2WB8A

Crystal structure of haspin kinase
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
352
structure length
351
Chain Sequence
LGSIEISNKKASDAEKVYGECSQKGPVPFSHCLPTEKLQRCEKIGEGVFGEVFQTIADHTPVAIKIIAIEGPDLVNGSHQKTFEEILPEIIISKELSLLSGEVCNRTEGFIGLNSVHCVQGSYPPLLLKAWDHYNSTKGSANDRPDFFKDDQLFIVLEFEFGGIDLEQMRTKLSSLATAKSILHQLTASLAVAEASLRFEHRDLHWGNVLLKKTSLKKLHYTLNGKSSTIPSCGLQVSIIDYTLSRLERDGIVVFCDVSMDEDLFTGDGDYQFDIYRLMKKENNNRWGEYHPYSNVLWLHYLTDKMLKQMTFKTCNTPAMKQIKRKIQEFHRTMLNFSSATDLLCQHSLFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords SERINE/THREONINE-PROTEIN KINASE HASPIN
publication title Crystal Structure of the Catalytic Domain of Haspin, an Atypical Kinase Implicated in Chromatin Organization.
pubmed doi rcsb
source organism Homo sapiens
total genus 120
structure length 351
sequence length 352
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2009-02-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2wb8A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2wb8A01
4AACA 2VX0A 3G90X 3OT3A 3CY2A 4FV4A 4YJNA 1OMWA 2FGIA 3GCUA 3TKIA 1UA2A 5B2KA 5LMAA 1M52A 3HUCA 5EDRA 2P2HA 2XYNA 3REPA 4ANOA 4BDCA 3G51A 4O6EA 5CQUA 3NAYA 5L2QA 1JVPP 1Q62A 4YJUA 2NRYA 2VTQA 3BWFA 2JIVA 3PY3A 2HXLA 3W1FA 4EH6A 2XF0A 3BLQA 4Q2AA 3V5TA 3SVVA 5AUZA 1FQ1B 3ZLXA 5ANJA 2QHNA 5HIDA 4C02A 2P0CA 1YHVA 2C1BA 2Z2WA 3EN4A 4HJOA 4JT3A 2XNBA 5FXRA 4DEDA 4RA5A 5DIAA 4JJRA 5F20A 3SRVA 4EH7A 2IO6A 4BIBA 5JGAA 4FT7A 4AZSA 3SOCA 4D2SA 3R7OA 4CRLA 3TZMA 1CKPA 3KN5A 4FKWA 4TYIA 3HAVA 2W4KA 3CD3A 4NKAA 5M4CA 3QHWA 3TL8A 3A4PA 5LVNA 4QYGA 5KMNA 2Z7RA 4BBMA 4BCPA 3GC9A 4ITIA 1IA9A 3UIMA 4V0GA 5I3OA 2UW6A 2VWXA 3PPKA 2JKOA 3ZXTA 3PA4A 3L8XA 3QFVA 4E8AA 3QGWA 4H3BA 3QBNA 4M0ZA 1FVRA 4QP8A 3R71A 2WMQA 2YCSA 2ETKA 2HAKA 5EYCA 4RJ3A 4FV8A 3VS2A 3H10A 2JBOA 2JDRA 3RJCA 3ZFXA 4BTFA 5CU6A 3IOKA 3CC6A 4D1ZA 4I3ZA 2W1CA 2AC5A 2QOKA 4I23A 3I5NA 4JG7A 5EI2A 4MXOA 5TT7A 4NL0A 5D1JA 5J9LA 3HAMA 1GY3A 2OGVA 2QC6A 3MJ1A 3S4QA 3VULA 4ASZA 5DFPA 4EORA 4KIPA 4PRJA 3IGGA 4EOSA 4TNDA 2ZM4A 2YWPA 3BWJA 4AA5A 4JIKA 3R7GA 4FZAB 1WAKA 2OWBA 5HBEA 3AMAA 5FTOA 3P9JA 5CI6A 5DA3A 2PE0A 5I3RA 1RQQA 1T46A 2BZJA 3NUPA 2VO3A 4FNZA 2F7EE 2XK4A 3FKOA 3W2OA 4C38A 5AUUA 5TE0A 2UW3A 4YZDA 4F64A 4FEXA 4O7SA 3IDPA 5I9YA 3SLSA 3V5LA 1XH6A 4MK0A 3UDBA 4B4LA 4DFBA 5M09A 2VO7A 3I60A 3MIYA 3FEGA 3PRIA 4XV2A 3R2BA 2PVKA 4YBKA 4BDEA 4QMMA 3TNHA 2QVSE 4C58A 3A7FA 1H1WA 3ERKA 3EZRA 1MRVA 4L3LA 4BGGA 2W1EA 2O65A 4GL9A 2XNEA 2XKCA 4J53A 4ZTNA 4C34A 2R3PA 3UNKA 1O6YA 2FSTX 3QXOA 2YDJA 5CNNA 4QNYA 4KUJA 3GU6A 4YJQA 4E6AA 1Y6AA 2F49A 3MFTA 3PJ1A 5CSXA 4Z7HA 3DFCB 3QZGA 4C62A 5B7VA 5DR2A 3MIAA 3R8LA 2B9JA 5FEDA 1Z5MA 5AUYA 2C3KA 5DHJA 3I4BA 2PSQA 4WG5A 5HOAA 3WE8A 4IACA 3HRFA 2XJ1A 3BEGA 4RJ8A 4X3JA 2E9OA 5HG8A 5HHWA 3VS4A 4ACDA 1KUTA 2C6DA 4I6QA 3TNPC 5CWZA 4ZMEA 5ANKA 2X2LA 4HVHA 5M44A 1K9AA 3DBQA 4BWPA 2I1MA 5A46A 3VJOA 5BMSA 3ALNA 2OF4A 4KSQA 5TO8A 1YOLA 2VTTA 4O2PA 4DEEA 2PL0A 2WQMA 5BX0A 1H27A 4U45A 4RPVA 1YXVA 5L2SA 4F09A 3MH2A 3JXWA 5JGBA 3GU7A 3F3TA 3QWJA 2I0HA 4I0SA 2ESMA 4WBBB 5J5SA 2W4JA 3ZUTA 2UW0A 3DBCA 4I20A 3TIZA 4U6RA 3UVPA 4D9TA 4QYYA 2IVSA 2J0LA 5HLPA 5KZ0A 3LJ0A 4MWIA 1UKIA 4ACCA 1OIUA 5CAVA 2PPQA 2WELA 1PMUA 2ZOQA 1OPJA 3DV3A 3FLZA 3GCQA 5IA0A 5KNJA 2Y0AA 2A0CX 2ZM3A 4IQ6A 3FHRA 5AV0A 4I1ZA 3PWYA 5AP1A 5IMXA 5K3YA 4O7LA 5ANGA 5LVLA 4IIRA 4JXFA 4OTGA 4YR8A 3U6HA 2UZTA 3FZOA 4Y5QA 3R28A 4NU1A 3L8VA 5M08A 2C6EA 1NA7A 5A4CA 3G5DA 1IA8A 4OLIA 2YA9A 1YXSA 4EOKA 1ZOEA 4JRNA 2NNWB 4J71A 4PNKA 4ZY6A 1PXLA 1WBWA 1CSNA 2OSCA 2VTNA 4J8MA 2P33A 3EQRA 5IUHA 1JPAA 4JG6A 1BMKA 4RG0A 4JBQA 3ZO1A 4EK3A 2VGOA 3PXRA 4FG9A 2H34A 2OJJA 4HPTE 4IE9A 4N6ZA 4BCOA 3TWJA 4BDFA 4CFFA 1XH7A 2OH4A 4B8LA 3V5PA 3FPMA 4IZ7A 2V62A 1E1VA 3R1SA 3L9MA 2FO0A 5DRBA 1SM2A 3FQSA 4EI4A 4EUUA 4LV8A 3OY1A 3MGYA 4MTAA 5ACKA 2Z7LA 5KHXA 4DGGA 3CR0A 3JY9A 3CIKA 4ZS0A 4A07A 4GUBA 5IDNA 1RE8A 3L8SA 2A1AB 4NUSA 1OBGA 4KKEA 3PP0A 4YZBA 4CKJA 3NUXA 3N4VA 2PZ5A 1WBNA 4L3PA 4F9BA 2VTIA 2QKRA 3HECA 3VUDA 1XH8A 4RZWA 2X8IA 3P7CA 5LMKC 5IQBA 5GINE 1H4LA 3PVGA 3QX2A 4BYJA 1L8TA 2Y8OA 5FQDC 4FYOA 3P78A 5K9IA 3ENHA 1LP4A 2GS6A 4C4FA 3A62A 3P1AA 2RGPA 3QQKA 4GG5A 4ZJVA 2C30A 5HQ0A 4DF3A 2X6DA 2WTKC 3CJFA 4OTHA 2YJSA 3PY1A 2B53A 2JC6A 2A27A 3R9RA 4QYEA 4MXCA 4L43A 4J8NA 3GNIB 1YXXA 5KO1A 4LGDA 4RC4A 3SRVB 4V04A 4XRJA 2X0GA 3QQUA 1JNKA 3KF4A 3QCXA 4YPSA 5EW3A 3RPVA 3D5UA 2VO6A 3K3JA 2GU8A 3MFSA 4PTGA 2QCSA 3QGYA 2RFSA 3KVWA 3QALE 2QOCA 4ANSA 2PZPA 1RJBA 4M66A 4V01A 4J1RA 4X2NA 2F9GA 2ZMCA 4RLKA 5TF9A 5M4IA 5DI1A 3TV4A 2X4FA 3VC4A 3GU5A 5AR3A 2BKZA 5GZ8A 5HORA 4UZDA 4V0GB 3UZPA 3NSZA 4MH7A 3ZM9A 4U80A 1WBVA 4WNOA 4IX6A 4UY9A 3WF9A 1UU9A 2CNUA 3EQBA 3GI3A 3LIJA 2I0YA 3PVUA 4EQMA 3R21A 3SOAA 5JEBA 2QR8A 2PTKA 4PMSA 1OL1A 5EI8A 4NFNA 4TTHB 3RAHA 2CKQA 1H28A 1UNGA 2VRXA 3OP5A 2IZTA 3Q52A 2CGUA 4PP9A 4X3FA 2YM6A 4CYJA 3BBWA 5ICPA 3PSBA 3UC4A 1DAWA 3QUPA 4KD1A 3GENA 3QAME 3QRJA 5FEEA 5E4HA 2EUFB 3LAUA 4JS8A 2BRBA 4X6RA 5AX9A 1KE8A 1OGUA 3N9XA 3VS0A 3BEAA 4IHPA 3U4WA 1L3RE 4XLVA 3R30A 3R9HA 4TNBA 4FZFB 5AV4A 3BHHA 5IEXA 4FTJA 4YLKA 