2WB8A

Crystal structure of haspin kinase
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
352
structure length
351
Chain Sequence
LGSIEISNKKASDAEKVYGECSQKGPVPFSHCLPTEKLQRCEKIGEGVFGEVFQTIADHTPVAIKIIAIEGPDLVNGSHQKTFEEILPEIIISKELSLLSGEVCNRTEGFIGLNSVHCVQGSYPPLLLKAWDHYNSTKGSANDRPDFFKDDQLFIVLEFEFGGIDLEQMRTKLSSLATAKSILHQLTASLAVAEASLRFEHRDLHWGNVLLKKTSLKKLHYTLNGKSSTIPSCGLQVSIIDYTLSRLERDGIVVFCDVSMDEDLFTGDGDYQFDIYRLMKKENNNRWGEYHPYSNVLWLHYLTDKMLKQMTFKTCNTPAMKQIKRKIQEFHRTMLNFSSATDLLCQHSLFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of the Catalytic Domain of Haspin, an Atypical Kinase Implicated in Chromatin Organization.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords SERINE/THREONINE-PROTEIN KINASE HASPIN
total genus 120
structure length 351
sequence length 352
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2009-02-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2wb8A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2wb8A01
1YRPA 4DITA 4HYIA 3OFMA 3ZC6A 2BRGA 2QG5A 2B55A 2KTYA 4KRCA 4X2NA 3L9MA 5AMNA 1H8FA 3FE3A 5CTPA 4ORKA 3ZC5A 4QQCA 2OLCA 5CI6A 3PXZA 4ZZOA 3BYVA 3CXWA 2QG7A 2W06A 4E26A 3R8LA 4DFNA 4ENXA 3LXKA 4DA5A 3WI6A 4WNPA 3BHTA 4KSQA 4DTBA 3OXZA 3I7BA 5AP2A 5L2TA 1KUTA 4ERWA 3ROYA 2F7EE 4PMTA 3LKMA 3R1YA 4O2ZA 3QZGA 5I5ZA 3R1NA 4FE2A 4WNMA 5HICA 1QPEA 4HGSA 5EKNA 2DUVA 2UVYA 3RAKA 2UVXA 2WMRA 1PMUA 4KIKB 3G5DA 3EQPA 2IPXA 4P2KA 3CTJA 4R78A 1YQJA 2V22A 3IKAA 3JPVA 5KUPA 2GHMA 4C33A 4XMOA 2J9MA 3RKBA 2QO7A 4AW2A 1GZKA 4CTBA 1P4OA 4IFGA 4RA4A 4BKYA 2XJ1A 3KL8A 4ITHA 2YCSA 4I0RA 3RVGA 4GT4A 4DINA 3UDBA 3RPSA 4I6QA 5ANOA 5CT0A 4HYUA 3G9LX 4MXAA 3WF7A 4CVAA 3BHUA 4MBJA 4WSYA 3VS2A 5B2LA 2HY0A 2JEDA 3OF0A 4BICA 2W1HA 3FSKA 4CSVA 3DFCB 5H8EA 4L01A 2Y6OA 4KABA 2PYWA 4I6HA 3VWAA 3H3CA 4DF3A 4ALVA 3HMMA 1H4LA 3DA6A 3OY3A 3QRTA 5LMKC 3ZH8A 1YHSA 4HGTA 5HO7A 3R7OA 4FNYA 3QAME 1O6LA 3LFSA 3A4PA 4QMYA 4ACMA 4P4CA 4NSTA 3WILA 4I6FA 4IHPA 2CN5A 4RX7A 3Q53A 2ZOQA 2X1NA 3DZOA 3TV7A 3EIDA 3VW8A 4BHZA 4CZTA 1KE9A 3KC3A 3A62A 4CMTA 1P2AA 2UZUE 1Q3DA 4GUBA 5DWRA 2W9FB 4YHJA 1JLUE 3MVMA 4IBMA 5I0BA 5M57A 4E4MA 3FMEA 3NGAA 4FG7A 2GCDA 4DEDA 2BFXA 4L68A 4FSYA 3SW4A 4PDOA 4AFEA 5A46A 2H34A 4IB0A 5TR6A 4DG3E 4DCAA 4WG4A 4Y73A 2YM7A 5ACBC 2OJFE 4MD9E 1M2RA 3DKGA 5AADA 4DH7A 4X3FC 2OZOA 3FHRA 5EYDA 3RJCA 5LOHA 5L2WA 4AP7A 4GK3A 4IB3A 3FY0A 5K4IA 4FEWA 3R7YA 4AWIA 4FTRA 2F7XE 2VU3A 3OHTA 3R7GA 4W8EA 2J5EA 3Q4CA 5AR5A 4EI4A 1ZY4A 4XOYA 4JR7A 3LQ8A 4Y85A 4H1MA 2FYSA 1XH8A 4G5JA 4L67A 2XKEA 4QYGA 5KHXA 2YITA 2VTAA 2A2AA 2EXEA 3S00A 4QTEA 5AA9A 4EOJA 4S30A 1Q5KA 5HG9A 2GFSA 3RWQA 3CD3A 5AP1A 3ORNA 3RNIA 2GSFA 3VQUA 3R01A 3UP7A 3ZUTA 5AV2A 2XK9A 4F0GA 4WUNA 5AUXA 2JITA 3ZS5A 3WBLA 3KN6A 4BCJA 4KIQA 3MH3A 5CVGA 5LMAA 5HNIX 3AC1A 2OIDA 1PYEA 5FQDC 5CZHA 4F9CA 5BYYA 4RQVA 5L6OA 1BX6A 4QP9A 2PZYA 3RPYA 2YM6A 4L7SA 1JVPP 4QP7A 4EZ7A 3AC5A 2ZV2A 3D94A 3T3UA 4KKEA 2W1FA 2C5NA 3DBFA 4P7EA 3VNTA 4E5BA 3NVMB 4IAKA 2VV9A 3KU2A 3F88A 2XUUA 1OI9A 1MP8A 3MVLA 4RIXA 3MH0A 2JC6A 3F7WA 3UTOA 5D12A 2UW8A 3F5GA 3NUXA 3R8ZA 5KKRB 1MUOA 4YZNA 3H9RA 1Q97A 4FR4A 3KQ7A 4XG7A 4D4YA 5FBNC 5H8GA 3TKUA 5IQFA 3D15A 2O3PA 3QZIA 2C1AA 3CPBA 3PG1A 4TWNA 5TKDA 1U59A 2G1TA 3KULB 4TTHB 4YSMA 3OVVA 3LQ3A 4JIAA 3U4UA 3N4UA 4NUSA 4XG2A 2XKDA 2X4ZA 3AC2A 