2OJIA

Crystal structure of erk2 in complex with n-benzyl-4-(4-(3-chlorophenyl)-1h-pyrazol-3-yl)-1h-pyrrole-2-carboxamide
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
344
structure length
344
Chain Sequence
RGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Mitogen-activated protein kinase 1
publication title Flipped Out: Structure-Guided Design of Selective Pyrazolylpyrrole ERK Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 105
structure length 344
sequence length 344
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2007-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2ojiA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2ojiA01
2W4OA 3KQ7A 4JR7A 4HVGA 4ORKA 4D9TA 3RK9A 4UYAA 5IMEA 2HZ0A 4FV5A 1Y6AA 4QYEA 2EXEA 4FZDB 2C5NA 3AC4A 4JBOA 3BEGA 3ZLSA 3ZDUA 4K77A 4KKEA 2X9EA 3FXXA 4ZEGA 5A9UA 3R00A 4PRJA 4NW6A 4E4NA 3NVMB 3F7WA 5ETAA 5FEEA 3VJOA 2CGUA 2RG5A 4EHZA 1W82A 4E8AA 4BDCA 3Q52A 4FG7A 2WEVA 3W2PA 4EQMA 5BUIA 1PXKA 4WHZA 5ANJA 3VS2A 4C35A 4EH6A 4EQUA 2Y4PA 4E6CA 3O7LD 5JFWA 5H8BA 5HE2A 1OI9A 2HIWA 3KB7A 4EOMA 4FOBA 5I3RA 3HVCA 1SVEA 3ZZWA 2YA9A 3PLSA 3KXZA 4RRVA 4C4JA 3WARA 3W10A 4BI1A 5M09A 3DBEA 5EDRA 3NUAA 5DA3A 2R3MA 5A4LA 4MXXA 5IQDA 2C3KA 4AFJA 4E5WA 5JEBA 2GNIA 4DG0E 3ZRKA 2GQRA 3FMJA 3WF9A 4YBKA 5L6OA 1O6LA 4DYMA 3TNHA 3ZO3A 5AEPA 4CV9A 4O0YA 4HVSA 2WTDA 4JX3A 4D2TA 5AR3A 4B9DA 4C61A 3UOLA 4FTMA 3KF4A 1OL5A 2R3GA 3DS6A 3I7CA 5CWZA 3C7QA 4QP9A 3GC0A 5GZ8A 5I5ZA 4FKSA 1ZOGA 1HCLA 3L9NA 5IH5A 4YTIA 4OGRA 4IAKA 2ZV7A 4TYIA 1QPEA 4AS0A 3PA3A 5L8KA 2F4JA 3QGWA 4U80A 3IO7A 3VBTA 2PU8A 2JKKA 3VBYA 3P7BA 3MVHA 2C68A 3QHRA 3PUPA 4YNOA 2YM4A 4RJ8A 4TXCA 5BYZA 4RQVA 3QRJA 3BHTA 2FSTX 1VZOA 3ZYAA 5A6NA 4JI9A 2QHMA 5KMLA 4CFFA 1OL6A 4RA5A 5CU2A 3TUCA 1YDTE 5I4NA 4H3QA 2QO2A 4JLCA 4X3FC 5HCZA 3G2FA 1XH9A 4IDTA 5IISA 1JKLA 2G15A 4C4EA 1GZ8A 2WQEA 3FJQE 3CR0A 1Y57A 3PSDA 5EDQA 5D1JA 5C8NA 3RI1A 4DE4A 5EW9A 4Z3VA 5JFVA 4RC2A 4RMZA 4ZZNA 3HAMA 5CEIA 4ASXA 2JAMA 4BCNA 1IR3A 2CSNA 4ANSA 3ORKA 4X3JA 2VTQA 3GBZA 1FVTA 3Q4TA 2IW9A 2HXQA 1UU7A 3QFVA 3V01A 1VR2A 2HWPA 3HV5A 4YTCA 4QMXA 5AR8A 3ULZA 3OD6X 3M1SA 4FEUA 4F1TA 3PZHA 4DLIA 1LPUA 5AV3A 4O27B 5CT7A 3PDTA 4RIXA 3GT8A 3FLWA 4CEGA 2FGIA 2QOHA 4AU8A 3R21A 4M66A 4ZSEA 5EYCA 4PMTA 1YI4A 1H0WA 4JBQA 1ZY5A 4RJ6A 2BMCA 3LVPA 4N6YA 4YTHA 2OK1A 4BCOA 2X8DA 3LCKA 5HG8A 5CAUA 3FXZA 4Y5QA 5GHVA 4GUBA 1KE6A 3NUYA 3JS2A 3RMFA 4NZWB 1BL7A 3FUPA 3LFQA 4FL1A 4Y85A 4APCA 5CAVA 4CFNA 3VC4A 2A0CX 4BTJA 3R02A 4DGNA 1I09A 2VO7A 2WIHA 3AMBA 3EL7A 3HYHA 4IW0A 5EDPA 2YLEA 5LVLA 5LVPA 2VN9A 4IBMA 5CSHA 2OIBA 1OKVA 2UW5A 3F2RA 4FTNA 4RIYA 2WQOA 3LMGA 3MH2A 3CXWA 1UV5A 3KXMA 3AOXA 3QQGA 2QOLA 1OITA 4YJRA 2BFYA 3Q04A 1PMUA 1QPCA 4F9AA 5J1WA 1GZOA 5HG9A 5EYMA 2C6MA 3RCJA 3P7AA 1DAYA 3UNJA 3OBGA 5IQIA 2R64A 3FPMA 1RE8A 3PP0A 4LL0A 5L8LA 2V0DA 4KBAA 4EK4A 4EKLA 2RGPA 4YR8A 4FC0A 3OS3A 4XS2A 1Q3WA 4KRDA 2XKDA 2IVSA 3QQUA 4BDEA 4NEUA 5J7HA 2PVYA 3HMPA 3LQ5A 3PJ1A 2RFEA 2W9FB 4G6OA 4YHJA 3KK9A 5AX9A 2QR8A 4KIKA 4LOOA 1H1QA 4IX5A 5CS6A 4HVIA 2BPMA 2XS0A 5JN2A 1IA9A 4F4PA 4JOAA 3RJCA 4UZDA 3PVWA 3OW3A 4GW8A 5CVFA 2GHLA 2NP8A 3LLTA 3ZRLA 4EWQA 2PVFA 1H1RA 5E8TA 1GJOA 3DXQA 4K33A 4C4GA 4G3CA 3SLSA 3FV8A 4AE9A 5EI6A 3OUNB 2YM7A 2WMUA 3SD0A 4AW0A 3MWUA 2VWVA 4A7CA 2WFYA 4RPVA 4YMJA 5A14A 3ZBFA 2UUEA 4M14A 4AACA 4F6SA 4PX6A 1URCA 3F66A 4L8MA 4QMPA 4XG9A 3LMIA 3E3BX 3NGAA 3BHHA 1APME 4ZLOA 4PQNA 1ZMVA 3LFSA 4O7SA 5AIRA 4MQ1A 3SHEA 4FKWA 5DI1A 3OT3A 5AV1A 3GNIB 3A62A 3KY2A 5D7VA 1V0OA 4TL0A 2PE2A 5ICPA 1BYGA 3QQLA 4E4XA 2UW0A 4ALVA 4C58A 1SNXA 4CCUA 3W18A 5EW8A 2UW6A 3EN9A 5JRSA 4MXZA 1R0EA 3PP1A 1PMEA 2O63A 3IG7A 2I0VA 2J2IB 2QD9A 3ZLYA 4H39A 3Q6WA 5GJFA 3R7YA 3D9VA 1CMKE 4GT5A 2GQSA 2JGZA 4I6BA 4E6QA 4JX7A 1OL2A 3GU7A 4M7IA 5CI7A 3VS7A 4TYHA 3CS9A 4MD8E 4CMOA 3OROA 5IEXA 4M0ZA 2LGCA 2I6LA 5T68A 2JBOA 4FVQA 3FDNA 3EQHA 4FV8A 4MK0A 5BPYA 4YZBA 2ITNA 4DAWA 3QCXA 3RNYA 3WYYA 1UA2A 3MPAA 5E8XA 4BCIA 4BZDA 2R5TA 3FAAA 2IW8A 3TN8A 3I4BA 2VZ6A 3CD8A 4G9RA 3IW4A 2GTMA 3G0FA 2OXDA 3ZO4A 4GU9A 2QHNA 4FL3A 1ZYSA 4DFLA 1WBWA 4DGLC 4YZCA 1WVYA 4F1MA 1OIQA 3PWYA 2WELA 3ZCLA 3M2WA 5IQEA 4G6NA 2B9FA 3CE3A 3W8LA 4AP7A 2YAKA 5EK7A 4RBLA 5B7VA 4HYHA 4IZ7A 4ACCA 3NUSA 2ZV8A 4BGQA 3LJ2A 4I92A 4K8AA 4XV9A 5GIOE 1WBVA 4FV4A 4LRJA 3TDVA 4FKOA 3G6HA 3VS5A 2GNLA 2X2KA 1OGUA 3FI3A 5DR9A 5HD7A 2VTSA 3SA0A 2Y7JA 2CLQA 1XHAA 3UG2A 2ZB1A 3E3PA 4QPAA 1YHVA 4O38A 5IKWA 4FTTA 3S4QA 3HP5A 1RDQE 3MPMA 5H9BA 2OF2A 3NW6A 4E6AA 1SM2A 3KEXA 4ITHA 2JDRA 3SX9A 4EUTA 2CGVA 3FMLA 3Q9XA 2JDSA 3CBLA 4X7QA 2QOFA 1GAGA 5KE0A 3WE4A 1FBNA 4ZMEA 1IEPA 5DR6A 4S30A 4FICA 4WUAA 4MNEB 3I7BA 4M0YA 4V01A 3QX4A 4BVUA 2BTRA 4V0GA 3VHEA 1QPJA 3TTIA 4JT3A 1Z5MA 4G17A 3Q53A 5T6KA 3NAXA 5BX0A 3LCOA 4KRCA 4QQJA 2C1AA 5J5SA 3BBTB 4O82A 4NW5A 3LPBA 2ZB0A 4CKJA 5IF1A 4NU1A 4TNDA 5L2QA 1Q24A 3F3TA 4A07A 4O7NA 3COIA 1JAMA 3PVBA 4UY9A 2EB3A 3FC1X 4F63A 3DJ6A 4EHVA 1G3NA 4XCUA 5KZIA 5J9ZA 5EM8A 3OP5A 3U6JA 3UO6A 4X21A 5IEYA 1K9AA 2XH5A 3UQFA 2PUNA 2R3NA 3ODZX 3TIYA 5KHXA 1KOBA 