4OT5A 3P79A 4FSUA 3QRTA 2I0VA 4JRVA 4EWHA 4KABA 3ORTA 4YHFA 3OXIA 5CVHA 5IUIA 5HI2A 4DT8A 5D41A 4QPAA 2G2IA 1XBBA 3F7ZA 2X7OA 1V0BA 4GK4A 4C35A 4RVMA 4F7JA 2YDKA 4FTLA 2EWAA 5F9EA 3PIZA 4WIHA 4DE4A 5E91A 3G6GA 1CM8A 1KSWA 4XP3A 3BYUA 3IW7A 4UBAA 2F7ZE 2GCDA 2XK3A 2Q83A 3W16A 4CV8A 4JBPA 4FL1A 4UMTA 5AP7A 1YDTE 3SXFA 2VTJA 2HOGA 3R73A 5CANA 3KCFA 4FKRA 5B0XA 4D55A 4GJ2A 4TWCA 1OVEA 2OJFE 2XMYA 3UPXA 4AF3A 4C3PA 1J7LA 5FXSA 3BI6A 4FODA 5AR8A 3TNWA 3DY7A 3NW6A 2X1NA 3DQXA 4S2ZA 5JK3A 2WHBA 3O50A 3VVHA 4CGAA 5E8TA 3WE4A 1PJKA 3E7OA 1W82A 3O2MA 2XK9A 5DPVA 1R0PA 3R8UA 4E7WA 4N57A 3QLFA 2C6TA 3KK8A 3R9OA 3IKAA 4FVPA 2C3LA 4RSSA 4USEA 4WHZA 3TZ8A 3ORXA 4AW5A 2W1DA 2OZAA 1VZOA 4DEGA 5CALA 4XUFA 3NW7A 3ROCA 1RW8A 4R3CA 3RPYA 2OIBA 4BCKA 4X2KA 3DCVA 4WSYA 3ZS5A 3MV5A 1R0EA 5IH5A 4E3CA 5J1WA 4QP6A 4XV9A 2J5FA 2RFDA 3R22A 5HLNA 3A4OX 2QOLA 5EM7A 2OJGA 4M14A 5CVGA 2X2KA 1H1QA 5AP3A 3EN7A 3Q9XA 2WIHA 2H96A 3AC3A 2YLEA 4L00A 4XRLA 3TKUA 5HGIA 3MPTA 2R3LA 4FV3A 3JVRA 5B2LA 3P86A 4Y8DA 3DLSA 3PXFA 1JSVA 2WOUA 3ZLWA 3OMVA 3KGAA 3M2WA 2KULA 4KIKB 3Q6UA 4CVAA 2RL5A 2W1IA 4MD7E 2ZM1A 4ZOGA 3QLGA 4NM3A 5BUJA 1NVRA 4BDAA 5L4QA 2YCRA 3K54A 4PDSA 5FP6A 3VBQA 1ATPE 3B2WA 4U79A 4UYNA 3ZC6A 5M06A 5BNJA 4S32A 4KIQA 4KIOA 2HELA 4FIFA 4CNHA 3DKFA 3U9NA 3H9OA 2OW3A 4FV6A 1OL7A 5GIPE 4A4OA 5K0XA 4JQ7A 3ZRLA 4ZY5A 4FIEA 4JDKA 4BZNA 1IAJA 4GUEA 2GSFA 3OCSA 1U5QA 4YC3A 4QOXA 4RIWA 4XG2A 5J9ZA 2QG7A 4L9IA 5IMEA 5KCVA 2ERZE 3RALA 2OF2A 5HCZA 4G2FA 1GNGA 1GJOA 2H9VA 4XP0A 2GNGA 2UUEA 4PDOA 4CMUA 2C5VA 3AMYA 5EOLA 2YCQA 3AGMA 3LHJA 3WF8A 2EXMA 3TI1A 1U54B 4Y72A 2UZVA 3D0EA 5JQ8A 1V0OA 4QMOA 3UG2A 2QOBA 3D7TB 3NNXA 4CFMA 5D7VA 3O51A 4YTFA 3F7WA 2XNOA 1MRUA 3TUCA 3EOCA 4QYHA 4EQCA 2FA2A 5HX6A 5EW8A 4RX7A 4BI0A 5FBOA 4QQCA 3GUBA 3SXRA 4EZ5A 5CEOA 4I21A 1JKLA 3W2CA 4D28A 4DYMA 4TN6A 4HVIA 5AADA 5CU0A 3HV7A 2XKDA 3C4XA 3FXZA 4U3YA 4JBOA 3RINA 2OG8A 4R7BA 5M51A 3H4JA 3HMNA 1OBDA 4ZSGA 4PQNA 3ORPA 5CEQA 3NVMB 3MH3A 2OO8X 4EONA 4GU9A 4LOQA 3O0GA 4ORKA 2LGCA 5CU4A 3LFSA 2NO3A 3BIZA 4PMPA 2VWZA 4U97A 3SXSA 4ARKA 4ZZMA 3LCTA 3FSFA 3KMUA 5DEYA 4RBLA 4ACGA 4DFZE 5KX8A 4E4LA 3DBFA 4FUYA 3AGLA 5AP6A 4E6CA 2XKEA 4DFLA 1F5QA 4TWOA 4DH5A 5CF6A 1ZY4A 4K1BA 3FC1X 2P2IA 4DLIA 4KRDA 1CKIA 4FSZA 1EH4A 3NYXA 3T3UA 4CLIA 5A54A 5JMSA 5EQPA 3OHTA 1IEPA 2A4LA 3L1SA 3QQGA 5E8VA 3G9NA 2PMOX 3ORKA 2JFMA 1KV2A 4YNOA 5EHYA 4EEVA 4HVGA 3JVSA 2ZMDA 3KY2A 3PE1A 3MPAA 2J0MB 5LVPA 1G8SA 3COHA 4M15A 2Z02A 2QI8A 4P2KA 1BKXA 1KV1A 4H3QA 4LG4A 1NW1A 1Y6BA 2PY3A 4AN9A 2ITUA 4KS7A 3KK9A 4YZMA 3KXXA 3V51A 2R2PA 4DCEA 3OWPA 4KRCA 4JDHA 3DPKA 2W7XA 3DKOA 3FY0A 3JS2A 4O21A 1PXIA 5IA5A 5C8MA 1FBNA 4U42A 2DS1A 2FH9A 1G5SA 1YKRA 4TWNA 2IZSA 3VW8A 4TT7A 4PTEA 2OIQA 1M2PA 2X8EA 5H2UA 2HW7A 3BHUA 1HCKA 3IGOA 3FQHA 4G6LA 4DA5A 5L6WL 4O0TA 2YIXA 3QTUA 1PF8A 4EOPA 5LCKA 4A9YA 1SVEA 4HGSA 3C4CA 3IQ7A 3R1YA 3VF9A 3Q9ZA 4D9UA 1Z9XA 2RF9A 3PA5A 5EM8A 4MQ1A 4G6NA 1Z57A 5L2TA 4ACHA 4OBOA 2YZLA 3HDMA 3FZSA 2R0UA 1V0PA 3IDBA 4LRJA 5LXMA 4D2TA 3C4ZA 4PTCA 3EQHA 4A4XA 1YXUA 2QO2A 3NCZA 5DWRA 5BUIA 1IASA 2YM4A 3ZDIA 4NCTA 3EL7A 2C5OA 4FX3A 3U9CA 2C69A 4HNIA 4HPUE 5DT4A 5CXZA 5J9YA 3DB6A 5EYMA 5CI7A 3LFFA 3FYJX 3SAYA 4I6FA 2WMTA 1AD5A 2YM7A 3MVLA 4BWKA 3FLWA 4FEUA 3EN6A 3QZFA 2X2MA 3QL8A 4UWCA 4W9XA 3UO5A 3G0EA 5AR4A 3VQUA 4IAFA 4LMUA 3UMWA 3NIEA 4FSWA 3ZBFA 4AXAA 3GOPA 2GNFA 5D9HA 4CTCA 3QCSA 4J96A 5FM3A 3WZDA 3F61A 3GU4A 3ZUVA 3LQ5A 3V6SA 4QMNA 4X21A 3NVKI 3LM5A 4D4SA 2ACXA 3MB7A 4QMWA 3VBTA 5L6OA 5L3AA 4Q9ZA 2WQBA 3TV6A 4DBXA 3QD3A 1YWVA 4G3GA 4L3JA 1KOAA 4R6VA 4GCJA 2XEYA 3R8ZA 3TT0A 4DFNA 2OK1A 2YDIA 5EDPA 4ZJIA 2BIYA 3RAWA 4YUQA 3PXZA 4G3CA 3V8WA 3DJ5A 2C47A 3N4TA 1H00A 3R8VA 4BI1A 3A61A 4DEHA 3UJGA 5BYYA 4IANA 4IAIA 2C6KA 4KAOA 4RIXA 3SQQA 3BGQA 3LFCA 4WRGA 4LOPA 5HD7A 4CG8A 4GT4A 4EC9A 4J98A 4K6ZA 4O86A 5KBRA 3FLSA 3PYYA 4UMPA 4QPMA 4DGNA 3UC3A 4BDJA 2GNJA 3BLRA 4GS6A 4B0GA 4PL5A 3OCTA 3FZPA 3C9WA 2GNLA 2J90A 2WTWA 4RFYA 2OBJA 3CLYA 3Q2MA 3MY1A 4PPCA 5IEYA 4UN0C 5BMMA 2KTYA 4IX5A 2FVDA 3HNGA 4Z3VA 5BUEA 4XHKB 4B8MA 3UVQA 2R3GA 3QXPA 4C33A 2W1FA 4IXPA 2RG6A 2E9NA 4FG7A 5LVMA 1YVJA 2XA4A 4NK9A 5CT7A 5CAUA 4C3RA 4JI9A 2C3JA 3UO6A 2XP2A 4FTCA 1JKSA 4JX7A 4IX4A 4C4IA 2A2AA 3H30A 4IZYA 4U43A 4EZ7A 3SHEA 3DTWA 4I5MA 4I5HA 5ANOA 4OUCA 3HMMA 5E9EA 3PJ3A 4U41A 5DT0A 4DEAA 3SA0A 5M4FA 1RDQE 2WMBA 2IW8A 4YMJA 5BYZA 2YZAA 3QA8A 4K9YA 2B1PA 2DUVA 4O7RA 1SZMA 5E7RA 4LOOA 3R8PA 1A9UA 4CD0A 4RIWB 3EMGA 2V7AA 2VTLA 3QKMA 3RM6A 3QQFA 5FDXA 3C0GA 2OKRA 1NT2A 3D4QA 4M13A 1H01A 2IG7A 1ZXEA 4LL5A 3A7GA 4YJRA 3FXWA 4U7ZA 3VJNA 1M14A 2QOOA 1F0QA 4QMXA 4OT6A 3OT8A 2WU6A 4F6UA 4FTOA 4F1TA 3RZBA 3Q5ZA 4I4EA 1OB3A 2OZOA 3IO7A 1XHAA 5H8EA 3MVJA 2BFXA 4MD8E 3EFKA 4TZRA 2XNNA 3MY0A 4LM5A 4MNFA 1U59A 3U87A 5EQEA 4FI1A 4GW8A 3WIKA 5HD4A 4CCUA 5C4LA 4RJ4A 3W8QA 3FKNA 2DQ7X 2R3QA 3KL8A 4NWMA 5FXQA 4O7ZA 2EU9A 3MVMA 5DBXA 3V04A 5C8KA 1DAYA 4JIAA 1Y8YA 2XM8A 3POOA 3DB8A 1FGKA 1GZOA 1XH4A 4D4VA 3NZ0A 3UP7A 3BRBA 3NCGA 4Y46A 4DFXE 2XNPA 4FL3A 5AAGA 3PG3A 1Y57A 5HVYA 3TNIA 5K5NA 1K3AA 5KE0A 2GHMA 4RJ6A 4IB1A 4MNEA 4J95A 3FMMA 4E93A 