4F99A 5M4CA 1PMVA 2YFXA 3ORTA 2OKRA 4XV2A 2J0KA 1I44A 2ONLA 3NDMA 4UN0C 3H9FA 4U45A 2WXVA 5CX9A 4OW8A 4KBAA 4EH7A 4UY9A 3E8NA 4ZP5A 4PMSA 4QP2A 5ANIA 3EFWA 3RPVA 4IM2A 3TZMA 4FUYA 3SX9A 3TWJA 2W0JA 1SNUA 3P78A 3RINA 5EG3A 4IJPA 2PMLX 4I4EA 1SYKA 3PSCA 5D7VA 1APME 3QTXA 5ANJA 2X6EA 2F9GA 2W5BA 3D7ZA 4EOKA 3HUCA 2V0DA 5CXZA 1XBBA 3MW1A 3C4EA 3QYWA 4RGJA 4BDHA 4PDYA 3NVKI 1DAWA 4CFVA 5HE3A 2C0TA 3H4JA 5F4NA 3V01A 4C4GA 4AZFA 3LVPA 5EM7A 4F4PA 5C8KA 2DQ7X 1ZWSA 3I4BA 3CC6A 2XIYA 1WVWA 3PVGA 4FV8A 4YPDA 5HX6A 5J1WA 5JT2A 2GTMA 3OZ6A 4D5KA 1FOTA 4U42A 3KK8A 2OIBA 4MEDA 5JMSA 4IB5A 5CSVA 4PY1A 2YM4A 5LARA 4IMYA 4YUQA 2B9JA 4DFBA 2E9OA 3KMMA 4BRXA 2C47A 5HIBA 3LFQA 4CLJA 4IWDA 5L6PA 3MI9A 4IVDA 4CV8A 4YTCA 3MYGA 4J96A 3DU8A 5A4LA 1R0PA 2RIOA 2ZB0A 3G6GA 2BRBA 4X6QC 1NA7A 1ZYDA 4JDHA 3FI4A 1OM1A 1J1BA 2R3GA 3KXNA 4RVMA 1SVHA 5IEYA 1BYGA 4YBKA 5LMKA 4GVAA 2C6IA 4YPSA 3EQCA 5DFPA 4GV1A 4HOKA 4ACDA 5EOBA 4RLLA 4W9XA 2BHHA 3UIMA 3ZFYA 3R1SA 2CN8A 3QTQA 3R73A 4PPAA 2HY81 4NKSA 4DBNA 4I3ZA 1FGKA 3P08A 4YHTA 4CKRA 5J9YA 2G2HA 1XWSA 5AWMA 4V0GA 3D5XA 4N4SA 2OU7A 3A99A 5L8KA 5J9LA 4FEXA 3EYHA 5HLWA 3RWPA 3WYXA 5AR8A 4ANOA 5TOZA 2BRNA 3NPCA 4AE9A 2OH4A 2RSVA 1O6KA 3DAKA 5HU3A 5L2SA 2WKMA 3FQHA 2HXQA 2QD9A 2JDOA 2ZDTA 2WB8A 1GY3A 3FL5A 3RZFA 1PXIA 4BI2A 3SV0A 4GFMA 4IAAA 4Q2AA 3C5UA 4QYYA 4TT7A 3QQGA 4AZEA 4J1RA 5DI1A 2XM8A 4FVQA 4IM3A 5EYKA 1DM2A 3SXSA 2GQGA 4AUAA 2G01A 4GJ2A 5E91A 2UW3A 4AF3A 1OIYA 2XBAA 4FOBA 4CFFA 4ZAUA 4Q5EA 3HVCA 3KXGA 1YI6A 4BWXA 3BHVA 4TWCA 3DBEA 2VGOA 3MFSA 4PMMA 5E7RA 4MQ1A 2V55A 3O17A 2ZV7A 5M08A 4QP4A 3FQEA 3UVQA 2OSCA 1ZZ2A 4M14A 1YDRE 3CCNA 3BYSA 4OT6A 4ANSA 3OTUA 3R21A 3QTIA 1QL6A 5EW8A 3Q04A 2JAMA 1GZNA 3DV3A 3QQHA 2VWBA 2C68A 4FIEA 4JL9A 2LAVA 4FTTA 4YZDA 3PP1A 4OT5A 2XRWA 3VUKA 4DEGA 5BYZA 3QBNA 3C0GA 3PRIA 2OK1A 4FV5A 4H3PA 3M1SA 4PTEA 4R7HA 3VS3A 5BNJA 4BIBA 3KFAA 5GZ9A 3MH1A 3WF6A 1FMOE 3ZLSA 3CTQA 2J5FA 3OY1A 4AA5A 3VJNA 4O2PA 5E1SA 2ESMA 4FSNA 3EZVA 2VWVA 3W2QA 4GS6A 3QX2A 4JIKA 4YGAA 3SVVA 3VQHA 4BDJA 3C5IA 1JKSA 4RWIA 3L8PA 4K8AA 4ZTRA 2JKOA 1URCA 4EHVA 4UALA 5T3QA 1H27A 3C7QA 3I6WA 3EKKA 3QCSA 3FJQE 2J51A 4EQCA 5EW3A 5AP3A 3ZFXA 1CSNA 5EQPA 2A27A 3ZSHA 5JFSA 3NCZA 3K3IA 1R0EA 4QMMA 4FVPA 3PPZA 4XG6A 5DHJA 1M7QA 5HESA 2IG7A 2J0MB 3LAUA 4PPCA 5CU0A 3P7CA 4NEUA 2YWPA 2PVNA 4U44A 4FZFB 3THBA 5LVMA 2WZJA 2R64A 1O9UA 3C4XA 1OL6A 4V05A 2WTVA 3R9DA 5KMIA 4FEUA 4IADA 4YTIA 3K54A 3R83A 3ULIA 3VBVA 4FGRA 3RMFA 3D2IA 4FT5A 4FSRA 4HNFA 4ERKA 3HV6A 1CDKA 1Q99A 4PL4A 3UJGA 2OXXA 4EOIA 3LLAA 3TM0A 1JKLA 3GU5A 4C3PA 4M97A 1LUFA 4AQCA 5IH5A 3DK6A 4RJ4A 5KKRC 4UX9A 4ZSEA 5CEPA 2IJMA 2RG5A 3I60A 4FODA 4KIPA 4YTFA 2XS0A 2F49A 3QD0A 3Q52A 4RVLA 4MTAA 2QR7A 1SZMA 3LCOA 4MD8E 2BALA 1XHAA 5DGZA 3PXRA 4E1ZA 2QQ7A 3WZDA 1AD5A 4II5A 3SKCA 1Q3WA 4BYIA 5HCZA 4DC2A 3FDNA 4H3QA 4DN5A 3FMNA 3CKWA 3HX4A 2VNWA 4RJ5A 3ZBXA 4C3RA 4ENYA 5M4UA 3VAPA 3QQUA 3BZ3A 3OWJA 2C69A 3OCGA 4IWPA 1U5RA 3HV7A 3UPXA 5IEXA 2QOLA 3NNWA 4ZXTA 2HK5A 3VRYA 3O2MA 4FTLA 3MPAA 4IVBA 4FI1A 4EONA 4CD0A 5E8YA 2PVHA 2RGPA 1JSUA 3VS6A 4ZOGA 3E92A 1I09A 2BILB 1STCE 4OR5A 4H1JA 3CD8A 4TNBA 4WG3A 2BDWA 3IOPA 2A4LA 4RC3A 2J0IA 1FBNA 4GFOA 3CQWA 3TZ9A 5CSWA 2XKFA 2X9EA 4F7JA 3K5VA 5AP7A 3ODYX 1CKJA 2ACXA 1K2PA 3LM5A 3CGOA 2G9XA 3DJ7A 3R8PA 5EYMA 3B8RA 1YOJA 4LOQA 