2Z7SA 1IG1A 5FTGA 4U3YA 4IH8A 3V5PA 2W99B 2XVDA 3P7CA 3OTVA 1J7LA 5CXHA 5ANEA 4B99A 2OBJA 3N4VA 3NCGA 4HVHA 4O7LA 5FRIA 5CENA 2J0KA 3ALOA 1R0PA 4YZ9A 2VGOA 3HMOA 4DEEA 1IRKA 2C6OA 3I6UA 4S32A 3E8EA 2Z7RA 3KN6A 4M69A 5HOAA 5I9ZA 3QD0A 4ZTRA 3A7GA 4W4WA 4DEDA 5LWNA 3E93A 3QKLA 4LL5A 3ENHA 1E1XA 4FKQA 3GEQA 4XHKB 2VWXA 5KUPA 1Q8UA 1REKA 3CKXA 3HX4A 3PJ3A 4ZTLA 4R5YA 4PV0A 5E8VA 1GY3A 4L3LA 3U55A 4F7LA 3DDPA 5CAOA 3OTUA 2XIRA 5HESA 4FKLA 4AFEA 2GS7A 1Q8YA 3KULB 3C13A 3NYXA 3EFWA 2B9JA 3QD3A 4MAOA 4AA5A 4EQCA 3PA4A 5EM5A 3LFNA 5JFSA 3WF8A 4ZS0A 2A27A 3E63A 4AZTA 3I1AA 3DCVA 2YLFA 1H08A 4WG5A 4BCJA 3WZUA 2XNGA 2J9MA 3HV7A 4FGBA 4NSTA 3QBNA 4QPMA 4AGCA 1IAJA 4IB1A 4YJUA 1GZNA 2BR1A 4BDBA 5KKRB 1S9IA 2WMAA 4QP8A 3PZEA 5DMZA 1WBPA 2QO7A 4XLVA 4FIJA 1AQ1A 4EUUA 4E5AX 5CU3A 4F9WA 4RX5A 5EQYA 2GQGA 5L3AA 2W0JA 4FV9A 4PDSA 3L9LA 3NNUA 5EI2A 4EH8A 5JZNA 5CTPA 2GPHA 2Y4IB 3FE3A 3Q4UA 4XG7A 3G9LX 1H8FA 2H6DA 4P5QA 4U45A 4XRLA 1BL6A 2WMXA 5AUYA 4C2VA 5CASA 4M15A 5M08A 5AP5A 2XM8A 4YJNA 2BKKA 2HY0A 3CEKA 4Z16A 4UZHA 3POZA 2PZRA 4O7VA 2QOOA 3D94A 4YNEA 3G15A 5TOZA 3EQIA 1VJYA 3DQWA 4RWLA 4ZTSA 2C47A 1YXUA 2WAJA 4ZP5A 4GT4A 3QTXA 3FZSA 5CNOA 4WKQA 4CYJA 3BQRA 4D2VA 4JR3A 5HBEA 4WNMA 1CKIA 3PPZA 1V0BA 2CLXA 2NRUA 3EHAA 3EWHA 3NIZA 5FWKK 4ZS4A 2CDZA 4IWQA 3MA6A 4FZ6A 4G2FA 2R9SA 4M67A 3P86A 4N70A 3IW8A 4AA0A 2WGJA 4D0XA 4KKGA 4ZLZA 4RX9A 4KIPA 1B39A 4I3ZA 5E4HA 1Q3DA 4C57A 2WQMA 3VS1A 4F08A 2SRCA 4ZY5A 4MBIA 4QP2A 3ZFMA 4HCUA 3JXWA 3QYWA 1BI7A 4EC9A 4D2SA 5AV0A 3OW4A 4ANNA 4MWHA 3EQDA 3BZ3A 3MY5A 4R77A 4Z55A 3BLRA 1V1KA 1PXNA 2WTKC 1FMKA 1P14A 3ACKA 4YGAA 2UW9A 4YHTA 4O0WA 3U87A 5BMSA 5CF4A 2KULA 4BBMA 1OM1A 1FMOE 3MBLA 1EH4A 4ACGA 1OB3A 3BE9A 3TWJA 3CKWA 4BDIA 1CM8A 3IW7A 3G90X 3TM0A 2NPQA 4LUDA 3JVSA 5DRBA 1LP4A 3UC3A 4FIHA 5HLWA 4IIRA 3FKOA 3F5PA 2OKRA 4GU6A 4XBRA 3HDNA 4QMNA 1KE5A 3O0GA 3V5LA 4EL9A 4BR3A 4L46A 3QUPA 3OFMA 4FSWA 3KXNA 4KD1A 3OC1A 3DBCA 3U54A 5HVYA 3OWKA 4RVMA 1BMKA 1YXSA 4AN9A 3EOCA 1XBAA 2XK7A 3V5JA 4RJ5A 4S34A 3UIBA 4FV3A 4HVDA 5KX8A 4A9RA 4QO9A 1YHSA 1F3MC 3MVLA 2ITYA 2HCKA 4GYIA 3ZONA 2XNBA 4FK3A 3BU3A 4B8LA 3FY2A 4I6FA 3Q96A 1JKKA 2OJJA 3Q9YA 4Q5HA 1PYEA 5HO6A 4HZRA 2QOBA 4EH4A 3ZXZA 3BI6A 4IXPA 1BX6A 2EWAA 4UMRA 4FTCA 5M4CA 4RZVA 1V0PA 4BHZA 4CTCA 2CKPA 4JNWA 3GXLA 4BCGA 4RIXB 4U0IA 3FQEA 2VTOA 4GS6A 3FMMA 4L44A 4USFA 3ZUTA 4FKTA 5D41A 3QYZA 4GK3A 3TTJA 2EUFB 3MPTA 3OT8A 3B8QA 3BYUA 3F5GA 2QNJA 2X7GA 3QCQA 4E4MA 4N57A 3MJ2A 2LAVA 4KS7A 4NCTA 2C6IA 3MH3A 3KU2A 4ZJVA 5CEOA 2B53A 3A7JA 5E1EA 3ORXA 4PPCA 3OF0A 2XKEA 2YN8A 3RPRA 2PY3A 5CT0A 3PA5A 4FMQA 4GFOA 4J52A 3DY7A 4C3RA 2QG7A 4MXCA 1ZWSA 4KBCA 4ID7A 5HZNA 4DCAA 3LQ8A 3MV5A 4AF3A 3WIGA 5FQDC 3A99A 3FMHA 3H3CA 3O8UA 3L1SA 3Q4CA 3R9NA 3A7HA 3S95A 5EOLA 3TL8A 4Z7HA 4HPUE 5FLFA 3W2CA 4B0GA 2YCSA 3VUMA 1NT2A 5FEQA 2OZAA 1K3AA 1OMWA 3DZQA 3W33A 4F09A 3FLSA 4GIIA 2V62A 4FT9A 5EW3A 3RGFA 5JGAA 2G2IA 2REIA 3FQSA 4DTBA 4H36A 4YLJA 2PMNX 3TKHA 2CGWA 3WZKA 2OIQA 4DGMA 4JQEA 4R78A 5B0XA 2VTLA 3NUNA 2NNWB 4MD9E 2Q83A 4ZMFA 4H58A 3ZDIA 4DH3A 2XEZA 4J99A 4YUQA 4YC8A 4TW9A 3NAYA 4FNWA 4KIKB 4RFMA 3IPHA 5BVDA 1GIHA 2XYUA 4YJOA 2XIXA 5BQ0A 3LFEA 2Y6MA 3EQCA 4LQMA 1FGIA 4KKHA 4CXAA 3TNWA 1A9UA 2JFLA 3QC4A 2ITXA 3Q5IA 5EKOA 1NXKA 3MY0A 4FSRA 3NUXA 3QHWA 3VUGA 3HA8A 1XH8A 4EEVA 5BVOA 2BFXA 3LFFA 3OCBA 4G1WA 3M42A 3BCEA 2JAVA 2YISA 2P33A 4U44A 1WBSA 5LCJA 3UPZA 4NM5A 3DKGA 2IPXA 4BZNA 3LM0A 4K11A 2YZLA 3LKMA 3UO5A 2CHLA 3BLQA 3Q60A 3P0MA 2PSQA 2XA4A 3CP9A 5HBJA 5JT2A 4CGAA 3KGAA 1W98A 3BU5A 3L8XA 3UNZA 4AAAA 2PZIA 5I9VA 3LFCA 2PZ5A 4D1ZA 4IVCA 2OXYA 2WEIA 5JQ8A 4EH9A 3DFCB 2OFVA 3POOA 2IZSA 1Y8YA 2EB2A 2PTKA 5IA0A 1GZKA 4FYNA 2QCSA 4H1MA 1FINA 4AGDA 4M12A 2VWIA 5IDNA 1Q8ZA 4TYJA 4RWJA 2R3OA 2XKFA 5I9YA 1JVPP 4J8NA 5HNIX 3S00A 5HTIA 5A4QA 3BKBA 4DFNA 2IW6A 4R7HA 5CALA 1H07A 5JKGA 4IQ6A 4FTQA 2XK6A 2CKQA 4IEBA 3VN9A 5FP5A 4CQEA 1PMVA 2BROA 4G31A 4I23A 3LIJA 1QMZA 4QT1A 5BMMA 1ZY4A 2EU9A 5M4FA 2CNVA 3SRVA 3ZEPA 2ZM4A 3VRYA 2J5EA 3R04A 3C4CA 2G1TA 2Z7QA 3AGMA 2AUHA 2XNMA 1H27A 4HZSA 3EN5A 4AOTA 4XG6A 3OOGA 4NFMA 3R9RA 1U4DA 2XUUA 4TT7A 2FH9A 3SOCA 3NVKI 3BX5A 2YERA 5HVJA 4EK8A 4CG9A 3KVWA 2R7BA 3UMWA 4F65A 4O86A 3DK3A 1HCKA 2E9VA 4WSYA 1YVJA 3K54A 2IJMA 4I0SA 4JRNA 2O5KA 3I5ZA 3TV7A 3FEGA 2XZSA 3QD4A 4AG8A 3KRXA 3AD6A 4JVGA 5A4EA 4MBJA 5H8GA 4L00A 3FZ1A 3GC8A 4BTKA 4X2GA 2VRXA 4NKAA 2B54A 5HO7A 4RIOA 3CC6A 2NO3A 4YZNA 4X2KA 1XBBA 3OVVA 5IZFA 5ACBC 4KWPA 4UBAA 5E90A 4I21A 3F3ZA 1MUOA 5HCXA 3D0EA 3LCSA 4PP7A 1ZYJA 4D4YA 5CF6A 2X8EA 2VTJA 2WKMA 4FV2A 3SOAA 3R73A 1U46A 3BEAA 5CAQA 2ERKA 3BWFA 4FNYA 4FTOA 2ITOA 3WF7A 3MSSA 3NLBA 1U5QA 3RBWA 3K3JA 4IWDA 4XP2A 3NCZA 5DBXA 4CZYB 3MGYA 3GCQA 2OF4A 2W1GA 4RQKA 3IGGA 3UG1A 4R3PA 5CSVA 3SQQA 2VWUA 3RWPA 3GCUA 4L52A 4D58A 4V0GB 4DFYA 2C30A 4ZTHA 5GJGA 4Z7GA 5JK3A 4U40A 3KC3A 2IZUA 4D1SA 4YLKA 5C26A 3R22A 1CKJA 2OJFE 3FXWA 5HIDA 4AQCA 3AC5A 4U97A 2H96A 5EOBA 5HNBA 3PIZA 3PJ2A 4XMOA 3H10A 4CD0A 3MS9A 3HLLA 2F9GA 3H9FA 5F9EA 4RC3A 3UVRA 5DOSA 3RAHA 4NCTC 4GG7A 4LOPA 4O0VA 4O1OA 5DHJA 