2HK5A 3RVGA 3FMDA 4DINA 2IW6A 4FG8A 1WBOA 3LCDA 3E88A 2PVHA 2UZNA 3KF7A 4FF8A 4G5PA 2B52A 3BZ3A 4CTBA 4EOLA 3NDMA 2X9FA 3ACKA 5KHWA 4FA2A 5AP0A 5CEKA 3CKWA 3OZ6A 4EHGA 4IAZA 4EKLA 4JR3A 4FZ7A 4F65A 3PY0A 2PUNA 4CZYB 2V0DA 4JNWA 2R4BA 4EJ7A 3NYNA 4FSMA 1JSTA 1H0VA 2C1AA 2CKEA 2WKMA 4FT3A 3ZLSA 3WOWA 4BZDA 1IRKA 3DBDA 1I44A 3GOKA 4QMQA 3DXQA 3RM7A 2A19B 4DG3E 5B2MA 2F2UA 2X8DA 4F0IA 2BALA 2IZRA 1H0WA 3I81A 3EKKA 3MSSA 5BVEA 3ATTA 3G9LX 4MCVA 2ZAZA 4X7QA 2G2FA 4EOQA 2ITVA 1CKJA 1OUKA 4OTIA 4O0VA 5IUGA 2AC3A 4F1OA 4DH8A 1Y8GA 3CTHA 3CGOA 4EL9A 1X8BA 3CP9A 3V5WA 4BKJA 2BKKA 3K3IA 3TJDA 2Y4IB 5DMZA 2GQSA 4FTUA 4YU2A 3ZTXA 4AWIA 3UODA 3WZEA 1W8CA 4P4CA 2BAKA 4OGRA 3F3ZA 3VUMA 3CS9A 3OUNB 4D1XA 4FV7A 4GU6A 2VWWA 4L8MA 5JFWA 4BVUA 5C9CA 5JT2A 3QRIA 3LZBA 3CPCA 4FV0A 2ITNA 3KULA 1JWHA 1UNLA 4AN3A 4FIJA 3PVBA 3DAKA 4FV2A 3LCOA 2VWVA 4EH8A 3TUDA 4GK2A 2JITA 5EQYA 1OECA 4PNIA 4ZP5A 2EB3A 3Q4CA 1XH9A 1NVQA 4YTCA 2BDJA 1NY3A 3UO4A 3KXGA 4GMYA 1JSUA 4Q9SA 4E6QA 3EN5A 1PMVA 1URCA 2PVLA 3FXXA 2UZBA 3QYZA 3EQDA 3SW7A 1GAGA 3KN6A 5DH3A 3QHRA 3UNZA 3QZIA 5HICA 4G9RA 1P4OA 3I6WA 2R3MA 1PXNA 5HNBA 4ID7A 5G6VA 4FIHA 4R78A 4IVCA 2W96B 4BDGA 4IMYA 4LMNA 3UPZA 4H1MA 3ITZA 1UU3A 5HCXA 4I0RA 4UALA 5KUPA 3AXWA 3DK7A 3R00A 2BHEA 5CF4A 3DKCA 4CSVA 4NEUA 1U46A 2W05A 3P0MA 4YO4A 4IJ9A 1LR4A 4GVJA 4FSYA 3SD0A 5BVDA 3NPCA 3F5PA 5DOSA 4MXAA 3OCBA 3HKOA 1PKGA 3HVCA 5AX3A 2ZJWA 3ZH8A 3F5GA 5HG9A 5AUWA 2XEZA 5E8XA 3H9FA 3PXKA 4FMQA 4MHAA 4ZTQA 4FOBA 2QODA 3ORMA 5FP5A 1MP8A 3W10A 4M12A 5GNKA 2HZNA 5I9VA 4RIXB 5AJQA 4WNPA 5CSPA 4R7HA 5HEZA 1OKWA 4E4MA 3FYKX 2XB7A 3C4WA 2OLCA 4OAVB 4I22A 4EYJA 5GIOE 4E6DA 3MFRA 4HCVA 1DI9A 2PVYA 2W5AA 2XH5A 5FEQA 2YIQA 3UMXA 3LQ8A 3VAPA 3OD6X 1H08A 5IQGA 3BCEA 1Q99A 2YITA 1B39A 3FDNA 5FTGA 5C03A 4O7VA 3ZO2A 4DEIA 4EC8A 3AD6A 4JX3A 4E20A 5E8UA 4XOYA 4QP9A 2W9ZB 3IK3A 2JD5A 4AW0A 5LJJA 1XR1A 4AE9A 4DGLC 3Q60A 2NRUA 3V01A 2G01A 1QPCA 2FSLX 4RVTA 3SKCA 1XWSA 5A4TA 4EZ3A 4FE2A 3P7BA 4LUEA 3HMPA 4Y5HA 4LRKA 3U54A 3FHIA 1SVGA 3QTSA 4QQ5A 4QMZA 3TZ9A 3V3VA 5LWMA 3EN9A 3PPZA 4YJSA 2CKPA 3HMIA 3Q32A 1GZ8A 4G9CA 4QMTA 5E1EA 2WIPA 3RNYA 2VNYA 4RRVA 1SMHA 3VUTA 4D5HA 2R3RA 4NIFB 5EDQA 1Q8TA 5JZJA 3G2FA 3IPHA 2R0IA 5BPYA 1BL6A 3BKBA 3OVVA 2BVAA 3GCVA 2ITYA 3QUDA 4QMUA 5CEPA 4IWQA 1O9UA 2QOFA 3NUUA 5T3QA 5K5XA 1Q8ZA 2QLQA 2C0TA 3WF7A 3PSCA 3FMHA 3R83A 5E8ZA 3PFQA 5L8JA 2RSVA 4ZAUA 1SYKA 3LXKA 4ZY4A 1JQHA 2WO6A 4FKIA 2YABA 3TTIA 4LRMA 3JYAA 4O0WA 5I9XA 2V7OA 4O0YA 3WF6A 3MTLA 3LPBA 3NYVA 5E90A 4GT5A 4YNEA 3BPRA 2DYLA 2QURA 3E87A 3NUNA 4YC6A 1S9JA 5IPJA 1PKDA 4RLLA 3B2TA 4I93A 2XK7A 4D0WA 4CFUA 3LXNA 3IW6A 5DLSA 3ZFMA 3U8WA 3VS7A 3R04A 2PHKA 4O7YA 4G1WA 3WF5A 4FSQA 4R3RA 2BFYA 5JFSA 3K2LA 4EH9A 3LVPA 2LAVA 2Z60A 4GFOA 4F7SA 3CQEA 4OTFA 4GRBA 4O7TA 2Y7JA 2O5KA 4NJ3A 4CQEA 4EK6A 5A6NA 3WBLA 2J6MA 4YSMA 5A9UA 5JFVA 2ONLA 3ZONA 4WBOA 4DLJA 2F7XE 2E9VA 2Y6OA 4WUAA 4EQUA 3EKNA 4K8AA 4ZSEA 5IEVA 2E9PA 5BVNA 4AZTA 4F0GA 4BF2A 4NM7A 2XYUA 3F2RA 1UWJA 3EQGA 3PUPA 3F82A 3C4EA 4C57A 2W1HA 3I1AA 4I92A 3HYHA 4I6HA 2YIYA 2W06A 1OKZA 2J7TA 4LI5A 4X6QC 2PVNA 4XG7A 2QLUA 3EFJA 4QQJA 5EK7A 3VBWA 2B9FA 4OTRA 4PX6A 3LMIA 3EB0A 5L8LA 4CMOA 5LMKA 3R7YA 1Q4LA 4G17A 3VUHA 4KA3A 2I40A 3C0IA 3I7CA 2ITXA 4F63A 4NW5A 2WGJA 4S34A 2CNQA 3OW3A 4F0FA 3G15A 3VS5A 2VX3A 3HUBA 5BVFA 3UG1A 1FMOE 1R39A 3Q6WA 3ZZEA 4FNWA 4F70A 4BTKA 4R5SA 4UEUA 1REJA 1W84A 2XUUA 5JN2A 4QP7A 5DGZA 3NNWA 4M0YA 5AM6A 1OIYA 3ORIA 4U3ZA 4G3DA 3QQHA 4K18A 3C0HA 1OL6A 1WCCA 2GPHA 2CSNA 4GV1A 4IC8A 1YHWA 2PE1A 4QP1A 4JG8A 5CSHA 3CQWA 1YI4A 4OR5A 4ZLOA 5CU2A 3ZUUA 3V8TA 4QTBA 2XNMA 3KRLA 2W4OA 3JUHA 3D83A 1G3NA 3COIA 4IH8A 4O2ZA 2CGWA 3BU3A 3LXPA 5C27A 1R78A 4PWNA 4BRXA 3KC3A 2JGZA 3FMEA 4K77A 2CGVA 3ZZWA 1G8AA 4KB8A 4TL0A 4BHNA 4IZAA 5KBQA 2O64A 3FC2A 5CSVA 4YO6A 4Q5EA 4AOIA 3AT2A 3T9IA 4QYFA 2WXVA 3OXTA 2JKMA 2Q0BA 4QMYA 3ZOSA 4IDVA 4D1SA 5AA9A 3TUBA 2ZVAA 4XG9A 3BQRA 2OI4X 2QO9A 4WG4A 1WBSA 3GCSA 3NYOA 5ETFA 4ASEA 2J4ZA 3I6UA 3KRWA 5EHLA 1FPUA 3RBWA 2VNWA 3LCSA 1REKA 2XIYA 2XIRA 4NFMA 4O96A 3ZRMA 4F99A 3PDTA 3BBTB 4RWJA 1BI7A 3TDWA 5J79A 3ULIA 5HG5A 1FOTA 2YM3A 2CN5A 3C13A 5CENA 3VUIA 4BR3A 5EFQA 2WMXA 4W4WA 2YHVA 5IG1A 4YHTA 4G31A 4EK8A 4IJPA 3RCJA 5FLFA 2R3IA 2XBAA 3KKVA 4FC0A 4UMQA 3QD2B 4YJTA 4FKQA 3PVWA 2VTAA 3C7QA 4J52A 4OTQA 3AC1A 1OIRA 2OU7A 4USDA 4HZSA 3RMFA 3NUYA 2B7AA 4MD9E 2QNJA 4YPDA 3E64A 3QQJA 4BL1A 4DFUA 1YWNA 3F3VA 3JPVA 5GZAA 3FQEA 3DKGA 5I4NA 1Q61A 4I6BA 3FLYA 2VGPA 3NW5A 1Q41A 4L01A 4BC6A 3TDVA 3ODZX 1ZMVA 5FDPA 4GYIA 4CCBA 3VBXA 4XG4A 1SVHA 1ZYLA 5GJFA 2JAMA 3BYMA 3V5JA 2BILB 4MXYA 1R1WA 3C1XA 4DBNA 4WNKA 5AP5A 5AA8A 3OC1A 3D15A 4RIYA 2UZLA 3EQPA 1B38A 4FT0A 4AS0A 3RWPA 3R9DA 2NP8A 5A4QA 4IB5A 4IZ5A 1PYEA 1YHSA 3UP2A 5CF5A 3MS9A 3CTJA 3AD5A 3KXHA 4I94A 4M69A 5JH6A 3FBVA 4HYSA 3Q5IA 1R3CA 3LQ3A 3BYSA 3KA0A 1GZNA 2CCIA 4JDIA 4IM3A 2WTDA 5HE2A 2PMIA 5FG8A 2ZB0A 4F1MA 5LCJA 1JKKA 5AEPA 2QONA 3A8XA 3A7JA 4N4SA 4CEGA 2HXQA 3OCGA 4M7IA 4RWLA 3L9LA 4AW1A 3FI4A 4IVDA 4F9CA 4X2FA 4EOOA 4UB7A 2R64A 1IR3A 4FTRA 4NYEA 2BR1A 3I0QA 3H3CA 4AZEA 2IVUA 4XG3A 3ZO4A 4F7NA 4ZK5A 