KRWA 4M15A 2C6IA 1ZARA 2W9FB 3CEKA 3FJQE 4GG7A 4JG7A 1B6CB 4YJPA 3PJ3A 4KRCA 3EKKA 4KABA 3ZM4A 4ZJJA 4XG7A 2F57A 3EB0A 4CKRA 2XALA 1GNGA 4CFMA 3NFGB 2WQEA 5F4NA 4WA9A 2QKRA 3TNIA 4C4JA 5I9UA 4MXYA 2WB8A 3P79A 2CLQA 3KKVA 4V05A 3TTJA 3RVGA 3UPXA 4BDKA 4FV1A 2H34A 3EN6A 4JBVA 3FSKA 2VTSA 5EDRA 4FV3A 3F3UA 2QCSA 3I60A 2AUHA 3PA4A 4C57A 4XBUA 1KOBA 5IUIA 2ZM3A 5FXRA 4D2TA 3HKOA 2XJ1A 2XNEA 3R7EA 5DWRA 4PMMA 5IH4A 4HCUA 1J7UA 4BWKA 4MNFA 3SV0A 2AC3A 3TACA 4TWCA 1YWNA 3PJ8A 1E1VA 2C68A 3M1SA 1VZOA 2GNHA 3VJNA 3SLSA 4FTLA 3LJ2A 5AM7A 2GU8A 2PZPA 4MVFA 3EQPA 2X7FA 4EKKA 3FMLA 4GIIA 4BL1A 2Q83A 2VTNA 1XH6A 3NPCA 4FVQA 4Z7GA 2CNVA 3MY1A 3HV4A 5BUEA 3O96A 5CSWA 4W9XA 4O7LA 2F2UA 4RVMA 5EM8A 3UYSA 2GNFA 3OD6X 1UWJA 4UALA 4EOQA 3FZ1A 3QWJA 1ZOHA 4AZEA 2QO9A 3VS4A 5DH3A