4EOKA 3LFAA 3FL4A 2OG8A 4DEHA 5I3OA 1B6CB 2CJMA 2V55A 4O7WA 2PPQA 2A2AA 3SW4A 2VTMA 4FUYA 1M17A 3TNQB 4O2ZA 3AT2A 2CKEA 4AZVA 4EC8A 3QZFA 5LOHA 2Y0AA 1ATPE 3PXQA 2ZDUA 4BGGA 3EZRA 4DT9A 3NW7A 3QQKA 4C02A 2VWZA 5AUWA 3BWJA 3O96A 4FV0A 3ID6C 4DC2A 4WRGA 4NWMA 3DLSA 5KO1A 4YZDA 3QLFA 2OZOA 4G6LA 4M69B 4RIWA 4YJVA 3UYTA 4EBVA 2X7FA 3BHVA 4BY9E 4EK6A 1PXMA 1WVWA 4UB7A 2PUIA 4LYNA 4CG8A 1U59A 4CKRA 2XEYA 2UZLA 2X8IA 5L2TA 5BYLA 1OIYA 4EONA 4QMQA 3VWAA 3C4XA 3GU4A 4FYOA 3OCGA 5C27A 2ITTA 1XBCA 4YC6A 4ZSAA 3TACA 2R3RA 3NIEA 5J87A 3FMEA 3I5NA 3QTQA 3FSFA 4FF8A 4BDDA 2UZDA 3RZFA 2Y6OA 3OZ6A 2C6DA 5CZIA 1O6KA 1YDRE 3TJCA 4BHNA 4RC4A 4CV8A 3HEGA 3IECA 3TUBA 2CGXA 2XB7A 2XNEA 3DAKA 4HNIA 4TKSA 2V7OA 5CLPA 4C4HA 3P4KA 2OGVA 2XCKA 5LQFA 4GG5A 2GS2A 2YCRA 4BCQA 4QMSA 1XH7A 3I79A 4IX6A 1DM2A 1OZ1A 2GNGA 4EOIA 3C5UA 4GFGA 2HZ4A 1J7IA 4XP3A 4H3BA 3HV4A 4CTBA 3JPVA 4BTFA 3ZU7A 4U43A 4KB8A 2XP2A 1CKPA 4IM0A 4F0IA 2ZAZA 4WSQA 4M8TA 3W2SA 3GQIA 3OWPA 5TKDA 3U9NA 5J9YA 3U8WA 3VBWA 4RGJA 4YP8A 1MQBA 4AOJA 2WIPA 5BUJA 2EVAA 4AWIA 1OUYA 1P4OA 4TWOA 3TZMA 4CFXA 1OKYA 2FSMX 4U5JA 4BDFA 4IB3A 4L01A 4MXAA 4Y46A 3Q5ZA 2VV9A 3NYVA 2I7QA 3NDMA 3QTWA 4L9IA 2HW6A 3KCKA 5EG3A 4KIQA 4F0FA 2B9HA 2OW3A 3FZOA 3NR9A 5CAPA 2GHGA 2UZEA 2VTIA 3DV3A 3REPA 2OU7A 5AM6A 3UC4A 3DTWA 2QR7A 3THBA 2R7IA 4F1OA 3G33A 3EYGA 4GT3A 3NNVA 3RP9A 2QVSE 2C3IB 4C34A 5CU6A 3NUPA 2NRYA 1OKWA 2HY81 3IW6A 2QG5A 3UOJA 2PZYA 4FTRA 3V5TA 2J0JA 3AC2A 2WMBA 5LMAA 2W05A 5M44A 3D2KA 4MWIA 3MVMA 3FKNA 4NL0A 2ETKA 2PMIA 5KMOA 4D5KA 3IW5A 4IC8A 4UXQA 4L3JA 4L67A 4J97A 3WYXA 4A4XA 5HLNA 5HIBA 3K5VA 4RG0A 5M07A 2YIQA 5F1ZA 3OG7A 2GDOA 4U6RA 3H30A 5B2MA 2VO6A 4R1VA 4CT1A 1NW1A 3ITZA 1UNLA 4IADA 4XX9A 2XJ0A 4D4SA 2P2HA 3A8WA 4HCTA 3CY3A 4UMUA 3E64A 3P1AA 3FKLA 5C4LA 2RKUA 3QCSA 5D7AA 3C0HA 1JNKA 5DIAA 4FTKA 2DUVA 4J1RA 4TWPA 4HGLA 2W7XA 2Z2WA 4FOCA 3WOWA 4JRVA 5CQUA 4FK6A 5E1SA 3GOKA 5LVOA 2RFSA 4Q9SA 3C0IA 3C51A 4G16A 4HYIA 3DDQA 5IA2A 4EH3A 3EN7A 3LXPA 4LMUA 4RZWA 3DK7A 2YJRA 3UZTA 3UZPA 2OIDA 4DEIA 3D7TB 4CVAA 3RVGA 3KRLA 4JAIA 3QXPA 1Z9XA 4O2PA 2F57A 3IQ7A 1CTPE 3HV6A 4ALWA 4AZEA 3CQWA 2A1AB 4PDYA 4CRSA 2J0MB 2W5BA 2HENA 5AX3A 3HAVA 3KMWA 4O1PA 4QP7A 3P5KA 3QQHA 3QXOA 2PZPA 4JXFA 4OTPA 2C5VA 3VJNA 4C62A 2W17A 1Y6BA 5DWRA 5K5XA 1WBNA 2JLDA 2JDTA 3ALNA 3GUBA 5T3QA 3ACJA 1IAHA 3IS5A 4PL5A 3G51A 3BGQA 4UWCA 2JD5A 3EB0A 4NJ3A 5FDXA 4RA4A 3Q6UA 2E9UA 4E1ZA 2PK9A 4W8EA 3IDCA 4ERKA 4KA3A 5EFQA 3NPCA 1O9UA 4UWYA 3UVPA 4E26A 5DYJA 2RG6A 4GRBA 2BALA 4YJPA 1W7HA 5HO8A 5IQGA 3PXZA 3CLYA 4AZSA 4BZOA 2YDIA 3OUKA 4QP1A 1J1CA 3QTRA 3HECA 2PE1A 4QD6A 4X3FB 5TE0A 3SV0A 3V8SA 2X0GA 3P78A 4A06A 3QALE 4QYYA 2UW7A 3ZS5A 4B6LA 5HHWA 2IVVA 3DBFA 2UVZA 3R9OA 2J0IA 4D1XA 2OZAB 5HE3A 4EBWA 4Y72A 3TUDA 5BVKA 3IK3A 4ANMA 5E9EA 5M06A 2IVTA 4O6EA 4I94A 4OTRA 4MXOA 2OXXA 1UKHA 5C4KA 3BU6A 3MW1A 5AR5A 4XG2A 4EJ7A 4RVLA 3TZ9A 3E5AA 2X2MA 5LCKA 3ORLA 4IWOA 4G3FA 5AR7A 4APPA 3W32A 2ETRA 2UZOA 3DNDA 4BWPA 4J98A 3JUHA 4I4EA 3UYSA 4U7ZA 4GJ2A 3QCYA 4IWPA 4ZJIA 3VBXA 1R39A 5HKMA 3IDPA 3LHJA 4DEBA 3ZO1A 2BRMA 2YCFA 3ORNA 5BNJA 4AZWA 5M53A 2OJGA 3DB8A 2ZV2A 5HD4A 4CMUA 3R83A 4QP6A 1T46A 3WZJA 5B2LA 3DLZA 2VWBA 5E8YA 5AR4A 1H25A 5EQPA 4BKZA 2V5QA 4FI1A 3Q2MA 4QTCA 1JSUA 1M2PA 4BYJA 3PXYA 2W4JA 3LXNA 4TYEA 2UVXA 4DITA 4DFBA 4ENYA 3ROYA 4F9YA 3I81A 1YI3A 2BAJA 5E92A 4BI2A 1G8SA 1PYXA 2OLCA 2YWVA 4XLIA 4BF2A 5LXMA 3WF5A 4FZAB 3O17A 4IC7A 4YTFA 2J4ZA 4MKCA 3AT4A 3UIUA 5AM7A 1Q62A 5D9HA 2W1FA 2XM9A 4ZSJA 4IX3A 2O3PA 2XRWA 4CFMA 5FTOA 4DEAA 4C59A 3PPJA 3R2YA 4OAUC 2C1BA 4FSYA 2WTIA 1OPKA 4GSBA 4UMPA 2BKZA 2PVMA 4E4LA 3PRFA 2C5OA 4R8QA 3N4UA 5JH6A 5LARA 2UZBA 4CSVA 4O0XA 2R3FA 3QRTA 2C6KA 2WXVA 5E8UA 5AP2A 2Z02A 2VO3A 4TWCA 2PWLA 4C4FA 5HX8A 5IA1A 3VF8A 4DCEA 1L8TA 3AMYA 1OL1A 4I0RA 4USEA 1UU3A 3DU8A 4IE9A 1OBDA 4EJNA 4IVAA 4R3RA 2PUPA 3GU5A 4F70A 3D5XA 3SRVB 1ZOHA 4YLLA 4AW2A 1UU8A 5A3XA 4BCKA 5ETIA 5L6WL 2W96B 2RFNA 3BRBA 2YIXA 5JQ5A 2WOTA 4JAJA 2IZRA 4OT6A 3BYVA 5D10A 3ANRA 4NT4A 5DEYA 5DT0A 5GNKA 4ANQA 4EH7A 3CTQA 2FYSA 3EMGA 2ZV9A 2WTWA 3OWJA 4EOQA 1YRPA 4I5HA 4PY1A 5KMNA 4ZY4A 3DK6A 3FQHA 1DS5A 4CLIA 2R4BA 4BCPA 2OH4A 3DQXA 2OH0E 3PJ8A 4LV8A 4PMPA 2XF0A 4GL9A 2UZWE 2QLUA 4A9SA 4O83A 3FZTA 2YZAA 4I6HA 3BE2A 3P9JA 3TJDA 5EHLA 3PVGA 2R3LA 4LGGA 1OKZA 5EH0A 2QU6A 2YM5A 2YABA 2YIYA 4TWNA 3UVQA 5E8SA 4F6UA 4EYJA 4IM3A 3RALA 4IZYA 2Y9QA 5FXRA 4NM7A 4RVKA 5DFPA 3PLAE 4V05A 3QGYA 3BGPA 2WU7A 3VUHA 3IOPA 2GFSA 3IDBA 4DH5A 3DBDA 1GIIA 3VS0A 2BDFA 3CQEA 3JVRA 4WOVA 4ASDA 2Q0NA 4JG6A 2F7ZE 4U79A 4BWKA 4FKJA 3C4EA 3E8DA 3ZTXA 1UWHA 4AE6A 2UW3A 4O7TA 3F2NA 4CZTA 3HUBA 5DN3A 3EH9A 3VO3A 3I6WA 4OTWA 2X4ZA 1PHKA 3QTZA 4H05A 3R8VA 3GGFA 2XK3A 5AWMA 3DT1A 4QQCA 3BGZA 3QC9A 2HYYA 4ANLA 2PMOX 2YFXA 3MY1A 4X2NA 5AUZA 3R2BA 5AP6A 5DT3A 3V8WA 5KMIA 5CVGA 5AUVA 3SXSA 2VX1A 4QYHA 4CFUA 5FXSA 1PRYA 4FE2A 3D7ZA 3CGOA 3E7VA 3QZHA 4FIIA 2B7AA 4FT3A 4DBNA 5ITAA 5AADA 4IACA 1OPLA 3Q9ZA 5A46A 4XBUA 5LJJA 4FKUA 1XWSA 4L53A 4D2RA 3FPQA 1W8CA 2FVDA 3R8ZA 3QWJA 3DOGA 4FZFB 2W1ZA 4IANA 5G6VA 4DFXE 