3F5XA 5CAPA 1FINA 3KU2A 3F5UA 4F6SA 4JAJA 3EJ1A 5JGDA 1CDKA 3LFAA 3OUKA 2VTMA 3P7AA 4F4PA 3VRZA 1UNHA 5HO7A 1APME 5I9WA 4RZVA 4ZTHA 3VNTA 4IC7A 1WVXA 4C36A 5M53A 5HE0A 2IPXA 2ZYBA 1HOWA 2EB2A 3DTCA 4JR7A 4P7EA 5I9ZA 5IDPA 2Z7SA 3PE2A 3QRKA 4HVDA 4S31A 2QHMA 3TCPA 2EVAA 2P55A 2W5BA 4Z9LA 2UW8A 3I5ZA 4KNBA 2REIA 1BX6A 3Q04A 4W4XA 4AOTA 5IQAA 2W5HA 2C5NA 4RX5A 3PLAE 5BVWA 3WIGA 2UZOA 4QMSA 3HA6A 5I0BA 4BWXA 1NXKA 3ZU7A 3BLHA 1BYGA 3ZM4A 2J51A 3R0TA 1O6LA 3MYGA 4YLJA 2ZV9A 3OXZA 4BI2A 2WOTA 4HCUA 2Y4PA 5LWNA 2SRCA 2ZDTA 2HWPA 3A99A 4RC3A 1Q8UA 2UV2A 5EH0A 4E5BA 3A7IA 1H1SA 2WTIA 3P23A 1Q8YA 1M7QA 4QMVA 5KMLA 2VTSA 2BAJA 2EXCX 2WEIA 2VWYA 5L8KA 4QQTA 3Q4TA 1MQ4A 1OM1A 2BMCA 4FSNA 4FKLA 2ERKA 3QF9A 3MBLA 1PRYA 2XRUA 3AOXA 1Q8WA 4N0SA 5AR5A 3R7UA 3NUAA 4A06A 4DEBA 4HNFA 5HVKA 1XO2B 2VTHA 4XCUA 4PPAA 4XG8A 2R9SA 3RNIA 3Q96A 3NUSA 4YJPA 1PXJA 2GS2A 3S0OA 2F2CB 2R3FA 4FSRA 2GS7A 2WMRA 3ZMMA 2C6OA 1KE5A 5AWMA 5GHVA 4DG2E 5EM6A 3UOJA 2GHGA 4J99A 5HE3A 4YHJA 4AT5A 1ZZLA 2XIKA 2PZYA 3Q9WA 4RJ7A 3RK9A 2ZV8A 3EYHA 3W18A 3LMGA 4IWPA 3OFMA 4J97A 4IWDA 4MYGA 4ZS4A 2UZEA 4FOCA 3FMNA 3QTQA 5CF8A 2O2UA 3QX4A 5ETCA 4BN1A 3PP1A 4X3FB 4BIEA 3MH1A 4O0XA 3COKA 1YDRE 2O63A 3FKLA 4O27B 1ZYSA 4QPSA 5EYKA 5A3XA 4AU8A 5M57A 4R3PA 5CS6A 4XEYA 4F7LA 2VUWA 2BRGA 5HZNA 3E63A 2GFSA 3MW1A 3ORLA 4L44A 1STCE 3PWDA 4PDPA 5EOBA 4YZNA 4WSQA 4AN2A 5HNIX 1M7NA 1VEBA 3AC5A 3G6HA 3GFEA 4FNXA 2OJIA 3FPQA 3DZOA 2ITZA 5KZIA 3EWHA 2CLQA 4AGUA 1BL7A 4GSBA 5HU3A 3UOLA 3CCNA 3TG1A 4MBIA 4HCTA 3HDNA 4WNMA 4NTTA 3RK7A 4ZSAA 1ZOHA 4UX9A 1TQPA 3FLQA 4BCHA 5FGKA 4BGQA 1U5RA 4KS8A 5HESA 5AM7A 2FUMA 2OXXA 3UZRA 3HRBA 3UIXA 2PULA 2O0UA 3UE4A 3LW0A 3R1QA 2R7BA 1TKIA 2UW5A 4XV1A 3W8LA 3WARA 4MXZA 3LXLA 2JKQA 2JFLA 1HCLA 1WVWA 4FEQA 4JVGA 4WT6A 1UU8A 3BGZA 1FVTA 5KMIA 2I0EA 2PYWA 3ZSHA 2WPAA 3DU8A 3IOPA 3ZLYA 1UWHA 3HV3A 2B0QA 4ERWA 1WZYA 4FR4A 4YSJA 3GU8A 3CSVA 2HWOA 1F3MC 3BX5A 5H3QA 3ZC5A 2OH0E 5CVFA 4DGOA 1QL6A 3VF8A 4CZUA 4EBWA 5JRQA 4MAOA 3Q4ZA 5DT3A 3VN9A 1ZY5A 4X0MA 4D4RA 3E8EA 3GCPA 5L2WA 3Q2JA 3RAKA 5HE1A 2C5YA 4ITHA 2UW4A 3OEFX 4I41A 3LKMA 4ANNA 4BDBA 3HA8A 3TV7A 4P5QA 2VWUA 2R3OA 2XIXA 3VRYA 3D9VA 4FIGA 4K11A 4HW7A 4UXQA 3Q4UA 3R7IA 5CY3A 4FL2A 5IF1A 4KKHA 5AMNA 4ZTLA 5CEIA 1B6CB 2WQOA 4F9AA 3HV5A 2OZAB 4DGMA 4H36A 4BDIA 3R2YA 3PXYA 5K4JA 3OWLA 3PG1A 4FICA 3QC4A 4KBAA 4EOIA 4L6QA 4NJDA 5DR9A 5KMJA 1QMZA 4UXLA 3KMWA 3OF0A 1MQBA 4IX3A 3AC8A 3FV8A 1GIJA 3PZHA 3THBA 4FVQA 5IH4A 3ZEPA 2VO0A 4EJNA 1M17A 2JEDA 4L45A 4RJ5A 3E8DA 3VUGA 4BKYA 4B99A 4DH7A 1PXMA 4IWOA 4D5KA 4KINA 4R1YA 4BDKA 4CFWA 2JBPA 2XNGA 3T9TA 3TJCA 4DITA 3EHAA 3DJ6A 3MPMA 4IM2A 2QD9A 2Z8CA 2IN6A 1WMKA 3CJGA 2BTSA 2Y6MA 4EKKA 4DAWA 3VUKA 4IAYA 5CT0A 1TVOA 5ETAA 5M07A 1JLUE 1Q5KA 4NT4A 3VO3A 2CGXA 2HY81 2J0JA 4HYIA 5HIEA 1ND4A 3E62A 2X9EA 2HZIA 2WMVA 3WILA 2FSOX 5EW9A 3HP5A 4II5A 4O81A 4DCAA 2YCFA 2BRMA 4GG7A 5DEWA 2IZUA 4QMPA 3ZO3A 3AT3A 2B9HA 2YN8A 5AFVA 4E4XA 5FWKK 4GIHA 3R01A 2PZRA 3SV0A 5DVRA 3QTXA 4FKVA 2BZIB 4AW2A 1SNXA 4WG3A 3R9NA 4YJOA 2QOHA 4FZDB 4O91A 5KKRB 2R3HA 1PMEA 4QP3A 2CNVA 3NRMA 3EH9A 2CDZA 4L7FA 3F3WA 3DFAA 3Q9YA 3JR1A 1KE6A 1OIQA 4O1OA 2YFXA 4O0UA 3DBEA 3PA3A 4G34A 4MXXA 4BBFA 2Y9QA 3F2NA 1JKTA 5KMKA 2FB8A 4YGAA 3TACA 2JDOA 2CKOA 4ANBA 4BICA 4ACMA 2X6EA 3FI2A 5AV2A 4JL9A 3O8TA 3ZSGA 2O8YA 4JDJA 2GFCA 3RP9A 4F6WA 4GIIA 1QPEA 3IS5A 5J8IA 5CQWA 1P14A 2X7FA 4PMTA 3R1NA 5HNGA 4EWQA 4BB4A 3E93A 5C4KA 3RHXA 2WZJA 1LUFA 1E1XA 2RIOA 4PL3A 3S3IA 4BCQA 2R3JA 3QTIA 1K2PA 3PXQA 3IECA 4Q5HA 4ALUA 2OXDA 1J3HA 3D5WA 4YZ9A 5AIRA 4CMTA 4CT2A 3DJ7A 2HZ0A 3C4FA 3PLSA 4ASXA 4D2RA 4USFA 4FK6A 4PY1A 4XX9A 5J5TA 1QPDA 2CHLA 2XIZA 3V8SA 3IG7A 2XCHA 3VBYA 5HTCA 5A14A 4HVSA 4OTWA 4QNAA 2QOIA 4XG6A 3ROYA 1OPLA 1TQMA 3MWUA 3O7LB 5AIKA 4YTIA 5BVOA 3VIDA 5M4UA 3QC9A 2RFNA 5F94A 3BU5A 3BE2A 1Q3WA 5AUTA 1OPKA 3U51A 3D5XA 3L9PA 4AG8A 2XS0A 3G0FA 1BLXA 5HIBA 3TIYA 2F4JA 2PK9A 1WFCA 3E92A 4BCMA 1YI3A 1YOMA 1ZYDA 3DLZA 1YW2A 2RG5A 4FBXA 1OUYA 3ATSA 4FV1A 3CGFA 1MUOA 4J7BA 5HG7A 4E1ZA 4O0SA 1ZYCA 1OL5A 3PRFA 4Z7GA 4PPBA 3R02A 3UQCA 3LE6A 3LCKA 2C4GA 1OZ1A 4HYUA 3ZYAA 3BE9A 3FY2A 2BZKB 3SG9A 4CFNA 2VWIA 3BHVA 5C8NA 4LUDA 2PVRA 2I6LA 4R7IA 4CKIA 3UZTA 4BDDA 3S00A 2C6MA 2UW9A 1H1RA 4O1PA 4AFEA 4K2RA 1YDSE 3M1SA 3MI9A 1YWRA 3AC2A 5C1QB 3MVHA 2CCHA 4E4NA 2WMWA 4PL4A 5EYDA 3K5VA 4P90A 5TOZA 2QU5A 4FT9A 4AZVA 4EH3A 4M84A 1PXPA 3FWQA 4X2GA 5CEMA 3B8QA 5BYLA 2W17A 4HYHA 3MA6A 3S95A 5IA4A 3W32A 3UTOA 4G6OA 4GFMA 4E5WA 4EH2A 3EFWA 4GKIA 2BRNA 1ZZ2A 2VTPA 4BBEA 4R8QA 1GZKA 4EK5A 4NKSA 5A4EA 1GIHA 3KRJA 1DI8A 2AUHA 2WMSA 3MJ2A 1H1PA 3CD8A 5K4IA 2XVDA 2JDTA 3O23A 4FKPA 3W2SA 3HLLA 3KQ7A 2YM8A 2G15A 4RFZA 3W55A 5CAQA 2UW7A 2BIKB 3OY3A 2YERA 2DWBA 3M42A 1XBAA 2WTJA 5IQFA 2E9UA 4TKSA 3OEZA 4O84A 5IQIA 2JDSA 1H8FA 3MFUA 4YC8A 4UWYA 3D94A 4NSTA 3RTPA 4E26A 4XMOA 5JKGA 1H26A 4O6LA 2X7GA 4EUTA 1YOJA 2F57A 2WTCA 3HP2A 3QCYA 3W2QA 5EI6A 3OBJA 4RIOA 4F08A 3KXZA 4ASDA 3BV3A 3F88A 4MVFA 2BHHA 3CPBA 3HEGA 4AT3A 3HZTA 5JFXA 3LFEA 3OBGA 4U8ZA 4M67A 4TYGA 4O22A 3WYYA 3DQWA 3II5A 5DRDA 1IAHA 4I0TA 2VN9A 5HTIA 3EFLA 3GFWA 3RZFA 2YAAA 