3VBYA 2YLFA 3NAYA 1J7UA 1BI8A 4PWNA 4C62A 3TDVA 3TNHA 4D55A 2XEYA 1XJDA 3OOGA 4DFUA 5JKGA 4I6BA 5AEPA 3ZSIA 2CCHA 3HEGA 1H25A 4APCA 5DR2A 3G0EA 5HNBA 3T8OA 2GFCA 4RT7A 4GW8A 3NEWA 2YJSA 3OUKA 4NFNA 2VTHA 5M4IA 1J7IA 2VTSA 3CPCA 1JWHA 2HW6A 5L4QA 3MTFA 3RBWA 1IA8A 2I0EA 3FKNA 3FXWA 2XYNA 3DLZA 3FZRA 4RFMA 3TL8A 3FPQA 1HCKA 2QKWB 4TYHA 5K0KA 4AU8A 4Y5HA 4H05A 4JDKA 3KXHA 4A07A 4X2FA 2YM3A 4GJ3A 5EM5A 4MF1A 1CM8A 3EMGA 1MQ4A 3UVPA 4ID7A 2WTIA 4UYAA 2BR1A 4YJOA 3GI3A 3U6IA 1REKA 4MF0A 1QCFA 5EDRA 3KXXA 5L3AA 4KKHA 3V04A 4RJ6A 3F5XA 2PZIA 3ANQA 5E8UA 4IANA 4KS8A 3VULA 4E6QA 3ATSA 4CMOA 5DNRA 4FF8A 4EOPA 2WTKB 2OF2A 3KRLA 2EB3A 2GS2A 5DPVA 3V8SA 4QT1A 4U80A 3QUEA 3R7UA 3BLQA 4R7BA 2VTOA 5TT7A 2PZ5A 2O8YA 4DTAA 5CNNA 2IN6A 3LHJA 4GK2A 3E7OA 3BU5A 4GH2A 3IDPA 3BWFA 2ETKA 3A4OX 3MDYA 5FM2A 4GKHA 4O7LA 5AM6A 5FD2A 4HGEA 2C6EA 3HECA 5FXSA 3VN9A 2B9IA 3AG9A 4IACA 4QMUA 4L46A 4EJNA 3ZUVA 5CF8A 1RW8A 2R0UA 2OO8X 3BEGA 3HKOA 1B6CB 4Y8DA 3U9CA 3MTLA 5AV4A 1PKGA 1TQMA 4ZSGA 1OUYA 2Z02A 4FTKA 4AGDA 3PJCA 1PRYA 5C8NA 2ITVA 4HVIA 3GCUA 2HW7A 1JSTA 3ULZA 5M53A 4OUCA 4HPTE 3E62A 4CV9A 4KSPA 5FTOA 4U81A 3PFQA 4XV3A 3TI1A 2OGVA 2QVSE 3BE2A 1GAGA 1UU7A 4N6ZA 3A8XA 2ERKA 5AM7A 3I81A 3DNEA 3TIZA 4BCIA 3COIA 4JX7A 4EYJA 3F2AA 2WELA 3MIYA 4FTIA 2R3RA 5IQBA 2W4JA 3HMPA 4L3LA 5D7AA 2YHVA 4QMXA 1RQQA 3PVUA 4FV2A 3S3IA 4U43A 3WF5A 2WHBA 4KBCA 5CAQA 4ZSJA 4NJDA 2XM9A 2I7QA 5HEZA 3R8VA 4DFLA 4LMUA 4L8MA 3UOJA 1KSWA 2X39A 3ERKA 3I1AA 3CIKA 5A54A 4HYSA 1SNXA 4MXZA 2PMIA 3BV3A 4HCVA 5JQ5A 4XP0A 2B53A 2XB7A 2XKCA 1YOMA 3QX4A 3KMUA 3ZO3A 4I5HA 3V5JA 5B7VA 5H2UA 1V0PA 3OCBA 3F3ZA 3H9OA 3QA8A 4BBEA 3QC4A 4FEQA 3WF8A 4ACGA 2FH9A 4KAOA 5LCJA 4FICA 1DI8A 5FEDA 3ZXZA 4XG9A 2JIUA 3NIEA 3GENA 2B4SB 5A6OA 4OBOA 5M09A 4B4LA 4QYHA 4DFZE 4UWYA 3CGFA 2WEVA 2W99B 4MKCA 4CTCA 1PY5A 1W7HA 3EN6A 2A1AB 2EB2A 2BZHB 3FLNC 4O1OA 3KKVA 3R7EA 4PTCA 5TE0A 5I4NA 3GCPA 1W82A 3GEQA 4YC6A 4RIYA 1YDTE 1XH6A 3OEFX 3QUDA 5CVFA 4DGOA 4LRJA 3MFRA 3N9XA 4BTJA 5K9IA 2CKQA 4MBLA 5CU4A 2PVFA 4OAUC 5DMZA 3EQBA 3Q96A 4GFGA 5CENA 5HKMA 3VS5A 5BQ0A 4NL0A 5JRSA 4FKUA 5IA2A 5EK7A 4AACA 3E3BX 4F1TA 4Z55A 4AOJA 4BBFA 4APPA 2W1CA 4AZWA 4O0XA 4C37A 4JQ7A 4FSUA 5KHWA 3R63A 4NJ3A 4BB4A 3UNZA 4A9UA 5CF4A 1KE5A 3EL8A 4ZTQA 4R5SA 3FZTA 4FSZA 3HAVA 2CKEA 3MJ1A 3PJ3A 5AA8A 2PVJA 3UBDA 4TNDA 3HMNA 2PUPA 2PWLA 1MRUA 5J8IA 1UNGA 3DQWA 3DBQA 3RI1A 3TJDA 1O6YA 5E4HA 2W05A 5HO6A 3HP2A 3UIUA 4BTFA 5IZFA 3BEAA 4WD5A 4ONAA 1CTPE 3F3WA 4ZSLA 3WZKA 4NIFA 1Y6AA 2Z7RA 4XOZA 2VTNA 3R04A 4Y95A 3VS4A 3LXLA 4ZK5A 2XNNA 3W2OA 3LIJA 5IQIA 5HG7A 3VF8A 4MCVA 2ITQA 5FXQA 3FEGA 5HGIA 4FKWA 5B0XA 4CFUA 1V0BA 4RSSA 4TYHB 3UZTA 1YXXA 2IZUA 2W5HA 3PVBA 4KNBA 4TZRA 2C5VA 4A9YA 3FL4A 3ID6C 2PVLA 5M07A 5CEMA 3OG7A 2YAAA 1OKZA 3KA0A 1Q24A 3ZBFA 2LGCA 4JG8A 3PY1A 4L44A 2YLEA 4IAIA 3FHIA 5J9ZA 5K5XA 4I5PA 3VRZA 2O63A 4C59A 3DZQA 2W1EA 2ITZA 5LVNA 3EZRA 3Q9WA 5EQYA 5AJQA 2ITOA 5AAEA 3L8VA 5CU2A 4J52A 3LFDA 4L7FA 5B2KA 1PJKA 4PL3A 4BKJA 1Y91A 3R28A 2UZWE 1ZLTA 4H36A 4XX9A 4IX5A 5DT3A 5AUVA 2IW9A 3TACA 1U46A 2VUWA 4PMPA 3LM0A 1WFCA 2VD5A 3FKLA 4ASEA 3F7ZA 3V5LA 4FTJA 4NM7A 3QZFA 4OGRA 3PVWA 4BWKA 4U7ZA 1PKDA 2VTTA 3D2KA 3QRIA 4O86A 1WZYA 1ZMVA 3LW0A 4HCTA 4M13A 3LMIA 2O5KA 4G17A 3PLAE 3EN5A 3UNKA 1MRYA 3CJFA 3KRXA 4LRKA 5F9EA 4O21A 2ETRA 2H6DA 