2WB8A

Crystal structure of haspin kinase
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
352
structure length
351
Chain Sequence
LGSIEISNKKASDAEKVYGECSQKGPVPFSHCLPTEKLQRCEKIGEGVFGEVFQTIADHTPVAIKIIAIEGPDLVNGSHQKTFEEILPEIIISKELSLLSGEVCNRTEGFIGLNSVHCVQGSYPPLLLKAWDHYNSTKGSANDRPDFFKDDQLFIVLEFEFGGIDLEQMRTKLSSLATAKSILHQLTASLAVAEASLRFEHRDLHWGNVLLKKTSLKKLHYTLNGKSSTIPSCGLQVSIIDYTLSRLERDGIVVFCDVSMDEDLFTGDGDYQFDIYRLMKKENNNRWGEYHPYSNVLWLHYLTDKMLKQMTFKTCNTPAMKQIKRKIQEFHRTMLNFSSATDLLCQHSLFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SERINE/THREONINE-PROTEIN KINASE HASPIN
publication title Crystal Structure of the Catalytic Domain of Haspin, an Atypical Kinase Implicated in Chromatin Organization.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 120
structure length 351
sequence length 352
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2009-02-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2wb8A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2wb8A01
2W17A 5CI7A 2PZPA 4MX9A 4E6CA 3CSVA 4TYIA 2WTJA 3WOWA 2JGZA 4IEBA 3N4TA 4NKAA 5IA1A 2X2KA 2R3NA 3IS5A 5IA2A 3I81A 4RZVA 3RPVA 5CZHA 4JAIA 4EK8A 3CKXA 3EQGA 3ENMA 2YZLA 5GIPE 4X3FA 3ET7A 1P2AA 4F4PA 4CNHA 3F2NA 4QPMA 4A9RA 4N57A 4FT7A 5JFVA 2UZDA 1NW1A 3OBGA 3PLAE 5J95A 2ZB0A 2ITVA 3PRIA 4AGWA 4ZTSA 4O84A 4IAYA 3VBTA 2XNEA 3CD8A 4E93A 4ZTHA 4F7LA 2G2HA 3ODZX 3EN4A 2BFXA 5DI1A 3ZONA 3LMIA 3MS9A 3ZCLA 1QPDA 2ITXA 4UZDA 2C69A 5DEWA 5HBEA 5CF5A 3PJ3A 5E91A 3LKMA 1IEPA 4B7TA 2XA4A 4BDJA 3ZOSA 3A62A 2VZ6A 2X0GA 3MJ1A 4G3DA 3BLQA 4ZS4A 4RG0A 3VBQA 5GHVA 2ZDUA 5IQDA 3G2FA 3NAYA 2W1HA 5K5NA 4O0TA 2XIXA 3FLSA 4X7QA 3UIXA 3OXIA 5A14A 3E8NA 3QZHA 3OT3A 4X2FA 5EM6A 3UOLA 1J7UA 3QKKA 4QQJA 1CTPE 3D94A 3R00A 4XCUA 3BQCA 5AUXA 3A7IA 3CTQA 3QTQA 2WMTA 4O0XA 5HIDA 4KS8A 2YERA 4QD6A 3NLBA 5IA5A 1W84A 2C6MA 4L44A 5EK7A 3ZUUA 5BMSA 4BWPA 3A7FA 3UDBA 2WOTA 3LFDA 2XM9A 3EWHA 3WYYA 4CKIA 2EWAA 3QTXA 3DKOA 5DN3A 4ANBA 3WIGA 3FYJX 3AXWA 1WVWA 3TKUA 3C4XA 3GCVA 3UOJA 2YM3A 2ZMDA 2PUPA 1IG1A 2JC6A 3F82A 4X21A 2HXLA 4RWLA 3UIMA 5JGDA 5FEQA 1O6YA 3FLZA 2G9XA 2RFNA 3NW7A 4FODA 2WO6A 2J5FA 2F7EE 4JLCA 4EZ7A 3QQHA 4LGDA 4C4IA 4CEGA 1ZARA 5GJGA 4IVAA 3B2WA 4XUFA 4BY9E 2J2IB 4I6FA 1OKYA 2IVSA 4RWJA 5I9UA 4KSPA 4NK9A 2ZYBA 2VTQA 2NPQA 2XIKA 3D7TA 3IW4A 3ZEPA 3DTWA 2IVVA 2UW9A 2CKOA 3C4FA 1KE6A 4FT3A 1ZXEA 4HYIA 4RPVA 3WZKA 5AADA 2OJ9A 1U59A 3SOCA 2LGCA 4FBXA 3CD3A 2QKWB 4GUBA 3I0QA 3FMLA 5JN2A 2PE2A 5IDPA 2XIYA 2OU7A 2VWIA 4KB8A 3BPRA 2XBAA 2XK9A 4FG7A 4CQEA 4J71A 2PSQA 2GQGA 5M53A 4FTRA 5HX8A 2C5NA 5I9WA 2YLFA 2J50A 3ATSA 3QWKA 2QONA 4Q9ZA 4YZNA 3EN5A 5C9CA 3RAKA 4D1ZA 2RIOA 1BI7A 4H36A 3A8WA 2OG8A 5H3QA 2C4GA 3MVMA 4IDVA 5CQUA 3SXRA 4C3FA 3AD6A 5A3XA 4PPBA 5LVPA 3IDCA 3OP5A 2YDKA 4TYHB 4BB4A 4YJQA 4D1SA 5FDPA 3DQWA 2QOOA 4IE9A 2WZJA 2ZJWA 1WBNA 2J0KA 4IH8A 4UB7A 3ZM4A 4R8QA 5ACKA 4OBPA 4L00A 5AP1A 4AX8A 4CMTA 4I5CA 2Y6OA 4Y72A 5B7VA 4FZFB 5L2IA 1JSUA 3K5UA 3MIAA 5AP2A 3ZSGA 3I1AA 4ZMFA 4S31A 3O0GA 1YHVA 2R3LA 4QQCA 2RGPA 3BLRA 3F5PA 3L9NA 4K6ZA 2IW9A 4RVKA 1WAKA 5M4FA 4EH8A 3FMHA 3ORPA 3TI1A 3U6HA 1JOWB 4J52A 4J98A 2C0IA 4O0WA 1FQ1B 1H27A 4JRNA 3TG1A 3TNQB 3EQRA 4ANNA 4EEVA 2PVLA 5ETFA 3NUYA 3RINA 5IH4A 5J5TA 3ZLWA 3D7ZA 1GIJA 5DE2A 3QXOA 1KE8A 5CXHA 5EYMA 5HO8A 4EK6A 2GHLA 5AUVA 4B9DA 1SMHA 3TNHA 4E3CA 1KE9A 3JVRA 3Q32A 4OTGA 4PP9A 3DAEA 3JXWA 5CLPA 4YO4A 1IA9A 4NL0A 2XJ1A 4ALUA 3NUNA 3PE2A 2PUIA 5JH6A 3W33A 5I3OA 3DB6A 4BDDA 3HUBA 5F4NA 4EOKA 4IAZA 5BVDA 1UVRA 2C30A 3UYTA 3E8DA 3W2RA 4Q5EA 4QMPA 4WBOA 4LUDA 3F61A 4IJPA 4EQUA 4KIQA 4O0RA 4CZYB 4BDCA 3E3PA 3LM5A 2YIRA 2X6DA 4OUCA 3RNIA 4FE2A 4IAFA 4L3JA 4YO6A 4O0YA 1ZYLA 4QMWA 4YC3A 3HMNA 5D1JA 3SXFA 2F7XE 4YR8A 1XWSA 3R7UA 3OW3A 4ANLA 2PVHA 5L2QA 4JG7A 2YAKA 3ZC5A 4F9BA 4OTDA 2XYNA 2ERKA 4I0SA 5KKRB 4RC2A 3RAIA 4ZLOA 3ZXTA 4H3QA 1FGIA 3R8VA 3DK6A 4FKPA 1GZOA 5KZ0A 3NRMA 4JDIA 4PDYA 5CF8A 2R0IA 1OKVA 1U54A 2PVKA 3OCBA 4JL9A 3TDVA 3RVGA 3TIZA 1WBTA 3HUCA 4IBMA 5CF4A 3W8LA 3ZLSA 3ATTA 5J87A 3E3BX 4EUTA 4U0IA 4IB3A 3Q3BA 3KEXA 4O7LA 4F1MA 4YJPA 1Q3WA 1YHWA 3OY3A 4JQEA 4QMVA 4L3LA 5EM5A 2B9FA 5HE1A 2E2BA 4LMNA 4E6DA 4ZY5A 2BKZA 5A4EA 5EI8A 4GS6A 3RK5A 5E8VA 3MIYA 1GY3A 4LFIA 5AAFA 5BNJA 3UP7A 4P7EA 4TWCA 3VS7A 2X7FA 5L2TA 3H10A 2GS7A 3OC1A 4YLJA 4Q2AA 4ASDA 1CM8A 4EOSA 4G6OA 4JIKA 1ZMWA 4BGQA 4QMZA 2R3PA 5CEIA 3CQWA 4MF0A 3D5VA 1WBWA 3UO4A 5A46A 1OKWA 3SOAA 3KREA 4AOJA 3W2PA 4U45A 3GEQA 3KVWA 4O1OA 4QP1A 4ZTMA 3FZ1A 3GC7A 3GQIA 3IONA 5FWKK 4PY1A 4HVDA 3CR0A 1OIUA 3ELJA 4IFCA 3P79A 1PXPA 4M3QA 4WRSA 3FKNA 4IX5A 3TKHA 3UIUA 3EQBA 4A4XA 4CTBA 2XNOA 1NVSA 3B8QA 5I9XA 1ZOHA 3OCTA 1UV5A 3BYUA 3F9NA 5JKGA 4FNWA 4L68A 4EC8A 4BVUA 2I0YA 3TNWA 5IF1A 2PUUA 4TYGA 1OUYA 2PZRA 2WGJA 3MPTA 1L3RE 2RKUA 4PL3A 3SV0A 4Z7HA 3PVWA 4XMOA 3U6JA 3PE1A 4YZDA 2WIHA 3HL7A 4PPAA 5J9YA 2R3IA 4D4VA 3LFBA 2OXYA 4F09A 4C3PA 2XB7A 2A27A 1XBCA 4BDFA 2W1EA 1X8BA 1OBGA 3TCPA 3MVJA 1P5EA 3P1AA 4GMYA 3UNZA 3KU2A 4XG9A 2C3JA 4RX9A 3IGGA 2VO6A 2YIXA 2W1FA 2FSOX 5M55A 1H26A 3HMPA 3QWJA 4F1OA 2GSFA 3ZS5A 4FYNA 3ODYX 4FKQA 4IM0A 3A60A 4RBLA 2QURA 4H58A 5EH0A 