1Y91A 1VJYA 2X4ZA 5BVKA 4IM0A 3GT8A 1XJDA 3CKXA 4G3EA 4XOZA 4DC2A 3O7LD 4K33A 2HIWA 3UOHA 4FV5A 2XBJA 2GNIA 2XK6A 3KEXA 3VS3A 1XQZA 5DE2A 4GK3A 2PUPA 4R1VA 3CTQA 4U40A 2PVJA 3KRXA 4FKJA 2VTOA 3FI3A 4IFGA 3Q53A 4ANMA 4BTJA 3W2PA 5C26A 2PUUA 2V55A 4UV0A 3CE3A 3FUPA 4QD6A 5AV1A 4TRLA 3CY3A 5FRIA 3OTVA 5TR6A 5IQEA 2XK8A 4YBJA 4O83A 3RK5A 4DFYA 4EHVA 4Y73A 3GP0A 1PMNA 3JY0A 4D4YA 3Q3BA 4OTDA 4MX9A 3DK3A 4XH6A 4DHFA 2V5QA 2VD5A 5FUTA 4H39A 4G3FA 2HYYA 4CKRA 2Z7QA 3HRCA 2V22A 4PMMA 4KIKA 1J1BA 3DNDA 3WZJA 4RWKA 4EHEA 4L7SA 3RPOA 4K0YA 3VHEA 4AGWA 4CZTA 4MBJA 3SG8A 3SC1A 3QD0A 4Y83A 3EL8A 4D2PA 2W0JA 4GEOA 5J1VA 4FKOA 4OAUC 3FLNC 2ETRA 3SGCA 3DGKA 4C59A 3I0OA 3MY5A 3QKKA 4LGGA 1VYZA 2YJRA 3AQVA 3NLBA 2C3IB 4QO9A 1P2AA 5IA1A 4B7TA 5LVOA 5IKWA 4NH1A 2WU7A 3P4KA 4XP2A 3UNJA 5ETIA 3BV2A 3GQLA 4F9WA 3A8WA 5H8GA 2IW9A 5HCYA 1AGWA 5T6KA 3HX4A 3A7HA 3KVXA 3P5KA 3TM0A 2AYPA 3C50A 4I5CA 5HKMA 3UGCA 3NR9A 2BUJA 3V6RA 2XJ2A 3ZFYA 4IVBA 4TY1A 4RQKA 2ONLC 3F2AA 3IW5A 4FNYA 3AT4A 4W8EA 3ELJA 5IU2A 2OICA 2J0KA 3KMMA 1Q24A 4IDTA 4DH3A 5IZFA 3RPSA 4YTHA 1U54A 1LEZA 1UU7A 4JAIA 2HW6A 1WBTA 2WQEA 4S30A 3QTRA 5CU3A 3RPRA 4FGRA 4W4YA 3D7TA 4GH2A 4H05A 4IAKA 4O7NA 4LYNA 3EQIA 4C4JA 1ZOGA 1T45A 1OI9A 4XJ0A 1PY5A 5CZIA 3PTGA 4JLCA 4XNEA 4L67A 4AOJA 3KXNA 4RQVA 5CSWA 5KMMA 4UMRA 2J9MA 4X3FC 3EZVA 3PSDA 4N70A 1GOLA 3NIZA 2X39A 1QCFA 2WD1A 1ZYJA 2VU3A 4MNEB 4C61A 5L2IA 3S1HA 4RMZA 3WYXA 2YIRA 4TYJA 4W9WA 4ONAA 3I7BA 5GJDA 4UYAA 3VWAA 4CRSA 3AG9A 4CG9A 5IQDA 3LJ1A 4L68A 4C7TA 4PF4A 3ULZA 3IONA 4FZ6A 4CT1A 4M97A 2HCKA 3VBVA 3BHTA 4NM5A 1MRYA 1SNUA 2YAKA 3R7EA 3DXPA 5ACBC 3DZQA 2W1GA 3VHKA 4WD5A 4ZTMA 5DNRA 4ZTRA 5CX9A 3RCDA 4NTSA 2B4SB 3FL5A 4KWPA 3LFQA 5D11A 2OFUA 3AMBA 3UOKA 4ZSLA 4KBCA 5EM5A 5J95A 2WB8A 3QA0A 1M2QA 3QUEA 5EKOA 2GQGA 5AV3A 3D14A 3U6IA 3N4UA 4TW9A 3DDPA 4CXAA 5IH6A 4ITJA 5HO6A 4DN5A 3ZCLA 3TNQB 3U6JA 2ITPA 5G1XA 1P4FA 5AUVA 4A4LA 3L8PA 2QG5A 4ZJJA 2C6LA 4FTIA 3MN3A 4AE6A 5F1ZA 2Q0NA 4IW0A 4RGJA 2WTVA 2JLDA 3EYGA 3VW6A 3ZSIA 4CV9A 2E2BA 3U4UA 1A06A 5IISA 5JSMA 2JIIA 2JIUA 3O17A 3PIXA 4NM0A 4DTAA 3NX8A 4P5ZA 3OWKA 1A48A 5CLPA 1UV5A 5F95A 2C6IA 1H24A 3PPJA 2ZDUA 5AR7A 4GVAA 3VQHA 3TXOA 3KULB 4BCNA 3RGFA 4Y85A 3QZHA 3TN8A 4ERKA 2BROA 2JDVA 4RT7A 5E8WA 4C37A 4MKCA 3TEIA 5A6OA 1W7HA 1OKVA 2WMAA 5J7HA 4IFCA 2G2HA 2UZWE 4N6YA 3GC0A 2BCJA 2B54A 3LJ2A 5EG3A 4BTMA 2IWIA 5L6PA 3SW4A 3FMLA 3CQUA 4GKHA 1PXOA 2VV9A 4A9RA 4C0TA 5D12A 1ZMWA 2C0OA 4ZEGA 1W98A 4W4VA 5AAEA 4QP4A 4XS2A 2RKUA 3DA6A 1KE9A 3QYWA 3NEWA 4A9UA 4EBVA 4DT9A 1OITA 4FTNA 3WZUA 4AA0A 4AFJA 4RC2A 3RAIA 2HY0A 3M11A 4BGHA 3MESA 4WO5A 2H8HA 2YEXA 4R5YA 3UYTA 3FAAA 4FV9A 4LL0A 5D10A 1H25A 3U55A 4PV0A 5HBHA 4ZXTA 4H1JA 1ZAOA 4YP8A 4MBLA 5E92A 2IVVA 4GJ3A 5AUXA 5EKNA 4FKUA 4V05A 3VS1A 4Y95A 1KWPA 3PZEA 3AD4A 2H6DA 3BU6A 5LMBA 1FMKA 3QWKA 3UQFA 2P3GX 1YI6A 4JQ8A 4F9YA 4LFIA 1ZRZA 4KKGA 5JZNA 4QTEA 3N51A 4U9AA 3GQIA 1KOBA 1PHKA 3DNEA 4ANLA 3O96A 3HMOA 5AP4A 1ZWSA 1U4DA 2BDFA 3A2CA 4A9TA 5KKRC 2YM5A 5JRSA 4DTBA 3IW8A 4FIIA 5CZHA 5EHOA 3GB2A 4AUAA 1BI8A 3LFBA 1JBPE 2X81A 4MEDA 2J5EA 4ALWA 3CEKA 5J7BA 3ID6C 3DOGA 3OS3A 3KB7A 4NZWB 3FZRA 1WVYA 4JQEA 2GDOA 3QQLA 5E8YA 1J7IA 4TYHA 2CMWA 1UKHA 3C5UA 1FVVA 1YRPA 4FKTA 4MF0A 3MTFA 2I7QA 3PJ2A 3P08A 2VAGA 2PVMA 4I5PA 5CNOA 1JOWB 2UVXA 3LLTA 4HOKA 4I24A 4L53A 5M56A 2UZUE 4O7WA 3K5UA 5HX8A 4MWHA 2CPKE 4U81A 2XRWA 1Q3DA 1XBCA 1V1KA 3DXNA 3TKHA 3UYSA 4C4GA 5ITAA 3D5VA 3HGKA 3LMHA 1E9HA 2BPMA 3ORZA 4EOJA 4FTKA 2GQRA 3OWJA 3UVRA 2PWLA 4WKQA 3RI1A 1PYXA 4WRSA 3EQFA 2WAJA 2YACA 1AQ1A 4C2VA 4YZCA 3T8OA 3GC7A 2C0IA 4X2JA 5FTQA 5I5ZA 3BQCA 5IA2A 3D2IA 3UIBA 5ANIA 3OROA 2GHLA 3S2PA 3VS6A 1LEWA 2UZDA 4FUXA 4AZWA 4C4HA 3V5QA 3W2RA 4I4FA 4EH5A 4C4EA 1PXKA 3LOKA 4MQ2A 4IAAA 5AP2A 1ZMUA 4AGCA 4LGHA 2R7IA 4MF1A 4U0IA 2R3NA 3HL7A 4ZZNA 3GGFA 4CFXA 3DAEA 3OOGA 4PUZA 4BCIA 4HGLA 1Q97A 4G5JA 2XKFA 3E3BX 4OBQA 3TZ7A 2C5XA 3ZHPC 3GXLA 4ZLZA 3LLAA 5HBJA 2ETMA 3E7VA 3GBZA 5CAOA 3O8PA 2YWVA 3ZXZA 5CASA 3COMA 3B8RA 4JBVA 1ERKA 3DDQA 1WBPA 4HGEA 4XBRA 3A60A 4JOAA 2G1TA 3BYVA 3UIUA 3GC8A 2CJMA 5DR6A 5ANDA 3NNUA 1J1CA 4NW6A 5DG5A 4AGDA 5HU9A 4C2WA 4RVLA 4RX8A 3C51A 3QU0A 4BCFA 2P4IA 2YIWA 3AC4A 2QKWB 4RWIA 4AT4A 2J2IB 3KXMA 3QTZA 3QRUA 3EQCA 3ODYX 5E8SA 4ENYA 5GJGA 3QD4A 5CTPA 3RHKA 1J91A 5IQHA 3NWWA 4H3PA 4HZRA 5JQ5A 2IVTA 2Y4IC 3H0YA 4A9SA 4W8DA 2XZSA 3BGPA 3MDYA 4XV3A 4WUNA 4ZSJA 5FBNC 4GFGA 4E5AX 5HTBA 4R77A 4D2VA 3D7ZA 2G9XA 3R8MA 3LM0A 1O6KA 5KMOA 3DAJA 3HV4A 4IVAA 4QTAA 4FEVA 2O3PA 3FJQE 4IEBA 1M2RA 4D0XA 4FEWA 3T3VA 3KRRA 4L42A 4BY9E 1IG1A 2QOQA 1CTPE 4BCJA 4ZMFA 2VTRA 4AP7A 4APPA 4IB0A 4M3QA 1VR2A 2WTKB 3ZRKA 3FI8A 3ANQA 3BYOA 4NCTC 3FE3A 4G16A 2PUIA 3TTJA 2ZB1A 3QCQA 4FSTA 1S9IA 4KSPA 4Z55A 1TQIA 5LARA 5TKDA 4O82A 5H8BA 2JKKA 2R5TA 3R6XA 4FTAA 4B9DA 2BTRA 4B6LA 1J7UA 4QMLA 2B55A 1QPJA 3W33A 4FTMA 4TPTA 4FKGA 3F69A 5AR2A 3FMKA 2IJMA 4FT5A 4CQGA 5HVJA 3HV6A 4M8TA 5M55A 4TYEA 2XM9A 2PE2A 4ALVA 5DYJA 4Z16A 5I9UA 4U44A 2OXYA 1XH5A 3OTUA 4OW8A 2CLXA 2W9FB 3GVUA 3F3UA 4RFMA 3R63A 3C5IA 2CN8A 3F66A 2UVZA 4EOMA 3E8CA 3NAXA 3NS9A 4ANQA 4BIDA 4L46A 4WOVA 2JAVA 