2WB8A

Crystal structure of haspin kinase
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
352
structure length
351
Chain Sequence
LGSIEISNKKASDAEKVYGECSQKGPVPFSHCLPTEKLQRCEKIGEGVFGEVFQTIADHTPVAIKIIAIEGPDLVNGSHQKTFEEILPEIIISKELSLLSGEVCNRTEGFIGLNSVHCVQGSYPPLLLKAWDHYNSTKGSANDRPDFFKDDQLFIVLEFEFGGIDLEQMRTKLSSLATAKSILHQLTASLAVAEASLRFEHRDLHWGNVLLKKTSLKKLHYTLNGKSSTIPSCGLQVSIIDYTLSRLERDGIVVFCDVSMDEDLFTGDGDYQFDIYRLMKKENNNRWGEYHPYSNVLWLHYLTDKMLKQMTFKTCNTPAMKQIKRKIQEFHRTMLNFSSATDLLCQHSLFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of the Catalytic Domain of Haspin, an Atypical Kinase Implicated in Chromatin Organization.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords SERINE/THREONINE-PROTEIN KINASE HASPIN
total genus 120
structure length 351
sequence length 352
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2009-02-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2wb8A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2wb8A01
1QPJA 3GOPA 3OBJA 5JQ5A 2ITYA 5HIDA 5IG1A 4FUYA 3V6RA 4CFWA 3F5XA 4NEUA 3TCPA 4FV4A 4IX4A 5IQDA 2CSNA 4I6FA 4O0SA 4HJOA 2R3NA 4A4OA 3PJ3A 4EUUA 4QTBA 3MH0A 5CF8A 3A8WA 5HVKA 5GIPE 2C6EA 3KXNA 5K4IA 2YITA 3JXWA 4XHKB 1NVSA 3DJ7A 3VS5A 3DXQA 4G34A 2PY3A 4IFCA 1GJOA 4C33A 2JKOA 2QOIA 3FPQA 3H9RA 2B1PA 3QGYA 4U5JA 3FXZA 4D9UA 3QUDA 4WUNA 5LMAA 3MH1A 4UWYA 5HIEA 4ACMA 4ANLA 5BVFA 4QMXA 3QQUA 2RFSA 2RIOA 4IB3A 2WIHA 3KRXA 4GT4A 3HV4A 4XG3A 3W2QA 3VBYA 3BIZA 3QHRA 2VX0A 3R9DA 1PMEA 4L52A 4K9YA 3ZFMA 4F4PA 5B2MA 2QR7A 2UZBA 4DFXE 3K3JA 3NWWA 3OG7A 4JLCA 1OGUA 4RZWA 3SOAA 3VUDA 4CSVA 4R1VA 3MGYA 4A4LA 5F9EA 3TDVA 3PPZA 2PULA 2X8DA 4PMSA 3W16A 3ORKA 3TEIA 3R7GA 2R0UA 4I4FA 4PDYA 4RA4A 4CFMA 4J53A 5CU0A 3MS9A 2X6EA 5AUYA 4GU6A 1G5SA 4NCTC 4HGSA 4KWPA 3KRLA 4FIEA 5AP6A 5L2QA 4O2PA 5IDPA 2F49A 4BWXA 4LGGA 2ZMCA 4N70A 3RZBA 5FP5A 4G17A 5FXSA 3JPVA 2O64A 3LM0A 3ZH8A 2XEZA 2HW7A 4LFIA 4UY9A 4F6WA 4FNZA 3UO6A 3KXMA 3TUBA 3A7GA 2IPXA 4MD8E 3QRIA 3SVVA 3K54A 2BRBA 2PE0A 4MYGA 3G0EA 2VX3A 4DBXA 5EI2A 2YM7A 4EORA 1IEPA 4R3PA 1MQBA 2YM3A 5EHYA 4D28A 1FGKA 2BZKB 2BKKA 3TZMA 4ACDA 3D7TB 5I9WA 3L8VA 3CCNA 2A1AB 1ZZ2A 5DOSA 3O2MA 3W2CA 4Q2AA 3BU6A 4D5KA 1DAWA 3GFWA 1P4OA 2RSVA 3HEGA 3LZBA 1XWSA 4YLLA 4H1MA 4ZIMA 2UVZA 2OJJA 1NW1A 3Q5ZA 4PX6A 5DLSA 5A4CA 3BELA 3C1XA 4F9WA 4GVAA 5FQDC 2OZOA 3I0OA 3PRFA 4MVFA 3Q4CA 1CDKA 2CDZA 4ZY6A 2P3GX 3QTRA 3U8WA 4NIFB 3E8CA 5EHLA 1OB3A 2OU7A 3C50A 4BKJA 4FEQA 4FG8A 3T8OA 1OBGA 3HLLA 5FEEA 3R9NA 2VU3A 3G9LX 3UPXA 4I41A 2IW9A 1CKIA 3PFQA 4FTCA 1BLXA 1YKRA 3C4WA 4H3PA 1ZWSA 1KE6A 2IZTA 2XKDA 3TTIA 2R3RA 5E8WA 4WKQA 2QLQA 1JKLA 2WFYA 3KRJA 4RWKA 2PVLA 4GRBA 3BYSA 4I5MA 4LOQA 4BCMA 4PNKA 3EMGA 4TN6A 1Q61A 2VWYA 2WTKB 3MPAA 5D11A 3TZ8A 3OWJA 4C8BA 2NNWB 4J97A 2C6OA 5AWMA 4FEVA 2A27A 2XIZA 2XEYA 3RCJA 2B52A 3P7AA 4AZSA 3WIGA 4ANOA 4BZDA 3DNEA 3UZRA 1JSUA 3H3CA 2JC6A 3PDTA 4N6YA 2IVVA 5EDQA 4BDKA 4XLVA 3OT8A 3UIUA 3MPTA 3ZLWA 2WELA 4RJ3A 4Y5HA 4BDAA 2GHGA 5DT3A 2I1MA 5KZ0A 3BGPA 5CENA 3F7WA 5ANKA 5DRBA 2Z2WA 1O6YA 2VD5A 4QYFA 5KCVA 4LOPA 1OECA 2C6IA 2R7BA 4CMOA 2R3LA 5HE3A 5M08A 4MNFA 5IF1A 4DG0E 4ZZNA 3UIBA 2WMXA 3E3BX 4L7SA 1P14A 2F4JA 3ZLYA 3VJNA 4YGAA 2QNJA 4FV8A 2X7FA 4C7TA 4GMYA 3CSVA 4S31A 4IDTA 1JOWB 3JS2A 3ORXA 4GIIA 4NM0A 5IQIA 3L9MA 4AFEA 2W99B 3V04A 2XBAA 4RFZA 3R7UA 4HYUA 3TTJA 4WRSA 1JNKA 4A4XA 1UWHA 3ID6C 5LJJA 4KSPA 2PUIA 3OWPA 4LV5A 4CFXA 3OXTA 5IH4A 2YIRA 2QOCA 2UZWE 2VO0A 2VTHA 3BU5A 3CS9A 3BV2A 3EL8A 3HYHA 5H3QA 4YZ9A 5I9YA 4CRSA 3FBVA 2AC3A 2R9SA 3NW5A 3A62A 3CY2A 4IWOA 1E9HA 5HLPA 5CEPA 4PMMA 4ANBA 5HD7A 5EOBA 3NUAA 4F7SA 3C51A 3ZHPC 5J5TA 5CSHA 3LQ5A 4YZMA 3VRYA 5D10A 1YDRE 2J6MA 4ZTSA 4AA4A 4BBFA 2W5BA 4RG0A 4I22A 1MUOA 3OC1A 2RG6A 4C34A 4FIGA 4K11A 1MRUA 4H3QA 3K5VA 2W4KA 5HG5A 4ZLOA 5AMNA 5AR8A 3BE2A 4MXAA 4WSYA 2CKOA 4FKWA 3LCTA 4V04A 2G1TA 3R1QA 3QD4A 5HORA 3GU7A 4EH4A 5E7RA 3DOGA 3OD6X 3R1NA 5HE1A 4DG2E 2JBOA 3MVMA 4G3CA 4G9CA 2OH4A 4W4WA 4YJPA 4PMTA 4Z16A 3H0ZA 3GQLA 1WBTA 1URWA 2FSOX 2YLEA 4Y8DA 5AIKA 1YI3A 5FDPA 1RQQA 3S00A 5DRDA 3FPMA 4MNEB 5A6OA 3KRRA 2VGPA 4J7BA 3DK7A 4DGLC 5J9LA 3OWKA 1NY3A 4PTEA 3NYNA 3T3UA 3HA8A 4HZRA 5BUIA 5KMMA 3PLAE 3BWFA 4PPCA 2WO6A 3F5GA 1Q8WA 3O96A 4O6LA 5A4QA 5TT7A 5FM3A 3HMIA 3ZSHA 4XG8A 4AZEA 2J50A 4O91A 4FV2A 4NK9A 4NFNA 2RG5A 3GBZA 3O23A 1M17A 3PXKA 5IA3A 2X4FA 4L3LA 4ZZMA 4BDCA 5BPYA 4FEUA 1IA8A 3ZO1A 4GCJA 2H34A 5KMKA 3PE1A 4BI2A 3DZOA 4FKPA 5AUWA 3VVHA 4IM3A 2UVXA 3P0MA 1PMNA 2XYNA 4GFGA 3PRIA 3MJ1A 1OI9A 4LL0A 2W1DA 1ZOEA 4BZNA 4B8LA 1Q8YA 4CMUA 2BRMA 4ORKA 1LEWA 4QMTA 2WTVA 3OBGA 2HZ4A 3ORZA 2ZYBA 3DTCA 4FIJA 3CJGA 3TJCA 1QL6A 4MAOA 4TWNA 3MFUA 3VUIA 3VUKA 5KX8A 4E6QA 3DQWA 3ZEPA 1P5EA 2XIXA 4RSSA 3BLRA 1VYZA 5ACKA 4BCNA 4R7BA 3MI9A 2UUEA 4U8ZA 3WYYA 3EH9A 4GFOA 4H1JA 3LOKA 2BTSA 3R1SA 5GJGA 3NIEA 5EI6A 3ANQA 3M11A 2WMUA 2V0DA 4YP8A 3QCXA 3WF9A 3EJ1A 2R3PA 4LQMA 2Y4IB 4GIHA 2QI8A 4MWIA 3R8ZA 3TNPC 3L9LA 4RIXA 5F1ZA 3KXGA 1ZXEA 2EXCX 4AE9A 3EIDA 3RPVA 1IAHA 4JR3A 4J8MA 4RZVA 4DFNA 4U7ZA 1YOJA 3V8WA 4WIHA 4PMPA 2C6MA 5A14A 3OXZA 4QP6A 1CSNA 2JITA 1RW8A 4IWDA 4XG2A 3V5TA 5AP1A 