3JXWA 5HBHA 4HZRA 5HHWA 3DOGA 4RPVA 1SVEA 1P4FA 2JAVA 5A3XA 2PPQA 4O7WA 1SM2A 4O0VA 2AYPA 3CS9A 2QODA 4X3FB 4I92A 5HE1A 4V04A 4Q9ZA 2VTRA 3RM6A 4I5MA 4R1VA 4I24A 3NNUA 3ATTA 5BYLA 2X9FA 4CT1A 4X6RA 1E1XA 3EQGA 4K18A 4LV5A 4E3CA 1H00A 3O51A 2PVKA 3PY3A 3BWJA 5HE2A 5IQCA 2YABA 5EM6A 3TZ7A 4O7NA 1YXVA 4FX3A 4C2VA 4AW5A 3HAMA 4I23A 4YMJA 3AXWA 3FWQA 4CKIA 3W2RA 4C0TA 1BI7A 4R6VA 4RJ8A 3OUNB 1XBAA 3WOWA 3BELA 3EQDA 3C1XA 1PXMA 4NWMA 3BRBA 4XP2A 4U3ZA 4D1ZA 5LXMA 2WEIA 3K5UA 2XK3A 3DJ5A 2YEXA 3QL8A 3TNPC 4ANQA 5FEQA 4MNEA 1IR3A 3W10A 2I0VA 4C02A 4UMPA 3QCYA 4O91A 1H1RA 4QO9A 5JZJA 3PY0A 4QPSA 5E92A 3S2PA 4B99A 4X3FA 3U55A 3FC2A 4TWPA 3SRVB 1PXKA 4BWPA 5FDPA 4O22A 3FV8A 5IA1A 2IW8A 4IM0A 3RGFA 5CU3A 4ALWA 2I1MA 5CSHA 3DGKA 5FDXA 2HYYA 4JRVA 3EYGA 4C4EA 4FYNA 2HELA 3C13A 3NUAA 2QI8A 5BUIA 4LMNA 3ENHA 5DG5A 4ZS0A 4F6UA 3QKLA 4TYJA 3OP5A 4FV0A 4QMTA 5DT0A 4FL1A 4GCJA 4J8MA 4E8AA 4F9BA 4IC8A 2UW7A 5HQ0A 4G6LA 4JS8A 3QTRA 4UWBA 4FKIA 4B0GA 3D5UA 3IK3A 5FP5A 4TKSA 4USEA 4F7LA 3CP9A 2IWIA 5HLNA 5ANKA 2Y0AA 4UXQA 4DFXE 3PXQA 1P5EA 2R5TA 2GNIA 4O0SA 4RFYA 4FTOA 4YJVA 5HIDA 4CEGA 4DG2E 4IWOA 4G3CA 4MQ2A 5DRBA 2W96B 2BKZA 4DEAA 4NW5A 4NH1A 3E88A 1OBGA 3IGGA 2VTMA 4C38A 4FUXA 3W2SA 4WRSA 3COHA 2C6MA 2RKUA 3ACKA 4Y46A 3V3VA 4D0WA 2V7OA 4MX9A 4GL9A 4BVUA 4HW7A 4F0FA 1JOWB 4F6WA 2H96A 3COKA 5HTIA 3IG7A 4LGHA 4MXOA 1IAHA 3QHRA 4BCPA 5BVNA 3TIYA 4S2ZA 3QRKA 3UZRA 4G9CA 3CKXA 4U79A 4QP8A 2JIIA 2FO0A 3B2WA 3BQCA 3FMDA 2GNLA 3IW4A 3NW5A 5EQEA 1YXTA 5FEEA 4BY9E 3VBTA 1HOWA 5CASA 5LVOA 2J90A 3ETAA 2CDZA 5BVDA 3WARA 1HCLA 4IQ6A 2XF0A 3FMJA 2J7TA 5JRQA 3Q4UA 3RPRA 3RAIA 3F2NA 1W0XC 3OCTA 4IDTA 4QMNA 4ZTHA 4XRLA 3EQFA 2QURA 4XYFA 2X8EA 3VHEA 3DK7A 2VO0A 4DEBA 4ZLOA 4BCQA 5KBQA 3EN9A 3C4WA 5HIEA 4U97A 3S0OA 3V5TA 2W1ZA 3GCSA 4L6QA 5CQWA 2ZMDA 2WQOA 4E6AA 3BCEA 3LOKA 3R71A 4RMZA 5EOLA 4ZLZA 2JBOA 2VTQA 4NTSA 5BUJA 4M0YA 5H3QA 4TRLA 5L2QA 5C4KA 2UW9A 3IW7A 5E8VA 4FIJA 2FSMX 4JG6A 4E5AX 4KRDA 4FKOA 3UIBA 2BIKB 2YCRA 4FKJA 5F20A 2W1GA 4G6OA 4Q9SA 5C03A 2A0CX 3D4QA 4C58A 3NRMA 4PRJA 4F7NA 4PX6A 5IF1A 5G1XA 3IECA 4G6NA 3FBVA 3R2YA 2VAGA 3F6XA 2ITPA 4GT5A 3ZLXA 2WQNA 4FV3A 3U4WA 3DJ6A 3VS7A 5IQEA 4LI5A 4WSQA 3VBWA 4BFMA 2VX1A 1F3MC 4KD1A 3Q4TA 2PMOX 5DEYA 3CEKA 5A4EA 1LPUA 2FUMA 1WBOA 3FSFA 2HZIA 2VWZA 2PMNX 4OTWA 4O1PA 4YNOA 3A7GA 3WZEA 1JPAA 2WO6A 3N51A 4X2JA 4AOIA 1OPLA 4YJRA 2XK7A 2XNBA 2ITXA 4FTAA 4JJRA 4XV9A 3IOKA 2F2UA 4RJ7A 1W83A 3W8LA 3ZOSA 5CQUA 3G33A 2YISA 5AR2A 1GIJA 4UXLA 4DCEA 4TYIA 1ZYCA 4HCUA 3UYSA 1AQ1A 2UW0A 2H9VA 3A60A 2O65A 4AT4A 4D2WA 1YWNA 1OPJA 3SA0A 3DCVA 2IVUA 4K2RA 5E8TA 1URWA 4RIOA 5GNKA 4F0IA 3PZEA 2OBJA 3U51A 4OTGA 3TG1A 4DT9A 4K9YA 4DHFA 4F09A 5BVKA 4BDCA 3GQLA 3KXZA 3PRFA 1REJA 1PXOA 4FV9A 3VBQA 5CEOA 2ZYBA 2QOHA 1Q8YA 2QHMA 2Y7JA 3F5UA 3Q6UA 2FB8A 1NVSA 3HV5A 2QNJA 1XBCA 2BRHA 3VF9A 2BRMA 1ND4A 3G6HA 3W1FA 4YBJA 3TUBA 5KMLA 2WOTA 3I5ZA 5CEIA 1IASA 2GS6A 3QKMA 4QQTA 4DG0E 2PY3A 4PPBA 3E93A 2OW3A 3O8UA 4R77A 1KWPA 2UVZA 2WOUA 4EOOA 3PWYA 4LRMA 5FP6A 4KB8A 2GS7A 3PZHA 1R39A 4AGUA 2OJ9A 3MB7A 4USFA 5CS6A 1UNLA 5FTGA 4DAWA 3I6UA 5JEBA 3R2BA 3P7AA 4IC7A 3V8TA 4BCHA 2V62A 5AX9A 4CYIA 4O6EA 3UQGA 5BVEA 4DT8A 2DS1A 5FLFA 4NFMA 4AXAA 1TQPA 4C4HA 3BBWA 1UU3A 4Z9LA 3FKOA 3ZRKA 4EC9A 4IVCA 4AGWA 1FINA 4BDGA 4K1BA 4YR8A 2ZB1A 3TT0A 1K3AA 