2PHKA 3MFUA 4O0UA 3V3VA 5FM3A 3EFJA 3ANQA 4WA9A 4EK3A 5CXZA 3KKVA 3R7OA 4BFMA 2ZDTA 3WIKA 2R3IA 2E2BA 3C4WA 2XRUA 4O96A 4YSJA 3E92A 4JIKA 1F0QA 3N4TA 3R1SA 1FOTA 5TT7A 4FL2A 2DWBA 3PSCA 4PTGA 2YM8A 2BIKB 3ORTA 2VTHA 3NMUF 1DI8A 2KTYA 4L6QA 5FXQA 5JSMA 5KHWA 5EQEA 1Q97A 2ESMA 3D5WA 4FNZA 4O0RA 3F82A 4PPAA 4ZK5A 3RK7A 3W2RA 4TNBA 1F5QA 4NM0A 1Q41A 3KMMA 3QRKA 4MXYA 5ANKA 5BVEA 3KREA 1VYZA 4S31A 3F5UA 3R7UA 1JSTA 4W4VA 5L2IA 1IA8A 2JIVA 3BLHA 2WMTA 4UALA 2RL5A 4FSQA 2QQ7A 3OXIA 4F64A 1URWA 1O6YA 2HOGA 3NRMA 2ZM1A 3PY0A 3SXRA 2A4LA 3AC3A 3MVJA 2UZTA 1PKGA 3ZSIA 4CRLA 3LFDA 4K1BA 4C0TA 4XEYA 4NIFA 2QOQA 4UMQA 3D5VA 1VEBA 4FSZA 4ERWA 4PWNA 1AD5A 3PJCA 2QOCA 4U81A 3W16A 2ITWA 3EQGA 3ZBXA 5LMBA 4U9AA 2GTNA 2F2UA 2VTRA 1TVOA 3B2TA 4QMZA 4IZAA 3R8MA 4I4FA 2VNYA 4FSMA 4FX3A 4ZZOA 4EYMA 3U4WA 2J50A 2BDWA 4D2PA 3HDMA 4JBVA 4LGDA 5IQFA 3N51A 5CYIA 2A19B 4M68A 1NVRA 2P0CA 5CEPA 1MP8A 2HZNA 3QA8A 2YM3A 4ONAA 4X2JA 3TXOA 3WF6A 5IEVA 1KE7A 4QMYA 3GCSA 5HNGA 3DBQA 3F5XA 4JQ7A 4IAIA 4J7BA 4ACDA 3GU6A 2PYWA 1OUKA 5HTBA 1WMKA 1UKIA 2XNOA 3R1QA 4TRLA 3B8RA 4V04A 5IA3A 3EQBA 4P7EA 4FBXA 5D12A 3DAJA 5L6PA 3OY1A 3C4FA 2JIIA 2PVRA 2W9ZB 4RWIA 2VTPA 4IFGA 4RIYB 4FA2A 3RHKA 5K0XA 4H3PA 4F7NA 2BRHA 4RFZA 1J3HA 2RFDA 3NX8A 3UPXA 2C3JA 2PUUA 3VAPA 2QONA 3R7VA 4AT4A 5K5NA 1M14A 3QZIA 4PDPA 1HOWA 3O8PA 4NK9A 1REJA 3VVHA 3MN3A 4ZSLA 4ZZMA 5JZJA 3EFKA 5IPJA 3DKOA 4DLJA 4NTSA 3TI1A 3PXKA 3TIZA 4FEQA 5ANOA 2FSOX 3BIZA 3E8CA 4JS8A 4L43A 3ULIA 3TV4A 1WVXA 4XNEA 4BN1A 4L3PA 4BDGA 3G5DA 3HUCA 1YXTA 3MDYA 1ZMWA 1YDSE 1PMNA 1PXLA 2ITVA 4ITIA 2BRNA 2F7XE 4JL9A 3A2CA 5CVHA 2WPAA 4CFWA 3ODYX 3VUDA 4FSNA 5EYDA 3QWKA 2CPKE 5J8IA 3EL8A 4CNHA 1KWPA 3PSBA 5DPVA 5AUTA 4I41A 4UX9A 4DH1A 4DGOA 3I60A 4YJQA 3DA6A 4AT5A 4KSQA 1YOMA 2XIKA 4OTDA 1WBOA 2WMRA 3PYYA 3RCDA 3RKBA 4OBOA 5CY3A 4D28A 2V7AA 4FNXA 2CN5A 3PIXA 4E7WA 4XV1A 4FODA 3VF9A 4QMLA 2X4FA 3DZOA 3QTIA 3CY2A 3T9TA 4YPSA 4RLLA 4JDJA 2G9XA 3QQJA 1XKKA 5A4CA 2VTAA 3T3UA 1RW8A 4TPTA 2DQ7X 3PE1A 4S2ZA 5FBNC 3MESA 4OLIA 3LJ1A 2I40A 2B9IA 3A4PA 3A60A 4PMSA 4QYGA 4ZIMA 3V6RA 5EM6A 2R3JA 3DJ5A 3O50A 2W5HA 3Q3BA 1YWVA 4OTFA 4FUXA 2ITUA 2PMLX 4BIDA 4D5HA 4XG8A 2H9VA 4I24A 5IH4A 3VNTA 4C37A 4G5JA 2CN8A 2FA2A 2BHHA 1ZRZA 2C6LA 3NSZA 1GIJA 3HRFA 4USDA 4WUNA 3AC1A 1Y8GA 3BHUA 5AA9A 4QP4A 4E6DA 5CEKA 3RM7A 4KABA 3R7IA 1YQJA 1Q8WA 4JG7A 3V5QA 2ITZA 4G5PA 4KS8A 3HA6A 3F3UA 2VWYA 3QRUA 4D2WA 3R30A 5DRDA 3WBLA 2P55A 2X39A 4MVFA 3T9IA 4O84A 3PG3A 4BDHA 1MRVA 2BTSA 3OCSA 4ASZA 4TYHB 3NS9A 2YHVA 3TNPC 4HOKA 2WMSA 1T45A 3FMKA 3RNIA 4Y8DA 2WTKB 3FY0A 3TDWA 1OIRA 4KIOA 3ETAA 2BDJA 4M3QA 4LV5A 2GSFA 3PRIA 3ZXTA 3OMVA 3FLYA 1UNHA 4GK4A 3HL7A 3HV3A 3AQVA 3Q9WA 3HNGA 3ZFXA 4AN2A 4KAOA 4I0TA 5J9LA 5AFVA 2R0IA 4DFUA 5AJQA 5I0BA 1R78A 3ZMMA 3LLAA 5M4IA 5I9XA 5J1VA 2O0UA 3VW6A 4P5ZA 3EZVA 3ZRMA 5HORA 3ZSHA 5AMNA 5AUUA 3GFEA 3W55A 4U41A 3MFRA 4DG3E 1G5SA 3MFTA 1M2RA 3ATSA 3BBWA 5KMJA 5IA5A 5CSPA 4DHFA 2B1PA 2J6MA 1ZZ2A 1JKTA 3G9NA 4CLJA 3ZC6A 5G1XA 5HX6A 3DXNA 4GFMA 3KXHA 4QRCA 4EH2A 2IG7A 3SAYA 2RIOA 1W0XC 5CU4A 3UOKA 5AAEA 4TY1A 4H1JA 3D14A 3A4OX 4GVJA 5IMXA 5M57A 3PY1A 2I0YA 3C1XA 1ZMUA 4KBKA 5LMKC 3CGFA 1YW2A 2W5AA 3KXGA 2FSLX 4ANBA 5IU2A 2VD5A 3DKFA 4MX9A 2BZKB 4Y5HA 3UTOA 4C3FA 4O7YA 2XBJA 3L8VA 3R6XA 3D83A 4HJOA 5L2SA 3RAKA 2ITPA 4L7SA 5H8EA 2WD1A 1KOAA 3DJ7A 3FZRA 4J71A 4BBFA 4I22A 2PE0A 3GB2A 4MF1A 2C5XA 4N4SA 3WZEA 1X8BA 1CDKA 3LQ3A 5AIKA 2P3GX 4UWBA 4QMOA 5CU0A 5IUHA 1I44A 3O7LB 4YO6A 1ND4A 4FSUA 1P2AA 4RX8A 4O7RA 2HXLA 3R01A 5J5TA 3T3VA 1W83A 2OSCA 3KRJA 4BDJA 2XBAA 1PF8A 4JQ8A 2JKOA 3H9OA 4FTIA 4YPDA 3TZ8A 3ZOSA 1RJBA 5CSWA 4EK5A 4F7JA 4I5MA 4CQGA 5IQHA 1ZYCA 3EN6A 3P23A 1LEWA 3ET7A 3GP0A 3DTCA 5LVMA 2B55A 4DINA 3ERKA 3R7EA 5CZHA 4GK2A 4EZ7A 4BBEA 2OI4X 4WNKA 4YJTA 2VU3A 4PUZA 3KK8A 2BRBA 4XOYA 4AGWA 2ONLA 3PY3A 4Q5EA 2C0IA 4WD5A 4EOSA 3CTHA 3LJ0A 2YAAA 4UXLA 5HICA 4BCMA 5C01A 4CFVA 1KUTA 2X81A 4CZUA 5A54A 5HVKA 3QUEA 4FIFA 5IQCA 3PXRA 4FZ7A 4X2FA 4B8MA 2VTNA 2YIRA 4NYEA 4JG8A 4LMNA 2FO0A 1R3CA 1U54A 3CJGA 1IASA 3CPCA 5IDPA 4XYFA 2CNQA 3UJGA 4HGTA 4L42A 4FVPA 1KE9A 4GVAA 5BVNA 4FGRA 4LM5A 3AXWA 3NYNA 2BVAA 2R2PA 1PXOA 5C8KA 4R7BA 1WZYA 3V04A 3UP7A 4OUCA 5TR6A 3RWQA 1TQPA 4L45A 3F3WA 1ERKA 4QMWA 5FUTA 3H0YA 2FUMA 4LI5A 5BVWA 4OR5A 1Q61A 4OAVB 4FV6A 4XRJA 4BI0A 2YIWA 4IVDA 4BB4A 2G01A 4E73A 4FTUA 4MCVA 4A4OA 2J90A 4II5A 2CKOA 3RPSA 5IQBA 4RJ4A 3ZC5A 3KCFA 1XR1A 3R1YA 3R8LA 3BQCA 4MBLA 1JWHA 1PXIA 3F69A 3S0OA 2WOUA 3UOHA 3II5A 3O23A 4A4LA 1B38A 4HGSA 5HEZA 1S9JA 3AGLA 4DA5A 2BZHB 3ORPA 4BRXA 4ZAUA 2YWPA 1MQ4A 4FV7A 4GIHA 4YC3A 3WI6A 1H01A 5C9CA 5ETCA 2XK4A 3V6SA 4BKJA 4G3GA 4QTBA 4QMVA 1FGKA 2EXMA 2O65A 3AG9A 4C7TA 4EHEA 3NNWA 5A4TA 2XYNA 2E9PA 5KBRA 3GVUA 1XJDA 4XV3A 3HRCA 1JOWB 1TQMA 2BIYA 2WZJA 3L8SA 3R1NA 4KSPA 3IOKA 2GU8A 2JIUA 2R0UA 4IM2A 5AV2A 3K3IA 4TZRA 4P90A 3UQGA 4YHFA 2YACA 3DNEA 2C0OA 4N0SA 5M56A 5DNRA 2RSVA 2BHEA 3F7ZA 2ERZE 1PKDA 2BZJA 3H4JA 3TV6A 1KSWA 3KFAA 3HMIA 4R1YA 3MTFA 5JRQA 3H0ZA 4B4LA 2W06A 2CNUA 1OVEA 3OBJA 4XUFA 3HKOA 5EHYA 3UIMA 3F2AA 