3M42A 4FKOA 2Q83A 3V5WA 1M7NA 4EK3A 4D0XA 2GFCA 2O65A 3DK6A 3QTQA 3WZDA 2BCJA 4RX5A 1ZYSA 3HECA 3S4QA 4G6LA 3COMA 4I1ZA 4O21A 1Y6AA 1Q8ZA 4ZY5A 2PMOX 5GINE 2OSCA 3AMAA 4ZEGA 2EB2A 5J8IA 4BZOA 1ZYCA 3D0EA 4CFUA 4IANA 2J9MA 3NW7A 3V8SA 4R78A 4MBJA 3COKA 3PY1A 4ASDA 5BVOA 2JBPA 4XYFA 2G01A 4Y95A 2IW8A 3SHEA 4BKYA 4U3ZA 2ITNA 4TYHA 3DJ6A 3NVMB 3WF8A 3U6HA 3FAAA 1M14A 1UNGA 2XUUA 3C9WA 2PVJA 5HCXA 3GVUA 5JZJA 5BMSA 3R00A 2E9VA 3ET7A 3GC7A 4OBPA 4QP2A 4AZWA 4ERWA 3R02A 3FLYA 5DMZA 1IA9A 3GU4A 3V6SA 4GJ2A 2X2MA 3F88A 1KOBA 1ZMVA 1XH9A 2OF4A 3PA3A 1U46A 4JL9A 4TYEA 4U97A 4XG6A 4XX9A 5IEVA 2I0EA 2YCSA 3S0OA 4V0GA 4DEHA 1T45A 4BCPA 2PUNA 4AGDA 2W0JA 4GG5A 3MFSA 3TZ7A 3O8TA 5CAVA 5CSPA 4J99A 2A4LA 2PL0A 2J5EA 2BKZA 1OPJA 4W4XA 3CR0A 2JIIA 4G3GA 2HK5A 2OXXA 2R3MA 4FV0A 1H0WA 3TWJA 3UOKA 2C0OA 2PYWA 3V8TA 3LLTA 4XS2A 4IACA 4A9SA 4M7IA 2JDSA 4TW9A 1V0OA 4FKRA 4B99A 3RAWA 3VBWA 3ZSGA 2XKEA 2UV2A 1KE8A 5BMMA 4CYIA 2ZV8A 5T3QA 4DE4A 4WA9A 3ZC5A 4FTTA 2YCQA 4GH2A 4ZJVA 2RL5A 4NIFA 4HOKA 1PXKA 5DHJA 3KMMA 2GQSA 3OY1A 1A06A 3QZIA 4KBKA 5DN3A 1JVPP 2YDJA 3AC2A 4O27B 4QMSA 4GYGA 4B0GA 2VTQA 3OWLA 3ZRMA 4J95A 3OF0A 2GHMA 1W0XC 2CGWA 3P86A 3SRVA 4P7EA 3OOGA 3UDBA 3A7JA 2VTOA 2HYYA 3HDMA 1P2AA 2RFEA 5L2WA 4FV3A 3RMFA 4MXCA 2FUMA 4QMUA 5CAPA 4BIBA 5FD2A 4PDOA 3SXSA 1U54A 2PVKA 4IZYA 2VO6A 4IFGA 3KULB 4NW6A 5L6WL 2BZJA 3UG1A 3ZRKA 3FI8A 4ZAUA 4Q9SA 5FBNC 2Y0AA 4GK2A 4RX8A 5T6KA 3N4VA 4RFYA 3DBFA 3RCDA 2R5TA 4D9TA 1OIQA 4UV0A 4O7WA 4TXCA 4AN2A 4QMZA 4KIPA 2G2FA 4PV0A 1APME 4TY1A 4R1YA 2YABA 4XBUA 2VO3A 5HNGA 3TNWA 3ZMMA 4M67A 3P9JA 3KK8A 2BALA 2F7ZE 2FYSA 2I40A 3HX4A 3KN6A 4IB1A 4AP7A 4BDJA 4C36A 5E4HA 4LYNA 4YJVA 1SMHA 3HVCA 3I0QA 4HPUE 3R9HA 4W8EA 4E6DA 4BIEA 5IEYA 4UBAA 2JKQA 4MHAA 4ZSLA 2ERZE 4FT3A 5AUXA 2GDOA 3FZTA 2UW0A 3F82A 4FTAA 4N57A 3DLZA 1FQ1B 3UG2A 4EK6A 1GOLA 2GNJA 1HCLA 3O50A 3KXHA 2VNWA 3R63A 5M44A 3ZLXA 5KUPA 3MFTA 5E8YA 3U9NA 4EOSA 1UNLA 5IDNA 4FSRA 4WRGA 2XK9A 2Y4IC 3MA6A 3VNTA 1V1KA 3TZ9A 4HVHA 4KD1A 2WMAA 3P78A 4HW7A 3ATTA 2VAGA 3UO5A 3DDQA 3QTZA 5GHVA 3LFAA 4O38A 3EN7A 5K9IA 5DA3A 4JNWA 3ITZA 1Q99A 2Y9QA 3FYKX 4L6QA 2H96A 4TRLA 4DT9A 2WTJA 4F9BA 4G3DA 5GZAA 2HWPA 3QTUA 2X2KA 4FTRA 4U41A 4ENYA 3DBEA 1OVEA 4K2RA 2OZAB 1X8BA 4BRXA 2B4SB 3NUUA 4EC8A 1XBCA 3ZZEA 3UNKA 2BR1A 2J51A 3CD8A 4BDHA 4UN0C 3QRKA 1TKIA 2X0GA 4KIKB 3W1FA 2P33A 5L3AA 3FC1X 4XEYA 3TI1A 4BCOA 4RLLA 2VTTA 4TYIA 4YZCA 3RP9A 4WG4A 4DTBA 4FIFA 2JKKA 3HRCA 4NWMA 1J3HA 3NYXA 3FZOA 4XUFA 3NW6A 3QQHA 5FXQA 1SVHA 5EM7A 1Q97A 5E92A 4P2KA 3CBLA 4QPSA 1OKZA 3R6XA 4FNWA 1FINA 4AZFA 5LVMA 4AGCA 3THBA 4L7FA 4FL2A 5F94A 3EYGA 2YJSA 3FMHA 5F95A 5H8EA 3QF9A 4YJRA 2QKWB 2WOUA 3C5UA 3VC4A 3WZUA 3RAIA 4U45A 4PUZA 4YPDA 4AN9A 4AGWA 1OIYA 5HNBA 4HCUA 4OTIA 5TF9A 3A7FA 3G5DA 4R5YA 4YHFA 3R22A 3BEAA 2XMYA 4ERKA 2UW9A 4P90A 2P2IA 1WBPA 2VNYA 2UZTA 1RE8A 4UXLA 2XF0A 4FZDB 2RF9A 2JAVA 3FLSA 4Y73A 2CKPA 4IZ7A 4BGHA 4GL9A 2WTCA 2OFUA 2BIYA 3PJCA 2CGXA 4KIOA 3TJDA 1G8SA 3PTGA 1L3RE 4F9CA 3PIYA 2QO9A 5LOHA 4FZFB 5A54A 2ZB0A 3CTHA 3UP2A 5C8MA 4BICA 2OKRA 2AYPA 4RC3A 2GQRA 4W8DA 2QG7A 2R3JA 3O7LD 4NH1A 4P5QA 3ZO3A 4E5WA 2YACA 4KKEA 2GNLA 4YJUA 4RJ4A 2WEVA 3W10A 4C38A 5CZIA 4BBMA 4DFYA 4DFBA 3LJ0A 2IO6A 4ZY4A 3C4XA 2OW3A 4CZTA 2C6DA 4QYYA 2ZJWA 3EWHA 3V5QA 5DR2A 2DS1A 3LHJA 4MKCA 1H26A 4ONAA 3RNIA 4FNYA 4OTDA 3O8UA 3ORLA 1H25A 1GIHA 4I93A 3FEGA 3N51A 4LRKA 3DPKA 5LMKA 5JSMA 4UWBA 3PZEA 1J1CA 2O2UA 3KGAA 3O51A 4YZDA 2VTAA 1U59A 1ZRZA 4ZJIA 3Q53A 4L3PA 1KE9A 4YZBA 4AW1A 3LXKA 2XVDA 4G5PA 3PJ1A 2JGZA 4ACCA 2B55A 4KBCA 4EWQA 4BN1A 2E2BA 1YXTA 3WYXA 4ZK5A 5HO6A 4NM7A 1OL1A 3C0HA 4MBIA 5E91A 4A9RA 2YJRA 5CNNA 4U43A 2F2CB 3M2WA 3AGMA 2OJIA 4FODA 4IX6A 5M06A 4C62A 3Q96A 1GZOA 4I6QA 4U6RA 2YZAA 2UVYA 2VO7A 3QZFA 4QTCA 2J5FA 5HLNA 3G90X 4NKSA 4FKSA 1XH6A 4NT4A 4TNBA 5CEKA 1B6CB 1PY5A 2XNOA 4N6ZA 4O0WA 4W9WA 2C1BA 5CLPA 5AAFA 4AG8A 1SVEA 2EWAA 2OFVA 4RX7A 4CV9A 3ZLSA 5FG8A 4WNMA 3PA4A 3QQJA 3LE6A 4QMPA 3I7CA 4MXOA 5L6OA 4FTJA 5HE2A 4QMNA 1PF8A 1R3CA 2PZYA 4PL3A 2HZ0A 4L44A 2WU7A 3G33A 3MYGA 5IQBA 3ZTXA 3UC4A 1PKDA 4I21A 2W5AA 5C8KA 4ANQA 2JLDA 4YUQA 2QOFA 5ACBC 2E9OA 3VRZA 4JG8A 3CGFA 3MWUA 3R73A 4RIYA 2VWXA 4D1SA 2WU6A 2UW6A 4XV3A 4DGGA 1Q5KA 4JQ8A 5GNKA 3AT4A 3A4OX 4DYMA 4EYJA 3PUPA 4JX7A 3VS6A 4G3EA 5IQAA 3E8EA 3DB8A 1YW2A 5EK7A 2P55A 5EM6A 3NYVA 5KE0A 5EHOA 4F99A 4O0YA 1FVRA 4JIKA 1H8FA 4QMMA 5CF5A 3Q5IA 4LL5A 3O8PA 4JRNA 3LFDA 2DQ7X 2FGIA 3BHYA 2PZRA 3QKKA 4U9AA 4YC3A 4ZTHA 4HVIA 5I5ZA 3HKOA 1WZYA 2XK8A 3EQDA 4S33A 3LPBA 3QLGA 4S2ZA 3KCFA 4ZSGA 2ITWA 4Y83A 4F0IA 3VW6A 5CALA 2W1IA 3FXWA 3PY0A 5CSWA 3C0GA 3QFVA 5TO8A 4FV9A 4YNOA 4C37A 4F08A 3CKXA 4IDVA 5BYLA 2QURA 4ASXA 4D2VA 2XIYA 4MD7E 4EH2A 1YRPA 4IWQA 3LXNA 3AC1A 4WNOA 3R71A 2B9IA 3F5UA 3FMMA 1I44A 5FGKA 4E8AA 4PP9A 5DWRA 3AMYA 3R7IA 3VHKA 2QQ7A 4OR5A 4KIQA 3VJOA 4FK3A 3NEWA 4LRMA 2C1AA 4BTJA 2VN9A 4USDA 3S95A 1OKWA 3FLZA 4USEA 3VBXA 4PTCA 3VQHA 1G3NA 3Q6UA 4IHPA 4HVSA 3R2BA 3NUXA 1JLUE 1UU3A 2IJMA 5IU2A 1H07A 4C59A 4Z55A 2B9FA 2HENA 3NNWA 4FKJA 5AJQA 1K2PA 4CT1A 3L9PA 1GIJA 4OBOA 5AP2A 2H6DA 4RMZA 5D41A 4I5CA 2WQNA 5CSVA 