5IMEA 3S4QA 5ITAA 2X8IA 4XJ0A 2B54A 5HX8A 1WBPA 4XBUA 4FSTA 4HYHA 5K0XA 2Y6MA 3FLYA 3FZPA 3GU8A 4BTKA 3EWHA 1E9HA 3KCKA 3DY7A 4L43A 4WO5A 5AIKA 3QA0A 4Y5QA 2GNFA 1J3HA 5BUEA 4RC4A 2ZVAA 5D10A 4B7TA 4MK0A 3R0TA 4IH8A 4RX8A 5ETAA 3BHYA 1CKIA 4LG4A 5A4CA 5LVPA 4XP3A 3PIXA 4O0RA 3FY2A 4C35A 4MAOA 4QMPA 1A9UA 3GC8A 4KINA 4E93A 4EWHA 2WTCA 1ZMUA 1KE6A 2XJ2A 4S31A 4EHZA 4UZDA 3NX8A 4IEBA 5J79A 4MD7E 1ERKA 4A4LA 1H0WA 4D5HA 4O6LA 4RA5A 3Q9XA 2XIRA 3NYVA 4Z16A 4C3FA 3DAEA 4FG9A 3UP2A 4EYMA 3RHKA 3AGMA 3V6SA 3LCTA 1PXLA 2WAJA 5JSMA 4RX9A 5KNJA 4U3YA 3MFUA 1OL2A 4V01A 4B6LA 4D2SA 4IB1A 3PPKA 4E4XA 2UZVA 4M8TA 2WIHA 1P14A 3IW6A 3JVRA 3HV4A 4BHNA 5A4TA 4EH4A 3LMHA 1B38A 2UZOA 3BIZA 4AA4A 4LUDA 3H30A 4CNHA 4EJ7A 1XH9A 4PF4A 3IO7A 1OUKA 4PUZA 4ANNA 4PDSA 3BX5A 4YC8A 3WZUA 4B8MA 5CSPA 3LJ0A 3IDCA 3HA8A 4UV0A 4M69A 4FV4A 3GGFA 3Q32A 4M15A 3MPTA 5DVRA 1NT2A 3WZJA 4FKSA 4TY1A 4U0IA 3VC4A 5J5SA 1MRVA 3O7LD 2PL0A 4EH2A 2WMBA 4AX8A 2ZM4A 3HUBA 3CR0A 5KZ0A 4A9SA 4ZMEA 4WG5A 3EFLA 4G1WA 3HMOA 1PMEA 3D14A 2C5OA 4J71A 4EOSA 3F2RA 4NZWB 1VJYA 4BCKA 3KF4A 4R1YA 1OVEA 5IPJA 3EQIA 3E7VA 4F1MA 4RIWA 3NW6A 1ZAOA 3Q5ZA 3QXOA 1H1SA 3ACJA 5BX0A 2YM5A 5JQ8A 3DDPA 2OXYA 1OITA 4EZ5A 3FXXA 5EI2A 2R3HA 4JRNA 4WUAA 3ZRLA 5CZIA 3PXKA 4E4NA 4FV1A 2YDIA 4YNEA 4DEEA 3QD3A 3O50A 3GU4A 1BL6A 5JH6A 3UC3A 1R1WA 4A9TA 3ANRA 1OL5A 3DDQA 4WBOA 3Q2JA 2C3KA 3EQRA 4RJ3A 3RALA 3DNDA 4U41A 2Z2WA 3FYKX 4O7ZA 4IWQA 3ZZWA 3WIGA 5EW9A 2Z60A 4XCUA 3ENMA 1XR1A 3UG2A 1UVRA 2W9ZB 2YIRA 3UGCA 2OFUA 4I1ZA 2HZ4A 4EBWA 1F5QA 3NUNA 4LL0A 2WFYA 2NRUA 3OTVA 1UV5A 4AW0A 3LFNA 4QTAA 4DGNA 2VX0A 2WQMA 4WBBB 3Q9ZA 3ALNA 1FPUA 4FC0A 1YOLA 3DBCA 4FT9A 2OJIA 4FTCA 3B8QA 3S1HA 5EYCA 2R3QA 2XK6A 2YIYA 5KMOA 4Z7GA 1U54B 4BF2A 5M4FA 4ZMFA 3ET7A 2OICA 3D7TA 2YN8A 5DRDA 3A7FA 4O38A 3PSBA 1B39A 1GNGA 3E64A 5AUUA 3MB6A 5AR3A 4C36A 5HORA 3AOXA 3QTZA 5AFVA 3ODZX 1GZ8A 4HPUE 4M12A 4YLKA 3PLSA 4LQMA 5EHOA 5GJGA 3VUGA 3BYUA 4E20A 4EOMA 2GTNA 4WHZA 1YXUA 3E8EA 1VYZA 4RWLA 5IMXA 4O81A 2ZAZA 4E5WA 3JY0A 4U8ZA 1K9AA 4FVRA 1WBNA 3SW7A 4R3CA 5IA5A 3LJ2A 3LXPA 3QF9A 4FV6A 2BAJA 5M44A 2GU8A 2HXLA 1NW1A 2UW5A 4K11A 4G3DA 3VS1A 4N0SA 1H08A 4ZTMA 4WIHA 3RP9A 2FSOX 2P0CA 3O7LB 3C0IA 4FIHA 3JVSA 4FKLA 4KKGA 4BGQA 3PWDA 3GU7A 4L53A 4FNZA 4IZ7A 1UNHA 2P3GX 4QTCA 3NS9A 4M3QA 1MQBA 4YSJA 5BMSA 4EH8A 4XRJA 2QOKA 4MXXA 3C50A 3OWKA 5I9ZA 4G9RA 2SRCA 2RFSA 3MY5A 2IZTA 3GUBA 3CSVA 2FA2A 4QQJA 2NP8A 2PUUA 1LP4A 3TUDA 5HD4A 2HENA 1W84A 3NYXA 3DLSA 3ZYAA 4LOPA 1JAMA 2RF9A 3RM7A 1E1VA 1H01A 4DFYA 2F2CB 4QMOA 1YI4A 4HGLA 5GINE 3ZRMA 3NNXA 3NYOA 3ZDUA 3L9PA 4G3EA 4XLVA 3MVHA 5EKOA 2VWIA 4EOQA 2P33A 3A7JA 4OLIA 1S9JA 2ETMA 4GEOA 4UB7A 4NCTA 2ITWA 4HZSA 4M67A 5GJDA 2PSQA 2DYLA 2I0HA 4L9IA 5C27A 5TF9A 3NCGA 2QO2A 3TDWA 2QOOA 4BYJA 2C6LA 3GVUA 4QMSA 4CRSA 4F9YA 2F57A 3BGZA 3UOKA 3OC1A 3F66A 2WTDA 3FLWA 4FL2A 2UZNA 4D28A 3GFEA 5GIOE 3OW4A 4MH7A 4UMQA 3DAJA 4H3BA 5D41A 3VBXA 5LVLA 2WMUA 4USDA 3ZDIA 3A8WA 4YP8A 4MBIA 1WMKA 4QNYA 4XEYA 5IUGA 5AV1A 1JBPE 3DXQA 4CGAA 2QO9A 3ELJA 3PA4A 3AMYA 5C8MA 2EXCX 5L6WL 4AAAA 3P86A 3JR1A 3E8DA 5F1ZA 1TQIA 3L1SA 4JBPA 2HZ0A 2XYUA 3F9NA 3ZLYA 1DAYA 3HMIA 4CG8A 4YURA 2PTKA 3OBGA 3Q3BA 4K33A 4BCOA 3H0YA 3OT8A 1TVOA 2VTJA 4F63A 4FA2A 2O64A 2Y4IB 3QCQA 3UZPA 2AUHA 3GCQA 4N6YA 3LE6A 4GSBA 3UG1A 3TKHA 4MWIA 