3R8MA 4FT9A 3ITZA 2WXVA 4M0YA 3EYGA 3C4ZA 2UVXA 2A2AA 3E64A 1HCKA 3V5LA 3SDJA 1Q8UA 3OXZA 4FTUA 3E87A 5JZJA 3KFAA 3RK9A 4O6LA 3QD2B 4DINA 4D2TA 2F57A 4U40A 3R7EA 4LQMA 3PG3A 4HVHA 4L52A 1Y57A 5HNGA 3Q53A 3T9TA 3DV3A 3NCZA 3B8RA 4C7TA 1M14A 5AUYA 2FGIA 2JFLA 5DMZA 4QMYA 1YOMA 5LVNA 1WMKA 1WBPA 3KXXA 4XS2A 2G15A 2CGWA 3U4UA 3TNIA 2C3LA 5LMBA 2YM5A 3A7GA 3I5ZA 4DEGA 1OIQA 1Z9XA 1CKJA 3RCDA 4PMPA 1B6CB 5GINE 3WF8A 4YSJA 1G8AA 3CJFA 4ZTQA 2PZ5A 3FQHA 4DAWA 2YDJA 4EK4A 5KZIA 4WKQA 2RFSA 3IW7A 2C1AA 3ZFMA 4AG8A 5C1QB 2OZOA 1ZOGA 4PTGA 4YPSA 5IISA 1JQHA 4PF4A 4MKCA 3VJOA 1WVXA 3V01A 5C4KA 5L3AA 5HORA 1Q8TA 2BROA 3KA0A 2CGUA 2EXMA 4O0UA 3DPKA 4UALA 4EOPA 2WHBA 4KBAA 3KB7A 1YW2A 2BRBA 3DDQA 4I5MA 4ZSAA 2HOGA 3MWUA 4ZJIA 4BCKA 1H1QA 4L46A 4HNFA 2KULA 4B99A 3QRUA 3ZU7A 4JG6A 5EYDA 3QCQA 2WQEA 2QLQA 4X3JA 4ZSLA 1W8CA 5EOLA 5IH5A 2CKEA 2OF4A 1JAMA 2C5OA 4FIFA 4DEHA 4F64A 5HBJA 4N6YA 5IEVA 3G6HA 2JIUA 4EH9A 4BL1A 5B0XA 4AN9A 4G3EA 4AW2A 5F9EA 2X9EA 3BYVA 3RTPA 5L8JA 3ZZEA 3SG9A 4MEDA 1H07A 3QALE 2VWWA 3MVLA 3R9DA 3TXOA 5I3RA 2PL0A 1Q61A 4DFUA 3QTRA 4I23A 1H4LA 4H3PA 3MGYA 4BWXA 4FGRA 5HG9A 3DBCA 3O50A 3NR9A 2XK3A 4NM3A 4TWOA 5JGAA 4HGSA 4BIBA 5EFQA 1H24A 2R2PA 3ORKA 2UZUE 4MBJA 2VWXA 5FBNC 3V5PA 1WCCA 4J1RA 5M51A 2YHVA 3K2LA 5HG7A 3ZEWA 2E9OA 3F3TA 3HDNA 2DWBA 2WFYA 3ORMA 4RIXB 5GJDA 3UE4A 4A4LA 2J0JA 3VHKA 3TZ9A 3LFSA 1I09A 4O2PA 4JT3A 2PE1A 2VO3A 3BWJA 5HD7A 2R9SA 2B53A 4MNEB 2KTYA 5M57A 4QMXA 2Z60A 4DLJA 2Y4PA 4BCPA 4GIHA 5HTBA 4I1ZA 5DEYA 2Y6MA 3R22A 3EOCA 4FV7A 3FZSA 4IDTA 1UWHA 2AC5A 3FKLA 4FUYA 5HE0A 4DFBA 3FMKA 2O3PA 3IECA 4BHZA 4USEA 1H1RA 3F7WA 4O7NA 3VRZA 3AGMA 3VBVA 4I94A 5FM3A 3I6WA 1H1WA 2BAQA 2C5XA 1R78A 3PY1A 3I6UA 3OOGA 5HKMA 3MFRA 4UYAA 4C2WA 4DG3E 5K3YA 4QMNA 4DBNA 1A48A 3R30A 2C6EA 4QP2A 4FTNA 5F20A 3WZUA 3NUSA 3E7OA 3R1QA 1OVEA 3C13A 3NYNA 5CY3A 2UZNA 3BHUA 3ZYAA 1UA2A 5DHJA 4O7VA 2XYUA 2UW6A 2GS6A 3L8VA 4YJOA 3UOKA 2QOKA 3WE8A 3OXTA 2BHEA 3R83A 3EYHA 4K77A 3U9CA 3RNYA 3ROYA 3G15A 4CLIA 3PY0A 3NNUA 1PYXA 3COMA 3FSKA 3Q60A 3N9XA 1TQIA 3ORXA 3IQ7A 1VR2A 4KAOA 2QOLA 4ZTNA 3L8PA 4QMMA 2G2IA 3QYWA 4AW5A 4UWYA 3LMGA 3F88A 3GU6A 3F2RA 2Z7SA 5CVHA 4I0TA 5CU2A 4QP3A 2WMRA 2XK4A 5AP4A 2HCKA 4G16A 1SVEA 5M4CA 3BGQA 5JFXA 3TZ7A 3FSFA 4U97A 5CT7A 5GIOE 3A61A 2CKQA 1OM1A 3G9NA 4BCNA 4FKGA 4I3ZA 3QQGA 5F94A 2G1TA 1OKZA 3G0EA 4FSUA 4BRXA 3HP5A 3A4PA 4ZZOA 3MA3A 3BRBA 3NWWA 3ORIA 4NTSA 4JX3A 4FSZA 4FTCA 3QD0A 4PRJA 4AU8A 4BWKA 4XG6A 3CLYA 3HMIA 3NX8A 4N70A 4YP8A 3FXXA 4UMPA 5HU3A 5HTCA 3DBDA 4FV1A 3W2OA 4I93A 2XIZA 4ZIMA 5I4NA 2XK7A 3RHKA 5HI2A 3LJ2A 3DZOA 2WEIA 4D2WA 5M09A 1AD5A 4FC0A 2ACXA 3PXQA 4TNDA 2C68A 3V5JA 4JAJA 4FSWA 4WG3A 3P0MA 4BTMA 3ZH8A 3LQ5A 4EH6A 3G0FA 4O38A 4YNEA 4FGBA 1JVPP 2NP8A 5CU3A 1XH8A 3NS9A 3BE2A 2WELA 5JT2A 4D0XA 3QRTA 4WSQA 4S30A 3LM0A 2QVSE 4AAAA 4EK3A 2BTSA 4HVGA 4DCAA 4FNXA 3VW8A 1STCE 2YZAA 4BHNA 1RDQE 4XG7A 2GQRA 3VC4A 5BVKA 4CZTA 3WBLA 2EVAA 5AR7A 4FA2A 3UZTA 1JLUE 4UXQA 2BDFA 3MH0A 4I6BA 4BKJA 1XO2B 2F4JA 3FJQE 4BCOA 5HVKA 5KBQA 4ANOA 5G6VA 2JFMA 2VTOA 2QD9A 4IVDA 4RIWB 2I1MA 3BIZA 3HA8A 4XRJA 4IIRA 4CG9A 4J8MA 3Q9ZA 5JQ8A 3LFEA 3NCGA 4PUZA 4U9AA 4CT1A 4E73A 4LUEA 4OTFA 1CKPA 4GV1A 3RK7A 4FTQA 4LRMA 3PP0A 3GXLA 4FKUA 4WNKA 3NW6A 3PY3A 1F5QA 4HNIA 3H9RA 4Y83A 2G2FA 5BYYA 5KHXA 4E4NA 4EK5A 4FOCA 4QMSA 4BCMA 2JAMA 4FKVA 4RIWA 4FSYA 4KIKB 2QO9A 5TR6A 4A4OA 4DEAA 4BDHA 2OLCA 4BR3A 4AFJA 2HZ0A 2YWVA 3IDPA 4IQ6A 2V7OA 5IQAA 3BKBA 3H3CA 4FKIA 4J96A 4BFMA 3PXKA 3QQKA 2IW8A 3VBXA 2ZV8A 5T68A 5ACBC 4ANMA 1J3HA 4YZMA 2NRYA 4FV0A 5AR3A 5C8NA 2R3FA 4USDA 4K1BA 4NIFB 1IAHA 2YCRA 4W4YA 4FEWA 3A7HA 4KIKA 4QO9A 4RIYB 5C4LA 4RJ8A 2WIPA 3QX4A 2VNWA 3MPAA 4BGGA 1H0WA 1XJDA 4LG4A 4F70A 1O6LA 1M2PA 3DU8A 4DGGA 2F2UA 3PDTA 2GS2A 3M11A 1LUFA 4RC3A 1MRVA 2GHMA 3KL8A 4IACA 2J7TA 4ZSGA 3RHXA 3UQGA 3FI3A 4RIYA 4MH7A 4UV0A 2BMCA 4TZRA 4XBRA 3TN8A 4AE9A 5EYCA 1IAJA 4I92A 4GL9A 1DM2A 4CFUA 4ERKA 3AGLA 1JNKA 4QMTA 1L8TA 2I40A 3GCPA 4YPDA 4G9RA 4PQNA 5GJFA 3PVBA 2X7GA 3RZFA 1Y8YA 3BCEA 3ACJA 5JFWA 4GJ2A 3IK3A 5JMSA 4MXCA 2BALA 2BRMA 3BEGA 3C4WA 4TNBA 3VAPA 4HYSA 3U54A 2R0UA 2EXEA 3NW5A 4WT6A 3T3VA 2XK8A 1HCLA 2NO3A 3WYXA 5B2LA 5K0XA 3LCTA 4F6UA 3UYSA 3FV8A 4ALWA 3R7OA 3VS0A 5AX9A 4RJ4A 4QYEA 2Y8OA 2FUMA 5DR9A 2J6MA 5HIEA 2Y7JA 3HMMA 4LV8A 4I24A 3DKFA 3E8CA 4KA3A 3SA0A 5AR8A 4DGNA 2RFEA 2VX1A 3AC1A 1J91A 4FG8A 3EQHA 4NWMA 5FGKA 2OJJA 2WTVA 2C0TA 3PJ1A 4XHKB 3RAHA 3VHEA 3ZUVA 3F5UA 4GG5A 3OEFX 1ZYDA 3OWLA 4FTIA 4BTJA 4QTEA 4O7ZA 5HD4A 3TL8A 3R9OA 2AC3A 4FL3A 4BI0A 2R3HA 5IQGA 3NMUF 3TZMA 4K11A 5DT3A 2J0IA 5J1WA 4W4WA 2XP2A 3BHVA 5AX3A 5JRQA 3HLLA 1GZ8A 2RL5A 3BX5A 3NVMB 2IO6A 3BHTA 3P9JA 3W10A 1AQ1A 4XBUA 3FEGA 2J0MB 4ONAA 4OW8A 5EDRA 3BV2A 4D0WA 3FL4A 2ONLC 1XH9A 3EFKA 4YZ9A 5ANGA 3VS2A 1Y6BA 4I0RA 3BV3A 2FSMX 4YTIA 5I9ZA 3DKGA 1YOLA 1E1XA 2A1AB 2QO2A 2Z7LA 4CRSA 4E1ZA 4ASEA 4RVMA 4CT2A 4TPTA 5IQIA 2V5QA 2RF9A 3ZO3A 4HPUE 1FMKA 2Q0NA 3BHHA 4GK2A 4YJUA 5E8TA 3SLSA 1PKGA 4ORKA 4WA9A 2WTKB 1WBSA 2VAGA 3WE4A 3P7CA 4KKGA 4J97A 3VW6A 4D2VA 4H05A 3P08A 3G90X 3KRWA 5FQDC 3O2MA 2E9UA 3DNEA 3HRBA 4AFEA 4C4FA 4HVIA 