2QO7A 4WG5A 5CI6A 4C3PA 1OITA 2XJ2A 4OTQA 4DA5A 5GJDA 1REKA 2E9NA 4QMOA 2FB8A 3UQFA 3RHKA 4IJPA 3SKCA 4WSQA 4UX9A 4A07A 3D15A 4QMQA 5DEYA 3F6XA 2O3PA 2WMSA 3KMWA 3LXPA 3GCSA 3NSZA 2W17A 3WZJA 3VBVA 4FG7A 3E8NA 3PSCA 4PWNA 3CXWA 1BI8A 2Z60A 3F2RA 4FZ7A 4NUSA 3DBDA 3KVXA 3JY0A 3PWDA 2BIKB 4ANSA 2PPQA 3N9XA 4KNBA 2HY81 4RIYB 5FM2A 2V7AA 1ZMWA 2WMVA 3EKKA 4GUEA 5I3OA 4JR7A 5K0KA 2E9UA 4LGHA 4MH7A 2CNVA 1Q41A 4PL4A 4RLKA 5E8TA 3IG7A 5ANGA 1W98A 3JVSA 4ZJJA 3R8MA 3ACJA 4CQGA 1R39A 1UNHA 2GS6A 2XJ0A 3GU8A 5LARA 2X2LA 3UOJA 4F7LA 3NCGA 4F09A 1CTPE 2ZDTA 2Y6MA 1BI7A 2EXMA 2BHHA 5CEIA 3MTFA 4XP2A 4UZHA 1OZ1A 1OL2A 2XM8A 4FTMA 4QMWA 5IQFA 2CJMA 3EQCA 3ZBXA 5HQ0A 4HPTE 1U5RA 4TYHB 3VUMA 4G6NA 2WEIA 3PVWA 4D2RA 2XYUA 4FT0A 3GGFA 3RINA 4E4LA 3R1YA 3Q4UA 3NUYA 1NVRA 4YU2A 2ZVAA 2X1NA 2JFMA 2YIXA 5CEOA 5IQEA 2OGVA 3MY1A 3TL8A 3VS3A 3FZSA 4O7RA 4FTOA 1LR4A 4X3JA 3LXLA 4I24A 4XOZA 4BI0A 1XH8A 5FWKK 3LFEA 3UGCA 2J90A 3CY3A 3QC4A 3A99A 1ZARA 4JQ7A 4X7QA 4BIDA 3FKOA 5EG3A 1PXJA 2OBJA 1U4DA 2IWIA 2J4ZA 3R7YA 4X2FA 4AE6A 3LLAA 4YC6A 2CMWA 1XR1A 4DITA 2DUVA 5JFWA 5TKDA 4HNFA 4J71A 5CANA 3UQCA 4FBXA 5HOAA 4TWOA 3DKOA 3AD5A 4J96A 3ORTA 4IVCA 4E5BA 1TVOA 5KMOA 2X7OA 4IW0A 2WOTA 5ETCA 1LPUA 1Y57A 2WMTA 3BHHA 5CF4A 1MP8A 1RJBA 4FK6A 4J98A 3VS2A 5CWZA 4QP3A 4C4FA 4E4NA 4D2PA 2PU8A 2V55A 4QNAA 4O96A 4RFMA 2UW7A 2GTMA 2BILB 3HV6A 4IQ6A 4L01A 3TNIA 5ETAA 3TUDA 2YA9A 1J7IA 4QMYA 4PP7A 1XBBA 4QPAA 2WNTA 5EM8A 3V5JA 4F6UA 4RVLA 4BY9E 4I0TA 1OL7A 3QD2B 4YMJA 4G2FA 4XG7A 3VBTA 4MWHA 2XJ1A 1P4FA 4L67A 4I5PA 3MB6A 5D12A 1G8AA 1B39A 4ZTNA 4EOMA 5EW9A 4EHEA 2VTMA 3UNJA 3KB7A 3PZHA 3A4PA 3LCSA 4ZMFA 4BR3A 3V5PA 2BRNA 1M52A 5DEWA 2A19B 5H2UA 2ITUA 1WCCA 4IH8A 1UWJA 5HGIA 4C4IA 5L8LA 4OT6A 3P5KA 1WAKA 4FYNA 5EYKA 3HV3A 5HBHA 2W4OA 3PPKA 2Z02A 2QO2A 3EYHA 2HZNA 2C5YA 2J7TA 2XK4A 4QMVA 2ZOQA 2WQEA 3ZM4A 5CEMA 5M56A 4C61A 3DNDA 3O17A 3VULA 4O0VA 5E9EA 2X8EA 2VTNA 3DTWA 3QCQA 5AA9A 1R0PA 1YHVA 1U54B 2UW4A 3GXLA 3QC9A 4DAWA 4ZSAA 4NL0A 3HMMA 4MD9E 3UIXA 3UOHA 4EK5A 3NLBA 4R6VA 2J0IA 1OPKA 2VWBA 4EH6A 4BC6A 2FA2A 2JIVA 2QHMA 2FSMX 1KE7A 3CTQA 1H01A 3CLYA 3F2AA 3QZHA 4MEDA 4USFA 2DWBA 3BGQA 5C8NA 4BTKA 3F3ZA 2OIBA 5M4IA 3IOPA 4ASZA 3D83A 1Q24A 5CYIA 4ANMA 2O63A 4DG3E 3R8VA 3ZUVA 5A6NA 3UPZA 3Q52A 4BCJA 1GY3A 3ZM9A 5LWMA 1H1QA 2I6LA 2ITXA 4G9RA 4L9IA 5J1VA 3GU6A 3W2RA 4QO9A 4RC2A 4AOTA 2QCSA 1XO2B 3MB7A 1L8TA 5HIBA 5AR2A 3PVUA 3EQRA 4RVMA 3RTPA 4IZ5A 3FI2A 3Q9ZA 4YR8A 4EHGA 4YTCA 2YWPA 3H0YA 2WGJA 3MSSA 3NAXA 4HZSA 4FGRA 1GNGA 3A7HA 1JWHA 3L1SA 4RT7A 5CTPA 3E93A 1PMUA 3RK7A 3P7BA 3B8RA 1JAMA 3CP9A 1WBVA 4XBRA 4C0TA 2C0TA 4CKRA 3EHAA 3I5ZA 3U4UA 3A7IA 2W05A 1WBOA 2YDKA 4IAIA 4FEXA 1F5QA 3RNYA 4OTFA 2CN5A 1VR2A 2ITZA 2QOKA 2W1HA 3FKNA 5FTQA 3KKVA 2VWUA 4OTGA 4UB7A 5CU3A 3PVGA 3DGKA 3QKMA 4M13A 5C9CA 3F9NA 4QQ5A 3A61A 3WF5A 3WE8A 3AD6A 5IMXA 5B2LA 3VIDA 3SW7A 5KBQA 4MQ2A 3SD0A 3GCUA 2QHNA 4OGRA 4IAFA 2X9FA 5HI2A 4LM5A 4CFVA 4FF8A 4IVBA 1XQZA 5B2KA 3H9OA 5AP4A 2BUJA 4XV2A 4EZ3A 4X3FB 2OICA 4YJTA 4OTWA 2CLQA 4I0RA 5BNJA 2QVSE 3HZTA 4ZZOA 5AEPA 5IZFA 1ZAOA 4QP8A 4AUAA 5KMJA 1GZNA 3RBWA 4HVDA 2UZNA 2ZV9A 4BFMA 3I60A 4C2VA 1Q62A 4BDIA 5JGDA 5ANJA 3GC8A 3UC3A 2Z7SA 5C27A 4C4GA 5F4NA 3ZZWA 3DXNA 3POOA 1KOAA 3LCOA 3NPCA 4AU8A 4F1MA 2PVFA 2CN8A 1R0EA 5IA1A 4EK8A 4BYJA 2C4GA 2XK3A 4TWCA 4IX3A 3DKCA 4J8NA 1AGWA 1IAJA 5HBEA 2JDRA 2PMNX 4JBVA 1YHSA 3KC3A 4JAJA 4DTAA 4U42A 5CAUA 5CSXA 3BV3A 3E7OA 2QODA 4TZRA 4ALUA 1QPDA 4CRLA 4FUXA 4YURA 5L8JA 2R7IA 3GQIA 3DAJA 3KEXA 4YO4A 3GI3A 4EHZA 4U44A 4FKQA 3HRBA 5AV0A 4C58A 5BX0A 4EJ7A 3IDPA 3ULIA 3QWKA 4JG7A 4LRJA 4D4VA 1WVXA 3FDNA 3OCGA 5BVEA 3QU0A 4X21A 4JXFA 5I9VA 4M15A 5J7HA 2VTIA 4AN3A 4KAOA 5HEZA 2QLUA 3W8LA 4XP0A 4E3CA 3E87A 2RFNA 5JFSA 2XS0A 3FY0A 3UP7A 3L8XA 5E8UA 4UZDA 4X2JA 4ACHA 2J0KA 4LG4A 4X2NA 2R3FA 3P79A 3LFFA 3QTWA 2UZDA 3KY2A 3VO3A 3PP0A 4TNDA 1FOTA 2NRYA 3TIZA 4JDHA 2CPKE 4BWPA 4EH5A 5DGZA 4B8MA 4XRJA 4PTGA 4EOKA 1YXUA 4XH6A 5A3XA 4UWCA 4LUDA 5B7VA 5HZNA 4EZ7A 3EFJA 4IM2A 1MRYA 4C57A 1V0BA 4O0RA 3EZRA 4RWLA 1BUHA 2W5HA 3VW8A 5HBJA 5ICPA 3E64A 2I7QA 2WMQA 4O82A 2F2UA 2W1EA 3BHVA 1YXVA 2HW6A 4GW8A 3LAUA 2C0IA 4D4RA 3UNZA 3AGLA 4FSTA 2YLFA 5TOZA 4K8AA 4BTMA 5KBRA 4GFMA 4XG9A 4C4EA 1OUYA 4XLIA 5JZNA 4RIXB 3IDCA 4YC8A 4FTKA 4FG9A 5HG8A 3UJGA 3ZYAA 4FT7A 5BUJA 1OM1A 2PVNA 4FZAB 4R5SA 3RKBA 3VAPA 1OMWA 4EOLA 4C02A 2R3IA 4EH9A 2XK6A 2XNMA 1GZ8A 5GZ9A 3JVRA 5CVFA 2WMRA 5HG7A 4CCBA 5JRQA 1S9JA 3NZ0A 4F9YA 3T3VA 2VTRA 5EDRA 2EU9A 1M2QA 4I5HA 3SLSA 3V3VA 3G15A 5IKWA 4HCVA 3ZDUA 5IA5A 4FV7A 5CAQA 5GJFA 4RJ5A 3U87A 3WF7A 3DDPA 4NW5A 5KHWA 4ACGA 3L9NA 5KKRB 1UU9A 5EI8A 2EVAA 4FVQA 3D5WA 2XA4A 3LCDA 3PY3A 3D7ZA 5LMKC 3QZGA 4RIWB 3BEGA 4IM0A 4JX3A 3MTLA 3NUSA 3SRVB 2VUWA 3D4QA 4ZTMA 4MXZA 4DH3A 4F63A 2XNPA 2JD5A 2W1CA 3TIYA 3EQBA 5HX6A 2G9XA 4OUCA 4NSTA 3REPA 5KZIA 1Y8YA 3BZ3A 1ZOGA 5E8XA 3L8SA 2X81A 3U9CA 4DFUA 5M09A 5D1JA 1OBDA 2BDFA 2J0MB 3BQRA 3BYVA 4AW5A 1JQHA 4C4JA 3LVPA 5EW8A 3A60A 3EQGA 3FY2A 3ZO2A 3ZRLA 2BZIB 2PMIA 2UZUE 4NU1A 3UVQA 3VQUA 3W2SA 4D0WA 4EONA 3PSDA 2A2AA 2R0IA 2RFDA 3FI3A 3UTOA 1YXSA 4O0XA 