3F61A 2WTWA 2YDJA 5CWZA 3SLSA 4O84A 3IPHA 5AP5A 3UOLA 4DGMA 4NW6A 3JY9A 3UIXA 3L8SA 3L8XA 4C61A 4MNEB 5F94A 4J53A 5BVFA 3VIDA 2BAQA 4DEIA 1TKIA 2C6KA 3GP0A 5EDPA 3DS6A 4X0MA 5CAUA 4E4LA 4L42A 4R7IA 2VX3A 3UOHA 2AC5A 1H1PA 4GIIA 4A06A 2GNHA 2W5AA 3RCDA 3ZUUA 2GQRA 2BROA 2YA9A 2XRUA 3Q2MA 4FBXA 3VUHA 2XCKA 2VWYA 3BBTB 3CBLA 2ZV9A 4GK4A 3AT4A 4EZ3A 3UQFA 4E73A 3EJ1A 4PTGA 4GVJA 4M68A 5FG8A 2IVTA 2R3KA 3R6XA 4FNXA 3BE9A 3O8PA 3GB2A 2PUNA 4TYEA 2C1BA 1OECA 5HTCA 1G5SA 3IS5A 2RFDA 4WNOA 4MNFA 3ZU7A 3W2CA 4BCGA 3II5A 3HL7A 4CLIA 2NO3A 4JI9A 4RRVA 5KO1A 1T46A 3LZBA 4EK3A 2OXDA 3LCSA 4RWJA 3SXRA 4PNKA 2IW6A 3I5NA 4FMQA 4IDVA 4LL5A 4IJ9A 2VTIA 2Y8OA 2OF4A 1OL7A 3QGWA 4RBLA 4EBVA 3VJOA 4RX5A 3FZOA 3SDJA 5EI8A 1BL7A 4GKIA 4BIDA 3F69A 3AD6A 4NK9A 1UU9A 2WMSA 4MXYA 2OH0E 4GUEA 4ASXA 5KCVA 1Q41A 3HGKA 5M06A 4CMUA 3GT8A 3KGAA 2CNQA 4ITJA 2JGZA 4D2PA 4ACHA 2J50A 4C4FA 1VEBA 1PXJA 2FVDA 5CI7A 2HWPA 5DIAA 5T6KA 5CNOA 1YW2A 2JFMA 4CT2A 2BDFA 3QQFA 5KMKA 2C30A 2W4OA 3BU6A 3RK9A 5KX8A 4OAVB 5LCKA 2UW4A 4AW1A 4LOOA 5M55A 1GZOA 5GHVA 4EK5A 3C4ZA 3CY2A 4U6RA 1CMKE 3R9HA 3TEIA 5HTBA 3P7BA 3VHKA 3NLBA 5I3OA 4GG5A 3F3VA 1ZYSA 3PIYA 4ALUA 5HO8A 1UA2A 1ZRZA 3SOAA 4YC3A 1S9IA 1FMKA 4QP1A 2GPHA 2QU6A 2VNYA 2W17A 4XHKB 5DT4A 1JKTA 1OL1A 1LEZA 4F70A 3DQXA 4DEHA 4FL3A 4ZEGA 3I79A 3LCDA 1H24A 5CSXA 3KVWA 2PVRA 4OTIA 1YWVA 2ZDUA 5H9BA 5HE0A 2P2HA 3A2CA 2BKKA 4QMVA 3GC9A 1ZYLA 4RFZA 4YZCA 2Z7LA 3PG3A 2IO6A 4A9RA 2I6LA 1M52A 4L00A 3R7VA 2PU8A 4AT3A 4EORA 3C51A 3O0GA 3B2TA 3K3JA 1J1CA 2CGUA 4GU6A 5T68A 4EHEA 4LGDA 3DKOA 1Z5MA 5ANDA 2VRXA 1PYXA 4I21A 2PVMA 5HZNA 2CHLA 1UWHA 4FZAB 1V1KA 4DH3A 3V5PA 4RLKA 4OTPA 4FSMA 3F3TA 2R7IA 5BVOA 2CJMA 3GC0A 2CLQA 5AP6A 2Q0NA 2E9UA 1FGIA 5J87A 3D5WA 3P23A 2JLDA 3FXZA 3SQQA 5IUIA 2OZAA 3QQLA 5IDNA 3QYZA 2QKRA 3QCXA 3VW6A 3SD0A 5DE2A 3I7CA 3AC4A 2B9HA 3BGPA 2QONA 3KEXA 2BIYA 3DKCA 3LFAA 4D1XA 5KMJA 5I9XA 1OKWA 4ZY5A 4Y83A 2VWWA 2ITUA 4JAIA 5D9HA 4XV1A 4FT3A 2QOIA 3KULA 3V5WA 4BN1A 5IQHA 4S34A 3ORLA 4DGGA 2FGIA 5AR4A 5DR9A 5G6VA 5J7HA 4AN2A 2CLXA 2BAKA 3F5PA 2HOGA 4HVSA 4L3JA 4KUJA 1WBWA 2X2MA 3LJ1A 3PPJA 2ZJWA 3QTWA 2NPQA 2FSTX 1U5QA 3WE8A 1UKHA 2CKPA 2IZRA 1LEWA 4I93A 5HVJA 3S95A 3PXYA 4G3FA 4EOLA 3IW5A 3NUYA 5DYJA 3POZA 1SVGA 3QQJA 2HWOA 5AV0A 4M69B 1Q8UA 3FLZA 4DLJA 3MPMA 3SRVA 1OIUA 3PXFA 3QD4A 5KZIA 5KMNA 2P55A 1NXKA 1Q4LA 3MBLA 4O7VA 3JS2A 4GRBA 4AG8A 4FIFA 2C6DA 4XNEA 3OWLA 4F65A 4RZWA 4QP6A 4ZIMA 3PUPA 3HDMA 2JKKA 4FK6A 4ZY4A 3UVRA 2ITNA 4F7SA 3IONA 4PNIA 3ZLWA 4PP7A 1OMWA 4EH6A 2EVAA 4CG9A 2G2FA 3NSZA 1M2PA 1GOLA 2R3FA 3QALE 4JOAA 5KMMA 1R3CA 2C6TA 3NW7A 4F9WA 5HVKA 4R5YA 1J91A 1PMNA 5BMMA 4X21A 2QHNA 4G2FA 2VN9A 1G8AA 4GMYA 4D58A 5GZAA 2WTJA 1ZOHA 2WQEA 4AFJA 5CAOA 4JVGA 4BGHA 4I0TA 2V7AA 3ZEPA 4V0GB 3TV6A 1QPJA 5L8JA 5F95A 1H26A 4S32A 1PXPA 5M56A 1ZYJA 3E5AA 2PE2A 3T9TA 4GYIA 4JNWA 2WGJA 4RVTA 5AUZA 4XS2A 3DT1A 1QPDA 3OXIA 4XBRA 2YCFA 1ZMWA 3TN8A 2QC6A 3R1QA 1OGUA 5DEWA 3BU3A 3COMA 2PVYA 5AUYA 3PP0A 4F9AA 5LMBA 5EDQA 3NUUA 4UWCA 3M42A 2ZMCA 1NVRA 4ZLYA 4X2KA 3UMXA 3R9OA 2I40A 3G51A 3NWWA 3QLGA 4WKQA 3OBJA 3UO6A 3OEZA 5K3YA 4IZAA 5J95A 1ZY5A 4IX3A 2R3OA 3QXPA 1KE8A 2QU5A 3NAXA 4NM3A 3R9RA 2QLUA 3AC3A 4YJNA 2X7GA 3REPA 1UWJA 5A9UA 3PJ2A 3FZSA 4WOVA 2RL5A 2W4KA 3QU0A 1OZ1A 4QMLA 4BI1A 4C7TA 4DH8A 3KREA 3QFVA 4LM5A 