3FMJA 5C01A 4DH1A 5F4NA 4BZOA 4XLIA 3MH0A 5DN3A 5HLWA 4EYMA 1PW2A 2FSMX 4BDHA 5HO8A 5A4LA 3R7VA 5IQCA 2OFVA 2UVYA 3FZ1A 4RVKA 3G33A 4QP2A 2GTMA 3QKLA 3SX9A 4C8BA 4EHZA 3O71A 4C3FA 5ANEA 4BKZA 3NMUF 3BELA 4OBPA 1GIIA 2GTNA 2W99B 1NVSA 4FVRA 3SDJA 3ZEWA 1JAMA 3CBLA 4O0RA 3LFDA 3ET7A 2YISA 1UVRA 3BHYA 2BRHA 3FSKA 3H0ZA 4UMUA 2YLFA 4RX9A 3KCKA 3H9RA 2BAQA 2RFEA 3ACJA 4AX8A 4FTTA 4CFVA 4IADA 3EIDA 4FYNA 4XYFA 4APCA 3F9NA 1ZLTA 4O38A 4QTDA 4PDYA 2XJ0A 1OL2A 1I09A 4UWBA 3O8UA 4IBMA 3KREA 2BZHB 1W0XC 2PVFA 4QTCA 4QRCA 4AQCA 4EH4A 1P5EA 1BUHA 4TXCA 2QO7A 1XKKA 4UZHA 4WA9A 1W83A 4LQMA 4BYIA 2VX1A 1FGIA 1DS5A 2VZ6A 3WZKA 3L9NA 2FYSA 4RIYB 4IB3A 4H58A 3DT1A 5D7AA 5IA3A 2PU8A 4AA4A 4KBKA 5GZ9A 4BCGA 3PIYA 1DM2A 3UQGA 2ITQA 2BDWA 2C68A 1VYWA 4FK3A 4A7CA 3NGAA 2PMLX 2ITWA 4LV5A 2WFYA 2ZV2A 4XBUA 4GT3A 4M69B 4YJVA 5FM2A 2HENA 4E73A 3GEQA 3IW4A 3ENMA 5LOHA 3RKBA 3NNVA 3OOMA 2J50A 3MB6A 1OKYA 1URWA 3D2KA 4RA4A 3WI6A 4PP7A 3DS6A 3KFAA 2WEVA 3E8NA 4D2WA 2ITTA 5LQFA 3ORNA 4M68A 1YXTA 1CMKE 3DK6A 1ZARA 5CYIA 4TYHB 4YLLA 4EK4A 4YURA 3QTWA 4AZFA 4TWPA 3FZTA 1KE7A 4ENXA 4ZZOA 5J87A 3RWQA 1H07A 3FL4A 5T68A 4BFMA 4OTPA 3IDCA 3OG7A 4U5JA 3LFNA 2PMNX 4QT1A 3ANRA 3I79A 5H9BA 2WNTA 3E5AA 4ZTSA 2NPQA 4CLJA 4FKSA 4AAAA 3OW4A 4D58A 2ITOA 2VWBA 4L52A 4ZIMA 3ZBXA 2GNHA 4NIFA 5BQ0A 3PJCA 2HZ4A 2WMUA 2W1ZA 1LPUA 3POZA 4FTQA 3UBDA 3PJ8A 2XCKA 3ZDUA 4CYIA 4GYGA 2J0IA 2QQ7A 3MA3A 4S33A 5FD2A 2ZV7A 2B9IA 4BHZA 5E1SA 5AAFA 5CXHA 2PZIA 3F6XA 2EXEA 4FGBA 4HGTA 2OIDA 5K0KA 4DG0E 2R3KA 3CXWA 3ALOA 4DTKA 4ZLYA 2OJ9A 1YQJA 2QU6A 2WQNA 2GMXA 2QR7A 3ETAA 3E3PA
chains in the Genus database with same CATH superfamily
4AACA 2VX0A 3G90X 3OT3A 3CY2A 4FV4A 4YJNA 1OMWA 2FGIA 3GCUA 3TKIA 1UA2A 5B2KA 5LMAA 1M52A 3HUCA 5EDRA 2P2HA 2XYNA 3REPA 4ANOA 4BDCA 3G51A 4O6EA 5CQUA 3NAYA 5L2QA 1JVPP 1Q62A 4YJUA 2NRYA 2VTQA 3BWFA 2JIVA 3PY3A 2HXLA 3W1FA 4EH6A 2XF0A 3BLQA 4Q2AA 3V5TA 3SVVA 5AUZA 1FQ1B 3ZLXA 5ANJA 2QHNA 5HIDA 4C02A 2P0CA 1YHVA 2C1BA 2Z2WA 3EN4A 4HJOA 4JT3A 2XNBA 5FXRA 4DEDA 4RA5A 5DIAA 4JJRA 5F20A 3SRVA 4EH7A 2IO6A 4BIBA 5JGAA 4FT7A 4AZSA 3SOCA 4D2SA 3R7OA 4CRLA 3TZMA 1CKPA 3KN5A 4FKWA 4TYIA 3HAVA 2W4KA 3CD3A 4NKAA 5M4CA 3QHWA 3TL8A 3A4PA 5LVNA 4QYGA 5KMNA 2Z7RA 4BBMA 4BCPA 3GC9A 4ITIA 1IA9A 3UIMA 4V0GA 5I3OA 2UW6A 2VWXA 3PPKA 2JKOA 3ZXTA 3PA4A 3L8XA 3QFVA 4E8AA 3QGWA 4H3BA 3QBNA 4M0ZA 1FVRA 4QP8A 3R71A 2WMQA 2YCSA 2ETKA 2HAKA 5EYCA 4RJ3A 4FV8A 3VS2A 3H10A 2JBOA 2JDRA 3RJCA 3ZFXA 4BTFA 5CU6A 3IOKA 3CC6A 4D1ZA 4I3ZA 2W1CA 2AC5A 2QOKA 4I23A 3I5NA 4JG7A 5EI2A 4MXOA 5TT7A 4NL0A 5D1JA 5J9LA 3HAMA 1GY3A 2OGVA 2QC6A 3MJ1A 3S4QA 3VULA 4ASZA 5DFPA 4EORA 4KIPA 4PRJA 3IGGA 4EOSA 4TNDA 2ZM4A 2YWPA 3BWJA 4AA5A 4JIKA 3R7GA 4FZAB 1WAKA 2OWBA 5HBEA 3AMAA 5FTOA 3P9JA 5CI6A 5DA3A 2PE0A 5I3RA 1RQQA 1T46A 2BZJA 3NUPA 2VO3A 4FNZA 2F7EE 2XK4A 3FKOA 3W2OA 4C38A 5AUUA 5TE0A 2UW3A 4YZDA 4F64A 4FEXA 4O7SA 3IDPA 5I9YA 3SLSA 3V5LA 1XH6A 4MK0A 3UDBA 4B4LA 4DFBA 5M09A 2VO7A 3I60A 3MIYA 3FEGA 3PRIA 4XV2A 3R2BA 2PVKA 4YBKA 4BDEA 4QMMA 3TNHA 2QVSE 4C58A 3A7FA 1H1WA 3ERKA 3EZRA 1MRVA 4L3LA 4BGGA 2W1EA 2O65A 4GL9A 2XNEA 4AXEA 2XKCA 4J53A 4ZTNA 4C34A 2R3PA 3UNKA 1O6YA 2FSTX 3QXOA 3W0PA 2YDJA 5CNNA 4QNYA 4KUJA 3GU6A 4YJQA 4E6AA 1Y6AA 2F49A 3MFTA 3PJ1A 5CSXA 4Z7HA 3DFCB 3QZGA 4C62A 5B7VA 5DR2A 3MIAA 3R8LA 2B9JA 5FEDA 1Z5MA 5AUYA 2C3KA 5DHJA 3I4BA 2PSQA 4WG5A 5HOAA 3WE8A 4IACA 3HRFA 2XJ1A 3BEGA 4RJ8A 4X3JA 2E9OA 5HG8A 5HHWA 3VS4A 4ACDA 1KUTA 2C6DA 4I6QA 3TNPC 5CWZA 4ZMEA 5ANKA 2X2LA 4HVHA 5M44A 1K9AA 3DBQA 4BWPA 2I1MA 5A46A 3VJOA 5BMSA 3ALNA 2OF4A 4KSQA 5TO8A 1YOLA 2VTTA 3PUFC 4O2PA 4DEEA 2PL0A 2WQMA 5BX0A 3O5AA 1H27A 4U45A 4RPVA 1YXVA 5L2SA 4F09A 3MH2A 3JXWA 5JGBA 3GU7A 3F3TA 3QWJA 2I0HA 4I0SA 2ESMA 4WBBB 5J5SA 2W4JA 3ZUTA 2UW0A 3DBCA 4I20A 3TIZA 4U6RA 3UVPA 4D9TA 4QYYA 2IVSA 2J0LA 5HLPA 5KZ0A 3LJ0A 4MWIA 1UKIA 4ACCA 1OIUA 5CAVA 2PPQA 2WELA 1PMUA 2ZOQA 1OPJA 3DV3A 3FLZA 3GCQA 5IA0A 5KNJA 2Y0AA 2A0CX 2ZM3A 4IQ6A 3FHRA 5AV0A 4I1ZA 3PWYA 5AP1A 5IMXA 5K3YA 4O7LA 5ANGA 3TMOA 5LVLA 4IIRA 4JXFA 4OTGA 4YR8A 3U6HA 2UZTA 3FZOA 4Y5QA 3R28A 4NU1A 3L8VA 5M08A 2C6EA 1NA7A 5A4CA 3G5DA 1IA8A 4OLIA 2YA9A 1YXSA 4EOKA 1ZOEA 4JRNA 2NNWB 4J71A 4PNKA 4ZY6A 1PXLA 1WBWA 1CSNA 2OSCA 2VTNA 4J8MA 2P33A 3EQRA 5IUHA 1JPAA 4JG6A 1BMKA 4RG0A 4JBQA 3ZO1A 4EK3A 2VGOA 3PXRA 4FG9A 2H34A 2OJJA 3PFYA 4HPTE 4IE9A 4N6ZA 4BCOA 4O4FA 3TWJA 4BDFA 4CFFA 1XH7A 2OH4A 4B8LA 3V5PA 3FPMA 4IZ7A 2V62A 1E1VA 3R1SA 3L9MA 2FO0A 5DRBA 1SM2A 3FQSA 4EI4A 4EUUA 4LV8A 3OY1A 3MGYA 4MTAA 5ACKA 2Z7LA 5KHXA 4DGGA 3CR0A 3JY9A 3CIKA 4ZS0A 4A07A 4GUBA 5IDNA 1RE8A 3L8SA 2A1AB 4NUSA 1OBGA 4KKEA 3PP0A 4YZBA 4CKJA 3NUXA 3N4VA 2PZ5A 1WBNA 4L3PA 4F9BA 2VTIA 2QKRA 3HECA 3VUDA 1XH8A 4RZWA 2X8IA 3P7CA 5LMKC 5IQBA 5GINE 1H4LA 3PVGA 3QX2A 4BYJA 1L8TA 2Y8OA 5FQDC 4FYOA 3P78A 5K9IA 3ENHA 1LP4A 2GS6A 4C4FA 3A62A 3P1AA 2RGPA 3QQKA 4GG5A 4ZJVA 2C30A 5HQ0A 4DF3A 2X6DA 2WTKC 3CJFA 4OTHA 2YJSA 3PY1A 2B53A 2JC6A 2A27A 3R9RA 4QYEA 4MXCA 4L43A 4J8NA 3GNIB 1YXXA 5KO1A 4LGDA 4RC4A 3SRVB 4V04A 4XRJA 2X0GA 3QQUA 1JNKA 3KF4A 3QCXA 4YPSA 5EW3A 3RPVA 3D5UA 2VO6A 3K3JA 2GU8A 3MFSA 