5IUHA 3BZ3A 4NUSA 1WFCA 2WTCA 3HP2A 3Q4ZA 3V8WA 2GNIA 3K54A 3LMHA 2OF2A 4OR5A 1Z57A 2B9IA 1OBDA 4O82A 4O2ZA 3QTWA 5KCVA 2WD1A 2P3GX 5BVEA 5CAVA 3OWPA 3PJCA 5AR5A 4K0YA 4IZYA 5DG5A 4DH3A 3ORTA 1JKLA 4DA5A 2BZKB 1W82A 2C3KA 1Q3DA 3UP2A 3SD0A 1MRYA 4H1JA 4QP6A 3ZXZA 2VNYA 4LGHA 2EUFB 4UMTA 3OUNB 5BVNA 1GOLA 4K18A 4FNZA 4O7WA 2BCJA 3SG8A 4YU2A 2ITOA 3DBQA 4TW9A 2HY81 3FYKX 1V0OA 3OZ6A 4AWIA 5BUEA 3TZ8A 5AFVA 3Q52A 2XM8A 4UEUA 2YA9A 4UYNA 1J1BA 4AZFA 2YN8A 2EB2A 4IVBA 5CWZA 1JKTA 2V7AA 4IAIA 3HMOA 5A4LA 5JK3A 2VTLA 4R78A 3V5TA 2CLXA 3A8XA 4YJVA 1MQBA 2BPMA 4C4GA 1QPJA 3BGPA 4HGEA 4MXZA 5CU0A 2CCIA 4UMRA 2XK6A 3LVPA 4O81A 3MN3A 3ANRA 3BEAA 5D10A 4MXAA 4P5ZA 2F7ZE 5AAGA 5DWRA 5KBRA 2B55A 3QRJA 3VF9A 4ZY4A 1TKIA 2FH9A 4QMQA 3QZIA 4GT3A 3MFTA 4U6RA 5LMKC 2R4BA 1ZYSA 5A6NA 4A9SA 3OMVA 3WF7A 2R3JA 2W1IA 4AP7A 4EL9A 3D2IA 2P4IA 5IH6A 3D83A 1BI8A 4IZ5A 4NYEA 3CTHA 1M2QA 2VGPA 5EHLA 3O7LB 3IG7A 4IANA 3QC9A 2XF0A 4NH1A 1Q41A 4MBIA 2JIVA 2VTIA 4I5HA 2JLDA 3FMEA 3TUCA 5DBXA 4BF2A 4O0SA 2YLEA 2X81A 4DFXE 3DA6A 3KXHA 5IQCA 1ZOEA 3FZOA 4DTKA 4MWIA 1H1SA 3G51A 3UMWA 5G1XA 3R9HA 4G3CA 4C4EA 4E5AX 4QYGA 4IVCA 4F99A 2R64A 5C27A 3W16A 3MY1A 5AP0A 4TT7A 5CNOA 1H00A 4L7FA 1Q5KA 2WU6A 5I5ZA 2OIDA 3KMMA 4O22A 3MBLA 3R8LA 4CGAA 3PPZA 4NM5A 4FKWA 3ZRKA 4ASZA 4C58A 3V51A 4U7ZA 1SVGA 5ETCA 4AZEA 4ACHA 1MQ4A 2GHGA 4M67A 5IA4A 1YI3A 2Z7QA 2Y4IC 3K3JA 3POZA 4G3GA 4P4CA 4BBEA 3VUHA 4Z55A 4NM7A 3Q6UA 5LWNA 3GU4A 3UGCA 3QTUA 3N4VA 4GU9A 3IW8A 1K3AA 4CD0A 4OTHA 2OK1A 3FMDA 2OI4X 3KK8A 5ANDA 4G9CA 3RM7A 4AGCA 4D5HA 3LFCA 2XBJA 1ZRZA 4HGLA 3FY2A 3QTIA 2VTMA 3GU5A 4WNOA 3EFJA 2WU7A 4EWHA 3RKBA 3KULB 3NYVA 2Q83A 2RSVA 1RQQA 4DC2A 1NY3A 4GSBA 4TYHA 2WQMA 1YVJA 4QTBA 3RWQA 3MY5A 2QHMA 3F3ZA 3HV6A 3RI1A 3DDPA 3LJ1A 2BRNA 2ITNA 2YM6A 4RT7A 5C8KA 5JQ5A 4EOQA 1FVVA 4RFMA 2F49A 3O8PA 5E1SA 3IOKA 4IB5A 4IHPA 3LFQA 3KULA 4XV1A 4FI1A 1YWRA 4O83A 1BL6A 4FTMA 2YABA 1V0PA 2GNHA 3QF9A 1ATPE 4WNMA 2W4OA 5FG8A 2W7XA 2UZTA 3E5AA 1FVTA 4XV9A 2YJRA 3QD4A 3U9NA 5EKNA 4DFNA 4CYJA 2Z02A 3L9MA 4KD1A 5DT0A 3PIZA 4KSQA 4ZY6A 4YC8A 3KN5A 4QPSA 3WZJA 4D9TA 4ZZNA 2QR8A 3LAUA 3BBWA 5FEEA 3ALNA 4F9YA 1BMKA 4EQCA 4ZXTA 4YHFA 5LCJA 3CEKA 3BYMA 2GQSA 3CP9A 2JEDA 4C8BA 2OKRA 4FV5A 2VN9A 4IX3A 3EZVA 4ITIA 5FTQA 3NUUA 4R5SA 5BUIA 1FBNA 1G8SA 4WD5A 2YACA 5AP5A 2HZNA 4BDAA 3R02A 1SZMA 4J95A 4C2VA 4X2KA 4IJ9A 4JBQA 3EZRA 3KF7A 3TTJA 2PE0A 1SVHA 2YAAA 2YIQA 2WOUA 4RQVA 3UIBA 4JOAA 3HECA 2OFVA 3I5NA 4AQCA 4HYUA 2VWYA 4RRVA 5J7BA 4R3RA 3SAYA 2UZWE 1PMUA 4QNYA 5FP5A 4FIHA 4YLKA 1UU3A 3C5UA 3EIDA 3AOXA 4HCUA 4IB1A 4UWCA 3WI6A 4BCJA 3QHWA 2QODA 2Z7RA 4LM5A 3MYGA 4PMMA 4BDKA 4F63A 2UZVA 4UZHA 5CEKA 3K3IA 3KGAA 3QUDA 4BIEA 4FKTA 4KBKA 3MI9A 5AR4A 2PMOX 4XLIA 4WHZA 3SRVB 4YTFA 4E5WA 4JNWA 2IZTA 4OTRA 1PXKA 2R7IA 2C6DA 4GH2A 4J7BA 5HG8A 4QP9A 4WO5A 5CQWA 3TJDA 4EBVA 5JFSA 3UPXA 3FC2A 4FKJA 3EQCA 2QU6A 3KF4A 4AZSA 5AP6A 4GK3A 5IMXA 3HRFA 4AW0A 4RSSA 1LPUA 3WF6A 2Z2WA 5KO1A 4MHAA 2V62A 4LGGA 4QMLA 3TWJA 4EBWA 5K4IA 2FA2A 4O86A 1WBOA 4I5PA 5CZIA 4I20A 3SRVA 4BZNA 2C6TA 4A9UA 1DAYA 4U5JA 4TWPA 4ZLYA 3CKWA 4NT4A 5E90A 5A4CA 2XKCA 4L9IA 5ANKA 1H0VA 2JITA 4MD7E 5B2KA 4RQKA 3U6IA 3IOPA 3H4JA 1PXMA 3AD5A 4QTCA 4DEDA 4EONA 3VIDA 4BKZA 2C3IB 3GENA 4XOYA 4OTWA 4RWIA 1MRUA 3R7YA 3VVHA 4YUQA 4DHFA 3PSCA 1OIYA 2QG5A 3PWYA 3UNJA 2WMQA 3QAME 4JI9A 4G31A 4R3CA 3FAAA 3FKOA 2XEZA 3BHYA 5AJQA 4B0GA 3RPSA 2X2MA 5TOZA 4XNEA 2XNPA 2AYPA 3L8SA 5DGZA 5I9YA 4GCJA 3O17A 2C6IA 3OEZA 3ZLYA 3VUDA 3MW1A 3S0OA 1YXVA 4BYJA 4C59A 4F0FA 3GCSA 4JQ8A 4IX6A 4RLKA 4NCTC 5EG3A 3KQ7A 4FZDB 4D4RA 2C6KA 4F7JA 2WPAA 5IUIA 3NZ0A 4OTQA 4G17A 2XRWA 2ZV7A 4U41A 3OTUA 3SX9A 4EHGA 4FZ7A 3E8EA 4ZZMA 2JIIA 5EYKA 3S4QA 3QQLA 3AC2A 4XOZA 5GZ8A 3D5UA 4EWQA 1DI8A 4EJNA 5C03A 5TF9A 3VUIA 2WMAA 3ETAA 4G6LA 3ZFYA 3DZQA 3CC6A 2HW7A 3C0HA 1JBPE 4S34A 2XJ2A 2ZM3A 2WMBA 2QG7A 4JXFA 3TIYA 4R3PA 3B2TA 4AZVA 3R04A 4FG9A 5LJJA 1G5SA 1M7NA 3OW4A 5K5XA 2VTHA 3MY0A 3QC4A 3JS2A 3QTSA 4ACGA 5FLFA 4APPA 4L53A 1WBVA 2VX3A 3EN6A 3ACKA 2HZIA 4FIIA 4FV4A 4M8TA 4Q9SA 2OH0E 3H0YA 3NEWA 3V04A 4JDHA 5AUTA 1SYKA 2HY0A 2OSCA 5AAEA 2F9GA 4L8MA 3RM6A 2QR7A 4N0SA 4FNYA 3VS5A 3DBEA 5CS6A 3W18A 4P2KA 3KXNA 3RZBA 1J7LA 3KCFA 4IAKA 2B9HA 3RMFA 4ID7A 1PJKA 3ORNA 5CF6A 1JKKA 2BDWA 5HU9A 4FEUA 2BZIB 1UNHA 5HVYA 4YURA 4JDJA 1RJBA 4X2GA 2QOIA 2UW3A 2W4KA 3I4BA 4FV2A 4KNBA 4M69B 3V6RA 3GGFA 3AT3A 4M0ZA 4F6SA 5FXRA 4DE4A 2ITWA 3VJNA 4USFA 2UW4A 4FEQA 3S95A 3QTZA 1UKHA 1GIIA 2OWBA 3VBYA 5EI2A 4BCQA 3GC0A 4FTOA 4RVLA 5ETIA 4G3FA 4NFMA 3IKAA 3AC8A 2VTRA 2EXCX 3GI3A 4WIHA 2J0LA 3OCSA 5FXSA 3LLTA 5KMOA 5DA3A 4WRGA 3TKIA 4TWNA 4DN5A 3CPBA 3PVGA 4HCVA 3R8ZA 5KMJA 3R71A 1PYEA 2CPKE 1ZAOA 1FVRA 5DOSA 5M44A 3TV7A 3U8WA 4HZRA 4LL5A 4GYGA 4DFZE 4FKOA 3PVUA 2B4SB 1H1PA 1PHKA 3COHA 5AM6A 5IU2A 5CI6A 2WMVA 2QI8A 2ZV2A 3D5WA 1OECA 5CEQA 2GDOA 2VTTA 4O21A 3U51A 3SVVA 3KRXA 3FZRA 3SQQA 4CFVA 1O6KA 2GTNA 3GNIB 2W99B 3VF8A 2XNGA 4A7CA 4M13A 4BICA 4J99A 4D2SA 2P55A 2C1BA 4F6WA 4C36A 4AW1A 3EJ1A 4Y5HA 3IGOA 3LQ8A 1CDKA 1OZ1A 5CT0A 2GCDA 1KE5A 4J8NA 4RIXA 3PXZA 4RX8A 4PP7A 1JKSA 4QRCA 5LCKA 1QL6A 1ZZ2A 