4O0UA 4O83A 3FQSA 2XNGA 3IDBA 4FKVA 5IQAA 5HBJA 1WBTA 2BZJA 2YERA 3CY3A 3HA6A 2C3LA 4FKTA 4O27B 4AZSA 4BDBA 3CE3A 5L2IA 1GIHA 4PL5A 2BTSA 3O96A 5FGKA 4BKZA 3OS3A 5EM8A 1H1QA 3HV3A 2XNEA 4FKGA 4MXCA 5DA3A 4TL0A 1BMKA 3GU6A 1GIIA 1ZOGA 3EL7A 3MESA 1KE7A 4UBAA 5ETFA 5D1JA 2REIA 5E8WA 3FLQA 3H0ZA 5DBXA 5JN2A 3KRJA 4X7QA 4D9TA 3KXMA 3OROA 5H8BA 5IH4A 3O71A 4L45A 2GHGA 4EK6A 5FXRA 4BDKA 3IW8A 4QPAA 1BLXA 3BV2A 4XUFA 1OKYA 1SMHA 2X0GA 4ARKA 3JUHA 3LCKA 1RE8A 4EKKA 3FPMA 5ACKA 4AA0A 3AC8A 2UZLA 3KVXA 2DWBA 3U8WA 2C5YA 4BDEA 1V0OA 3HZTA 3QD2B 2C0OA 1OIQA 3D7TB 4CQGA 3MN3A 5HCYA 4I94A 4IX6A 3FMMA 3EH9A 3QWJA 1X8BA 1U54A 4FTUA 4C8BA 4CFWA 4JG7A 2C3IB 4W4WA 4J8NA 5AIRA 3KMWA 1M2QA 3HRCA 1Q8WA 3POOA 4G34A 4O7YA 2C5XA 2ITTA 4IIRA 4OTQA 4BZOA 4F64A 2XA4A 4P90A 3F3UA 4TPTA 3RAWA 3EB0A 4FTQA 4P5ZA 4QMZA 1GJOA 2Z7SA 3Q5IA 4JAJA 3P9JA 3MY1A 4LYNA 4ACCA 4ZSAA 1L8TA 4N70A 3RPOA 3RHXA 4R8QA 2WMQA 5IA4A 4BCNA 5JZNA 2WMXA 3C0HA 4QYEA 4YJQA 5HLPA 2W1IA 5IG1A 5HG5A 2O0UA 1BKXA 3CJGA 4M0ZA 2PUIA 4D2VA 4ZTLA 4U9AA 2X8DA 1DS5A 4NTTA 3FMKA 4PV0A 3KY2A 2QR8A 3AD4A 3PIZA 4O7RA 4OTDA 4W9WA 4ANBA 3MIAA 1H28A 4O82A 3OT3A 3QRJA 1WAKA 1XH7A 3EFKA 2IVSA 2BFYA 4GT3A 5CY3A 2CPKE 4EK8A 3LQ5A 4BCFA 5ETIA 4RIWB 2B52A 3W33A 3QLFA 4AT5A 1Q62A 4FIGA 1G3NA 2HZNA 2BCJA 5I9UA 4C57A 2OZAB 4C34A 2UZBA 1YHVA 4LV8A 3QZHA 3VUIA 1M17A 3C4CA 2PZPA 3RK7A 3ZFMA 4CCBA 3MV5A 3R30A 2AC3A 1XQZA 3P0MA 4YHFA 5DR6A 4FSWA 5K5NA 4D4VA 3TUCA 1OPKA 4W8DA 3U9NA 4JDIA 3ORIA 4GG7A 3V5QA 1XH4A 4FKQA 3SC1A 3R22A 3KCFA 3ZM4A 3T3VA 4EWQA 2XIKA 4QQ5A 4YO4A 3A7HA 2OI4X 3FLSA 3NUPA 3GXLA 4M66A 4YZBA 3UYTA 3DTWA 4QP3A 3ZXTA 3U54A 4QTDA 2R9SA 3LLTA 3FI3A 3N4VA 5IEVA 4ZTSA 5KBRA 3LFEA 3V51A 1L3RE 2ITYA 5DH3A 2UZTA 5CALA 3ORMA 3OXTA 3FZ1A 3C4FA 3R00A 3G90X 2WPAA 5BVWA 1BUHA 3TCPA 2Q83A 2WNTA 2XMYA 4M7IA 4YJSA 3UO5A 3IGOA 3KN5A 2P2IA 3QUPA 2X2KA 3HDNA 3ZO2A 5LQFA 5HI2A 3NYNA 5IDPA 1Y8YA 5DN3A 5CLPA 3U87A 2JDSA 5JFXA 2W1DA 4W4XA 4AS0A 4JX3A 4D1SA 3PTGA 4TYGA 5CF6A 1JKKA 4JR3A 2NRYA 4D0XA 1OB3A 3QC9A 4JT3A 5CT7A 3ZSGA 3ZEWA 4U5JA 1YWRA 2QOBA 3ZCLA 4FSQA 3FUPA 4QNAA 5GJFA 3G15A 3VUTA 3PJ8A 2R3PA 3MGYA 4G16A 3EKNA 4J7BA 4GYGA 1IG1A 4BBMA 3VUDA 4GIHA 1KV2A 3FMLA 4YLLA 3BKBA 3DTCA 3SAYA 2WQBA 3L9LA 4IAZA 4BTMA 4QOXA 5HVYA 4N57A 5FUTA 3HRBA 4FKPA 3QGYA 2VO7A 5HOAA 4O7SA 2VZ6A 2VWXA 3KF7A 4TN6A 3TKIA 2C6OA 4A4XA 3TJCA 1WVYA 2C4GA 2XK4A 1FVRA 3AT3A 3TNQB 1VYWA 2J4ZA 4RZVA 2WMTA 5JK3A 4O7TA 1YHWA 5AUTA 2CCIA 3OOMA 2YJRA 2EU9A 2BVAA 2Z8CA 3C9WA 3RK5A 3UE4A 2XBJA 2G15A 5FBOA 4TXCA 3W55A 4CKJA 4EQUA 4Q5HA 4TWOA 2JDVA 5FRIA 4A4OA 4DGLC 4NM5A 1PW2A 4O0WA 4ANLA 3D0EA 1QMZA 3V6RA 1YI3A 2WIPA 2CNUA 5CXHA 2CGVA 3ALOA 5FM3A 2CGWA 3UQCA 3PYYA 5K4JA 2YZAA 2BTRA 4MHAA 2R3LA 2JFLA 4WT6A 4ZJVA 4FEVA 5IA3A 5IA0A 2O2UA 3PE1A 4UMRA 3PJ1A 5HNGA 3CTHA 4Y72A 4FK3A 2KULA 3H10A 4RQKA 4YZMA 3UC4A 1W98A 2ZM3A 3W32A 4CFXA 4UYNA 5EHYA 3DK3A 1FQ1B 1PXNA 4BDDA 3UNJA 3A61A 3U6JA 5CYIA 5GZ8A 2RFEA 4IX4A 4FZ6A 3EN7A 2X81A 4EH3A 3NIZA 5AX3A 3TNIA 2YZLA 2ZV8A 3L9NA 4B8LA 2UZDA 3NUSA 4FZ7A 4I0SA 4RC2A 5IH6A 3SG9A 1KOAA 3GOPA 3FC1X 1T45A 4HVGA 2BHEA 2X4FA 1H1WA 1YXSA 1KV1A 2Y9QA 4HVHA 4NU1A 4ZY6A 4F6SA 2C0IA 2Y4IC 3FAAA 1YDSE 2X7FA 4DE4A 3QQKA 3DB6A 4JBQA 4F1OA 2OFVA 4WA9A 5CF5A 3SGCA 4CZUA 1DI9A 2EUFB 1Z57A 4YJTA 2JD5A 2UZEA 2XIXA 4AN3A 2F4JA 