2YWVA 4EBVA 4EOQA 3CGOA 3BYMA 4TL0A 4TYGA 2Q0BA 3FV8A 4NKAA 1XHAA 4YJQA 3GCQA 2Z7QA 3P7CA 3MJ2A 4ZTRA 4JT3A 3TV6A 1F0QA 3ZC6A 3Q32A 3TKUA 3ENHA 4OT5A 5BYZA 4UMUA 4QQTA 4O7VA 3G2FA 3MA3A 5AR3A 4CKIA 2Y4PA 5I3RA 3F2NA 1K3AA 4FSWA 3UMXA 2C6TA 3FZRA 1OPLA 2GMXA 4WUAA 2PWLA 4D5HA 4MF0A 3TNHA 4L3JA 3FL5A 3HV7A 5JQ8A 3PWYA 1SNXA 4IIRA 2R3KA 3TKIA 3QBNA 3KK9A 1KSWA 2G2IA 3FUPA 2YAKA 4APCA 4IAYA 5CI7A 4YLKA 3KREA 5ETIA 4UMRA 3BYUA 4EH8A 2ITQA 2HXQA 2I0YA 3W8QA 3ODYX 4DEAA 5AUUA 2VX1A 3AC8A 4JVGA 4JAIA 2VWIA 4QT1A 4ID7A 3D7TA 4X2GA 5J9YA 2FH9A 2XH5A 3DB6A 2XNGA 1YDSE 2YIQA 5HLWA 2JDTA 4F7JA 5FUTA 3MY0A 3FLQA 3GFEA 4R7IA 5HE0A 5IISA 1DI8A 3QKLA 5LVNA 5HICA 3UO4A 3DLSA 4KRCA 3W2OA 2KULA 3QRJA 4N4SA 5CU6A 4A7CA 4EHVA 3IW5A 4PQNA 1JKSA 3UIMA 1WBWA 4NZWB 3QCYA 4U81A 4D4SA 4YJOA 4E4MA 5M51A 2XIRA 3DK3A 3DU8A 4PNIA 4DH5A 1GAGA 2CGUA 3NIZA 1EH4A 1W84A 3OHTA 3IECA 4MF1A 2UW3A 3I79A 3GCVA 5FEDA 3LCKA 4I0SA 3ROCA 1YI4A 5AA8A 4F9AA 1SVGA 4L43A 5IUGA 4FI1A 1Q3WA 2I0HA 4W4VA 2C3JA 5C03A 2QONA 1H1PA 2PUUA 4FYOA 5D7VA 1NT2A 1JKTA 3HUBA 4YTHA 4FE2A 2WPAA 3KF7A 4QNYA 3I4BA 5ANOA 4FTLA 5M4FA 5M4UA 3VBQA 5K4JA 4KS7A 2EB3A 1ZOHA 2CLXA 2WQBA 4EKKA 2HZIA 3Q60A 5LVOA 2GPHA 1BYGA 2GNGA 3LFCA 5AAEA 3FMEA 5HX8A 4DH1A 2ERKA 4FOBA 2J0LA 3LMHA 3TV7A 3AT3A 4I92A 3TN8A 5JKGA 2HELA 3TUCA 3MIAA 4HNIA 2AC5A 4I4EA 4NM3A 4CCUA 1E1XA 4BTFA 5CNOA 2ZM3A 5E1EA 4CLIA 1DI9A 2H9VA 2WMWA 3E3PA 4B7TA 1WBNA 3HNGA 3K3IA 2R3HA 4O7NA 2IVTA 5J87A 4ZLYA 2YHVA 1ZMUA 3O0GA 4YNEA 2ZDUA 3BBWA 4CFFA 4UMTA 4W9XA 2YISA 3KU2A 4QQCA 4PPBA 1VZOA 2V7OA 5HVJA 4AQCA 2C69A 4BB4A 4EQUA 3HAMA 3DJ5A 4ENXA 3VN9A 3FHRA 3UZTA 2ITOA 2DYLA 2W7XA 3AC5A 3FI4A 3GC9A 4FX3A 3HGKA 4EEVA 3ZBFA 3C4CA 4UALA 3GUBA 3RWQA 3BQCA 1IRKA 2BDJA 3OTUA 4JG6A 4OTHA 2EUFB 3DCVA 4KB8A 4GV1A 4RJ7A 1YHWA 3HL7A 1WFCA 1H27A 3R21A 3R30A 4YBKA 1R1WA 2OO8X 1W83A 2ZMDA 4IE9A 3A2CA 2R4BA 1CKJA 4BCFA 3Q9XA 2QOHA 4AOJA 4G3FA 3GENA 4HYHA 3VF9A 3W2PA 3HA6A 2XNBA 2PVRA 1A48A 3G6GA 4L42A 3I1AA 3G6HA 4JJRA 2XRWA 3MESA 3QHWA 1TQMA 3ENMA 1OKVA 2GS7A 3OOMA 3EQHA 4JDIA 5CEQA 4F7NA 2GQGA 3KL8A 5DT0A 1QCFA 3I5NA 4RQVA 1GZKA 4XP3A 3UQGA 2YZLA 4EWHA 3ZXTA 1SNUA 1ZZLA 2WTKC 5L2TA 3I81A 5LCKA 4F65A 3W33A 3LMIA 1Y6BA 1Q8TA 2B0QA 3IGOA 4GSBA 5L6PA 2VRXA 5AP3A 4B9DA 3L8PA 4ANNA 4ALWA 1CMKE 2HAKA 1ZYLA 3UE4A 4ITIA 5FBOA 4OLIA 3BLHA 3DY7A 3PXQA 5M55A 3V01A 5IQHA 1PXNA 3NNVA 3ODZX 3VUHA 4RRVA 3LJ1A 2YERA 2NRUA 5EDPA 3DXPA 3F7ZA 4L53A 2JFLA 2QOBA 3KXXA 2R64A 4PPAA 4LOOA 2R2PA 5CXHA 4IX5A 3PA5A 5C26A 2BAQA 2NPQA 2YAAA 5AUZA 4UYAA 4E6CA 4EC9A 5JMSA 3FHIA 3IGGA 4I3ZA 5JEBA 2C68A 1OUKA 4ASEA 5LWNA 3BHTA 3OP5A 2P4IA 3I7BA 2Q0NA 4KSQA 3R2YA 2ZV2A 4L45A 3Q2MA 3E88A 1OKYA 3U54A 4FKUA 1W8CA 2WTIA 1PKGA 4FSNA 4WO5A 1QPEA 4RIOA 4OTRA 3F3TA 4PDPA 4IB0A 3EFKA 3AG9A 1H1WA 4YSJA 2ITVA 3FWQA 5KHXA 1UA2A 4FKVA 4O84A 5DH3A 5H8BA 3MH2A 3SQQA 2CKEA 4DHFA 4O1PA 4KINA 2QU5A 3FMJA 4P4CA 4F70A 2WMBA 3TNQB 3H30A 2G15A 2UZEA 3OMVA 2VWZA 2VTSA 4J52A 1JSVA 2B9JA 4QYGA 4YPSA 3CKWA 3NGAA 4FSZA 1Q8UA 3Q9YA 3SX9A 4FV5A 2FO0A 1H1RA 4O0UA 4HYSA 2BRHA 3D5XA 4ZS0A 4RPVA 4NCTA 1UVRA 1IG1A 4S34A 5J9ZA 5AADA 1JSTA 5ANEA 3DKGA 3IW8A 2GHLA 3U4WA 5LXMA 4RJ8A 4DN5A 1PXOA 3P23A 4I6HA 1WBSA 3AQVA 1YI6A 4GT3A 2C6LA 4FL1A 1KV1A 4JBPA 5G1XA 3TG1A 5JK3A 3TM0A 3OVVA 3MVHA 4BKZA 3B2TA 4RWJA 4EOIA 2I0VA 5K0XA 2IW6A 2J2IB 3EN6A 5C1QB 4IWPA 3EKNA 3VS7A 1STCE 4YZNA 4O2ZA 4WT6A 4W4YA 4LGDA 1BL7A 4FT9A 3POZA 4HGEA 4II5A 5CT0A 4F0GA 3W55A 2XKCA 4U0IA 3VS4A 4EBWA 2OZAA 5AX3A 5DE2A 1UKIA 3RM6A 4FL3A 4RQKA 4FNXA 1KE5A 1U5QA 2BRGA 2OJ9A 3KMUA 4JOAA 4KIKA 4C4HA 4CTBA 5L2SA 3RPOA 2XCKA 3NAYA 4PRJA 4ZTQA 3SG8A 3QX2A 3QQGA 5EKNA 5ANIA 3OW3A 4J1RA 4OTPA 1A9UA 4ITJA 2VTLA 5DBXA 1YDTE 4DEIA 3ZSIA 3PYYA 4DEDA 3QALE 4PDSA 4CG9A 2ZB1A 4MCVA 3BX5A 4EQCA 5HD4A 2YDIA 4BCHA 1BL6A 3R9OA 3FQSA 3IS5A 4ZLZA 3LQ3A 2C6KA 5AV1A 3M1SA 3UOLA 3QD3A 3AC3A 5CVGA 1UKHA 4F1OA 1Y8GA 2BFYA 2PSQA 5BVNA 4FV6A 1FGIA 3VUTA 3NRMA 3RPSA 3DS6A 2VWVA 2Y6OA 1J7UA 3A8XA 3WILA 3QQFA 4CD0A 2QD9A 3I6UA 1T46A 2PMLX 4JQEA 4FEWA 5I9UA 2Y8OA 5FXRA 3FQEA 4MQ1A 4NJDA 3LJ2A 5KNJA 4XNEA 5FP6A 4QOXA 4QD6A 3BGZA 4EH7A 5CXZA 5AR5A 4FMQA 4S30A 4C3FA 4ZS4A 4BL1A 5F20A 2VV9A 1JPAA 4GEOA 5AUVA 1VYWA 2X4ZA 3FMNA 2LAVA 3ULZA 4C2WA 4C3RA 4HVGA 1KUTA 2OIDA 3E62A 4AS0A 4OAVB 4ZSJA 3KA0A 4AWIA 3PXYA 2PE1A 2VWWA 3CPBA 2R3QA 1ZY5A 5EQYA 4Q5HA 4E1ZA 4XG4A 2VZ6A 3D5UA 3QAME 2OG8A 2XK7A 5J5SA 3WE4A 4M66A 4AT4A 3ORNA 5FRIA 1XJDA 5D7AA 3ZU7A 4H3BA 3KRWA 4O1OA 2XZSA 4P5ZA 4M84A 3OZ6A 2QOLA 5BVKA 4F6SA 1DM2A 2CNQA 3QD0A 3DA6A 4KBAA 5EYMA 4TT7A 3BLQA 1QMZA 3CD3A 2ZM1A 2RKUA 4K18A 4BGGA 4JIAA 5D9HA 1FMKA 3MFRA 3DQXA 2YIWA 3DT1A 4KUJA 4YLJA 3NS9A 1OIUA 4FR4A 1TQIA 1LUFA 3UZPA 4FGBA 3F3UA 1YVJA 3QYWA 5BQ0A 4BI1A 3PG3A 4WHZA 5AR4A 2C47A 4CTCA 2OJFE 4O7YA 1J91A 4K0YA 3MH3A 3LFQA 4FOCA 4KKGA 4F1TA 4FZ6A 1SYKA 1FMOE 5EYDA 3BWJA 4ITHA 1V0PA 5CQUA 3E7VA 4MXXA 1PW2A 3BYOA 4YBJA 2O8YA 2WAJA 4O7TA 1REJA 4GU9A 2BHEA 5A4LA 3PXRA 4Y72A 5AP0A 1XH4A 4DGMA 3MN3A 2C5VA 2WXVA 1TQPA 3D94A 1AD5A 4F0FA 3B8QA 3TACA 4DLJA 3DZQA 5IPJA 1Z5MA 4Y85A 1PYEA 3HMOA 3R01A 4XV9A 3ZO4A 3ETAA 2PVMA 