3HRBA 1JQHA 2WMVA 5BVFA 3BYMA 3QKMA 3AC8A 3D2IA 5H3QA 2B4SB 2ZM3A 3VBVA 2WB8A 3O71A 3GI3A 4HPTE 4YJSA 5M51A 5CF8A 2UW8A 3IKAA 3M11A 2WTJA 3ELJA 4HW7A 2X1NA 1AGWA 3GU8A 1GOLA 1E1VA 2DS1A 3QL8A 2OJIA 5ANIA 5TF9A 5ETFA 3ZSGA 4GEOA 3L9MA 3Q2JA 4DN5A 2XIZA 4E3CA 4CMTA 1PJKA 2VWWA 1OBGA 4A9TA 4I20A 2PVLA 5KCVA 4FT7A 1OPJA 4F99A 5I9WA 2JKMA 1OL7A 1JLUE 1H28A 4IHPA 3R8PA 3VUKA 5KNJA 4D9UA 4BL1A 4MD7E 3PTGA 5K4JA 4UV0A 2GMXA 2W1DA 2F7EE 5LWMA 4O0TA 3OWLA 2HK5A 3UMXA 3UE4A 4FKGA 3EFLA 1LEZA 2C69A 1UU9A 4OBQA 3E62A 2XIYA 1SVGA 4FKVA 4MEDA 4OT5A 3TKUA 4AZFA 2GNHA 4U8ZA 4BYIA 4UN0C 3EJ1A 4X6RA 2IWIA 3KF7A 4M13A 3QTUA 4RLKA 3R9HA 5HQ0A 4O22A 5KZ0A 2J51A 3VBQA 1Q5KA 5KKRC 2VTTA 5LVNA 2GCDA 2XNPA 4YURA 3SW7A 3UP2A 5BUEA 3CSVA 4IFCA 2QC6A 5C1QB 4NIFB 2XKCA 3B2WA 2Z60A 3I0OA 4K0YA 2QKRA 4PL4A 4CT2A 5CEMA 1WBTA 1FQ1B 4ARKA 2JDOA 4LGHA 3E7OA 2JDVA 4PDOA 3RAWA 2Y4IC 2ZMDA 3QRIA 3CJFA 3LCDA 3F9NA 3D4QA 3E88A 3EKNA 5FD2A 5D11A 3F3VA 1JBPE 4O91A 4YU2A 4K9YA 4PNKA 5JGBA 3COKA 3ENMA 4XG3A 4O81A 3SGCA 3GC9A 3EYHA 3PFQA 2GHMA 4P2KA 4RSSA 3TKIA 3VS6A 4C38A 3ORIA 4DG2E 3GENA 4UEUA 2ZOQA 3F6XA 3AMAA 4J95A 3R8UA 2X2LA 1A48A 2BAKA 2AC5A 3R9DA 5HG7A 1ZAOA 2X6EA 3LM5A 5FGKA 5KMMA 5DGZA 1PXJA 3I0QA 4NTTA 5HE0A 3S2PA 3ZM4A 2Z8CA 3LCTA 4RT7A 3QZGA 1MRYA 5I9UA 4WBBB 3UBDA 3VRZA 3KRRA 1H00A 5CF5A 4MF0A 4O0SA 3GOPA 2PULA 4ZSGA 3D15A 5EKNA 4QQTA 4U42A 1R1WA 2C0TA 3PXFA 4JJRA 1OIUA 2FB8A 4PPBA 2BAQA 3D5UA 4FTAA 4IB0A 5GZ9A 4EHGA 4EOPA 1ZYLA 2ONLC 1KV1A 2YCQA 3RK5A 3AD5A 2C5YA 4FV1A 2P4IA 3T8OA 3GCVA 3A8XA 3MJ1A 5DVRA 3UODA 4AN3A 4L7FA 3UO4A 3HMMA 4G9CA 1YOLA 3KVXA 3RM6A 5IUGA 1NVSA 3C9WA 3GC7A 2C4GA 4GCJA 3W2QA 4BICA 3KXXA 3KL8A 4PMMA 3VIDA 1SMHA 4EOLA 1H4LA 4JDIA 3P08A 1QL6A 4FTJA 5AP7A 3RTPA 3K5UA 5DR2A 3UGCA 4IMYA 3LXLA 3QD2B 4IAAA 4QNAA 4QYFA 3ZHPC 5C03A 3W1FA 4XJ0A 4F9BA 4XH6A 4WBOA 2E9NA 2QO9A 4F9CA 2DYLA 3VS3A 2QODA 2CCIA 3MFSA 5J95A 4YSMA 3SC1A 4L68A 4GUEA 1UNGA 3KRWA 3PE2A 5FP6A 2OJ9A 4DH7A 4GMYA 4M84A 4XP0A 3WILA 4EOJA 2VUWA 4YBJA 3FLQA 4GYGA 1LUFA 3FWQA 3QUDA 3VUIA 5HU3A 2BILB 5IH6A 2O64A 4FKPA 2YM6A 3OOMA 4GH2A 3UIXA 2BZIB 5ANDA 5AUXA 5BYYA 4J53A 2Y8OA 2W1HA 3FI2A 3C4ZA 3HGKA 3ORMA 3FL5A 4EORA 3MIAA 4AUAA 4I93A 2JBPA 3VUTA 4AX8A 4PP9A 3DFAA 4O21A 4QMTA 5HGIA 4NJDA 3CCNA 4AW5A 3FYJX 4EZ5A 3LAUA 3Q4ZA 2R3QA 3KA0A 2IVUA 5AAGA 3O51A 2JFMA 4X0MA 4QTAA 2AC3A 3MI9A 3OXTA 4NFNA 2EXCX 4MQ2A 5CSXA 4FEXA 4C2WA 5HCYA 1XH6A 3F88A 1L3RE 1YWRA 2JKQA 2H34A 2UZVA 3QAME 3PIYA 3DB6A 1M52A 4QMUA 3U9CA 3TT0A 3SVVA 2ETMA 1YXVA 3FC2A 3RAIA 4BTMA 4HYUA 4QOXA 2Q0BA 3MH1A 4J96A 4O6LA 5F20A 2PVHA 4ZJJA 4BC6A 2WMQA 3BHYA 4AT3A 2GFCA 2UZUE 4BIEA 3S3IA 2OWBA 3MA3A 3LZBA 1Q8TA 4J8MA 2B52A 2AYPA 4M97A 2J5FA 1ZARA 4W9WA 4U3ZA 4WNOA 4FT0A 3BV3A 3TNIA 5ANGA 3VW8A 4FKRA 2BRGA 2JEDA 3CQUA 3DKCA 4ITJA 4JIAA 2BUJA 4LUEA 5C8MA 5EYKA 3FMNA 4NUSA 5IG1A 3NW5A 5CQWA 2YJSA 4ALUA 2B0QA 2PL0A 2VX3A 4NM3A 3UZRA 3NNXA 5L2WA 3QU0A 4JBPA 4DEGA 1FVVA 3H9RA 3NEWA 5HG5A 4I5CA 5HLPA 3OHTA 3SDJA 1YWNA 5CNNA 5CEQA 2UW4A 5F95A 4ZTNA 3MTLA 2X9FA 3F61A 3SXFA 1H1SA 4MYGA 2HELA 3KMUA 4F6WA 4FR4A 4KINA 2H8HA 1JKSA 4EH5A 4LFIA 4PL3A 3EQFA 4TN6A 3BYSA 2O2UA 3ZUUA 2WTVA 1BKXA 4PTCA 2VNWA 3W2OA 4PNIA 2YEXA 4OTGA 3ZLXA 4LG4A 5HIEA 1KV2A 3JY9A 3U4UA 2X6DA 3SKCA 4IDVA 3FZPA 5GJDA 2UVYA 3EN4A 2R3HA 4OW8A 5E8ZA 2J7TA 4P4CA 4BDAA 3V5WA 4G34A 1TQIA 3RHXA 1PXPA 3CIKA 4Y73A 5E8WA 3W8QA 1FPUA 3R0TA 4BCFA 4EOOA 3VHKA 1ZZLA 1DI9A 3AT3A 3ZEWA 3UDBA 1M2QA 4HNFA 1YHWA 1JPAA 2XJ1A 3RPYA 4OTHA 3OCTA 3ATTA 4Q9ZA 3DXPA 2QOIA 5AP1A 3RZBA 1YKRA 4BIBA 5M55A 3HMNA 1W84A 3BELA 3LOKA 2GNJA 3C0GA 1H24A 4F0GA 2YITA 4R6VA 5ACKA 3VS4A 3QTSA 5GINE 3ZO2A 2ZMCA 3FBVA 4QPSA 1BUHA 4CYIA 5CANA 4RVTA 3MB7A 2UV2A 2WHBA 2GS6A 4RJ3A 5GIPE 4RJ7A 2W1EA 2WQBA 2IZTA 1H1WA 4BCHA 1XO2B 3O8TA 4D55A 1A06A 4IJPA 2QURA 4XV2A 1PW2A 4RIWB 4EKKA 3U6IA 4KUJA 2ITQA 3VQHA 5B2KA 3GQLA 3PVUA 4G3EA 3CPBA 4HYSA 2XCHA 4BGHA 2YDJA 3P79A 4I1ZA 5HU9A 4W4XA 1U54B 5LMKA 2G2FA 4GKHA 4S33A 4WIHA 5DG5A 4ZTQA 4E93A 4R7IA 3HZTA 3R28A 1BI8A 4ACMA 3RPVA 3QX2A 3ZH8A 1QCFA 4AGUA 4C3PA 4E20A 2C3LA 2VO0A 3ZLWA 1YOJA 4DH8A 5TO8A 5IQAA 2P2IA 3FHIA 2XJ2A 4AW1A 3VULA 3NUUA 4AXAA 4DF3A 2QOKA 3QF9A 3MYGA 3RPOA 3U6HA 5FG8A 5CI6A 1Y91A 5DE2A 2GNFA 3R63A 3COHA 4AA4A 1ZXEA 1ZLTA 5EHOA 2PVJA 3E8NA 2YDKA 4FIEA 2HZIA 3BPRA 3BV2A 4RFYA 4WG3A 4ASEA 4UMTA 2WTCA 4C36A 2O8YA 1H26A 3EKKA 3NYOA 1J7UA 4N6ZA 4IX4A 4LOQA 4NKSA 4QTEA 5AV4A 1G8AA 1PY5A 3QA0A 4XOZA 4ZTMA 4C4IA 2ACXA 5DLSA 3D7TA 2RF9A 3WE8A 3LFBA 4TTHB 5HBHA 3ZUVA 4KNBA 5JFXA 2CMWA 1U5RA 2QU5A 2G2HA 4XG4A 1H0VA 1SZMA 1NA7A 4HCVA 4IB5A 2XNNA 1J91A 4BDKA 2F2CB 5E7RA 1CSNA 3FLZA 4HGEA 2I0HA 3O2MA 4QQ5A 4FKIA 4BKYA 2PVNA 4AOIA 5HTCA 1STCE 3ROCA 2XK9A 1NY3A 5L4QA 4DT8A 2ZJWA 2PVKA 4DFZE 5FDPA 1BLXA 4EI4A 4FVRA 4K18A 3PWDA 2WO6A 1SVHA 2IO6A 2QI8A 3GFWA 3QQFA 2Z7LA 3IGOA 4K2RA 4D4VA 5K4IA 3DGKA 3C5IA 2W1IA 4R3CA 1YXXA 4O7ZA 1Q99A 1KE8A 3ORZA 4FT5A 4K6ZA 1WFCA 2E9OA 4IJ9A 5CX9A 4CCBA 3AD4A 4MTAA 4W9XA 4W4YA 5IUIA 3JR1A 3WZDA 4YO4A 3TEIA 3COMA 3MH0A 1SNUA 4QNYA 4F7SA 1RQQA 4X6QC 