3LXPA 4ZK5A 5J5SA 5E9EA 2WB8A 5H8EA 3MB7A 3R28A 5A4TA 2R3KA 4CMUA 4MNEA 3UOHA 2SRCA 4I4EA 3ZSIA 4ZJJA 3KKVA 4QYYA 5HZNA 5EI6A 4F9WA 2BTRA 1GZNA 4WG5A 2BAJA 5J9ZA 3DJ7A 4O7YA 5TO8A 2X2LA 3FPQA 2VTJA 2PTKA 3S00A 3ULIA 4X6QC 5EOBA 4MXOA 2PU8A 4Y5QA 1Q8WA 5HE3A 3AT2A 4FTLA 2FVDA 2B52A 4RIOA 3FLWA 2PVRA 4K2RA 2ZV9A 5I9VA 2QOCA 2A4LA 5EDPA 4Q5HA 3R6XA 4IB0A 4XLVA 2O8YA 3FXZA 2REIA 1IR3A 4E7WA 2YM8A 2W1ZA 2HZ4A 2UZOA 5CANA 5EW3A 3ZC6A 5C26A 4Z7GA 1UKIA 3R1SA 3M1SA 4ENYA 3GUBA 4M84A 2Z8CA 4AA0A 2ZB1A 4EH4A 5A4QA 3LCKA 4W4VA 2VWUA 5FDXA 4FEXA 2NNWB 1YXXA 2XUUA 3QFVA 3GCUA 2VTAA 3CPCA 3NYOA 4PDPA 4BDEA 4PTCA 1URCA 2BAKA 3NIEA 5IQHA 1ERKA 3MH1A 2YEXA 3HEGA 4A9YA 2I0EA 1VYZA 2ESMA 4I6HA 3BU3A 3FZPA 2J9MA 3UTOA 3LFNA 4FSMA 4P90A 3U87A 4JQ7A 4EOOA 5C8MA 4DG0E 4U8ZA 3PPJA 2YCQA 3C4EA 2I0HA 4O6EA 3W55A 1PXOA 3OWKA 3PA5A 4YTCA 5IUGA 4C4HA 3UVRA 3ALOA 2C47A 5HX6A 3QA8A 4FSQA 2XMYA 2VWZA 2JKQA 4FV8A 4QYFA 2XCKA 3W1FA 4E4MA 2I7QA 4B4LA 5E8YA 1S9JA 4X3FC 3OY1A 4AGUA 3OTVA 2RG6A 5EQYA 1OMWA 2IW6A 4RA5A 3RCJA 4CFWA 5HGIA 3TV4A 1W7HA 2QHNA 3FWQA 5IEXA 3GFWA 4RJ3A 3DNDA 4BCIA 4IADA 3TUBA 3T8OA 3EQFA 3GOKA 4GK4A 4OLIA 4RJ5A 5M4UA 2C5VA 1YKRA 3EN7A 1Q4LA 5FRIA 3LXLA 3QZFA 3R21A 4L67A 4N4SA 5ETAA 3E92A 3VS3A 5HHWA 4MVFA 3ROCA 5BVOA 3GVUA 5AEPA 3CQEA 4FTJA 4HVSA 1OL5A 3CQUA 1UU7A 2LAVA 3W8QA 4C37A 5HBHA 2BILB 4EYMA 3LW0A 5HIBA 4PMTA 2XKEA 3JY9A 3W2QA 4C38A 2X9FA 3DS6A 3LCDA 5AWMA 4J53A 1VEBA 1NVRA 4H39A 5L2WA 1LR4A 1MP8A 1K2PA 4HZSA 4V0GB 4YZCA 5BX0A 4QP4A 2HIWA 3HVCA 4U43A 1YDTE 4QYHA 4OGRA 4D1XA 2JBOA 3PIYA 1KV1A 2XVDA 3TTIA 5M07A 5IQEA 2VWBA 4FYOA 3P4KA 3C51A 2WMUA 4RA4A 3KXGA 3R73A 5E1EA 3F6XA 3N51A 5IA0A 5L6PA 2PULA 3O8TA 4JJRA 2O5KA 4C0TA 2ZAZA 3R7GA 1ZY4A 4PX6A 4V0GA 4DITA 1TQPA 3PIXA 2A19B 3H9FA 1P4OA 4RGJA 4E6QA 3DGKA 2P33A 1TQMA 3AMBA 4FZAB 3NUPA 4FVQA 4CG8A 4RC4A 4W9WA 4BDBA 3LE6A 4IAAA 4K8AA 3VRYA 2V0DA 1G3NA 3H0ZA 3R1NA 4ZTLA 3FXWA 4JBVA 5F95A 3OG7A 5CVFA 1SM2A 5BMMA 4GT5A 4FUXA 2CGVA 3BQRA 2ITTA 5BYLA 4NIFA 1CSNA 4GIIA 5LWMA 3UBDA 5HNBA 2GFSA 4HCTA 4G5PA 2WQBA 3JUHA 3L9LA 5EDQA 5EQPA 3LIJA 3MA6A 2WMWA 3RWPA 2IZRA 1URWA 2O0UA 4NEUA 2CHLA 2GU8A 3FPMA 3HV7A 4BBMA 2QLUA 4KINA 2CNQA 4FTAA 3LQ3A 3FLYA 4FOBA 4IWQA 4KABA 2WTDA 3NUAA 1QMZA 2GMXA 4RX5A 4OTIA 4YJRA 1U46A 5L8LA 3ZTXA 3C5IA 4RWKA 4BDGA 3KXMA 3QRIA 3EFLA 4X2NA 3KRRA 4F08A 4BCHA 2PVFA 2F2CB 3NIZA 3NAXA 3TT0A 1FGKA 3QHRA 5BVWA 3PZEA 4M68A 4CV8A 4D4SA 4AT5A 4IC7A 3ZBFA 1JPAA 4EOMA 2PUNA 4YSMA 1H8FA 3RPOA 4DLIA 3DKCA 4PNIA 3V5WA 4YGAA 5CSPA 1E9HA 1Q8ZA 4WBBB 3DJ6A 2I6LA 1XQZA 4DGMA 2NRUA 4KS7A 1M17A 5DPVA 5KUPA 4G5JA 5EM7A 3ORLA 4C35A 4AS0A 1QCFA 3VS6A 3S1HA 2WQOA 3EL8A 3NNVA 4RLLA 5L8KA 3NSZA 4PPCA 4YJTA 4YLLA 4DYMA 4EH3A 2ZVAA 4X6RA 4TTHB 3UNKA 5DIAA 1M2RA 4KKEA 1PXLA 2X6EA 4NJ3A 3O96A 3UVQA 1BLXA 4CRLA 4O27B 1NA7A 1CKIA 1AGWA 1XH4A 4CYIA 3MSSA 3ZBXA 5IZFA 4TL0A 3F5GA 3QU0A 3R01A 3NGAA 3D15A 5CSVA 5ANOA 4BTFA 5J9LA 2QKRA 4UX9A 3DOGA 4GVAA 3V8SA 3WILA 5JZNA 1Q97A 1XKKA 1O9UA 4P5QA 4AA4A 1REKA 2H34A 4FV3A 2BUJA 2R3RA 4D2PA 1YOJA 3F69A 1LP4A 1OPKA 2BR1A 5J7HA 3P7BA 5IEYA 5AV3A 4YJSA 2OIQA 5KNJA 3NYXA 1UU9A 5M56A 5CYIA 3D5XA 3COKA 1W0XC 3WARA 4C62A 4IMYA 3F7ZA 1UU8A 5HE2A 2C6OA 4O1PA 5KX8A 1H01A 2OH4A 3CGFA 3QQJA 3QYZA 2YITA 4KWPA 3W32A 4FL1A 4F0GA 3PXFA 5FTOA 3FY0A 3DLZA 3C50A 3JY0A 4TXCA 5J8IA 3THBA 3WF5A 5CXZA 5D41A 2PVJA 1GNGA 3KK9A 1ZZLA 2OW3A 1H28A 3DCVA 1MUOA 3Q9XA 4PDSA 4JG8A 4TY1A 3W2SA 5ITAA 2XJ0A 3DXQA 1XH7A 3CS9A 3ZDUA 4E26A 4MXXA 3Q4UA 4RVTA 2UV2A 4XG3A 3CBLA 4AUAA 3CY2A 5K4JA 1VZOA 1PKDA 4PV0A 4W4XA 4WUNA 3Q5IA 4FKLA 1PY5A 4FEVA 4RZWA 4PDOA 5L6OA 4NU1A 4CFMA 2HAKA 1DAWA 4G1WA 3R7IA 3ZRMA 1BL7A 3II5A 4CXAA 1PXNA 4ZAUA 2XIRA 2E9NA 3KRLA 2PK9A 3OHTA 5FEDA 4L42A 1GAGA 5IQFA 1E1VA 3QZGA 4NJDA 4CLJA 1BUHA 4ZP5A 3ZO1A 4BI1A 3PA4A 5IG1A 5IMEA 2CGXA 2VTNA 1ZMUA 4BC6A 1XR1A 4EZ5A 1NT2A 3PTGA 4NM0A 2JD5A 2VRXA 2XH5A 5AIKA 1R0EA 5ANIA 4CFXA 2VGOA 2W05A 3HYHA 4RFZA 1BX6A 3CTJA 2PVYA 1KOAA 1SNXA 5HCZA 3EQPA 3O51A 3PUPA 2W0JA 5EW8A 3IW5A 4L7SA 5KKRC 4GEOA 2Y0AA 2DYLA 5L6WL 2XNBA 4LI5A 3P23A 5EHYA 4LOPA 2W5HA 2ITQA 2OGVA 3F3WA 4GU6A 4FIGA 3UO6A 4WUAA 5M06A 3P86A 1SNUA 4IXPA 3PZHA 2X4ZA 3MFSA 2JBPA 4U81A 3R63A 3CGOA 5EW9A 3VWAA 1BKXA 4BCFA 3OOMA 2FSTX 1U5RA 2BRGA 2HENA 4EOIA 4B6LA 4KIPA 4FSTA 1PMNA 3Q4CA 4HYHA 5HNIX 4GKHA 4TRLA 3VNTA 1S9IA 4ASXA 3RAWA 1GIHA 4ZS0A 4BN1A 1GZKA 2QOHA 3LFFA 4RJ7A 2X8DA 3QUPA 3UQCA 4DG2E 4Z16A 3OS3A 4W8DA 3DFCB 3HKOA 4BDIA 1JSVA 2CN8A 4L6QA 3QRKA 4V05A 4ZJVA 2P2HA 4I22A 1RE8A 3ZMMA 3OBJA 3Q5ZA 5AIRA 2XEYA 3D7TB 4DCEA 4D2RA 4DTBA 2IVUA 3FMNA 4EUUA 3PLSA 4FKRA 5D12A 4L45A 1IA8A 1KOBA 3AMYA 1Y91A 3P7AA 3MFUA 5LVMA 1F3MC 1F0QA 3KMUA 4TYEA 5AV4A 5HQ0A 2CJMA 4BYIA 1K9AA 3ZO2A 5A6OA 2OBJA 5CENA 4QP8A 4O96A 4GG7A 5FD2A 4DT9A 4HGTA 4NSTA 3G6GA 5T6KA 4GFOA 3OD6X 3S2PA 4L43A 3DJ5A 1OPJA 2B7AA 4WNPA 2YISA 2PHKA 3MESA 2JKMA 5H9BA 2X1NA 2XKFA 3KCKA 4TYJA 1Y6AA 3RPYA 4C4JA 4CCUA 1W83A 3F3VA 4XP3A 4MD8E 1H08A 2IJMA 2O64A 3RALA 3ZSHA 4BCGA 4F7NA 1JWHA 3UG2A 4E4XA 2ETMA 5JGBA 4EYJA 4R7IA 4EKLA 3U55A 3UMXA 4I4FA 3ZZWA 1U5QA 4FF8A 5TT7A 4V04A 3DBFA 5HOAA 