2OXDA 5DNRA 2HOGA 1XH7A 2ETRA 4GG7A 5C01A 4AXAA 2XM9A 3AXWA 3CC6A 4Z9LA 4C35A 5JH6A 1FVTA 5TR6A 3CEKA 3C13A 1QPCA 4KA3A 4HCTA 4D1ZA 2C3IB 5CASA 3I6WA 3QUEA 2OXYA 3VUGA 3G9NA 3R8PA 5IUIA 2B7AA 4EOJA 4QP9A 4YJSA 1W7HA 3OUNB 3EL7A 1VJYA 4X2KA 1Y91A 5FDXA 4FKLA 1O6LA 4M3QA 3P4KA 4I94A 2JDVA 4APPA 3BCEA 3FMKA 1OL5A 2GSFA 2ONLC 3PG1A 4I6BA 2ZM4A 3HP2A 4XOYA 4D55A 5AFVA 4Z7HA 3RGFA 3TKHA 2LGCA 2XNEA 1DS5A 1HOWA 3RM7A 3MY5A 3ALNA 2F7XE 3RHXA 3CE3A 2E9PA 4BDEA 4JBOA 4XV1A 2BVAA 2XRUA 4BDDA 3NX8A 3F61A 3MBLA 4R8QA 5E90A 4BGQA 4GUBA 3G51A 5G6VA 3VS1A 2BTRA 1OIRA 2Z7RA 3RK9A 3FXXA 4R7HA 1J1BA 4GKIA 4I20A 3FQHA 3OCTA 3KFAA 4MX9A 2YEXA 1HCKA 5I9XA 4AACA 3GC0A 2IVUA 3ERKA 5E8SA 4FSQA 3JY9A 5BVWA 3UVRA 1M7QA 4H05A 3FYJX 3PIZA 5HHWA 3TDWA 2ONLA 5EOLA 4WG3A 4PL5A 4ARKA 3HMPA 5AX9A 2GU8A 3ZUTA 5AAGA 1PMVA 2PZPA 1ATPE 5LCJA 4BHZA 3AC4A 3CJFA 3ZDIA 2UZLA 5HTIA 5HESA 4AZTA 4BCQA 4O0TA 4CXAA 5JT2A 2X8IA 3EFWA 4ZOGA 3IPHA 3EQIA 4JRVA 3QQLA 2C3LA 3PVBA 3QTSA 4LI5A 2X7GA 4V05A 1URCA 1ZY4A 4IZAA 4A9UA 4QMLA 4O7ZA 4DH7A 2HWOA 2W1FA 2IZUA 4KKHA 4MTAA 4O83A 2FSTX 4X3FA 4EYMA 4E26A 3NMUF 4G6OA 3OS3A 1ZYDA 4M68A 1CKPA 3BI6A 2HY0A 4BDFA 2B54A 4CZYB 4CT2A 3BKBA 4BWKA 4DEBA 4KABA 4CFNA 2ETKA 1J7LA 4RWIA 2AUHA 2OIQA 4E20A 3OCSA 4X3FC 3EN9A 3U55A 2PZ5A 1Q3DA 3IW4A 4O7LA 4DBNA 3QXOA 4AA5A 4E7WA 3NYOA 5E8VA 2YCFA 2HCKA 2YIYA 4HGLA 5LMBA 5AV4A 3QRTA 4DT8A 3SW4A 4CKJA 2QR8A 5M53A 3ATSA 1XKKA 4NJ3A 3RJCA 1I09A 4RX9A 4RBLA 3T9IA 1SZMA 4U80A 4EZ5A 3FL4A 1UV5A 5HO7A 4EI4A 5JGBA 3F69A 4FIHA 5AP7A 4H58A 3JYAA 2O0UA 3N4UA 3DBQA 5IMEA 2RGPA 4G5JA 1M2PA 4WNKA 5AIRA 2CKQA 3C4FA 3DAKA 1NXKA 3FSKA 3MPMA 4E93A 1MRVA 4ALVA 5T68A 4Y46A 3ZOSA 4CMTA 4JI9A 1FPUA 5EM5A 3R7OA 2PE2A 5CU4A 1VEBA 5A46A 4M69B 4CNHA 1E1VA 1GIIA 4D4YA 2GNHA 4LUEA 4NM5A 5FEQA 4BF2A 5FTGA 1WVYA 5DG5A 4OBQA 5I0BA 5CF6A 3U6IA 5I4NA 2QOOA 4N0SA 2QG5A 5EW3A 3MVJA 3QYZA 3W32A 3BBTB 2KTYA 4A9YA 2C30A 3U6JA 2OLCA 4DF3A 4K1BA 3C5IA 3SOCA 3C4EA 1UU7A 3R28A 4IBMA 3OEFX 2NP8A 4CV8A 4DLIA 4E73A 4XJ0A 4IADA 3OEZA 1PXIA 2BMCA 4YTFA 4A9TA 4IXPA 3IW7A 3EOCA 4V0GB 3R8LA 3QTXA 3GU5A 2XIKA 3T9TA 5GZ8A 5M07A 4U79A 2IZRA 5AR7A 3E92A 3PJ8A 4M69A 2NO3A 1BX6A 2F57A 2WTDA 3E8DA 3PLSA 1H0VA 3Q6WA 2JAMA 2WQMA 4NFMA 4AW2A 2XNNA 2OF2A 4JS8A 3SDJA 4U3YA 3HAVA 1FVVA 2V62A 4O7SA 3BPRA 5CQWA 3ORPA 3Q4TA 2CNUA 4FA2A 2WZJA 1SM2A 3BHUA 4LV8A 4WNPA 5JFXA 5AV3A 3PE2A 3ZFYA 5K5XA 5KMLA 5EH0A 2YM6A 4MXYA 4D1XA 2REIA 5E8ZA 4BYIA 5IQGA 2OI4X 5AV2A 2B53A 3GEQA 4M8TA 5TE0A 5IA2A 3E5AA 3MDYA 2PVHA 5H8GA 5DR6A 2WHBA 2BAJA 3KN5A 1PJKA 4DH8A 3S1HA 4MBLA 4O6EA 1R78A 4OAUC 2VGOA 3QCSA 2Z7LA 3RWPA 4CVAA 2Y7JA 3OTVA 2PVYA 5IA4A 4BCKA 2CCIA 5DPVA 3V51A 5HVYA 4RIWA 4D2WA 4FV1A 2IG7A 4R3CA 4DEGA 5JFVA 1PRYA 3OCBA 2ZAZA 5BUEA 4DC2A 4ZSEA 4H36A 4B6LA 2GTNA 3PXFA 4PF4A 3HV5A 5M57A 4CEGA 2YM5A 3PSBA 5KKRC 3EN5A 5M4CA 4FSUA 3O71A 2EXEA 2OWBA 3Q9WA 4WD5A 5L4QA 3UYTA 4QP4A 5C4LA 2X6DA 1H4LA 2YFXA 3ROYA 5HKMA 1Z57A 3H4JA 4IMYA 4FKTA 4UYNA 5C4KA 2W1GA 2PZIA 2F7EE 2JEDA 2JKMA 2ACXA 3ANRA 2SRCA 4EQMA 4M14A 3CQUA 3S3IA 2IVSA 4E6AA 3EFLA 2YCRA 3LIJA 4IC7A 3DFAA 4IJ9A 3QX4A 5EKOA 2JIUA 3H10A 2ITPA 2GNFA 3OFMA 4JDJA 3ZONA 3IK3A 5HU9A 1NVQA 3OY3A 5LVLA 3QL8A 5IQCA 2XCHA 1UU8A 4R3RA 4IVDA 4AZVA 4Q5EA 1ND4A 2GNIA 5IEXA 3WZKA 3GB2A 4DCAA 3OXIA 1YWVA 3RPRA 3LW0A 5AP5A 2J0JA 2WTWA 3F66A 1WVWA 3UODA 4FKIA 3SXRA 4YJNA 4TTHB 4AT5A 2G2HA 3CTJA 1FBNA 4F64A 3D5VA 3DV3A 3F3VA 2X39A 4ZXTA 3ZXZA 2OH0E 4IAKA 4QP1A 3NR9A 3SXFA 3WI6A 3JR1A 2BPMA 1YWNA 4KRDA 4GS6A 2VTJA 5BVDA 1Z9XA 3R7VA 3GCPA 2YM8A 4KS8A 5IUHA 2CHLA 2UZVA 2WD1A 1PXLA 1YOMA 4GK4A 4UXQA 1YWRA 4G16A 3UBDA 4NYEA 2R3OA 3GOKA 1H1SA 5AM6A 2UW8A 3QXPA 2FVDA 4XCUA 5ITAA 4EJNA 5JN2A 5EQPA 5GIOE 4X0MA 1BMKA 4Z3VA 3QA8A 2HXLA 3NVKI 4IVAA 5HTBA 4G1WA 5CS6A 3II5A 3FMDA 4L00A 1IR3A 1M2RA 4K33A 2PTKA 1B38A 4X6QC 2VTPA 5CAOA 5DFPA 3HRFA 1PXMA 5FTOA 3DBCA 3KULA 4K6ZA 3B2WA 2GCDA 3KXZA 3QUPA 3NNUA 1S9IA 3IKAA 1YQJA 3MW1A 4QQJA 3GP0A 4X6RA 3NNXA 2IN6A 3COHA 3LFNA 2JDOA 4XRLA 3UVPA 2BFXA 3WZEA 2ITTA 3NCZA 4QTAA 4DTKA 3UMWA 3ZUUA 2C5NA 1O9UA 5ANDA 3SG9A 3QGWA 1Q4LA 3LFBA 4WOVA 3D2IA 5HTCA 2BROA 4BCGA 1AQ1A 4BCIA 4M12A 5J7BA 3R04A 2B9HA 4IEBA 4AOIA 1XH5A 3HMNA 2YN8A 4BDBA 3UYSA 3Q4ZA 3QRUA 3HDNA 3F5PA 4HYIA 4IB5A 4BDGA 2GS2A 4IC8A 4TYJA 4DGNA 3WF6A 4ZTLA 1ERKA 1YOLA 4QYHA 5HU3A 4HGTA 4TWPA 1PXPA 2QU6A 2W06A 2WQOA 3DFCB 4FSMA 4FT5A 4DGOA 5B0XA 2XBJA 4EKLA 3PXZA 3LQ8A 2W9ZB 4MNEA 5BYYA 4YHJA 4E4XA 4V01A 1LEZA 3VF8A 1ZYJA 4EH3A 3HP5A 5KO1A 5CZHA 4G31A 4FICA 1DAYA 3CQEA 5JRSA 3MIYA 5AM7A 2X9EA 3EB0A 3FMLA 3MVLA 3HUCA 4OW8A 4FIIA 2QC6A 4M97A 2GFSA 3C7QA 2OK1A 4CZUA 4CGAA 4O86A 3GNIB 3FC2A 3NUNA 1JKKA 5EQEA 5DR9A 5DVRA 5K5NA 3ELJA 4L46A 5CU2A 4FKGA 3E63A 4U40A 5DT4A 3EN4A 5L8KA 3FJQE 5CY3A 4CQEA 3W18A 1KWPA 3ZFXA 3NDMA 4YTIA 3FSFA 4CYJA 1H24A 3MV5A 4PY1A 4RVTA 3RZFA 4EOPA 2HIWA 2W96B 3LM5A 5J79A 4DINA 5FLFA 3PIXA 3IOKA 4GYIA 4RGJA 5I9ZA 1W82A 2BZHB 2OJGA 1K9AA 1O6KA 3CQWA 5DYJA 3FZPA 1H00A 3ZS5A 3SAYA 1JBPE 2W4JA 3LMGA 2CGVA 4WBOA 3RI1A 2XB7A 3SV0A 3OROA 2R3GA 1ZLTA 5H9BA 3DAEA 3EZVA 4FTUA 4QRCA 4RC4A 4YHTA 3AOXA 4EUTA 