4X3FA 2JC6A 5A6OA 5J7BA 4QMMA 3JY0A 3MIYA 4ZLYA 3EQRA 4IAYA 4ANOA 3K2LA 5M4UA 1WAKA 2ZVAA 4ZY6A 1QPDA 2QLQA 3ZZEA 2WMWA 2X7OA 4QP3A 5AP0A 5K3YA 4OTQA 5E91A 3L8PA 4WNPA 5K0KA 4BWXA 2C6EA 3OEFX 4D4RA 1WCCA 5IA4A 2HWOA 3E87A 1UWJA 4A9UA 4EWHA 3TCPA 3Q32A 3HP2A 4Y95A 3TG1A 2I1MA 3FLNC 3PPKA 1LR4A 3A7FA 5JGDA 3BYOA 4FTLA 3QLGA 4IZ5A 3FI4A 5DT4A 2IN6A 2XK8A 4Q2AA 5FM2A 3A7IA 4ACHA 3UNKA 3U51A 3UQCA 5FEDA 5AAFA 2UZNA 3ZM9A 1XH4A 3S1HA 4IAZA 3VQUA 3FHRA 1JSVA 4DBXA 1VYWA 4GV1A 4LRKA 5J79A 3R71A 3LMHA 1MRUA 1ZYDA 2F49A 2QKWB 2VAGA 3DPKA 3FMDA 3KN5A 4MNEA 4QTDA 4RX7A 5DH3A 4Z9LA 4C33A 4GKIA 3CD3A 3MB6A 5EM7A 4G3DA 3TZ7A 5KMKA 3FSKA 4JDKA 4FG8A 3QKKA 3A61A 3OXZA 1XQZA 3CTJA 4FIGA 4IAFA 4MH7A 1P5EA 2XMYA 2WNTA 3C50A 3R7GA 1M7NA 4RWKA 4W8DA 4ENXA 4WO5A 5EI8A 3IONA 5AA8A 5FBOA 4FEVA 5L8JA 3GCPA 3V8TA 4FG9A 4OBPA 1TKIA 2V22A 2J0LA 1M7QA 1XH5A 1YI6A 3G6GA 3PG1A 4GJ3A 3LW0A 4R5SA 3RINA 3SG8A 2VGPA 3G0EA 2ZYBA 3EIDA 3OY3A 1SYKA 3DAEA 1UVRA 3L9PA 4PTEA 5KBQA 1Q4LA 2OFUA 4FSTA 5H2UA 3JYAA 1P4FA 5HI2A 4IVBA 4LRMA 5GZAA 2W4KA 3FYKX 2HAKA 5AR2A 4PF4A 3LE6A 4JDHA 1DAWA 3LXKA 3N9XA 4EZ3A 4WT6A 5F4NA 5F94A 1OECA 1J1BA 1FVRA 4DTAA 3ZFYA 2BCJA 1Z57A 4WG4A 2WU6A 2VX0A 4D0WA 3V51A 2CCHA 2C6TA 4NH1A 5K9IA 3FI8A 4I6QA 1NVQA 1ZOEA 1E9HA 2I0EA 4MHAA 3KULA 4E5BA 4CKIA 4ZOGA 1GNGA 2JITA 4Y83A 5DEWA 4FEWA 3SG9A 4OTIA 5FTQA 4A9YA 4C8BA 4DGGA 2WQNA 2R3KA 5AP3A 2W1CA 3NZ0A 2OICA 2R3PA 4YZMA 4B7TA 4MNFA 4ZXTA 4TYGA 4UYNA 3EQPA 5AP4A 5HE1A 1K2PA 5JMSA 4I5PA 3NWWA 2HW7A 3OEZA 4DTKA 4WRSA 1H1PA 2OO8X
chains in the Genus database with same CATH superfamily
2W4OA 3KQ7A 4JR7A 4HVGA 4ORKA 4D9TA 3RK9A 4UYAA 5IMEA 2HZ0A 4FV5A 1Y6AA 4QYEA 2EXEA 4FZDB 2C5NA 3AC4A 4JBOA 3BEGA 3ZLSA 3ZDUA 4K77A 4KKEA 2X9EA 3FXXA 4ZEGA 5A9UA 3R00A 4PRJA 4NW6A 4E4NA 3NVMB 3F7WA 5ETAA 5FEEA 3VJOA 2CGUA 2RG5A 4BJJB 4EHZA 1W82A 4E8AA 4BDCA 3Q52A 4FG7A 2WEVA 3W2PA 4EQMA 5BUIA 1PXKA 4WHZA 5ANJA 3VS2A 4C35A 4EH6A 4EQUA 2Y4PA 4E6CA 3O7LD 5JFWA 5H8BA 5HE2A 1OI9A 2HIWA 3KB7A 4EOMA 4FOBA 5I3RA 3HVCA 1SVEA 3ZZWA 2YA9A 3PLSA 3KXZA 4RRVA 4C4JA 3WARA 3W10A 4BI1A 5M09A 3DBEA 5EDRA 3NUAA 5DA3A 2R3MA 5A4LA 4O4FA 4MXXA 5IQDA 2C3KA 4AFJA 4E5WA 5JEBA 2GNIA 4DG0E 3ZRKA 2GQRA 3FMJA 3WF9A 4YBKA 5L6OA 1O6LA 4DYMA 3TNHA 3ZO3A 5AEPA 4CV9A 4O0YA 4HVSA 2WTDA 4JX3A 4D2TA 5AR3A 4B9DA 4C61A 3UOLA 4FTMA 3KF4A 1OL5A 2R3GA 3DS6A 3I7CA 5CWZA 3C7QA 4QP9A 3GC0A 5GZ8A 5I5ZA 4FKSA 1ZOGA 1HCLA 3L9NA 5IH5A 4YTIA 4OGRA 4IAKA 2ZV7A 4TYIA 1QPEA 4AS0A 3PA3A 5L8KA 2F4JA 3QGWA 4U80A 3IO7A 3VBTA 2PU8A 2JKKA 3VBYA 3P7BA 3MVHA 2C68A 3QHRA 3PUPA 4YNOA 2YM4A 4RJ8A 4TXCA 5BYZA 4RQVA 3QRJA 3BHTA 2FSTX 1VZOA 3ZYAA 5A6NA 4JI9A 2QHMA 5KMLA 4CFFA 1OL6A 4RA5A 5CU2A 3TUCA 1YDTE 5I4NA 4H3QA 2QO2A 4JLCA 4X3FC 5HCZA 3G2FA 1XH9A 4IDTA 5IISA 1JKLA 2G15A 4C4EA 1GZ8A 2WQEA 3FJQE 3CR0A 1Y57A 3PSDA 5EDQA 5D1JA 5C8NA 3RI1A 4DE4A 5EW9A 4Z3VA 2X0OA 5JFVA 4RC2A 4RMZA 4ZZNA 3HAMA 4AXEA 5CEIA 4ASXA 2JAMA 4BCNA 1IR3A 2CSNA 4ANSA 3ORKA 4X3JA 2VTQA 3GBZA 1FVTA 3Q4TA 2IW9A 2HXQA 1UU7A 3QFVA 3V01A 1VR2A 2HWPA 3HV5A 4YTCA 4I6LA 4QMXA 5AR8A 3ULZA 3OD6X 3M1SA 4FEUA 4F1TA 3PZHA 4DLIA 1LPUA 5AV3A 4O27B 5CT7A 3PDTA 4RIXA 3GT8A 3FLWA 4CEGA 2FGIA 2QOHA 4AU8A 3R21A 4M66A 4ZSEA 5EYCA 4PMTA 1YI4A 1H0WA 4JBQA 1ZY5A 4RJ6A 2BMCA 3LVPA 4N6YA 4YTHA 2OK1A 4BCOA 2X8DA 3LCKA 5HG8A 5CAUA 3FXZA 4Y5QA 5GHVA 4GUBA 1KE6A 3NUYA 3JS2A 3RMFA 4NZWB 1BL7A 3FUPA 3LFQA 4FL1A 4Y85A 4APCA 5CAVA 4CFNA 3VC4A 2A0CX 4BTJA 3R02A 4DGNA 1I09A 2VO7A 2WIHA 3AMBA 3EL7A 3HYHA 4IW0A 5EDPA 2YLEA 5LVLA 5LVPA 2VN9A 4IBMA 5CSHA 2OIBA 1OKVA 2UW5A 3F2RA 4FTNA 4RIYA 2WQOA 3LMGA 3MH2A 3CXWA 1UV5A 3KXMA 3AOXA 3QQGA 2QOLA 1OITA 4YJRA 2BFYA 3Q04A 1PMUA 1QPCA 4F9AA 5J1WA 1GZOA 5HG9A 5EYMA 2C6MA 3RCJA 3P7AA 1DAYA 3UNJA 3OBGA 5IQIA 2R64A 3FPMA 1RE8A 3PP0A 4LL0A 5L8LA 2XAMA 2V0DA 4KBAA 4EK4A 4EKLA 2RGPA 4YR8A 4FC0A 3OS3A 4XS2A 1Q3WA 4KRDA 2XKDA 2IVSA 3QQUA 4BDEA 4NEUA 5J7HA 2PVYA 3HMPA 3LQ5A 3PJ1A 2RFEA 2W9FB 4G6OA 4YHJA 3KK9A 5AX9A 2QR8A 4KIKA 4LOOA 1H1QA 4IX5A 5CS6A 4HVIA 2BPMA 2XS0A 5JN2A 1IA9A 4F4PA 4JOAA 3RJCA 4UZDA 3PVWA 3OW3A 4GW8A 2IEWA 5CVFA 2GHLA 2NP8A 3LLTA 3ZRLA 4EWQA 2PVFA 1H1RA 5E8TA 1GJOA 3DXQA 4K33A 4C4GA 4G3CA 3SLSA 3FV8A 4AE9A 5EI6A 3OUNB 2YM7A 2WMUA 3SD0A 4AW0A 3MWUA 2VWVA 4A7CA 2WFYA 4RPVA 4YMJA 5A14A 3ZBFA 2UUEA 4M14A 4AACA 4F6SA 4PX6A 1URCA 3F66A 4L8MA 4QMPA 4XG9A 3LMIA 3E3BX 3NGAA 3BHHA 1APME 4ZLOA 4PQNA 1ZMVA 3LFSA 4O7SA 5AIRA 4MQ1A 3SHEA 4FKWA 5DI1A 3OT3A 5AV1A 3GNIB 3A62A 3KY2A 5D7VA 1V0OA 4TL0A 2PE2A 5ICPA 1BYGA 3KIOC 3QQLA 4E4XA 2UW0A 4ALVA 4C58A 1SNXA 4CCUA 3W18A 5EW8A 2UW6A 3EN9A 5JRSA 4MXZA 1R0EA 3PP1A 1PMEA 2O63A 3IG7A 2I0VA 2J2IB 2QD9A 3ZLYA 4H39A 3Q6WA 5GJFA 3R7YA 3D9VA 1CMKE 4GT5A 2GQSA 2JGZA 4I6BA 4E6QA 4JX7A 1OL2A 3GU7A 4M7IA 5CI7A 3VS7A 4TYHA 3CS9A 4MD8E 4CMOA 3OROA 5IEXA 4M0ZA 2LGCA 2XALA 2I6LA 5T68A 2JBOA 4FVQA 3FDNA 3EQHA 4FV8A 4MK0A 5BPYA 4YZBA 2ITNA 4DAWA 3QCXA 3RNYA 3WYYA 1UA2A 3MPAA 5E8XA 4BCIA 4BZDA 2R5TA 3FAAA 2IW8A 3TN8A 3I4BA 2VZ6A 3CD8A 4G9RA 3IW4A 2GTMA 3G0FA 2OXDA 3ZO4A 4GU9A 2QHNA 4FL3A 1ZYSA 3PUFC 