4IM2A 4O7RA 5DYJA 3QQUA 3MB6A 3SW7A 3TEIA 2DUVA 3BU5A 2HW6A 3I7BA 3LZBA 4U80A 4R7HA 4X0MA 4XG2A 3ZDIA 3DAKA 3L9PA 3PP1A 2ZMCA 5TKDA 2CN5A 2DQ7X 3CXWA 4Y73A 2GFCA 1PW2A 3QCYA 2PMIA 2W1GA 4JBOA 4OT5A 4KIOA 5L4QA 4UXLA 3NVKI 4II5A 5HICA 4IZ7A 3EKKA 4DH7A 4FV6A 3A4OX 5GNKA 4EKKA 4ACCA 3RP9A 1YXUA 4DBXA 5AP3A 3VUTA 4KKHA 2V55A 4CV9A 2IZUA 4UMQA 2CNUA 4FX3A 3DB8A 5BPYA 3D0EA 3FQEA 1YWNA 4APCA 4D9UA 2OFUA 4BZDA 5EM8A 5HCYA 2OICA 4ZSEA 3AG9A 5C01A 3FUPA 2FYSA 2ONLA 3OUKA 2BHHA 4LRKA 1OGUA 4E8AA 3PSBA 3BE9A 4FL2A 4AACA 4H3BA 3U4WA 5AM7A 4BIDA 3CIKA 2J4ZA 2ERZE 3OF0A 1T45A 3MH3A 5DFPA 2H96A 4FIJA 4U42A 5CAOA 1A9UA 2B54A 3QKLA 5A54A 5J79A 2OJGA 5IKWA 3T9IA 2ITYA 2CDZA 4O91A 4QNAA 4CKRA 5DRDA 5HG5A 1LEWA 3ENHA 1YRPA 5CEPA 3MTFA 2XZSA 2VTSA 4MCVA 4YBKA 2WMXA 2ETRA 3TJCA 3PFQA 4D4YA 3GCQA 3DTCA 4EZ3A 3Q4TA 4FMQA 4MWHA 2PY3A 3UC4A 2HELA 4A9TA 5AR2A 4QTDA 2B1PA 3R2YA 1DI9A 3D4QA 3POOA 2IPXA 3GU7A 4ARKA 2I0VA 3RPRA 3HRCA 4F65A 1U54B 3VULA 3FZTA 3MDYA 1UNLA 3QGYA 2WMSA 2W4JA 4MBLA 3VUGA 1R3CA 2ZOQA 4R1VA 3KN6A 4QOXA 4FTTA 5CAUA 5E8WA 4MK0A 4PMSA 4NW5A 3VQUA 4MTAA 4U3YA 3FLNC 3QKMA 2XS0A 3SC1A 3TUDA 3E63A 5CASA 1WZYA 4EH5A 1YDSE 1XH6A 2EU9A 5DNRA 4BBFA 4DFLA 4DEEA 2C6LA 4YZBA 3TM0A 4DF3A 4O7SA 4ZLZA 3O8UA 4C57A 4HOKA 3UZRA 4G2FA 3M42A 3R8UA 3SHEA 4O0VA 3TACA 2E9PA 3C7QA 4PWNA 3M2WA 4M14A 5HEZA 3HV4A 3T3UA 4JR7A 4HJOA 3ZRLA 3DAJA 5H8GA 4FSNA 4NW6A 1FPUA 2Q0BA 4JS8A 2VD5A 4XEYA 4ZTRA 4AZWA 2VU3A 4D5KA 1KUTA 5E7RA 3EQDA 3AMAA 2YCSA 4U3ZA 4UWBA 1J7IA 2ZM4A 4EI4A 4R7BA 3Q9WA 2YJSA 5J1VA 3E88A 5E92A 4U79A 5AUUA 3FHRA 3CJGA 3BGZA 2WAJA 2GNJA 4GFMA 3VS1A 4GRBA 2CKPA 5E8ZA 3MVHA 3P5KA 4U44A 5BYZA 2JDVA 4QQ5A 4XRLA 5AV2A 3F3UA 3VN9A 3ZLXA 3DK3A 3WZDA 4CKJA 5LMKA 3QGWA 1HOWA 4EC9A 1OIRA 3QUEA 2VV9A 4H1MA 3NUXA 4FICA 4LYNA 1ND4A 2W5AA 5CSHA 3KRJA 3LHJA 3C0GA 3PYYA 4YHJA 3V5QA 1OL2A 5BUJA 4M66A 4BZOA 5LQFA 4IM3A 4FT5A 4PL5A 5CAQA 2IVTA 2UW7A 3F2AA 4FVRA 2C5YA 4K9YA 4FVPA 3GQLA 4F7SA 2QC6A 2ZDTA 3UODA 5ANEA 2BRHA 2BZHB 1NXKA 3CY3A 4MAOA 2BFYA 4CFFA 2W96B 3GBZA 4DH5A 5KMMA 4FSRA 2WTWA 2Y4IB 3MTLA 3PSDA 5T3QA 2PWLA 3JR1A 3S3IA 5BQ0A 3R8PA 3VO3A 2PZYA 5HLWA 2HWPA 5HTIA 4E4LA 1CMKE 2VO7A 2RFDA 4LOOA 3GP0A 3DT1A 4MNFA 3ID6C 3HV3A 4F0IA 3F5XA 5HO6A 3JPVA 3Q04A 2O65A 2YWPA 4FIEA 2GNGA 2FB8A 3G5DA 3KXZA 4LOQA 3LPBA 2IWIA 2G01A 2OJFE 3A99A 3GU8A 3EFWA 3FMJA 2UZLA 4EORA 3HA6A 4C61A 5AA8A 2AUHA 2VO0A 4XJ0A 2CNVA 2A0CX 2B9JA 4RJ6A 3UVPA 2VWVA 2BIYA 3KVXA 4JDKA 3FI8A 2RG5A 2JKKA 5LARA 4Y8DA 3ERKA 4I21A 3D9VA 5LXMA 1B39A 1KE7A 5D9HA 4ALVA 5CTPA 4MD9E 2W9ZB 1KWPA 3UQFA 4R1YA 2FSLX 4C33A 4M15A 4EH7A 2PZIA 1PF8A 2DS1A 4IC8A 5KHWA 3MV5A 2W1CA 4GFGA 3ZFXA 2BDJA 2YIYA 5F1ZA 2X7OA 2J51A 5HLNA 4GYIA 1ZY5A 4RX7A 1PXJA 4Y46A 5IA3A 3Q9YA 5LVLA 3ULZA 1YDRE 2VX0A 5DR6A 4JR3A 2UZEA 3L8XA 4GVJA 2O2UA 5DR2A 4A06A 1EH4A 4JIAA 3AD4A 5D7AA 2X39A 4DT8A 3WZEA 5GZ9A 4JVGA 4LV5A 4OBOA 5DH3A 3QX2A 2WEVA 3RGFA 3HX4A 2UW8A 5AV1A 1R1WA 4OBQA 3EQIA 3SXSA 4QMOA 2XCHA 4OT6A 4UMUA 1Y8GA 1Z5MA 4ANQA 5BVFA 4YC6A 2R3OA 2X8EA 3LOKA 4FTKA 4M69A 5H2UA 2XNMA 3E7VA 2UVYA 4IWDA 5CX9A 3C4CA 3QCSA 1PMEA 1OI9A 2Y9QA 3QLFA 5CSWA 2V22A 4XP0A 4LRJA 4AXAA 4D28A 5FTGA 4KBCA 3HV5A 3NPCA 4GKIA 3BU6A 3FQSA 1A06A 5AUWA 3A2CA 4DGOA 2GNFA 1KV2A 3GT8A 3CE3A 1OL7A 4A07A 1T46A 3O23A 4MYGA 1YQJA 3FI4A 3L1SA 3DFAA 2BIKB 4QTAA 2VTPA 4FKSA 3RJCA 5CVGA 3SW4A 1P14A 2PMLX 4G6NA 4AN2A 4QQTA 2P0CA 3R9RA 3PA3A 4MQ2A 4C02A 1ZMVA 4AT4A 3GC8A 5GZAA 5KMLA 4F1TA 1FMOE 3R1YA 2YIWA 1PMVA 2JAVA 2QOBA 4DFYA 2YM4A 1YXTA 4YMJA 4NTTA 4I6QA 3R9NA 5HCXA 3BELA 5FXQA 3AQVA 4AGDA 3BBTB 3HAVA 4BKYA 3UC3A 5HESA 4BI2A 5DRBA 1OUKA 4YTHA 2XRUA 3O7LD 4ITHA 4EJ7A 3KC3A 4EH2A 3PPKA 2CCHA 2QOFA 4HW7A 5KE0A 3H9OA 4N6ZA 1OITA 1Q24A 3I60A 3GB2A 2PMNX 4XV2A 4YNOA 2E9VA 1UWJA 2XNNA 2IG7A 1YI4A 3QD3A 2R3MA 4OTPA 3UJGA 5M4IA 2QCSA 3ORZA 3NDMA 4W8EA 5HO7A 2B0QA 3PG1A 4CMOA 1VJYA 2VUWA 1LEZA 3JYAA 2UZBA 5L2SA 1VYWA 2H8HA 2X4FA 2OXXA 2YM7A 3IW6A 4KRCA 4YJNA 2W5BA 3D14A 2YDIA 4HPTE 2PVNA 4ENXA 4DH1A 1FINA 4D58A 2UW0A 3PJ8A 4DH8A 3LXNA 3BI6A 1XH5A 2H9VA 1OB3A 3EHAA 5TE0A 1W98A 2BZJA 2W1DA 3BWFA 5KMIA 2OIBA 4IX4A 3A7JA 3BYOA 3VUKA 4QP7A 3ZHPC 4NKSA 2GTMA 2C0OA 3QXPA 1R39A 1PRYA 3OROA 3FDNA 4LMUA 3LLAA 2JDOA 2HXQA 4ACMA 4CFNA 1XBBA 2J5EA 5IDNA 5IPJA 2YCFA 4JX7A 5JRSA 4M12A 3I79A 5E8XA 3AT4A 3LFAA 5FUTA 4TKSA 4B8LA 1U4DA 3R7VA 4LL0A 4NCTA 4XG8A 3PXRA 2PYWA 3OVVA 4Z3VA 3HNGA 2ITUA 4DTAA 4EHZA 2OXDA 4IWPA 5CEMA 1M7QA 2FO0A 4R5YA 2PPQA 5FBOA 3NNWA 1XHAA 2ITPA 3E93A 4D55A 4DEBA 3DLSA 2QQ7A 2PVMA 3GC9A 4S33A 5E8SA 4B8MA 3QBNA 1DS5A 3AC5A 3O71A 1QPEA 4M7IA 3EH9A 3QCXA 2ZM1A 3HAMA 5AA9A 4FR4A 1R0PA 5I0BA 1RW8A 2GPHA 2QU5A 4GUEA 5FM2A 4AOTA 4DEIA 4KUJA 5M08A 5HVJA 4PNKA 1B38A 2XKDA 1ZYCA 4IWOA 4FK3A 4EHEA 4GT4A 4WSYA 3Q2MA 5CU4A 4AA5A 4OAVB 1XBAA 4E6AA 4JBPA 4CSVA 4XG4A 4AZTA 5E8UA 3AC3A 3ZM9A 3EN9A 3FLQA 4ANSA 3LXKA 4E20A 5LMAA 3EKNA 3H30A 4I41A 5K9IA 2CLQA 3IDBA 5D7VA 1TVOA 3BYSA 5DLSA 3FE3A 2CMWA 5AV0A 3K5VA 3V6SA 3REPA 4QPAA 4EOLA 1P4FA 4FZ6A 2WTKC 4S2ZA 3WIKA 4BGHA 1H25A 2WKMA 3FC1X 3PRFA 3I0OA 1REJA 1QPCA 3WF9A 4CQGA 3LCSA 2W06A 4Y85A 5HLPA 3FBVA 