4BVUA 4QPMA 4DEEA 4GT5A 2CCHA 2Z8CA 5J95A 3D14A 1H28A 4FTQA 4XMOA 3QA0A 4NTTA 1IASA 3C4ZA 3VWAA 1F3MC 2QKRA 3RAHA 3BRBA 4CLJA 4M0YA 4Y5QA 2PUPA 2WIPA 2F9GA 3SC1A 3SA0A 3R9RA 2O5KA 4D58A 4IAZA 2IZSA 4JDKA 4WBBB 3FLWA 4DCEA 3AT2A 1KV2A 4AW0A 4Q9ZA 4B4LA 2C5OA 2XP2A 2ETMA 3JUHA 1PYXA 2WB8A 3D9VA 3R7EA 3WOWA 2PHKA 2W9FB 4LMNA 2C5XA 2W1ZA 4FTIA 5EYCA 3IW6A 2A0CX 4S32A 5A4TA 5HNIX 3H9FA 3QLFA 3R8UA 3TV4A 4D2TA 3FE3A 5HG9A 3NUPA 2P2HA 5CT7A 3RK5A 4CG8A 1BKXA 3PPJA 3ALOA 3CIKA 3PJ2A 3Q3BA 4O22A 3KVWA 5LQFA 5IH6A 4L8MA 3RPYA 3VS0A 3VHEA 3G0FA 4LMUA 3O7LB 5E1SA 3Q04A 4FSYA 4R77A 4ZMEA 3TT0A 3WBLA 5LVPA 4MK0A 5A9UA 5DI1A 3Q2JA 3FKLA 5DIAA 5KMNA 1PHKA 3V5LA 4D2SA 5IH5A 5L2IA 4EOOA 3IO7A 4AF3A 3ZEWA 4GK3A 3P08A 3COIA 4K77A 2XKFA 3C0IA 5ETFA 3CPCA 5AUTA 4EL9A 2UW5A 4AFJA 3IQ7A 5IA0A 3TXOA 1NA7A 2UZOA 3KCKA 4BBEA 4QTEA 4TPTA 5CX9A 2FSLX 3PP1A 4GVJA 4DFZE 3QTIA 4YSMA 4A06A 4UEUA 3RALA 4YO6A 3LFSA 4AT3A 5HO8A 4TKSA 3OW4A 4NTSA 5A4EA 3N4TA 3RAKA 2QOQA 4GJ3A 4EK4A 4ZP5A 4FVPA 3FZ1A 2WKMA 4UMQA 3OT3A 3AMBA 3IDBA 5EFQA 4M0ZA 2C3KA 4AA0A 5CVHA 2BDWA 2PK9A 2V22A 1RDQE 4FC0A 4FVRA 4DFLA 3FLNC 3RVGA 4AX8A 3R83A 2H8HA 3EQFA 1H08A 1OL6A 4IAAA 3IONA 3K5UA 1YXXA 3EQPA 5J1WA 3QQKA 4I23A 4GKHA 1LP4A 3GT8A 4RA5A 3AD4A 3WIKA 1XBAA 3BE9A 3P1AA 5HCZA 1MQ4A 4FTNA 2ESMA 4QP7A 4RVKA 1CM8A 3U51A 4O81A 2P0CA 3ORMA 3WARA 3KQ7A 2BAKA 3F3WA 3QWJA 5K3YA 5JGAA 5KMIA 4QYEA 3LKMA 3ACKA 2ZV7A 3ORIA 4L68A 4RJ6A 3DKFA 4Z7GA 3S2PA 2V5QA 3ZCLA 4H39A 1WMKA 3R0TA 3KF4A 3SGCA 2YM4A 3BU3A 5HCYA 4AGUA 4E5AX 3D2KA 3OUKA 4UMPA 4AAAA 4BHNA 4JBQA 4QTDA 3K2LA
chains in the Genus database with same CATH superfamily
1QPJA 3GOPA 3OBJA 5JQ5A 2ITYA 5HIDA 5IG1A 4FUYA 3V6RA 4CFWA 3F5XA 4NEUA 3TCPA 4FV4A 4IX4A 5IQDA 2CSNA 4I6FA 4O0SA 4HJOA 2R3NA 4A4OA 3PFYA 3PJ3A 4EUUA 4QTBA 3MH0A 5CF8A 3A8WA 5HVKA 5GIPE 2C6EA 3KXNA 5K4IA 2YITA 3JXWA 4XHKB 1NVSA 3DJ7A 3VS5A 3DXQA 4G34A 2PY3A 4IFCA 1GJOA 4C33A 2JKOA 2QOIA 3FPQA 3H9RA 2B1PA 3QGYA 4U5JA 3FXZA 4D9UA 3QUDA 4WUNA 5LMAA 3MH1A 4UWYA 5HIEA 4ACMA 4ANLA 5BVFA 4QMXA 3QQUA 3W0QA 2RFSA 2RIOA 4IB3A 2WIHA 3KRXA 4GT4A 3HV4A 4XG3A 3W2QA 3VBYA 3BIZA 3QHRA 2VX0A 3R9DA 1PMEA 4L52A 4K9YA 3ZFMA 4F4PA 5B2MA 2QR7A 2UZBA 4DFXE 3K3JA 3NWWA 3OG7A 4JLCA 1OGUA 4RZWA 3SOAA 3VUDA 4CSVA 4R1VA 3MGYA 4A4LA 5F9EA 3TDVA 3PPZA 2PULA 2X8DA 4PMSA 3W16A 3ORKA 3TEIA 3R7GA 2R0UA 4I4FA 4PDYA 4RA4A 4CFMA 4J53A 5CU0A 2ZFYA 3MS9A 2X6EA 5AUYA 4GU6A 1G5SA 4NCTC 4HGSA 4KWPA 3KRLA 4FIEA 5AP6A 5L2QA 4O2PA 5IDPA 2F49A 4BWXA 4LGGA 2ZMCA 4N70A 3RZBA 5FP5A 4G17A 5FXSA 3JPVA 2O64A 3LM0A 3ZH8A 2XEZA 2HW7A 4LFIA 4UY9A 4F6WA 4FNZA 3UO6A 3KXMA 3TUBA 3A7GA 2IPXA 4MD8E 3QRIA 3SVVA 3K54A 2BRBA 2PE0A 4MYGA 3G0EA 2VX3A 4DBXA 5EI2A 2YM7A 4EORA 1IEPA 4R3PA 1MQBA 2YM3A 5EHYA 4D28A 1FGKA 2BZKB 2BKKA 3TZMA 4ACDA 2XAOA 3D7TB 5I9WA 3L8VA 3CCNA 2A1AB 1ZZ2A 5DOSA 3O2MA 3W2CA 4Q2AA 3BU6A 4D5KA 1DAWA 3GFWA 1P4OA 2RSVA 3HEGA 3LZBA 1XWSA 4YLLA 4H1MA 4ZIMA 2UVZA 2OJJA 1NW1A 1G8JA 3Q5ZA 4PX6A 5DLSA 5A4CA 3BELA 3C1XA 4F9WA 4GVAA 5FQDC 2OZOA 3I0OA 3PRFA 4MVFA 3Q4CA 1CDKA 2CDZA 4ZY6A 2P3GX 3QTRA 3U8WA 4NIFB 3E8CA 5EHLA 1OB3A 2OU7A 3C50A 4BKJA 4FEQA 4FG8A 3T8OA 1OBGA 3HLLA 5FEEA 3R9NA 2VU3A 3G9LX 3UPXA 4I41A 2IW9A 1CKIA 3PFQA 4FTCA 1BLXA 1YKRA 3C4WA 4H3PA 1ZWSA 1KE6A 2IZTA 2XKDA 3TTIA 2R3RA 5E8WA 4WKQA 2QLQA 1JKLA 2WFYA 3KRJA 4RWKA 2PVLA 4GRBA 3BYSA 4I5MA 4LOQA 4BCMA 4PNKA 3EMGA 4TN6A 1Q61A 2VWYA 2WTKB 3MPAA 5D11A 3TZ8A 3OWJA 3NFGB 4C8BA 2NNWB 4J97A 2C6OA 5AWMA 4FEVA 2A27A 2XIZA 2XEYA 3RCJA 2B52A 3ML1A 3P7AA 4AZSA 1ST4A 3WIGA 4ANOA 4BZDA 2X0PA 3DNEA 3UZRA 1JSUA 3H3CA 2JC6A 3PDTA 4N6YA 2IVVA 5EDQA 4BDKA 4XLVA 3OT8A 3UIUA 3MPTA 3ZLWA 2WELA 4RJ3A 4Y5HA 4BDAA 2GHGA 5DT3A 2I1MA 5KZ0A 3BGPA 5CENA 3F7WA 5ANKA 5DRBA 2Z2WA 1O6YA 2VD5A 4QYFA 5KCVA 4LOPA 1OECA 2C6IA 2R7BA 4CMOA 4MUQA 2R3LA 5HE3A 5M08A 4MNFA 5IF1A 4DG0E 4ZZNA 3UIBA 2WMXA 3E3BX 4L7SA 1P14A 2F4JA 3ZLYA 3VJNA 4YGAA 2QNJA 4FV8A 2X7FA 4C7TA 4GMYA 3CSVA 4S31A 4DDIA 4IDTA 1JOWB 3JS2A 3ORXA 4GIIA 4NM0A 5IQIA 3L9MA 4AFEA 2W99B 3V04A 2XBAA 4RFZA 3R7UA 4HYUA 3TTJA 4WRSA 1JNKA 4A4XA 1UWHA 3ID6C 5LJJA 4KSPA 2PUIA 3OWPA 4LV5A 4CFXA 3OXTA 5IH4A 2YIRA 2QOCA 2UZWE 2VO0A 2VTHA 3BU5A 3CS9A 3BV2A 3EL8A 3HYHA 5H3QA 4YZ9A 5I9YA 4CRSA 3FBVA 2AC3A 2R9SA 3NW5A 3A62A 3CY2A 4IWOA 1E9HA 5HLPA 5CEPA 4PMMA 4ANBA 5HD7A 5EOBA 3NUAA 4F7SA 3C51A 3ZHPC 5J5TA 5CSHA 3LQ5A 4YZMA 3VRYA 5D10A 1YDRE 2J6MA 4ZTSA 4AA4A 4BBFA 2W5BA 4RG0A 4I22A 1MUOA 3OC1A 2RG6A 4C34A 4FIGA 4K11A 1MRUA 4H3QA 3K5VA 2W4KA 5HG5A 4ZLOA 5AMNA 5AR8A 3AKKA 3BE2A 4MXAA 4WSYA 2CKOA 4FKWA 3LCTA 4V04A 2G1TA 3R1QA 3QD4A 5HORA 3GU7A 4EH4A 5E7RA 3DOGA 3OD6X 3R1NA 5HE1A 4DG2E 2JBOA 3MVMA 4G3CA 4G9CA 2OH4A 4W4WA 4YJPA 4PMTA 4Z16A 3H0ZA 3GQLA 1WBTA 1URWA 2FSOX 2YLEA 4Y8DA 5AIKA 1YI3A 5FDPA 1RQQA 3S00A 5DRDA 3FPMA 4MNEB 5A6OA 3KRRA 2VGPA 4J7BA 3DK7A 4DGLC 5J9LA 3OWKA 1NY3A 4PTEA 3NYNA 3T3UA 3HA8A 4HZRA 5BUIA 5KMMA 3PLAE 3BWFA 4PPCA 2WO6A 3F5GA 1Q8WA 3O96A 4O6LA 5A4QA 5TT7A 5FM3A 3HMIA 3ZSHA 4XG8A 4AZEA 2J50A 4O91A 4FV2A 4NK9A 4NFNA 2RG5A 3GBZA 3O23A 1M17A 3PXKA 5IA3A 2X4FA 4L3LA 4ZZMA 4BDCA 5BPYA 4FEUA 1IA8A 3ZO1A 4GCJA 