4DFLA 1WBWA 4DGLC 4YZCA 1WVYA 4F1MA 1OIQA 3PWYA 4O4BB 2WELA 3ZCLA 3M2WA 5IQEA 4G6NA 2B9FA 3CE3A 3W8LA 4AP7A 2YAKA 5EK7A 4RBLA 5B7VA 4HYHA 4IZ7A 4ACCA 3NUSA 2ZV8A 3NFGB 4BGQA 3LJ2A 4I92A 4K8AA 4XV9A 5GIOE 1WBVA 4FV4A 4LRJA 3W0SA 3TDVA 4FKOA 3G6HA 3VS5A 2GNLA 4O4EA 2X2KA 1OGUA 3FI3A 5DR9A 5HD7A 2VTSA 3SA0A 2Y7JA 2CLQA 1XHAA 3UG2A 2ZB1A 3E3PA 4QPAA 1YHVA 4O38A 5IKWA 4FTTA 3S4QA 3HP5A 1RDQE 3MPMA 5H9BA 2OF2A 3NW6A 4E6AA 1SM2A 3KEXA 4ITHA 2JDRA 3SX9A 4EUTA 2CGVA 3FMLA 3Q9XA 2JDSA 3CBLA 4X7QA 2QOFA 1GAGA 5KE0A 3WE4A 1FBNA 4ZMEA 1IEPA 5DR6A 4S30A 4FICA 4WUAA 4MNEB 3I7BA 4M0YA 4V01A 3QX4A 4BVUA 2BTRA 4V0GA 3VHEA 1QPJA 3TTIA 4JT3A 1Z5MA 4G17A 3Q53A 5T6KA 3NAXA 5BX0A 3LCOA 4KRCA 4QQJA 2C1AA 5J5SA 3BBTB 4O82A 4NW5A 3LPBA 2ZB0A 4CKJA 5IF1A 4NU1A 4TNDA 5L2QA 1Q24A 3F3TA 4A07A 4O7NA 3COIA 1JAMA 3PVBA 4UY9A 2EB3A 3FC1X 4F63A 3DJ6A 4EHVA 1G3NA 4XCUA 5KZIA 5J9ZA 5EM8A 3OP5A 3U6JA 3UO6A 4X21A 5IEYA 1K9AA 2XH5A 3UQFA 2PUNA 2R3NA 3ODZX 3TIYA 5KHXA 1KOBA 2Z7SA 1IG1A 5FTGA 4U3YA 4IH8A 3V5PA 2W99B 2XVDA 3P7CA 3OTVA 1J7LA 5CXHA 5ANEA 4B99A 2OBJA 3N4VA 3NCGA 4HVHA 4O7LA 5FRIA 5CENA 2J0KA 3ALOA 1R0PA 4YZ9A 2VGOA 3HMOA 4DEEA 1IRKA 2C6OA 3I6UA 4S32A 3E8EA 2Z7RA 3KN6A 4M69A 5HOAA 5I9ZA 3QD0A 4ZTRA 3A7GA 4W4WA 4DEDA 5LWNA 3E93A 3QKLA 4LL5A 3ENHA 1E1XA 4FKQA 3GEQA 4XHKB 2VWXA 5KUPA 1Q8UA 1REKA 3CKXA 3HX4A 3PJ3A 4ZTLA 4R5YA 4PV0A 5E8VA 1GY3A 4L3LA 3U55A 4F7LA 3DDPA 5CAOA 3OTUA 2XIRA 5HESA 4FKLA 4AFEA 2GS7A 1Q8YA 3KULB 3C13A 3NYXA 3EFWA 2B9JA 3QD3A 4MAOA 4AA5A 4EQCA 3PA4A 5EM5A 3LFNA 5JFSA 3WF8A 4ZS0A 2A27A 3E63A 4AZTA 3I1AA 3DCVA 2YLFA 1H08A 4WG5A 4BCJA 3WZUA 2XNGA 2J9MA 3HV7A 4FGBA 4NSTA 3QBNA 4QPMA 4AGCA 1IAJA 4IB1A 4YJUA 1GZNA 2BR1A 4BDBA 5KKRB 1S9IA 2WMAA 4QP8A 3PZEA 5DMZA 1WBPA 2QO7A 4XLVA 4FIJA 1AQ1A 4EUUA 4E5AX 5CU3A 4F9WA 4RX5A 5EQYA 2GQGA 5L3AA 2W0JA 4FV9A 4PDSA 3L9LA 3NNUA 5EI2A 4EH8A 5JZNA 5CTPA 2GPHA 2Y4IB 3FE3A 3Q4UA 4XG7A 3G9LX 1H8FA 2H6DA 4P5QA 4U45A 4XRLA 1BL6A 2WMXA 5AUYA 4C2VA 5CASA 4M15A 5M08A 5AP5A 2XM8A 4YJNA 2BKKA 2HY0A 3CEKA 1G8JA 4Z16A 4UZHA 3POZA 2PZRA 4O7VA 2QOOA 3D94A 4YNEA 3G15A 5TOZA 3EQIA 1VJYA 3DQWA 4RWLA 4ZTSA 2C47A 1YXUA 2WAJA 4ZP5A 4GT4A 3QTXA 3FZSA 5CNOA 4WKQA 4CYJA 3BQRA 4D2VA 4JR3A 5HBEA 4WNMA 1CKIA 3PPZA 1V0BA 3BLAA 2CLXA 2NRUA 3EHAA 3EWHA 3NIZA 5FWKK 4ZS4A 2CDZA 4IWQA 3MA6A 4FZ6A 4G2FA 2R9SA 4M67A 3P86A 4N70A 3IW8A 4AA0A 2WGJA 4D0XA 4KKGA 4ZLZA 4RX9A 4KIPA 1B39A 4I3ZA 5E4HA 1Q3DA 4C57A 2WQMA 3VS1A 4F08A 2SRCA 4ZY5A 4MBIA 4QP2A 3ZFMA 4HCUA 3JXWA 3QYWA 1BI7A 4EC9A 4D2SA 5AV0A 3OW4A 4ANNA 4MWHA 3EQDA 3BZ3A 3MY5A 4R77A 4Z55A 3BLRA 1V1KA 1PXNA 2WTKC 1FMKA 1P14A 3ACKA 4YGAA 2UW9A 4YHTA 4O0WA 3U87A 5BMSA 5CF4A 2KULA 4BBMA 1OM1A 1FMOE 3MBLA 1EH4A 4ACGA 1OB3A 3BE9A 3TWJA 3CKWA 4BDIA 1CM8A 3IW7A 3G90X 3TM0A 2NPQA 4LUDA 3JVSA 5DRBA 1LP4A 3UC3A 4FIHA 5HLWA 4IIRA 4AXFA 3FKOA 3F5PA 2OKRA 4GU6A 4XBRA 3HDNA 4QMNA 1KE5A 3O0GA 3V5LA 4EL9A 4BR3A 4L46A 3QUPA 3OFMA 4FSWA 3KXNA 4KD1A 3OC1A 3DBCA 3U54A 5HVYA 3OWKA 4RVMA 1BMKA 1YXSA 4AN9A 3EOCA 1XBAA 2XK7A 3V5JA 4RJ5A 4S34A 3UIBA 4FV3A 4HVDA 5KX8A 4A9RA 4QO9A 1YHSA 1F3MC 3MVLA 2ITYA 2HCKA 4GYIA 3ZONA 2XNBA 4FK3A 3BU3A 4B8LA 3FY2A 4I6FA 3Q96A 1JKKA 2OJJA 3Q9YA 4Q5HA 1PYEA 5HO6A 4HZRA 2QOBA 4EH4A 3ZXZA 3BI6A 4IXPA 1BX6A 2EWAA 4UMRA 4FTCA 5M4CA 4RZVA 1V0PA 4BHZA 4CTCA 2CKPA 4JNWA 3GXLA 4BCGA 4RIXB 4U0IA 3FQEA 2VTOA 4GS6A 3FMMA 4L44A 4USFA 3ZUTA 4FKTA 5D41A 3QYZA 4GK3A 3TTJA 2EUFB 3MPTA 3OT8A 3B8QA 3NFFB 3BYUA 3F5GA 2QNJA 2X7GA 3QCQA 4E4MA 4N57A 3MJ2A 2LAVA 4KS7A 4NCTA 2C6IA 3MH3A 3KU2A 4ZJVA 5CEOA 2B53A 3A7JA 5E1EA 3ORXA 4PPCA 3OF0A 2XKEA 2YN8A 3RPRA 2PY3A 5CT0A 3PA5A 4FMQA 4GFOA 4J52A 3DY7A 4C3RA 2QG7A 2NYAA 4MXCA 1ZWSA 4KBCA 4ID7A 5HZNA 4DCAA 3LQ8A 3MV5A 4AF3A 3WIGA 5FQDC 3A99A 3FMHA 3H3CA 3O8UA 3L1SA 3Q4CA 3R9NA 3A7HA 3S95A 5EOLA 3TL8A 4Z7HA 4HPUE 5FLFA 3W2CA 4B0GA 2YCSA 3VUMA 1NT2A 5FEQA 2OZAA 1K3AA 1OMWA 3DZQA 3W33A 4F09A 3FLSA 4GIIA 2V62A 4FT9A 5EW3A 3RGFA 5JGAA 2G2IA 2REIA 3FQSA 4DTBA 4H36A 4YLJA 2PMNX 3TKHA 2CGWA 3WZKA 2OIQA 4DGMA 4JQEA 4R78A 5B0XA 2VTLA 3NUNA 2NNWB 4MD9E 2Q83A 4ZMFA 4H58A 3ZDIA 4DH3A 2XEZA 4J99A 4YUQA 4YC8A 4TW9A 3NAYA 4FNWA 4KIKB 4RFMA 3IPHA 5BVDA 1GIHA 2XYUA 4YJOA 2XIXA 5BQ0A 3LFEA 2Y6MA 3EQCA 4LQMA 1FGIA 4KKHA 4CXAA 3TNWA 1A9UA 2JFLA 3QC4A 4O4CA 2ITXA 3Q5IA 5EKOA 1NXKA 3MY0A 4FSRA 3NUXA 3QHWA 3VUGA 3HA8A 1XH8A 4EEVA 5BVOA 2BFXA 3LFFA 3OCBA 4G1WA 3M42A 3BCEA 2JAVA 2YISA 2P33A 4U44A 1WBSA 5LCJA 3UPZA 4NM5A 3DKGA 2IPXA 4BZNA 3LM0A 4K11A 2YZLA 3LKMA 3UO5A 2CHLA 3BLQA 3Q60A 3P0MA 2PSQA 2XA4A 3CP9A 5HBJA 5JT2A 4CGAA 3KGAA 1W98A 3BU5A 3L8XA 3UNZA 4AAAA 2PZIA 5I9VA 3LFCA 2PZ5A 4D1ZA 4IVCA 2OXYA 2WEIA 5JQ8A 4EH9A 4DHJA 3DFCB 2OFVA 3POOA 2IZSA 1Y8YA 2EB2A 2PTKA 5IA0A 1GZKA 4FYNA 1ST4A 2QCSA 4H1MA 1FINA 4AGDA 4M12A 2VWIA 5IDNA 1Q8ZA 4TYJA 4RWJA 2R3OA 2XKFA 5I9YA 1JVPP 4J8NA 5HNIX 3S00A 5HTIA 5A4QA 3BKBA 4DFNA 2IW6A 4R7HA 5CALA 1H07A 5JKGA 4IQ6A 4FTQA 3P5JC 2XK6A 2CKQA 4IEBA 3VN9A 5FP5A 4CQEA 1PMVA 2BROA 4G31A 4I23A 3LIJA 1QMZA 4QT1A 5BMMA 1ZY4A 2EU9A 5M4FA 2CNVA 3SRVA 3ZEPA 2ZM4A 3VRYA 2J5EA 