3HZTA 4M97A 4CZUA 2BKKA 4X2JA 3G33A 4ITJA 1KSWA 3COIA 4ERWA 5IQBA 3MPMA 4NFNA 1ZWSA 4F9CA 1ZLTA 2QO7A 3HGKA 3ANQA 1APME 3LJ0A 3UPZA 4GW8A 3EL7A 1YWVA 2ITZA 4AE6A 4EHVA 4XX9A 3EB0A 4FK6A 1M52A 3PWDA 4C3RA 1IRKA 4G34A 4CCBA 1Q62A 4NZWB 3VUMA 3OCGA 2OZAB 3EMGA 4W9XA 1J1CA 4YBJA 3E62A 3FMMA 2IN6A 1OPLA 5CALA 4E5BA 2HYYA 4XH6A 1YI6A 2OJIA 4S32A 4Y95A 3TV6A 3QA0A 2W9FB 5DT4A 2JDRA 4IZAA 2JDSA 2QNJA 4JRVA 2UW5A 5JEBA 5K0KA 5H8BA 3I7CA 4XV3A 4AOIA 5A9UA 4FT0A 2R3GA 3D2KA 4IW0A 1PXIA 4AN3A 2BVAA 4K33A 2OZAA 3C1XA 1GJOA 3DY7A 4EQMA 2HK5A 3V3VA 3GOPA 3Q2JA 1UNGA 1YXSA 3PXYA 3RBWA 4ZOGA 5KMNA 4F9AA 1NVQA 1I44A 3C0IA 4MF1A 1Q8YA 3JVSA 2X8IA 3IPHA 5FP6A 4C34A 3SKCA 4EOJA 5CEOA 5KMKA 1Q99A 3HDMA 3OT8A 4CTCA 4ZMEA 4R77A 4XYFA 3Q6WA 3QL8A 4MQ1A 3VS4A 4PL4A 3P78A 5JSMA 3MJ2A 3CCNA 2R3QA 1IASA 4RFYA 4AF3A 1JSTA 4AT3A 3G9LX 3UO5A 4YHTA 4ZSJA 1ZYJA 5AUZA 5B2MA 4Z9LA 5DVRA 5CU6A 3R2BA 4RMZA 2H6DA 4DGLC 2HWOA 2P2IA 3F66A 4O7TA 4IFGA 4L3PA 3V8TA 4PTEA 5CAPA 1YHSA 2WTIA 4GJ3A 5ICPA 3DXNA 5EHOA 3KMWA 3FHIA 3ZO4A 4R6VA 2YFXA 3OWJA 2OO8X 2R7BA 3VQHA 5ANJA 5CSXA 5AP7A 5EQEA 2IZSA 2WQNA 3QLGA 5E4HA 3AC4A 5LOHA 1BYGA 3W2CA 3IO7A 5LVOA 3OFMA 3LCOA 3UG1A 3DXPA 2EB3A 3FL5A 3TNPC 4L01A 4WOVA 4ZEGA 4KRDA 4BTKA 4FV9A 4UY9A 2J90A 4TN6A 3TDWA 4V01A 2JDTA 3KY2A 1WVYA 2JKOA 1V1KA 3UZPA 3MH2A 2UUEA 4MXYA 3BLHA 3QQFA 2ETKA 3ZUTA 3FI2A 3GFEA 4UBAA 1V0BA 3N4UA 1FOTA 4QMUA 3DQXA 5D11A 1OL6A 5EKOA 1OL1A 4QT1A 4XP2A 4UN0C 3C9WA 3DK7A 2R5TA 5CNNA 3SGCA 4WG4A 4ACDA 3NNXA 3PJ2A 4CVAA 3R0TA 2O63A 2QOQA 4OAUC 5AMNA 2CSNA 2WNTA 2GNLA 4X3FB 3VBWA 2UVZA 3Q96A
chains in the Genus database with same CATH superfamily
2W17A 5CI7A 2PZPA 4MX9A 4E6CA 3CSVA 4TYIA 2WTJA 3WOWA 2JGZA 4IEBA 3N4TA 4NKAA 5IA1A 2X2KA 2R3NA 3IS5A 5IA2A 3I81A 4RZVA 3RPVA 5CZHA 4JAIA 4EK8A 3CKXA 3EQGA 3ENMA 2YZLA 5GIPE 4X3FA 3ET7A 1P2AA 4F4PA 4CNHA 3F2NA 4QPMA 4A9RA 4N57A 4FT7A 5JFVA 2UZDA 1NW1A 3OBGA 3PLAE 5J95A 2ZB0A 2ITVA 2XANA 3PRIA 4AGWA 4ZTSA 4O84A 3W0SA 4IAYA 3VBTA 2XNEA 3CD8A 4E93A 4ZTHA 4F7LA 2G2HA 3ODZX 3EN4A 2BFXA 5DI1A 3ZONA 3LMIA 3MS9A 3ZCLA 1QPDA 2ITXA 4UZDA 2C69A 5DEWA 5HBEA 5CF5A 3PJ3A 5E91A 3LKMA 1IEPA 4B7TA 2XA4A 4BDJA 3ZOSA 3A62A 2VZ6A 2X0GA 3MJ1A 4G3DA 3BLQA 4AXFA 4RG0A 4ZS4A 3VBQA 5GHVA 2ZDUA 5IQDA 3G2FA 3NAYA 2W1HA 5K5NA 4O0TA 2XIXA 3FLSA 4X7QA 3UIXA 3OXIA 5A14A 3E8NA 3QZHA 3OT3A 4X2FA 5EM6A 3UOLA 1J7UA 3QKKA 4QQJA 1CTPE 3D94A 3R00A 4XCUA 3BQCA 5AUXA 3A7IA 3CTQA 3QTQA 2WMTA 4O0XA 5HIDA 4KS8A 2YERA 4QD6A 3NLBA 5IA5A 1W84A 2C6MA 4L44A 4O4BB 5EK7A 3ZUUA 5BMSA 4BWPA 3A7FA 3UDBA 2WOTA 3LFDA 2XM9A 3EWHA 3WYYA 4CKIA 2EWAA 3QTXA 3DKOA 5DN3A 4ANBA 3WIGA 3FYJX 3AXWA 1WVWA 3TKUA 3C4XA 3GCVA 3UOJA 2YM3A 2ZMDA 2PUPA 1IG1A 2JC6A 3F82A 4X21A 2HXLA 4RWLA 3UIMA 5JGDA 5FEQA 1O6YA 3FLZA 2G9XA 2RFNA 3NW7A 4FODA 2WO6A 2J5FA 2F7EE 4JLCA 4EZ7A 3QQHA 4LGDA 4C4IA 4CEGA 1ZARA 5GJGA 4IVAA 3B2WA 4XUFA 4BY9E 2J2IB 4I6FA 1OKYA 2IVSA 4RWJA 5I9UA 4KSPA 4NK9A 2ZYBA 2VTQA 2NPQA 2XIKA 3D7TA 3IW4A 3ZEPA 3DTWA 2IVVA 2UW9A 2CKOA 3C4FA 1KE6A 4FT3A 1ZXEA 4HYIA 4RPVA 3WZKA 5AADA 2OJ9A 1U59A 3SOCA 2LGCA 4FBXA 3CD3A 2QKWB 4GUBA 3I0QA 3FMLA 5JN2A 2PE2A 5IDPA 2XIYA 2OU7A 2VWIA 4KB8A 3BPRA 2XBAA 2XK9A 4FG7A 4CQEA 4J71A 2PSQA 2GQGA 5M53A 4FTRA 5HX8A 2C5NA 5I9WA 2YLFA 2J50A 3ATSA 3QWKA 2QONA 4Q9ZA 4YZNA 3EN5A 5C9CA 3RAKA 4D1ZA 2RIOA 1BI7A 4H36A 3A8WA 2OG8A 5H3QA 2C4GA 3MVMA 4IDVA 5CQUA 3SXRA 4DDGA 4C3FA 3AD6A 5A3XA 4PPBA 5LVPA 3IDCA 3OP5A 2YDKA 4TYHB 4BB4A 4YJQA 4D1SA 5FDPA 3DQWA 2QOOA 4IE9A 2WZJA 2ZJWA 1WBNA 2J0KA 4IH8A 4UB7A 3ZM4A 4R8QA 5ACKA 4OBPA 4L00A 5AP1A 4AX8A 4CMTA 4I5CA 2Y6OA 4Y72A 5B7VA 4FZFB 5L2IA 1JSUA 3K5UA 3MIAA 5AP2A 3ZSGA 3I1AA 4ZMFA 4S31A 3O0GA 1YHVA 2R3LA 4QQCA 2RGPA 3BLRA 3F5PA 3L9NA 4K6ZA 2IW9A 4RVKA 1WAKA 5M4FA 4EH8A 3FMHA 3ORPA 3TI1A 3U6HA 1JOWB 4J52A 4J98A 2C0IA 4O0WA 1FQ1B 1H27A 4JRNA 3TG1A 3TNQB 3EQRA 4ANNA 4EEVA 2PVLA 5ETFA 3NUYA 3RINA 5IH4A 5J5TA 3ZLWA 3D7ZA 1GIJA 5DE2A 3QXOA 1KE8A 5CXHA 5EYMA 5HO8A 4EK6A 2GHLA 5AUVA 4B9DA 1SMHA 3TNHA 4E3CA 1KE9A 3JVRA 3Q32A 4OTGA 4PP9A 3DAEA 3JXWA 5CLPA 4YO4A 1IA9A 4NL0A 2XJ1A 4ALUA 3W0OA 3NUNA 3PE2A 2PUIA 5JH6A 3W33A 5I3OA 3DB6A 4BDDA 3HUBA 5F4NA 4EOKA 4IAZA 5BVDA 1UVRA 2C30A 3UYTA 3E8DA 3W2RA 4Q5EA 4QMPA 4WBOA 4LUDA 3F61A 4IJPA 4EQUA 4KIQA 4O0RA 4CZYB 4BDCA 3E3PA 3LM5A 2YIRA 2X6DA 4OUCA 3RNIA 4FE2A 4IAFA 4L3JA 4YO6A 4O0YA 1ZYLA 4QMWA 4YC3A 3HMNA 5D1JA 3SXFA 2F7XE 4YR8A 1XWSA 3R7UA 3OW3A 3NFGB 4ANLA 2PVHA 5L2QA 4JG7A 4LV7A 2YAKA 3ZC5A 4F9BA 4OTDA 2XYNA 2ERKA 4I0SA 5KKRB 4RC2A 3RAIA 4ZLOA 3ZXTA 4H3QA 1FGIA 3R8VA 3DK6A 4FKPA 1GZOA 5KZ0A 3NRMA 4JDIA 4PDYA 5CF8A 2R0IA 1OKVA 1U54A 2PVKA 3OCBA 4JL9A 3TDVA 3RVGA 3TIZA 1WBTA 3HUCA 4IBMA 5CF4A 3W8LA 3ZLSA 3ATTA 5J87A 3E3BX 4EUTA 4U0IA 4IB3A 3Q3BA 3KEXA 4O7LA 4F1MA 4YJPA 1Q3WA 1YHWA 3OY3A 4JQEA 4QMVA 4L3LA 5EM5A 2B9FA 5HE1A 2E2BA 4LMNA 4E6DA 4ZY5A 2BKZA 5A4EA 5EI8A 4GS6A 3RK5A 5E8VA 3MIYA 1GY3A 4LFIA 5AAFA 5BNJA 3UP7A 4P7EA 4TWCA 3VS7A 2X7FA 5L2TA 3BLAA 3H10A 2GS7A 3OC1A 4YLJA 4Q2AA 4ASDA 1CM8A 4EOSA 4G6OA 4JIKA 1ZMWA 4BGQA 4I6LA 4QMZA 2R3PA 5CEIA 3CQWA 4MF0A 3D5VA 1WBWA 3UO4A 5A46A 1OKWA 3SOAA 3KREA 4AOJA 