2H34A 5KMKA 3PE1A 4BI2A 3DZOA 4FKPA 5AUWA 3VVHA 4IM3A 2UVXA 3P0MA 1PMNA 2XYNA 4GFGA 3PRIA 3MJ1A 1OI9A 4LL0A 2W1DA 1ZOEA 4BZNA 4B8LA 1Q8YA 4CMUA 2BRMA 4ORKA 1LEWA 4QMTA 2WTVA 3OBGA 2HZ4A 3ORZA 2ZYBA 3DTCA 4FIJA 3CJGA 3TJCA 1QL6A 4MAOA 4TWNA 3MFUA 3VUIA 3VUKA 5KX8A 4E6QA 3DQWA 3ZEPA 1P5EA 2XIXA 4RSSA 3BLRA 1VYZA 5ACKA 4BCNA 4R7BA 3MI9A 2UUEA 4BJJA 4U8ZA 3WYYA 3EH9A 4GFOA 4H1JA 3LOKA 2BTSA 3R1SA 5GJGA 3NIEA 5EI6A 3ANQA 3M11A 4DHIB 2WMUA 2V0DA 4YP8A 3QCXA 3WF9A 3EJ1A 2R3PA 4LQMA 2Y4IB 4GIHA 2QI8A 4MWIA 3R8ZA 3TNPC 3L9LA 4RIXA 5F1ZA 3KXGA 1ZXEA 2EXCX 4AE9A 3EIDA 3RPVA 1IAHA 4JR3A 4J8MA 4RZVA 4DFNA 4AQKA 4U7ZA 1YOJA 3V8WA 4WIHA 4PMPA 2C6MA 5A14A 3OXZA 4QP6A 1CSNA 2JITA 1RW8A 4IWDA 4XG2A 3V5TA 5AP1A 3M42A 4FKOA 2Q83A 3V5WA 1M7NA 4EK3A 4D0XA 2GFCA 2O65A 3DK6A 3QTQA 3WZDA 2BCJA 4RX5A 1ZYSA 3HECA 3S4QA 4G6LA 3COMA 4I1ZA 4O21A 1Y6AA 1Q8ZA 4ZY5A 2PMOX 5GINE 2OSCA 3AMAA 4ZEGA 2EB2A 5J8IA 4BZOA 1ZYCA 3D0EA 4CFUA 4IANA 2J9MA 3NW7A 3V8SA 4R78A 4MBJA 3COKA 3PY1A 4ASDA 5BVOA 2JBPA 4XYFA 2G01A 4Y95A 2IW8A 3SHEA 4BKYA 4U3ZA 3P5JC 2ITNA 4TYHA 3DJ6A 3NVMB 3WF8A 3U6HA 3FAAA 1M14A 1UNGA 2XUUA 3C9WA 2PVJA 5HCXA 3GVUA 5JZJA 5BMSA 3R00A 2E9VA 3ET7A 3GC7A 4OBPA 4QP2A 4AZWA 4ERWA 3R02A 3FLYA 5DMZA 1IA9A 3GU4A 3V6SA 4GJ2A 2X2MA 1KOBA 1ZMVA 1XH9A 2OF4A 3F88A 3PA3A 1U46A 4JL9A 4TYEA 4U97A 4XG6A 4XX9A 5IEVA 2I0EA 2YCSA 3S0OA 4V0GA 4DEHA 1T45A 4BCPA 2PUNA 4AGDA 2W0JA 4GG5A 3MFSA 3TZ7A 3O8TA 5CAVA 5CSPA 4J99A 2A4LA 2PL0A 2J5EA 2BKZA 1OPJA 4W4XA 3CR0A 2JIIA 4G3GA 2HK5A 2OXXA 2R3MA 4FV0A 1H0WA 3TWJA 3UOKA 2C0OA 2PYWA 3V8TA 3LLTA 4XS2A 4IACA 4A9SA 4M7IA 2JDSA 1VLRA 4TW9A 1V0OA 4FKRA 4B99A 3RAWA 3VBWA 3ZSGA 2XKEA 2UV2A 1KE8A 5BMMA 4CYIA 2ZV8A 5T3QA 4DE4A 4DHZA 4WA9A 3ZC5A 4FTTA 2YCQA 4DHJA 4GH2A 4ZJVA 2RL5A 4NIFA 4BJJB 4HOKA 1PXKA 5DHJA 3KMMA 2GQSA 3OY1A 1A06A 3QZIA 4KBKA 5DN3A 1JVPP 2YDJA 3AC2A 4O27B 4QMSA 4GYGA 4B0GA 2VTQA 3OWLA 3ZRMA 4FRFA 4J95A 3W0PA 3OF0A 2GHMA 1W0XC 2CGWA 3P86A 3SRVA 4P7EA 3OOGA 3UDBA 3A7JA 2VTOA 2HYYA 3HDMA 1P2AA 2RFEA 5L2WA 4FV3A 3RMFA 4MXCA 2FUMA 4QMUA 5CAPA 4BIBA 5FD2A 4PDOA 3SXSA 4AXCA 1U54A 2PVKA 4IZYA 2VO6A 4IFGA 3KULB 4NW6A 5L6WL 2BZJA 3UG1A 3ZRKA 3FI8A 4ZAUA 4Q9SA 5FBNC 2Y0AA 4GK2A 4RX8A 5T6KA 2IEWA 3N4VA 4RFYA 3DBFA 3RCDA 2R5TA 4D9TA 1OIQA 4UV0A 4O7WA 4TXCA 4AN2A 4QMZA 4KIPA 2G2FA 4PV0A 1APME 4TY1A 4R1YA 2YABA 4XBUA 2VO3A 5HNGA 3TNWA 3ZMMA 4M67A 3P9JA 3KK8A 2BALA 2F7ZE 2FYSA 2I40A 3HX4A 3KN6A 4IB1A 4AP7A 4BDJA 4C36A 5E4HA 4LYNA 4YJVA 1SMHA 3HVCA 3I0QA 4HPUE 3R9HA 4W8EA 4E6DA 4BIEA 5IEYA 4UBAA 2JKQA 4MHAA 4ZSLA 2ERZE 4FT3A 5AUXA 2GDOA 3FZTA 2UW0A 3F82A 4FTAA 4N57A 3DLZA 4DDGA 1FQ1B 3UG2A 4EK6A 1GOLA 2GNJA 1HCLA 3O50A 3KXHA 2VNWA 3R63A 5M44A 3ZLXA 5KUPA 3MFTA 5E8YA 3U9NA 4EOSA 1UNLA 5IDNA 4FSRA 4WRGA 2XK9A 2Y4IC 3MA6A 3VNTA 1V1KA 3TZ9A 4HVHA 4KD1A 2WMAA 3P78A 4HW7A 3ATTA 2VAGA 3UO5A 3DDQA 3QTZA 5GHVA 3LFAA 4O38A 3EN7A 5K9IA 5DA3A 4JNWA 3ITZA 1Q99A 2Y9QA 3FYKX 4L6QA 2H96A 4TRLA 4DT9A 2WTJA 4F9BA 4G3DA 5GZAA 2HWPA 3QTUA 2X2KA 4FTRA 4U41A 4ENYA 3DBEA 1OVEA 4K2RA 2OZAB 1X8BA 4BRXA 2B4SB 3NUUA 4EC8A 1XBCA 3ZZEA 3UNKA 2BR1A 2J51A 3CD8A 4BDHA 4UN0C 3QRKA 1TKIA 2X0GA 4KIKB 3W1FA 2P33A 5L3AA 3FC1X 4XEYA 3TI1A 4BCOA 4RLLA 2VTTA 4TYIA 4YZCA 3RP9A 4WG4A 4DTBA 4FIFA 2JKKA 3HRCA 4NWMA 1J3HA 3NYXA 3FZOA 4XUFA 3NW6A 3QQHA 5FXQA 1SVHA 5EM7A 1Q97A 5E92A 4P2KA 3CBLA 4QPSA 1OKZA 3R6XA 4FNWA 1FINA 4AZFA 5LVMA 4AGCA 3THBA 4L7FA 4FL2A 5F94A 3EYGA 2YJSA 3FMHA 5F95A 5H8EA 3QF9A 4YJRA 2QKWB 2WOUA 3C5UA 3VC4A 3WZUA 2X0OA 3RAIA 4U45A 4PUZA 4YPDA 4AN9A 4AGWA 1OIYA 5HNBA 4HCUA 4OTIA 5TF9A 3A7FA 3G5DA 4R5YA 4YHFA 3R22A 3BEAA 2XMYA 4ERKA 2UW9A 4P90A 2P2IA 1WBPA 2VNYA 3KIOC 2UZTA 1RE8A 4UXLA 2XF0A 4FZDB 2RF9A 2JAVA 3FLSA 4Y73A 2CKPA 4IZ7A 4BGHA 4GL9A 2WTCA 2OFUA 2BIYA 3PJCA 2CGXA 4KIOA 3TJDA 1G8SA 3PTGA 1L3RE 4F9CA 3PIYA 2QO9A 5LOHA 4FZFB 5A54A 2ZB0A 3CTHA 3UP2A 5C8MA 4BICA 2OKRA 2AYPA 4RC3A 2GQRA 4W8DA 2QG7A 2R3JA 3O7LD 4NH1A 4P5QA 3ZO3A 4E5WA 2YACA 4KKEA 2GNLA 4YJUA 4RJ4A 2WEVA 3W10A 4C38A 5CZIA 4BBMA 4DFYA 4DFBA 3LJ0A 2IO6A 4ZY4A 3C4XA 2OW3A 4CZTA 2C6DA 4QYYA 2ZJWA 3EWHA 3V5QA 5DR2A 2DS1A 3LHJA 4MKCA 1H26A 4ONAA 3RNIA 4FNYA 4OTDA 3O8UA 3ORLA 1H25A 1GIHA 4I93A 3FEGA 3N51A 4LRKA 3DPKA 5LMKA 5JSMA 4UWBA 3PZEA 1J1CA 2O2UA 3KGAA 3O51A 4YZDA 2VTAA 1U59A 1ZRZA 4ZJIA 3Q53A 4L3PA 1KE9A 4YZBA 4AW1A 3LXKA 2XVDA 4G5PA 3PJ1A 2JGZA 4ACCA 2B55A 4KBCA 4EWQA 4BN1A 2E2BA 1YXTA 3WYXA 4ZK5A 5HO6A 4NM7A 1OL1A 3C0HA 4MBIA 5E91A 4A9RA 2YJRA 5CNNA 4U43A 2F2CB 3M2WA 3AGMA 2OJIA 4FODA 4IX6A 5M06A 4C62A 3Q96A 1GZOA 4I6QA 4U6RA 2YZAA 2UVYA 2VO7A 3QZFA 4QTCA 2J5FA 5HLNA 3G90X 4NKSA 4FKSA 1XH6A 4NT4A 4TNBA 5CEKA 1B6CB 1PY5A 2XNOA 4N6ZA 4O0WA 4W9WA 2C1BA 5CLPA 5AAFA 4AG8A 1SVEA 2EWAA 2OFVA 4RX7A 4CV9A 3ZLSA 5FG8A 4WNMA 3PA4A 3QQJA 2X0QA 3LE6A 3I7CA 4QMPA 3MESA 4MXOA 5L6OA 4FTJA 5HE2A 4QMNA 1PF8A 1R3CA 2PZYA 4PL3A 2HZ0A 4L44A 2WU7A 3G33A 3MYGA 5IQBA 3ZTXA 3UC4A 1PKDA 4I21A 2W5AA 5C8KA 4ANQA 2JLDA 4YUQA 2QOFA 5ACBC 2E9OA 3VRZA 4JG8A 3CGFA 3MWUA 3R73A 4RIYA 2VWXA 4D1SA 2WU6A 2UW6A 4XV3A 4DGGA 1Q5KA 4JQ8A 5GNKA 3AT4A 3A4OX 4DYMA 4EYJA 3PUPA 4JX7A 3VS6A 4G3EA 