3R04A 3C4CA 2G1TA 2Z7QA 3AGMA 2AUHA 2XNMA 1H27A 4HZSA 3EN5A 4AOTA 4XG6A 3OOGA 4NFMA 3R9RA 1U4DA 2XUUA 4MUQA 4TT7A 2FH9A 3SOCA 3NVKI 3BX5A 2YERA 5HVJA 4EK8A 4CG9A 3KVWA 2R7BA 3UMWA 4F65A 4O86A 3DK3A 1HCKA 2E9VA 4WSYA 1YVJA 3K54A 2IJMA 4I0SA 4JRNA 2O5KA 3I5ZA 3TV7A 3FEGA 2XZSA 3QD4A 4AG8A 3KRXA 3AD6A 4JVGA 5A4EA 4MBJA 5H8GA 4L00A 3FZ1A 3GC8A 4BTKA 4X2GA 2VRXA 4NKAA 2B54A 5HO7A 4RIOA 3CC6A 2NO3A 4YZNA 4X2KA 1XBBA 3OVVA 5IZFA 5ACBC 4KWPA 4UBAA 5E90A 4I21A 3F3ZA 1MUOA 5HCXA 3D0EA 3LCSA 4PP7A 1ZYJA 4D4YA 5CF6A 2X8EA 2VTJA 2WKMA 4FV2A 3SOAA 3R73A 1U46A 3BEAA 5CAQA 2ERKA 3BWFA 4FNYA 2AEGA 4FTOA 2ITOA 3WF7A 3MSSA 3NLBA 1U5QA 3RBWA 3K3JA 4IWDA 4XP2A 3NCZA 5DBXA 4CZYB 3MGYA 3GCQA 2OF4A 2W1GA 4RQKA 3IGGA 3UG1A 4R3PA 5CSVA 3SQQA 2VWUA 3RWPA 3GCUA 4L52A 4D58A 4V0GB 4DFYA 2C30A 4ZTHA 5GJGA 4Z7GA 5JK3A 4U40A 3KC3A 2IZUA 4D1SA 4YLKA 5C26A 3UDSA 3R22A 1CKJA 2OJFE 3FXWA 5HIDA 4AQCA 3AC5A 4U97A 2H96A 5EOBA 5HNBA 3PIZA 3PJ2A 4XMOA 3H10A 4CD0A 3MS9A 3HLLA 2F9GA 3H9FA 5F9EA 4RC3A 3UVRA 5DOSA 3RAHA 4NCTC 4GG7A 4LOPA 4O0VA 4O1OA 5DHJA 4EOKA 3LFAA 3FL4A 2OG8A 4DEHA 5I3OA 1B6CB 2CJMA 2V55A 4O7WA 2PPQA 2A2AA 3SW4A 2VTMA 4FUYA 1M17A 3TNQB 4O2ZA 3AT2A 2CKEA 4AZVA 4EC8A 3QZFA 5LOHA 2Y0AA 1ATPE 3PXQA 2ZDUA 4BGGA 3EZRA 4DT9A 3NW7A 3QQKA 4C02A 2VWZA 5AUWA 3BWJA 3O96A 4FV0A 3ID6C 4DC2A 4WRGA 4NWMA 3DLSA 5KO1A 4YZDA 3QLFA 2OZOA 4G6LA 4M69B 4RIWA 4YJVA 3UYTA 4EBVA 2X7FA 3BHVA 4BY9E 4EK6A 1PXMA 1WVWA 4UB7A 2PUIA 4LYNA 4CG8A 1U59A 4CKRA 2XEYA 2UZLA 2X8IA 5L2TA 5BYLA 1OIYA 4EONA 4QMQA 3VWAA 3C4XA 3GU4A 4FYOA 3OCGA 5C27A 2ITTA 1XBCA 2A98A 4YC6A 4ZSAA 3TACA 2R3RA 3NIEA 5J87A 3FMEA 3I5NA 3QTQA 3FSFA 4FF8A 4BDDA 2UZDA 3RZFA 4F78A 2Y6OA 3OZ6A 2C6DA 5CZIA 1O6KA 1YDRE 3TJCA 4BHNA 4RC4A 4CV8A 3HEGA 3IECA 3TUBA 2CGXA 2XB7A 2XNEA 3DAKA 4HNIA 4TKSA 2V7OA 5CLPA 4C4HA 3P4KA 2OGVA 2XCKA 5LQFA 4GG5A 2GS2A 2YCRA 4BCQA 4QMSA 1XH7A 3I79A 4IX6A 1ST0A 1DM2A 1OZ1A 2GNGA 4EOIA 3C5UA 3W0OA 4GFGA 2HZ4A 1J7IA 4XP3A 4H3BA 3HV4A 4CTBA 3JPVA 4BTFA 3ZU7A 4U43A 4KB8A 2XP2A 1CKPA 4IM0A 4F0IA 2ZAZA 4WSQA 4M8TA 3W2SA 3GQIA 3OWPA 5TKDA 3U9NA 5J9YA 3U8WA 3VBWA 4RGJA 4YP8A 1MQBA 4AOJA 2WIPA 5BUJA 2EVAA 4AWIA 1OUYA 1P4OA 4TWOA 3TZMA 4CFXA 1OKYA 2FSMX 4U5JA 4BDFA 4IB3A 4L01A 4MXAA 4Y46A 3Q5ZA 2VV9A 3NYVA 2I7QA 3NDMA 3QTWA 4L9IA 2HW6A 3KCKA 5EG3A 4KIQA 4F0FA 2B9HA 2OW3A 3FZOA 3NR9A 5CAPA 2GHGA 2UZEA 2VTIA 3DV3A 3REPA 2OU7A 5AM6A 3UC4A 3DTWA 2QR7A 3THBA 2R7IA 4F1OA 3G33A 3EYGA 4GT3A 3NNVA 3RP9A 2QVSE 2C3IB 4C34A 5CU6A 3NUPA 2NRYA 1OKWA 2HY81 3IW6A 2QG5A 3UOJA 2PZYA 4FTRA 3UDTA 3V5TA 2J0JA 3AC2A 2WMBA 5LMAA 2W05A 5M44A 3D2KA 4MWIA 3MVMA 3FKNA 4NL0A 2ETKA 2PMIA 5KMOA 4D5KA 3IW5A 4IC8A 4UXQA 4L3JA 4L67A 4J97A 3WYXA 4A4XA 5HLNA 5HIBA 3K5VA 4RG0A 5M07A 2YIQA 5F1ZA 3OG7A 2GDOA 4U6RA 3H30A 5B2MA 2VO6A 4R1VA 4CT1A 1NW1A 3ITZA 1UNLA 4IADA 4XX9A 2XJ0A 4D4SA 2P2HA 3A8WA 4HCTA 3CY3A 4UMUA 3E64A 3P1AA 3FKLA 5C4LA 2RKUA 3QCSA 5D7AA 3C0HA 1JNKA 5DIAA 4FTKA 2DUVA 4J1RA 4TWPA 4HGLA 2W7XA 2Z2WA 4FOCA 3WOWA 4JRVA 5CQUA 4FK6A 5E1SA 3GOKA 5LVOA 2RFSA 4Q9SA 3C0IA 3C51A 4G16A 4HYIA 3DDQA 5IA2A 4EH3A 3EN7A 3LXPA 4LMUA 4RZWA 3DK7A 2YJRA 3UZTA 3UZPA 2OIDA 4DEIA 3D7TB 4CVAA 3RVGA 3KRLA 4JAIA 3QXPA 1Z9XA 4O2PA 2F57A 3IQ7A 1CTPE 3HV6A 4ALWA 4AZEA 3CQWA 2A1AB 4PDYA 4CRSA 1TFFA 2J0MB 2W5BA 2HENA 5AX3A 3HAVA 3KMWA 4O1PA 4QP7A 3P5KA 3QQHA 3QXOA 2PZPA 4JXFA 4OTPA 2C5VA 3VJNA 4C62A 2W17A 1Y6BA 5DWRA 5K5XA 1WBNA 2JLDA 2JDTA 3ALNA 3GUBA 5T3QA 3ACJA 1IAHA 3IS5A 4PL5A 3G51A 3BGQA 4UWCA 2JD5A 3EB0A 4NJ3A 5FDXA 4RA4A 3Q6UA 2E9UA 4E1ZA 2PK9A 4W8EA 3IDCA 4ERKA 4KA3A 5EFQA 3NPCA 1O9UA 4UWYA 3UVPA 4E26A 5DYJA 2RG6A 4GRBA 2BALA 4YJPA 1W7HA 5HO8A 5IQGA 3PXZA 3CLYA 4AZSA 4BZOA 2YDIA 3OUKA 4QP1A 1J1CA 3QTRA 3HECA 2PE1A 4QD6A 4X3FB 5TE0A 3SV0A 3V8SA 2X0GA 3P78A 4A06A 3QALE 4QYYA 2UW7A 3ZS5A 4B6LA 5HHWA 2IVVA 3DBFA 2UVZA 3R9OA 2J0IA 4D1XA 2OZAB 5HE3A 4EBWA 4Y72A 3TUDA 5BVKA 3IK3A 4ANMA 5E9EA 5M06A 2IVTA 4O6EA 4I94A 4OTRA 4MXOA 2OXXA 1UKHA 5C4KA 3BU6A 3MW1A 5AR5A 4XG2A 4EJ7A 4RVLA 3TZ9A 3E5AA 2X2MA 5LCKA 3ORLA 4IWOA 4G3FA 5AR7A 4APPA 3W32A 2ETRA 2UZOA 3DNDA 4BWPA 4J98A 3JUHA 4I4EA 3UYSA 4U7ZA 4GJ2A 3QCYA 4IWPA 4ZJIA 3VBXA 1R39A 5HKMA 3IDPA 3LHJA 4DEBA 4QDEA 3ZO1A 2BRMA 2YCFA 3ORNA 5BNJA 4AZWA 5M53A 2OJGA 3DB8A 2ZV2A 5HD4A 4CMUA 3R83A 4QP6A 1T46A 3WZJA 5B2LA 3DLZA 2VWBA 5E8YA 5AR4A 1H25A 5EQPA 4BKZA 2V5QA 4FI1A 3Q2MA 4QTCA 1JSUA 1M2PA 4BYJA 3PXYA 2W4JA 3LXNA 4TYEA 2UVXA 4DITA 4DFBA 4ENYA 3ROYA 4F9YA 3I81A 1YI3A 2BAJA 5E92A 4BI2A 1G8SA 1PYXA 2OLCA 2YWVA 4XLIA 4BF2A 5LXMA 3WF5A 4FZAB 3O17A 4IC7A 4YTFA 2J4ZA 4MKCA 3AT4A 3UIUA 1XMLA 5AM7A 1Q62A 5D9HA 2W1FA 2XM9A 4ZSJA 4IX3A 2O3PA 2XRWA 4CFMA 5FTOA 4DEAA 4C59A 3PPJA 3R2YA 4OAUC 2C1BA 4FSYA 2WTIA 1OPKA 4GSBA 4UMPA 2BKZA 2PVMA 4E4LA 3PRFA 2C5OA 4R8QA 3N4UA 5JH6A 5LARA 2UZBA 4CSVA 4O0XA 2R3FA 3QRTA 2C6KA 2WXVA 5E8UA 5AP2A 2Z02A 2VO3A 4TWCA 2PWLA 4C4FA 5HX8A 5IA1A 3VF8A 4DCEA 1L8TA 3AMYA 1OL1A 4I0RA 4USEA 1UU3A 3DU8A 4IE9A 1OBDA 4EJNA 4IVAA 4R3RA 2PUPA 3GU5A 4F70A 3D5XA 3SRVB 1ZOHA 4YLLA 4AW2A 1UU8A 5A3XA 4BCKA 5ETIA 5L6WL 2W96B