4PTGA 2QCSA 3QGYA 2RFSA 3KVWA 3QALE 2QOCA 4ANSA 2PZPA 1RJBA 4M66A 4V01A 4J1RA 4X2NA 2F9GA 2ZMCA 4RLKA 5TF9A 5M4IA 5DI1A 3TV4A 2X4FA 3VC4A 3GU5A 5AR3A 2BKZA 5GZ8A 5HORA 4UZDA 4V0GB 3UZPA 3NSZA 4MH7A 3ZM9A 4U80A 1WBVA 4WNOA 4IX6A 4UY9A 3WF9A 1UU9A 3AKLA 2CNUA 3EQBA 3GI3A 3LIJA 2I0YA 3PVUA 4EQMA 3R21A 3SOAA 5JEBA 2QR8A 2PTKA 4PMSA 1OL1A 5EI8A 4NFNA 4TTHB 3RAHA 2CKQA 1H28A 1UNGA 2VRXA 3OP5A 2IZTA 3Q52A 2CGUA 4PP9A 4X3FA 2YM6A 4CYJA 3BBWA 5ICPA 3PSBA 3UC4A 1DAWA 3QUPA 4KD1A 3GENA 3QAME 3QRJA 5FEEA 5E4HA 2EUFB 3LAUA 4JS8A 2BRBA 4X6RA 5AX9A 1KE8A 1OGUA 3N9XA 3VS0A 3BEAA 4IHPA 3U4WA 1L3RE 4XLVA 3R30A 3R9HA 4TNBA 4FZFB 5AV4A 3BHHA 5IEXA 4FTJA 4YLKA 4OT5A 3P79A 4FSUA 3QRTA 2I0VA 4JRVA 4EWHA 4KABA 3ORTA 4YHFA 3OXIA 5CVHA 5IUIA 5HI2A 4DT8A 5D41A 4QPAA 2G2IA 1XBBA 3F7ZA 2X7OA 1V0BA 4GK4A 4C35A 4RVMA 4F7JA 2YDKA 4FTLA 2EWAA 5F9EA 3PIZA 4WIHA 4DE4A 5E91A 3G6GA 1CM8A 1KSWA 4XP3A 3BYUA 3IW7A 4UBAA 2F7ZE 2GCDA 2XK3A 2Q83A 3W16A 4CV8A 4JBPA 4FL1A 4UMTA 5AP7A 1YDTE 3SXFA 2VTJA 2HOGA 3R73A 5CANA 3KCFA 4FKRA 5B0XA 4D55A 4GJ2A 4TWCA 1OVEA 2OJFE 2XMYA 3UPXA 4AF3A 4C3PA 1J7LA 5FXSA 3BI6A 4FODA 5AR8A 3TNWA 3DY7A 3NW6A 2X1NA 3DQXA 4S2ZA 5JK3A 2WHBA 3O50A 3VVHA 4CGAA 5E8TA 3WE4A 1PJKA 3E7OA 1W82A 3O2MA 2XK9A 5DPVA 1R0PA 3R8UA 4E7WA 4N57A 4QEBA 3QLFA 2C6TA 3KK8A 3R9OA 3IKAA 4FVPA 2C3LA 4RSSA 4USEA 4WHZA 3TZ8A 3ORXA 4AW5A 2W1DA 2OZAA 1VZOA 4DEGA 5CALA 4XUFA 3NW7A 3ROCA 1RW8A 4R3CA 3RPYA 2OIBA 4BCKA 4X2KA 3DCVA 4WSYA 3ZS5A 3MV5A 1R0EA 5IH5A 4E3CA 5J1WA 4DHIB 4QP6A 4XV9A 2J5FA 2RFDA 3R22A 5HLNA 3A4OX 2QOLA 5EM7A 2OJGA 4M14A 5CVGA 2X2KA 1H1QA 5AP3A 3EN7A 3Q9XA 2WIHA 2H96A 3AC3A 2YLEA 1W2DA 4L00A 4XRLA 3TKUA 5HGIA 3MPTA 2R3LA 4FV3A 3JVRA 5B2LA 3P86A 4Y8DA 3DLSA 3PXFA 1JSVA 2WOUA 3ZLWA 3OMVA 3KGAA 3M2WA 2KULA 4KIKB 3Q6UA 4CVAA 2RL5A 2W1IA 4MD7E 2ZM1A 4ZOGA 3QLGA 4NM3A 5BUJA 1NVRA 4O4CA 4BDAA 3W0QA 5L4QA 2YCRA 3K54A 4PDSA 5FP6A 3VBQA 1ATPE 3B2WA 4U79A 4UYNA 3ZC6A 5M06A 5BNJA 4S32A 4KIQA 4KIOA 2HELA 4FIFA 4CNHA 3DKFA 3U9NA 3H9OA 2OW3A 4FV6A 1OL7A 5GIPE 4A4OA 1XMLA 5K0XA 4JQ7A 3ZRLA 4ZY5A 4FIEA 4JDKA 4BZNA 1IAJA 4GUEA 2GSFA 3OCSA 1U5QA 4YC3A 4QOXA 4RIWA 4DDGA 4XG2A 5J9ZA 2QG7A 4L9IA 5IMEA 5KCVA 2XAMA 2ERZE 3RALA 2OF2A 4O4DA 4G2FA 1GNGA 5HCZA 1GJOA 2H9VA 4XP0A 2GNGA 2UUEA 4PDOA 4CMUA 2C5VA 3AMYA 5EOLA 2YCQA 3AGMA 3LHJA 3WF8A 2EXMA 3TI1A 1U54B 4Y72A 2UZVA 3D0EA 5JQ8A 1V0OA 4QMOA 3UG2A 2QOBA 3D7TB 3NNXA 4CFMA 5D7VA 3O51A 4YTFA 3F7WA 2XNOA 1MRUA 3TUCA 3EOCA 4QYHA 4EQCA 2FA2A 5HX6A 5EW8A 4RX7A 4BI0A 5FBOA 4QQCA 3GUBA 3SXRA 4EZ5A 5CEOA 4I21A 3ML1A 1JKLA 3W2CA 4D28A 4DYMA 4TN6A 4HVIA 5AADA 5CU0A 3HV7A 2XKDA 3C4XA 3FXZA 3W0SA 4U3YA 4JBOA 3RINA 2OG8A 4R7BA 5M51A 3H4JA 3HMNA 1OBDA 4ZSGA 4PQNA 3ORPA 5CEQA 3NVMB 3MH3A 2OO8X 4EONA 4LV7A 4GU9A 4LOQA 3O0GA 4ORKA 2LGCA 5CU4A 3LFSA 2NO3A 3BIZA 4PMPA 2VWZA 4U97A 3SXSA 4ARKA 4ZZMA 3LCTA 3FSFA 3KMUA 5DEYA 4RBLA 4ACGA 4DFZE 5KX8A 4E4LA 3DBFA 4FUYA 3AGLA 5AP6A 4E6CA 2XKEA 4DFLA 1F5QA 4TWOA 4DH5A 5CF6A 1ZY4A 4K1BA 3FC1X 2P2IA 4DLIA 4KRDA 1CKIA 4FSZA 1EH4A 3NYXA 3T3UA 4CLIA 5A54A 5JMSA 5EQPA 3OHTA 1IEPA 2A4LA 3L1SA 3QQGA 5E8VA 3G9NA 2PMOX 3ORKA 2JFMA 1KV2A 4YNOA 5EHYA 4EEVA 4HVGA 3JVSA 2ZMDA 3KY2A 3PE1A 3MPAA 2J0MB 5LVPA 1G8SA 3COHA 4M15A 2Z02A 2QI8A 4P2KA 1BKXA 1KV1A 4H3QA 4LG4A 1NW1A 1Y6BA 2PY3A 4AN9A 2ITUA 4KS7A 3KK9A 4YZMA 3KXXA 3V51A 2R2PA 4DCEA 3OWPA 4KRCA 4JDHA 3DPKA 2W7XA 3DKOA 3FY0A 3JS2A 4O21A 1PXIA 5IA5A 5C8MA 1FBNA 1OGYA 4U42A 2DS1A 2FH9A 1G5SA 1YKRA 4TWNA 2IZSA 3VW8A 4TT7A 4PTEA 2OIQA 1M2PA 2X8EA 5H2UA 2HW7A 3BHUA 1HCKA 3IGOA 3FQHA 4G6LA 4DA5A 5L6WL 4O0TA 2YIXA 3QTUA 1PF8A 4EOPA 5LCKA 4A9YA 1SVEA 4HGSA 3C4CA 3IQ7A 3R1YA 3VF9A 3Q9ZA 4D9UA 1Z9XA 2RF9A 3PA5A 5EM8A 4MQ1A 4G6NA 1Z57A 5L2TA 4DHJA 4ACHA 4OBOA 2YZLA 3HDMA 3FZSA 2R0UA 1V0PA 3IDBA 4LRJA 5LXMA 4D2TA 3W0MA 3C4ZA 4PTCA 3EQHA 4A4XA 1YXUA 2QO2A 3NCZA 5DWRA 5BUIA 1IASA 2YM4A 3ZDIA 4NCTA 3EL7A 2C5OA 4FX3A 3U9CA 2C69A 4HNIA 4HPUE 5DT4A 5CXZA 5J9YA 3DB6A 5EYMA 5CI7A 3LFFA 3FYJX 3SAYA 4I6FA 2WMTA 1AD5A 2YM7A 3MVLA 4BWKA 3FLWA 4FEUA 3EN6A 3UDZA 3QZFA 2X2MA 3QL8A 4UWCA 4W9XA 3UO5A 3G0EA 5AR4A 3VQUA 4IAFA 4LMUA 3UMWA 3NIEA 4FSWA 3ZBFA 4AXAA 3GOPA 2GNFA 5D9HA 4CTCA 3QCSA 4J96A 5FM3A 3WZDA 3F61A 3GU4A 3ZUVA 3LQ5A 3V6SA 4QMNA 4X21A 3NVKI 3LM5A 4D4SA 2ACXA 3MB7A 4QMWA 3VBTA 5L6OA 5L3AA 4Q9ZA 2WQBA 3TV6A 4DBXA 3QD3A 1YWVA 4G3GA 4L3JA 1KOAA 4R6VA 4GCJA 2XEYA 3R8ZA 3TT0A 4DFNA 2OK1A 2YDIA 5EDPA 4ZJIA 2BIYA 3RAWA 5BV3A 4YUQA 3PXZA 4G3CA 3V8WA 3DJ5A 2C47A 3N4TA 1H00A 3R8VA 4BI1A 3A61A 4DEHA 3UJGA 5BYYA 4IANA 4IAIA 2C6KA 4KAOA 4RIXA 3SQQA 3BGQA 3LFCA 4WRGA 4LOPA 5HD7A 4CG8A 4GT4A 4EC9A 4J98A 4K6ZA 4O86A 5KBRA 3FLSA 3PYYA 4UMPA 4QPMA 4DGNA 3UC3A 4BDJA 2GNJA 3BLRA 4GS6A 4B0GA 4PL5A 3OCTA 3FZPA 3C9WA 2GNLA 2J90A 2WTWA 4RFYA 2OBJA 3CLYA 3Q2MA 3MY1A 4PPCA 5IEYA 4UN0C 5BMMA 2KTYA 4IX5A 2FVDA 3HNGA 4Z3VA 5BUEA 4XHKB 4B8MA 3UVQA 2R3GA 3QXPA 4C33A 2W1FA 4IXPA 2RG6A 2E9NA 4FG7A 5LVMA 1YVJA 2XA4A 4NK9A 5CT7A 5CAUA 4C3RA 4JI9A 2C3JA 3UO6A 2XP2A 4FTCA 1JKSA 4JX7A 4IX4A 4C4IA 2A2AA 3H30A 4IZYA 4U43A 4EZ7A 3SHEA 3DTWA 4I5MA 4I5HA 5ANOA 4OUCA 3HMMA 5E9EA 3PJ3A 4U41A 5DT0A 