5IQAA 3E8EA 3DB8A 1YW2A 5EK7A 2P55A 5EM6A 3NYVA 5KE0A 5EHOA 4F99A 4O0YA 1FVRA 4JIKA 1H8FA 4QDEA 3W0MA 4QMMA 5CF5A 3Q5IA 4LL5A 3O8PA 4JRNA 3LFDA 2DQ7X 2FGIA 3BHYA 2PZRA 3QKKA 4U9AA 4YC3A 4ZTHA 4HVIA 5I5ZA 3HKOA 3W0OA 1WZYA 2XK8A 3EQDA 4S33A 3LPBA 3QLGA 4S2ZA 3KCFA 4ZSGA 2ITWA 4Y83A 4F0IA 3VW6A 5CALA 2W1IA 3FXWA 3PY0A 5CSWA 3C0GA 3QFVA 5TO8A 4FV9A 4YNOA 4C37A 4F08A 3W0RA 3CKXA 4IDVA 5BYLA 2QURA 4ASXA 4D2VA 2XIYA 4MD7E 4EH2A 1YRPA 4IWQA 3LXNA 3AC1A 4WNOA 3R71A 2B9IA 3F5UA 3FMMA 1I44A 5FGKA 4E8AA 4PP9A 5DWRA 3AMYA 3R7IA 3VHKA 2QQ7A 4OR5A 4KIQA 3VJOA 4FK3A 3NEWA 4LRMA 2C1AA 4BTJA 2VN9A 4USDA 3S95A 1OKWA 3FLZA 4USEA 3VBXA 4PTCA 3VQHA 1G3NA 3UDZA 3Q6UA 4IHPA 4HVSA 3R2BA 3NUXA 1JLUE 1UU3A 2IJMA 5IU2A 1H07A 4C59A 4Z55A 2B9FA 2HENA 3NNWA 4FKJA 5AJQA 1K2PA 4CT1A 3L9PA 1GIJA 4OBOA 5AP2A 2H6DA 4RMZA 5D41A 4I5CA 2WQNA 5CSVA 2QO7A 4WG5A 5CI6A 4C3PA 1OITA 2XJ2A 4OTQA 4DA5A 4LDTA 5GJDA 1REKA 2E9NA 4QMOA 2FB8A 3UQFA 3RHKA 4IJPA 3SKCA 4WSQA 4UX9A 4A07A 3D15A 4QMQA 5DEYA 2WMSA 2O3PA 3F6XA 3KMWA 3LXPA 3GCSA 3NSZA 2W17A 3WZJA 3VBVA 4FG7A 3E8NA 3PSCA 4PWNA 3CXWA 1BI8A 2Z60A 3F2RA 4FZ7A 4NUSA 3DBDA 3KVXA 3JY0A 3PWDA 2BIKB 4ANSA 2PPQA 3N9XA 4KNBA 2HY81 4RIYB 5FM2A 2V7AA 1ZMWA 2WMVA 3EKKA 4GUEA 5I3OA 4JR7A 5K0KA 2E9UA 4LGHA 4MH7A 2CNVA 1Q41A 4PL4A 4RLKA 4O4BB 5E8TA 3IG7A 5ANGA 1W98A 3JVSA 4ZJJA 3R8MA 3ACJA 4CQGA 1R39A 1UNHA 2GS6A 2XJ0A 3GU8A 5LARA 2X2LA 3UOJA 4F7LA 3NCGA 4F09A 1CTPE 2ZDTA 2Y6MA 1BI7A 2EXMA 2BHHA 5CEIA 3MTFA 4XP2A 4UZHA 1OZ1A 1OL2A 2XM8A 4FTMA 4QMWA 5IQFA 3TMOA 2CJMA 3EQCA 3ZBXA 5HQ0A 4HPTE 1U5RA 4TYHB 3VUMA 4G6NA 2WEIA 3PVWA 4D2RA 2XYUA 4FT0A 3GGFA 3RINA 4E4LA 3R1YA 3Q4UA 3NUYA 1NVRA 4YU2A 2ZVAA 2X1NA 2JFMA 2YIXA 5CEOA 5IQEA 2OGVA 3MY1A 3TL8A 3VS3A 3FZSA 4O7RA 4FTOA 1LR4A 4X3JA 3LXLA 4I24A 4XOZA 4BI0A 1XH8A 5FWKK 3LFEA 3UGCA 2J90A 3CY3A 3QC4A 3A99A 1ZARA 4JQ7A 4X7QA 4BIDA 3FKOA 5EG3A 1PXJA 2OBJA 1U4DA 2IWIA 2J4ZA 3R7YA 4X2FA 4AE6A 3LLAA 4YC6A 2CMWA 1XR1A 4DITA 2DUVA 5JFWA 5TKDA 4HNFA 4J71A 5CANA 3UQCA 4FBXA 5HOAA 4TWOA 3DKOA 3AD5A 4J96A 3ORTA 4IVCA 4E5BA 1TVOA 5KMOA 2X7OA 4IW0A 2WOTA 5ETCA 1LPUA 1Y57A 2WMTA 3BHHA 5CF4A 1MP8A 1RJBA 4FK6A 4J98A 3VS2A 5CWZA 4QP3A 4C4FA 4O4DA 4D2PA 4E4NA 2V55A 4QNAA 2PU8A 4O96A 4RFMA 2UW7A 2GTMA 2BILB 3HV6A 4IQ6A 4L01A 3TNIA 5ETAA 3TUDA 2YA9A 1J7IA 4QMYA 4PP7A 1XBBA 4QPAA 2WNTA 5EM8A 3V5JA 4F6UA 4RVLA 4BY9E 4I0TA 1OL7A 3QD2B 4YMJA 4G2FA 4XG7A 3VBTA 4MWHA 2XJ1A 1P4FA 4L67A 4I5PA 3MB6A 5D12A 1G8AA 1B39A 4ZTNA 4EOMA 5EW9A 4EHEA 2VTMA 3UNJA 3KB7A 3PZHA 3A4PA 3LCSA 4ZMFA 4BR3A 3V5PA 2BRNA 1M52A 5DEWA 2A19B 5H2UA 2ITUA 1WCCA 4IH8A 1UWJA 5HGIA 4C4IA 5L8LA 4OT6A 3P5KA 1WAKA 4FYNA 5EYKA 3HV3A 5HBHA 2W4OA 3PPKA 2Z02A 2QO2A 3EYHA 2HZNA 2C5YA 2J7TA 2XK4A 4QMVA 2ZOQA 1TZDA 2WQEA 3ZM4A 5CEMA 5M56A 4C61A 3DNDA 3O17A 3VULA 4O0VA 5E9EA 2X8EA 2VTNA 3DTWA 3QCQA 5AA9A 1R0PA 1YHVA 1U54B 2UW4A 3GXLA 3QC9A 4DAWA 4ZSAA 4NL0A 3HMMA 4MD9E 3UIXA 3UOHA 4EK5A 3NLBA 4R6VA 2J0IA 1OPKA 2VWBA 4EH6A 4BC6A 2FA2A 2JIVA 2QHMA 2FSMX 1KE7A 3CTQA 1H01A 3CLYA 3F2AA 3QZHA 4MEDA 4USFA 2DWBA 3BGQA 5C8NA 4BTKA 3F3ZA 2OIBA 5M4IA 3IOPA 4ASZA 3D83A 1Q24A 5CYIA 4ANMA 2O63A 4DG3E 3R8VA 3ZUVA 5A6NA 3UPZA 3Q52A 4BCJA 1GY3A 3ZM9A 5LWMA 1H1QA 2I6LA 2ITXA 4G9RA 4L9IA 5J1VA 3GU6A 3W2RA 4QO9A 4RC2A 4AOTA 2QCSA 1XO2B 3MB7A 1L8TA 5HIBA 5AR2A 3PVUA 3EQRA 4RVMA 3RTPA 4IZ5A 3FI2A 3Q9ZA 4YR8A 4EHGA 4YTCA 2YWPA 3H0YA 2WGJA 3MSSA 3NAXA 4HZSA 4FGRA 1GNGA 3A7HA 1JWHA 3L1SA 4RT7A 5CTPA 3E93A 1PMUA 3RK7A 3P7BA 3B8RA 1JAMA 3CP9A 1WBVA 4XBRA 4C0TA 2NYAA 2C0TA 4CKRA 3BLAA 3EHAA 3I5ZA 3U4UA 3A7IA 2W05A 1WBOA 2YDKA 4IAIA 4FEXA 1F5QA 3RNYA 4OTFA 2CN5A 1VR2A 2ITZA 2QOKA 2W1HA 3FKNA 5FTQA 3KKVA 2VWUA 4OTGA 4UB7A 5CU3A 3PVGA 3DGKA 3QKMA 4M13A 5C9CA 3F9NA 4QQ5A 3A61A 3WF5A 3WE8A 3AD6A 5IMXA 5B2LA 3VIDA 3SW7A 5KBQA 4MQ2A 3SD0A 3GCUA 2QHNA 4OGRA 4IAFA 2X9FA 5HI2A 4LM5A 4CFVA 4FF8A 4IVBA 1XQZA 5B2KA 3H9OA 5AP4A 2BUJA 4XV2A 4EZ3A 4X3FB 2OICA 4YJTA 4OTWA 2CLQA 4I0RA 3PUFC 5BNJA 2QVSE 3HZTA 4ZZOA 5AEPA 5IZFA 1ZAOA 4QP8A 4AUAA 5KMJA 1GZNA 3RBWA 4HVDA 2UZNA 2ZV9A 4BFMA 4O4EA 3I60A 4C2VA 1Q62A 4BDIA 5JGDA 5ANJA 3GC8A 3UC3A 2Z7SA 5C27A 4C4GA 5F4NA 3ZZWA 3DXNA 3POOA 1KOAA 3LCOA 3NPCA 4AU8A 4F1MA 2PVFA 2CN8A 1R0EA 5IA1A 4EK8A 4BYJA 2C4GA 1G8KA 2XK3A 4TWCA 4IX3A 3DKCA 4J8NA 1AGWA 1IAJA 5HBEA 2JDRA 2PMNX 4JBVA 4AXFA 1YHSA 3KC3A 4JAJA 4DTAA 4U42A 5CAUA 5CSXA 3BV3A 3E7OA 2QODA 4TZRA 4ALUA 1QPDA 4CRLA 4FUXA 4YURA 5L8JA 2R7IA 3GQIA 3DAJA 3KEXA 4YO4A 3GI3A 4EHZA 4U44A 4FKQA 3HRBA 5AV0A 4C58A 5BX0A 4EJ7A 3IDPA 3ULIA 3QWKA 4JG7A 4LRJA 4D4VA 1WVXA 3FDNA 3OCGA 5BVEA 3QU0A 2IF8A 4X21A 4JXFA 5I9VA 4M15A 5J7HA 2VTIA 4AN3A 4KAOA 5HEZA 2QLUA 3W8LA 4XP0A 4E3CA 3E87A 2RFNA 5JFSA 2XS0A 3FY0A 3UP7A 3L8XA 5E8UA 4UZDA 4X2JA 4ACHA 2J0KA 4LG4A 4X2NA 2R3FA 3AKJA 3P79A 3LFFA 3QTWA 2UZDA 3KY2A 3VO3A 3PP0A 4TNDA 1FOTA 2NRYA 3TIZA 4JDHA 2CPKE 4BWPA 4EH5A 5DGZA 4B8MA 4XRJA 4PTGA 4EOKA 1YXUA 4XH6A 5A3XA 4UWCA 4LUDA 5B7VA 5HZNA 4EZ7A 3EFJA 4IM2A 1MRYA 4C57A 1V0BA 4O0RA 3EZRA 4RWLA 1BUHA 2W5HA 3VW8A 5HBJA 5ICPA 3E64A 2I7QA 2WMQA 4O82A 2F2UA 2W1EA 3BHVA 1YXVA 2HW6A 4GW8A 3LAUA 2C0IA 4D4RA 3UNZA