3W2PA 4U45A 3GEQA 3KVWA 4O1OA 4QP1A 4ZTMA 3FZ1A 3GC7A 3GQIA 3IONA 5FWKK 4PY1A 4HVDA 3CR0A 1OIUA 3ELJA 4IFCA 3P79A 1PXPA 4M3QA 4WRSA 3FKNA 4IX5A 3TKHA 3UIUA 3EQBA 4A4XA 4CTBA 1G8JA 2XNOA 1NVSA 3B8QA 5I9XA 1ZOHA 3OCTA 1UV5A 3BYUA 3F9NA 5JKGA 4FNWA 3PFYA 4L68A 4EC8A 4BVUA 2I0YA 3TNWA 5IF1A 2PUUA 4TYGA 1OUYA 2PZRA 2WGJA 3MPTA 1L3RE 2RKUA 4PL3A 4O4EA 3SV0A 4Z7HA 3PVWA 4XMOA 3U6JA 3PE1A 4YZDA 2WIHA 3HL7A 4PPAA 5J9YA 2R3IA 4D4VA 3LFBA 2OXYA 4F09A 4C3PA 2XB7A 2A27A 1XBCA 4BDFA 2W1EA 1X8BA 1OBGA 3TCPA 3MVJA 1P5EA 3P1AA 4GMYA 4O4DA 3UNZA 3KU2A 4XG9A 2C3JA 4RX9A 3IGGA 2VO6A 2YIXA 2W1FA 2FSOX 5M55A 1H26A 3HMPA 3QWJA 4F1OA 2GSFA 3ZS5A 4FYNA 3ODYX 4FKQA 4IM0A 3A60A 4RBLA 4AXDA 2QURA 4H58A 5EH0A 3R8MA 4FT9A 3ITZA 2WXVA 4M0YA 3EYGA 3C4ZA 2UVXA 2A2AA 3E64A 1HCKA 3V5LA 3SDJA 1Q8UA 3OXZA 4FTUA 3E87A 5JZJA 3KFAA 3RK9A 4O6LA 3QD2B 4DINA 4D2TA 2F57A 4U40A 3R7EA 4LQMA 3PG3A 4HVHA 4L52A 1Y57A 5HNGA 1TZDA 3Q53A 3DV3A 3T9TA 3NCZA 3B8RA 4C7TA 1M14A 5AUYA 2FGIA 2JFLA 5DMZA 4QMYA 1YOMA 5LVNA 1WMKA 1WBPA 3KXXA 4XS2A 2G15A 2CGWA 3U4UA 3TNIA 2C3LA 5LMBA 2YM5A 3A7GA 3I5ZA 4DEGA 1OIQA 1Z9XA 1CKJA 3RCDA 4PMPA 1B6CB 5GINE 3WF8A 4YSJA 1G8AA 3CJFA 4ZTQA 2PZ5A 3FQHA 4DAWA 2YDJA 4EK4A 5KZIA 4WKQA 2RFSA 3IW7A 2C1AA 3ZFMA 4AG8A 5C1QB 2OZOA 1ZOGA 4PTGA 4YPSA 5IISA 1JQHA 4PF4A 4MKCA 3VJOA 1WVXA 3V01A 5C4KA 5L3AA 5HORA 1Q8TA 2BROA 3KA0A 2CGUA 2EXMA 4O0UA 3DPKA 4UALA 4EOPA 2WHBA 4KBAA 3KB7A 1YW2A 2BRBA 3DDQA 4I5MA 4ZSAA 2HOGA 3MWUA 4ZJIA 4BCKA 1H1QA 4L46A 4HNFA 2KULA 4B99A 3QRUA 3ZU7A 4JG6A 5EYDA 3QCQA 2WQEA 2QLQA 4X3JA 4ZSLA 1W8CA 5EOLA 5IH5A 2CKEA 2OF4A 1JAMA 2C5OA 4FIFA 4DEHA 4F64A 5HBJA 4N6YA 5IEVA 3G6HA 2JIUA 4EH9A 4BL1A 5B0XA 4AN9A 4G3EA 4AW2A 5F9EA 2X9EA 3BYVA 3RTPA 5L8JA 3ZZEA 3SG9A 4MEDA 1H07A 3QALE 2VWWA 3MVLA 3R9DA 3TXOA 5I3RA 2PL0A 1Q61A 4DFUA 3QTRA 4I23A 1ST0A 1H4LA 4H3PA 3MGYA 4BWXA 4FGRA 5HG9A 3DBCA 3O50A 3NR9A 2XK3A 4NM3A 4TWOA 5JGAA 4HGSA 4BIBA 5EFQA 1H24A 2R2PA 3ORKA 2UZUE 4MBJA 2VWXA 5FBNC 3V5PA 1WCCA 4O4CA 4J1RA 5M51A 2YHVA 3K2LA 5HG7A 3ZEWA 2E9OA 3F3TA 3HDNA 2DWBA 2WFYA 3ORMA 4RIXB 5GJDA 3UE4A 4A4LA 2J0JA 3VHKA 3TZ9A 3LFSA 1I09A 4O2PA 4JT3A 2PE1A 2VO3A 3BWJA 5HD7A 2R9SA 2B53A 4MNEB 2KTYA 5M57A 4QMXA 2Z60A 4DLJA 2Y4PA 4BCPA 4GIHA 5HTBA 4I1ZA 5DEYA 2Y6MA 3R22A 3EOCA 4FV7A 3FZSA 4IDTA 1UWHA 2AC5A 3FKLA 4FUYA 5HE0A 4DFBA 3FMKA 2O3PA 3IECA 4BHZA 4USEA 1H1RA 3F7WA 4O7NA 3VRZA 3AGMA 3VBVA 4I94A 5FM3A 3I6WA 1H1WA 2BAQA 2C5XA 1R78A 3PY1A 3I6UA 3OOGA 5HKMA 3MFRA 4UYAA 4C2WA 1W2DA 5K3YA 4DG3E 4DBNA 1A48A 3R30A 2C6EA 4QP2A 4FTNA 5F20A 3WZUA 3NUSA 3E7OA 3R1QA 1OVEA 3C13A 3NYNA 5CY3A 2UZNA 3BHUA 3ZYAA 1UA2A 5DHJA 4O7VA 2XYUA 2UW6A 2GS6A 3L8VA 4YJOA 3UOKA 2QOKA 3WE8A 3OXTA 2BHEA 3R83A 3EYHA 4K77A 3U9CA 3RNYA 3ROYA 3G15A 4CLIA 3PY0A 3NNUA 1PYXA 3COMA 3FSKA 3Q60A 3N9XA 1TQIA 3ORXA 3IQ7A 1VR2A 4KAOA 2QOLA 4ZTNA 3L8PA 4QMMA 2G2IA 3QYWA 4AW5A 4UWYA 3LMGA 3F88A 3GU6A 3F2RA 2Z7SA 5CVHA 4I0TA 5CU2A 4QP3A 2WMRA 2XK4A 5AP4A 2HCKA 4G16A 1SVEA 5M4CA 3BGQA 5JFXA 3TZ7A 3FSFA 4U97A 5CT7A 5GIOE 3A61A 2CKQA 1OM1A 3G9NA 4BCNA 4FKGA 4I3ZA 3QQGA 5F94A 2G1TA 1OKZA 3G0EA 4FSUA 4BRXA 3HP5A 3A4PA 4ZZOA 3MA3A 3BRBA 1XMLA 3NWWA 3ORIA 4NTSA 4JX3A 3W0QA 4FSZA 4FTCA 3QD0A 4PRJA 4AU8A 4BWKA 4XG6A 3CLYA 3HMIA 3NX8A 4N70A 4YP8A 3FXXA 4UMPA 5HU3A 5HTCA 3DBDA 4FV1A 3W2OA 4I93A 2XIZA 4ZIMA 5I4NA 3VONA 2XK7A 3RHKA 5HI2A 3LJ2A 3DZOA 2WEIA 4D2WA 5M09A 1AD5A 4FC0A 2ACXA 3PXQA 4TNDA 2C68A 3V5JA 4JAJA 4FSWA 4WG3A 3P0MA 4BTMA 3ZH8A 3LQ5A 4EH6A 3G0FA 4O38A 4YNEA 4FGBA 1JVPP 2NP8A 5CU3A 1XH8A 3NS9A 3BE2A 2WELA 5JT2A 4D0XA 3QRTA 4WSQA 4S30A 3LM0A 2QVSE 4AAAA 4EK3A 2BTSA 4HVGA 4DCAA 4FNXA 3VW8A 1STCE 2YZAA 4BHNA 1RDQE 4XG7A 2GQRA 3VC4A 5BVKA 4CZTA 3WBLA 2EVAA 5AR7A 4FA2A 3UZTA 1JLUE 4UXQA 2BDFA 3MH0A 4I6BA 4BKJA 1XO2B 2F4JA 3FJQE 4BCOA 5HVKA 5KBQA 4ANOA 5G6VA 2IEWA 2JFMA 2VTOA 2QD9A 4IVDA 4RIWB 1TFFA 2I1MA 3BIZA 3HA8A 4XRJA 4IIRA 4CG9A 4J8MA 3Q9ZA 5JQ8A 3LFEA 3NCGA 4PUZA 4U9AA 4CT1A 4E73A 4LUEA 4OTFA 1CKPA 4GV1A 3RK7A 4FTQA 4LRMA 3PP0A 3GXLA 4FKUA 3UDZA 4WNKA 3NW6A 3PY3A 1F5QA 4HNIA 3H9RA 4Y83A 2G2FA 5BYYA 5KHXA 4E4NA 4EK5A 4FOCA 4QMSA 4BCMA 2JAMA 4FKVA 4RIWA 4FSYA 4KIKB 2QO9A 5TR6A 4A4OA 4DEAA 4BDHA 2OLCA 4BR3A 4AFJA 2HZ0A 2YWVA 3IDPA 4IQ6A 2V7OA 5IQAA 3BKBA 3H3CA 4FKIA 4J96A 4BFMA 3PXKA 3QQKA 2IW8A 3VBXA 2ZV8A 5T68A 5ACBC 4ANMA 1J3HA 4YZMA 2NRYA 4FV0A 5AR3A 5C8NA 2R3FA 4USDA 4K1BA 4NIFB 1IAHA 2YCRA 4W4YA 4FEWA 3A7HA 4KIKA 4QO9A 4RIYB 5C4LA 4RJ8A 2NYAA 2WIPA 3QX4A 2VNWA 3MPAA 4BGGA 1H0WA 1XJDA 4LG4A 4F70A 1O6LA 1M2PA 3DU8A 4DGGA 2F2UA 3PDTA 2GS2A 3M11A 1LUFA 4RC3A 1MRVA 2GHMA 3KL8A 4IACA 2J7TA 4ZSGA 3RHXA 3UQGA 3FI3A 4RIYA 4MH7A 4UV0A 2BMCA 4TZRA 4XBRA 3TN8A 4AE9A 5EYCA 1IAJA 4I92A 4GL9A 1DM2A 4CFUA 4ERKA 3AGLA 1JNKA 4QMTA 1L8TA 2I40A 3GCPA 4YPDA 4G9RA 4PQNA 5GJFA 3PVBA 2X7GA 3RZFA 1Y8YA 3BCEA 3ACJA 5JFWA 4GJ2A 3IK3A 5JMSA 4MXCA 2BALA 2BRMA 3BEGA 3C4WA 4TNBA 3VAPA 4HYSA 3U54A 2R0UA 2EXEA 3NW5A 4WT6A 3T3VA 2XK8A 1HCLA 2NO3A 3WYXA 5B2LA 5K0XA 3LCTA 4F6UA 3UYSA 3FV8A 4ALWA 3R7OA 3VS0A 5AX9A 4RJ4A 4QYEA 2Y8OA 2FUMA 5DR9A 2J6MA 5HIEA 2Y7JA 3HMMA 4LV8A 4I24A 3DKFA 3E8CA 4KA3A 3SA0A 