4DEAA 3SA0A 5M4FA 1RDQE 2WMBA 2IW8A 4YMJA 5BYZA 2YZAA 3QA8A 4K9YA 2B1PA 2DUVA 4O7RA 1SZMA 5E7RA 4LOOA 3R8PA 1A9UA 4CD0A 4RIWB 3EMGA 2V7AA 2VTLA 3QKMA 3RM6A 3QQFA 5FDXA 3C0GA 2OKRA 1NT2A 3D4QA 4M13A 1H01A 2IG7A 1ZXEA 4LL5A 3A7GA 4YJRA 3FXWA 4U7ZA 3VJNA 1M14A 2QOOA 1F0QA 4QMXA 3W0OA 4OT6A 3OT8A 2WU6A 4AXDA 4F6UA 4FTOA 4F1TA 3RZBA 3Q5ZA 4I4EA 1OB3A 2OZOA 3IO7A 1XHAA 5H8EA 3MVJA 2BFXA 4MD8E 3EFKA 4TZRA 2XNNA 3MY0A 4LM5A 4MNFA 1U59A 3U87A 5EQEA 4FI1A 4GW8A 3WIKA 5HD4A 4CCUA 5C4LA 4RJ4A 3W8QA 3FKNA 2DQ7X 2R3QA 3KL8A 4NWMA 5FXQA 4O7ZA 2EU9A 3MVMA 5DBXA 3V04A 5C8KA 1DAYA 4JIAA 1Y8YA 2XM8A 3POOA 3DB8A 1FGKA 1GZOA 1XH4A 4D4VA 3NZ0A 3UP7A 3BRBA 3NCGA 4Y46A 4DFXE 2XNPA 4FL3A 5AAGA 3PG3A 1Y57A 5HVYA 3TNIA 5K5NA 1K3AA 5KE0A 2GHMA 4RJ6A 4IB1A 4MNEA 1G8KA 4J95A 3FMMA 4E93A 2HK5A 3RVGA 3FMDA 4DINA 2IW6A 4FG8A 1WBOA 3LCDA 3E88A 2PVHA 2UZNA 3KF7A 4FF8A 4G5PA 2B52A 3BZ3A 4CTBA 4EOLA 3NDMA 2X9FA 3ACKA 5KHWA 4FA2A 5AP0A 5CEKA 2IF8A 3CKWA 3OZ6A 4EHGA 4IAZA 4EKLA 4JR3A 4FZ7A 4F65A 3PY0A 2PUNA 4LDTA 4CZYB 2V0DA 4JNWA 2R4BA 4EJ7A 3NYNA 4FSMA 1JSTA 1H0VA 2C1AA 2CKEA 2WKMA 4FT3A 3ZLSA 3WOWA 4BZDA 1IRKA 3DBDA 1I44A 3GOKA 4QMQA 4AXCA 3DXQA 3RM7A 2A19B 4DG3E 5B2MA 2F2UA 2X8DA 4F0IA 2BALA 2IZRA 1H0WA 3I81A 3EKKA 3MSSA 5BVEA 3ATTA 3G9LX 4MCVA 2ZAZA 4X7QA 2G2FA 4EOQA 2ITVA 1CKJA 1OUKA 4OTIA 1W2CA 4O0VA 5IUGA 2AC3A 4F1OA 4DH8A 1Y8GA 3CTHA 3CGOA 4EL9A 1X8BA 3CP9A 3V5WA 4BKJA 2BKKA 3K3IA 3TJDA 2Y4IB 5DMZA 2GQSA 4FTUA 4YU2A 3ZTXA 4AWIA 3UODA 3WZEA 1W8CA 2ZFYA 4P4CA 2BAKA 4OGRA 3F3ZA 3VUMA 3CS9A 3OUNB 4D1XA 4FV7A 4GU6A 2VWWA 4L8MA 5JFWA 4BVUA 5C9CA 5JT2A 3QRIA 3LZBA 3CPCA 4FV0A 2ITNA 3KULA 1JWHA 1UNLA 4AN3A 4FIJA 3PVBA 2AEGA 3DAKA 4FV2A 3LCOA 2VWVA 4EH8A 3TUDA 4GK2A 2JITA 5EQYA 1OECA 4PNIA 4ZP5A 2EB3A 3Q4CA 1XH9A 1NVQA 4YTCA 2BDJA 1NY3A 3UO4A 3KXGA 4GMYA 1JSUA 4Q9SA 4E6QA 3EN5A 1PMVA 1URCA 2PVLA 3FXXA 2UZBA 3QYZA 3EQDA 3SW7A 1GAGA 3KN6A 5DH3A 3QHRA 3UNZA 3QZIA 5HICA 4G9RA 1P4OA 3I6WA 2R3MA 1PXNA 5HNBA 4ID7A 5G6VA 4FIHA 4R78A 4IVCA 2W96B 4BDGA 4IMYA 4LMNA 3UPZA 3W0NA 4H1MA 3ITZA 1UU3A 5HCXA 4I0RA 4UALA 5KUPA 3AXWA 3DK7A 3R00A 2BHEA 5CF4A 3DKCA 4CSVA 4NEUA 1U46A 2W05A 3P0MA 4YO4A 4IJ9A 1LR4A 4GVJA 4FSYA 3SD0A 5BVDA 3NPCA 3F5PA 5DOSA 4MXAA 3OCBA 3HKOA 1PKGA 3HVCA 5AX3A 2ZJWA 3ZH8A 3F5GA 5HG9A 5AUWA 2XEZA 5E8XA 3H9FA 3PXKA 4FMQA 4MHAA 4ZTQA 4FOBA 2QODA 3ORMA 5FP5A 1MP8A 3W10A 3AKJA 4M12A 5GNKA 2HZNA 5I9VA 4RIXB 5AJQA 4WNPA 5CSPA 4R7HA 5HEZA 1OKWA 4E4MA 3AKKA 3FYKX 2XB7A 3C4WA 2OLCA 4OAVB 4I22A 4EYJA 5GIOE 4E6DA 3MFRA 4HCVA 1DI9A 2PVYA 2W5AA 2XH5A 5FEQA 2YIQA 3UMXA 3LQ8A 3VAPA 3OD6X 1H08A 5IQGA 3BCEA 1Q99A 2YITA 1B39A 3FDNA 5FTGA 5C03A 4O7VA 3ZO2A 4DEIA 4EC8A 3AD6A 4JX3A 4E20A 5E8UA 4XOYA 4QP9A 2W9ZB 3IK3A 2JD5A 4AW0A 5LJJA 1XR1A 4AE9A 4DGLC 3Q60A 2NRUA 3V01A 2G01A 1QPCA 2FSLX 4RVTA 3SKCA 1XWSA 5A4TA 4EZ3A 4FE2A 3P7BA 4LUEA 3HMPA 4Y5HA 4LRKA 3U54A 3FHIA 1SVGA 3QTSA 4QQ5A 4QMZA 3TZ9A 3V3VA 5LWMA 3EN9A 3PPZA 4YJSA 2CKPA 3HMIA 3Q32A 1GZ8A 4G9CA 4QMTA 5E1EA 2WIPA 3RNYA 2VNYA 4RRVA 1SMHA 3VUTA 4D5HA 2R3RA 4NIFB 5EDQA 1Q8TA 5JZJA 3G2FA 3IPHA 2R0IA 5BPYA 1BL6A 3BKBA 3OVVA 2BVAA 3GCVA 2ITYA 3QUDA 4QMUA 5CEPA 4IWQA 1O9UA 2QOFA 3NUUA 5T3QA 5K5XA 1Q8ZA 2QLQA 2C0TA 3WF7A 3PSCA 3FMHA 3R83A 5E8ZA 3PFQA 5L8JA 2RSVA 4ZAUA 1G8JA 1SYKA 3LXKA 4ZY4A 1JQHA 2WO6A 4FKIA 2YABA 3TTIA 4LRMA 3JYAA 4O0WA 5I9XA 2V7OA 4O0YA 3WF6A 3MTLA 3LPBA 3NYVA 5E90A 4GT5A 4YNEA 3BPRA 2DYLA 2QURA 3E87A 3NUNA 4YC6A 1S9JA 5IPJA 1PKDA 4RLLA 3B2TA 4I93A 2XK7A 4D0WA 4CFUA 3LXNA 3IW6A 5DLSA 3ZFMA 3U8WA 3VS7A 3R04A 2PHKA 4O7YA 2XARA 4G1WA 4QDEA 3WF5A 4FSQA 4R3RA 2BFYA 5JFSA 3K2LA 4EH9A 3LVPA 2LAVA 2Z60A 4GFOA 4F7SA 3CQEA 4OTFA 4GRBA 4O7TA 2Y7JA 2O5KA 4NJ3A 4CQEA 4EK6A 5A6NA 3WBLA 2J6MA 4YSMA 5A9UA 5JFVA 2ONLA 3ZONA 4WBOA 4DLJA 2F7XE 2E9VA 2Y6OA 4WUAA 4EQUA 3EKNA 4K8AA 4ZSEA 5IEVA 2E9PA 5BVNA 4AZTA 4F0GA 4BF2A 4NM7A 2XYUA 3F2RA 4JMQA 1UWJA 3EQGA 3PUPA 3F82A 3C4EA 4C57A 2W1HA 3I1AA 4I92A 3HYHA 4I6HA 2YIYA 2W06A 1OKZA 2J7TA 4LI5A 4X6QC 2PVNA 4XG7A 2QLUA 3EFJA 4QQJA 5EK7A 3VBWA 2B9FA 4OTRA 4PX6A 3LMIA 3EB0A 5L8LA 4CMOA 5LMKA 3R7YA 1Q4LA 4G17A 3VUHA 4KA3A 3KIOC 2I40A 3C0IA 3I7CA 2ITXA 4F63A 4NW5A 2WGJA 4S34A 2CNQA 3OW3A 4F0FA 3G15A 3VS5A 2VX3A 3HUBA 5BVFA 3UG1A 1FMOE 1R39A 3Q6WA 3ZZEA 4FNWA 4F70A 4BTKA 4R5SA 4UEUA 1REJA 1W84A 2XUUA 5JN2A 4QP7A 5DGZA 3UDTA 3NNWA 4M0YA 5AM6A 1OIYA 3ORIA 4U3ZA 4G3DA 3QQHA 4K18A 3C0HA 1OL6A 1WCCA 2GPHA 2CSNA 4GV1A 4IC8A 1YHWA 2PE1A 4QP1A 4JG8A 5CSHA 3CQWA 4DHZA 1YI4A 4OR5A 4ZLOA 5CU2A 3ZUUA 3V8TA 4QTBA 2XNMA 3KRLA 2W4OA 3JUHA 3D83A 1G3NA 3COIA 4IH8A 4O2ZA 2CGWA 3BU3A 3LXPA 5C27A 1R78A 4PWNA 4BRXA 3KC3A 2JGZA 3FMEA 4K77A 2CGVA 3ZZWA 1G8AA 4KB8A 4TL0A 4BHNA 4IZAA 5KBQA 2O64A 3FC2A 5CSVA 4YO6A 4Q5EA 4AOIA 3AT2A 3T9IA 4QYFA 2WXVA 3OXTA 2JKMA 2Q0BA 4QMYA 3ZOSA 4IDVA 4D1SA 5AA9A 3TUBA 2ZVAA 4XG9A 3BQRA 2OI4X 2QO9A 4WG4A 1WBSA 3GCSA 3NYOA 5ETFA 4ASEA 2J4ZA 3I6UA 3KRWA 5EHLA 1FPUA 3RBWA 2VNWA 3LCSA 1REKA 2XIYA 2XIRA 4NFMA 4O96A 3ZRMA 4F99A 3PDTA 3BBTB 4RWJA 1BI7A 3TDWA 5J79A 3ULIA 5HG5A 1FOTA 2YM3A 2CN5A 3C13A 5CENA 3VUIA 4BR3A 5EFQA 2WMXA 4W4WA 2YHVA 5IG1A 4YHTA 4G31A