5AR8A 4DGNA 2RFEA 2VX1A 3AC1A 1J91A 4FG8A 3EQHA 4NWMA 5FGKA 2OJJA 2WTVA 2C0TA 3PJ1A 4XHKB 3RAHA 3VHEA 3ZUVA 3F5UA 4GG5A 3OEFX 1ZYDA 3OWLA 4FTIA 4BTJA 4QTEA 4O7ZA 5HD4A 3TL8A 3R9OA 2AC3A 4FL3A 4BI0A 2R3HA 5IQGA 3NMUF 3TZMA 4K11A 5DT3A 2J0IA 5J1WA 4W4WA 2XP2A 3BHVA 1W2FA 5AX3A 5JRQA 3HLLA 1GZ8A 2RL5A 3BX5A 3NVMB 2IO6A 3BHTA 3P9JA 3W10A 1AQ1A 4XBUA 3FEGA 2J0MB 4ONAA 4OW8A 5EDRA 3BV2A 4D0WA 3FL4A 2ONLC 1XH9A 3EFKA 4YZ9A 5ANGA 3VS2A 1Y6BA 4I0RA 3BV3A 2FSMX 4YTIA 5I9ZA 3DKGA 1YOLA 1E1XA 2A1AB 2QO2A 2Z7LA 4CRSA 4E1ZA 4ASEA 4RVMA 4CT2A 4TPTA 5IQIA 2V5QA 2RF9A 3ZO3A 4HPUE 1FMKA 2Q0NA 3BHHA 4GK2A 4YJUA 5E8TA 3SLSA 1PKGA 4ORKA 4WA9A 2WTKB 1WBSA 2VAGA 3WE4A 3P7CA 4KKGA 4J97A 3VW6A 4D2VA 4H05A 3P08A 3G90X 3KRWA 5FQDC 3O2MA 2E9UA 3DNEA 3HRBA 4AFEA 4C4FA 4HVIA 5IUHA 3BZ3A 4NUSA 1WFCA 2WTCA 3HP2A 3Q4ZA 3V8WA 2GNIA 3K54A 3LMHA 2OF2A 4OR5A 1Z57A 2B9IA 1OBDA 4O82A 4O2ZA 3QTWA 5KCVA 2WD1A 2P3GX 5BVEA 5CAVA 3OWPA 3PJCA 5AR5A 4K0YA 4IZYA 5DG5A 4DH3A 3ORTA 1JKLA 4DA5A 2BZKB 1W82A 2C3KA 1Q3DA 3UP2A 3SD0A 1MRYA 4H1JA 4QP6A 3ZXZA 2VNYA 4LGHA 2EUFB 4UMTA 3OUNB 5BVNA 1GOLA 4K18A 4FNZA 4O7WA 2BCJA 3SG8A 4YU2A 2ITOA 3DBQA 4TW9A 2HY81 3FYKX 1V0OA 3OZ6A 4AWIA 5BUEA 3TZ8A 5AFVA 3Q52A 2XM8A 4UEUA 2YA9A 4UYNA 1J1BA 4AZFA 2YN8A 2EB2A 4IVBA 5CWZA 1JKTA 2V7AA 4IAIA 3HMOA 5A4LA 5JK3A 2VTLA 4R78A 3V5TA 2CLXA 3A8XA 4YJVA 1MQBA 2BPMA 4C4GA 1QPJA 3BGPA 4HGEA 4MXZA 5CU0A 2CCIA 4UMRA 2XK6A 3LVPA 4O81A 3MN3A 3ANRA 3BEAA 5D10A 4MXAA 4P5ZA 2F7ZE 5AAGA 5DWRA 5KBRA 2B55A 3QRJA 4F78A 3VF9A 4ZY4A 1TKIA 2FH9A 4QMQA 3QZIA 4GT3A 3MFTA 4U6RA 5LMKC 2R4BA 1ZYSA 5A6NA 4A9SA 3OMVA 3WF7A 2R3JA 2W1IA 4AP7A 4EL9A 3D2IA 2P4IA 5IH6A 3D83A 1BI8A 4IZ5A 4NYEA 4AXEA 3CTHA 1M2QA 2VGPA 5EHLA 3O7LB 3IG7A 4IANA 3QC9A 2XF0A 2XAMA 4NH1A 1Q41A 4MBIA 2JIVA 2VTIA 4I5HA 2JLDA 3FMEA 3TUCA 2XALA 5DBXA 4BF2A 4O0SA 2YLEA 2X81A 4DFXE 3DA6A 3KXHA 5IQCA 1ZOEA 3FZOA 4DTKA 4MWIA 1H1SA 3G51A 3UMWA 5G1XA 3R9HA 4G3CA 4C4EA 4E5AX 4QYGA 4IVCA 4F99A 2R64A 5C27A 3W16A 3MY1A 5AP0A 4TT7A 2ZFYA 5CNOA 1H00A 4L7FA 1Q5KA 2WU6A 5I5ZA 2OIDA 3KMMA 4O22A 3MBLA 3R8LA 4CGAA 3PPZA 4NM5A 4FKWA 3ZRKA 4ASZA 4C58A 3V51A 3W0RA 4U7ZA 1SVGA 5ETCA 4AZEA 4ACHA 1MQ4A 2GHGA 4M67A 5IA4A 1YI3A 2Z7QA 2Y4IC 3K3JA 3POZA 4G3GA 4P4CA 4BBEA 3VUHA 4Z55A 4NM7A 3Q6UA 5LWNA 3GU4A 3UGCA 3QTUA 3N4VA 4GU9A 3IW8A 1K3AA 4CD0A 4OTHA 2OK1A 3FMDA 2OI4X 3KK8A 5ANDA 4G9CA 3RM7A 4AGCA 4D5HA 3LFCA 2XBJA 1ZRZA 4HGLA 3FY2A 3QTIA 2VTMA 3GU5A 4WNOA 3EFJA 2WU7A 4EWHA 3RKBA 3KULB 3NYVA 2Q83A 2RSVA 1RQQA 4DC2A 1NY3A 4GSBA 4TYHA 2WQMA 1YVJA 4QTBA 3RWQA 3MY5A 2QHMA 3F3ZA 3HV6A 3RI1A 3DDPA 3LJ1A 2BRNA 2ITNA 2YM6A 4RT7A 5C8KA 5JQ5A 4EOQA 1FVVA 4RFMA 2F49A 3O8PA 5E1SA 3IOKA 4IB5A 4IHPA 3LFQA 3KULA 4XV1A 4FI1A 1YWRA 4O83A 1BL6A 4FTMA 2YABA 1V0PA 2GNHA 3QF9A 1ATPE 4WNMA 2W4OA 5FG8A 2W7XA 2UZTA 3E5AA 1FVTA 4XV9A 2YJRA 3QD4A 3U9NA 5EKNA 4DFNA 4CYJA 2Z02A 3L9MA 4KD1A 5DT0A 3PIZA 4KSQA 4ZY6A 4YC8A 3KN5A 4QPSA 3WZJA 4D9TA 4ZZNA 2QR8A 3LAUA 3BBWA 5FEEA 3ALNA 4F9YA 1BMKA 4EQCA 4ZXTA 4YHFA 5LCJA 3CEKA 3BYMA 2GQSA 3CP9A 2JEDA 4C8BA 2OKRA 4FV5A 2VN9A 4IX3A 3EZVA 4ITIA 5FTQA 3NUUA 4R5SA 5BUIA 1FBNA 1G8SA 4WD5A 2YACA 5AP5A 2HZNA 4BDAA 3R02A 1SZMA 4J95A 4C2VA 4X2KA 4IJ9A 4JBQA 3EZRA 3KF7A 3NFFB 3TTJA 2PE0A 1SVHA 2YAAA 2YIQA 2WOUA 4RQVA 3UIBA 4JOAA 3HECA 2OFVA 3I5NA 4AQCA 4HYUA 2VWYA 4RRVA 5J7BA 4R3RA 3SAYA 2UZWE 1PMUA 4QNYA 5FP5A 4FIHA 4YLKA 1UU3A 3C5UA 3EIDA 3AOXA 4HCUA 4IB1A 4UWCA 3WI6A 4BCJA 3QHWA 2QODA 2Z7RA 4LM5A 3MYGA 4PMMA 4BDKA 4F63A 2UZVA 4UZHA 5CEKA 3K3IA 3KGAA 3QUDA 4BIEA 4FKTA 4KBKA 3MI9A 5AR4A 2PMOX 4XLIA 4WHZA 3SRVB 4YTFA 4E5WA 4JNWA 2IZTA 4OTRA 1PXKA 2R7IA 2C6DA 4GH2A 4J7BA 5HG8A 4QP9A 4WO5A 5CQWA 3TJDA 4EBVA 5JFSA 4BJJB 3UPXA 3FC2A 4FKJA 3EQCA 2QU6A 3KF4A 4AZSA 5AP6A 4GK3A 5IMXA 3HRFA 4AW0A 4RSSA 1LPUA 3WF6A 2Z2WA 5KO1A 4MHAA 2V62A 4FRFA 4LGGA 4QMLA 3TWJA 4EBWA 2FA2A 5K4IA 1WBOA 4I5PA 5CZIA 4I20A 3SRVA 4O86A 4BZNA 2C6TA 4A9UA 1DAYA 4U5JA 4TWPA 4ZLYA 3CKWA 3AKJA 4NT4A 5E90A 5A4CA 2XKCA 4L9IA 5ANKA 1H0VA 2JITA 4MD7E 5B2KA 4RQKA 3U6IA 3IOPA 3H4JA 1PXMA 3AD5A 4QTCA 4DEDA 4EONA 3VIDA 4BKZA 2C3IB 3GENA 4XOYA 4OTWA 4RWIA 1MRUA 3R7YA 3VVHA 4YUQA 4DHFA 3PSCA 1OIYA 2QG5A 3PWYA 3UNJA 2WMQA 3QAME 4JI9A 4G31A 4R3CA 3FAAA 3FKOA 2XEZA 3BHYA 5AJQA 4B0GA 3RPSA 2X2MA 5TOZA 4XNEA 2XNPA 2AYPA 3L8SA 5DGZA 5I9YA 4AAYA 4GCJA 3O17A 2C6IA 3OEZA 3ZLYA 3VUDA 3MW1A 3S0OA 1YXVA 4BYJA 4C59A 4F0FA 3GCSA 4JQ8A 4IX6A 4RLKA 4NCTC 5EG3A 3KQ7A 4FZDB 4D4RA 2C6KA 4F7JA 2WPAA 5IUIA 3NZ0A 4OTQA 4G17A 3AKKA 2XRWA 2ZV7A 4U41A 3OTUA 3SX9A 4EHGA 4FZ7A 3E8EA 4ZZMA 2JIIA 5EYKA 3W0PA 3S4QA 3QQLA 3AC2A 4XOZA 5GZ8A 3D5UA 4EWQA 1DI8A 4EJNA 5C03A 5TF9A 3VUIA 2WMAA 3ETAA 4G6LA 3ZFYA 3DZQA 3CC6A 2HW7A 3C0HA 1JBPE 4S34A 1ST4A 2XJ2A 2ZM3A 2WMBA 2QG7A 4JXFA 3TIYA 4R3PA 3B2TA 4AZVA 3R04A 4FG9A 5LJJA 1G5SA 1M7NA 3OW4A 5K5XA 2VTHA 1G8KA 3MY0A 3W0MA 3QC4A 3JS2A 3QTSA 4ACGA 5FLFA 4APPA 4L53A 1WBVA 2VX3A 3EN6A 3ACKA 2HZIA 4FIIA 4FV4A 4M8TA 4Q9SA 2OH0E 3H0YA 3NEWA 3V04A 4JDHA 5AUTA 1SYKA 4QDVA 2HY0A 2OSCA 5AAEA 2F9GA 4L8MA 3RM6A 2QR7A 4N0SA 4FNYA 3VS5A 3DBEA 5CS6A 3W18A 4P2KA 3KXNA 3RZBA 1J7LA 3KCFA 4IAKA