4D9UA 3DKFA 2PHKA 3GC7A 5IU2A 4FTMA 4E6CA 3MSSA 4JQ8A 1A48A 2R3IA 2B1PA 4FKRA 5ANEA 3UPZA 5B2MA 5HCXA 1Y57A 3A7IA 4B9DA 5JGAA 3GNIB 1WCCA 4G3GA 4EH5A 5A4QA 4QMQA 4ZZMA 2HAKA 4EK4A 2G2IA 4FIIA 4KS7A 4HJOA 3NNVA 3OCSA 1NY3A 4NCTC 3G0FA 4IE9A 4O96A 1ZARA 4ZS4A 2XJ0A 4XG3A 1IA9A 2QOQA 2XIZA 3VO3A 4DH5A 4Z7HA 1XH5A 4AGCA 5BPYA 3R8MA 4X2GA 4CYJA 4W4VA 3TTJA 3SG8A 4ZJJA 3P1AA 4BCMA 3G9NA 3P4KA 5EI6A 5I9VA 2E9PA 2XH5A 3MVJA 4L52A 4NIFB 5IKWA 2B7AA 2QCSA 4DH1A 2OJJA 2ZM1A 5C26A 2I0YA 3W8QA 2XK8A 4JBVA 3DPKA 5HBEA 1WVXA 5DLSA 4R3PA 5IISA 2JKMA 2JBPA 3HYHA 4NM0A 5AAGA 1M7NA 3RTPA 3WIKA 3EQHA 5C01A 3I0QA 2XCHA 2A19B 5E1EA 2UV2A 4EL9A 4WRGA 4UEUA 4TW9A 3NZ0A 3Q60A 3ZO1A 3ZO4A 3ROCA 1Z9XA 1EH4A 2GQSA 3AMBA 3GOKA 3F82A 3GCVA 4ZZNA 4JXFA 4QTBA 3NR9A 4FT7A 3P5KA 3ITZA 2IZSA 3P79A 4ASDA 3W2PA 4YTHA 3BI6A 2NNWB 4BIEA 4FT0A 3W18A 3E63A 4FG8A 4RVKA 1Q61A 4J98A 3HLLA 4FYOA 5AR7A 3AQVA 4EH9A 1KOBA 4YLJA 4DBXA 3GBZA 4JQEA 4QMWA 3HP5A 4YJUA 3DXNA 5E90A 3CQEA 3DBDA 2XEZA 5CEQA 3ZZEA 3R8UA 4BDFA 3RNYA 4AOTA 3CQUA 4NT4A 3AMAA 2BUJA 3T9IA 4HVDA 3BLRA 4I4FA 4QRCA 4J95A 4X3JA 3SOCA 2VTLA 3G2FA 3KB7A 4BGGA 3MA6A 3BYMA 4OBPA 4K6ZA 2ONLC 5C1QB 3ZHPC 1RJBA 1Y8GA 5M51A 3MS9A 3PA5A 4DYMA 3WF9A 5E8SA 2J6MA 4WNKA 2XZSA 3D9VA 4K0YA 2WMVA 3CLYA 1F0QA 3QWKA 3VVHA 5JGDA 2WD1A 2R3JA 4JBOA 3RAHA 5J1VA 2XNOA 5IQDA 4FGBA 1RDQE 3IQ7A 3BQRA 3KRWA 2QLQA 4KIKA 5A14A 3QTUA 1VZOA 3TNWA 4XLIA 4CRLA 5I9YA 2WU7A 3SXFA 4IW0A 2VO3A 5JFWA 4BR3A 3Q6WA 4RG0A 3BYOA 3MFTA 4ZTNA 3KRRA 2C3JA 4C4IA 3BGQA 2JDRA 1PF8A 4BL1A 3AT2A 3Q9YA 3FMHA 5FWKK 5AV3A 2E9VA 4PQNA 4E7WA 3R02A 1U4DA 3V8WA 4IAFA 3PDTA 3OW3A 2RFNA 4BDIA 3U6HA 1UKIA 4I5CA 1QPCA 3VS0A 3OWPA 4CFNA 2P4IA 2R4BA 1XKKA 3MY0A 5CU6A 2HIWA 5CVHA 4EKLA 5L8LA 5CAVA 1VR2A 5E8XA 4NKAA 3FI8A 4IZ5A 4IXPA 5EHLA 5EH0A 1CKPA 3D5VA 2FSLX 2E9NA 5IUHA 4EUTA 4KA3A 3PE2A 4XH6A 1OKVA 2YDKA 3TV4A 4OBQA 4ANMA 4EUUA 4QYFA 2JIVA 4K77A 4G5PA 2E2BA 4U40A 5HG8A 4I20A 2CGXA 4KBKA 2GMXA 4KWPA 4OTFA 3UMWA 3VUMA 5JGBA 5LWMA 1FVTA 4JLCA 2OWBA 3QTSA 5AAFA 5J7BA 4RWKA 1J7LA 2V5QA 2BMCA 4BDAA 4BC6A 3ORPA 3QHWA 3LFFA 3ORKA 4PP9A 1A06A 2J2IB 2VWUA 5DOSA 1Q8ZA 2GHLA 4OTRA 4IVAA 1H0VA 2XP2A 3Q4ZA 1H07A 4YU2A 1WBVA 5D11A 3LXNA 2CSNA 5HD7A 4GU9A 3W16A 2Z7QA 4L3PA 5ETCA 3BLHA 2BDJA 2J0JA 2J0LA 2XNPA 5AUWA 5KE0A 4D4RA 2GNJA 2WMAA 2R2PA 2X7OA 5J5TA 1XO2B 1JNKA 4UZHA 3RCJA 2CNVA 3OMVA 2YWVA 3RZBA 4NYEA 3BHHA 3E3PA 3D83A 2PZRA 5ICPA 1IEPA 3DFAA 1IAJA 1IRKA 4HNIA 2R0IA 4G31A 5EFQA 5C4LA 2PE1A 2YAKA 1ZOEA 2B0QA 4UMTA 2JDTA 5LWNA 3OD6X 3TXOA 1OIRA 4BI0A 3K2LA 3WYYA 3HRFA 4RIYB 3MJ2A 2PK9A 2W7XA 2BZKB 2F7ZE 2QOCA 4LFIA 4BZDA 2R3MA 3EOCA 4MYGA 3SHEA 1W8CA 4Z3VA 2GNGA 3BPRA 3WE4A 5LJJA 1NVQA 1YKRA 5TO8A 4UMUA 2OJGA 4AE6A 4D2RA 3ZTXA 2YIWA 4LGGA 1PHKA 3DXPA 4RIXB 3EFJA 2ERZE 3O8TA 3JYAA 1R78A 2PE0A 4PDPA 3E8CA 5ANGA 2XNMA 3R9NA 4IFCA 3O23A 2R7BA 4EC8A 3AD5A 3EN4A 4ASZA 4EQMA 1AGWA 4BZNA 3M11A 2BPMA 3UO4A 4O0YA 2CKOA 3FI2A 4FTNA 4OTHA 3QKKA 3TTIA 2VO6A 1ATPE 2R3NA 5E9EA 3GFWA 3LFCA 4MVFA 2YCQA 3MH2A 3AGLA 5FTQA 4CCUA 4A7CA 5A6NA 3E87A 4CFMA 1JSVA 4AN9A 5IQGA 4MWHA 4DTKA 2XVDA 3ZONA 3LFBA 4CQEA 4FZDB 4M84A 2BZIB 3UODA 1ZXEA 3MA3A 2IVVA 2YIXA 3DB8A 4ITIA 4D2TA 3NMUF 3EHAA 4R3RA 4YO6A 3GQIA 1WBSA 4FV7A 2OG8A 2GDOA 4EEVA 1JQHA 4DLIA 5CANA 3QRUA 4ZJIA 2EXMA 2VTPA 4QD6A 1ZZLA 4I22A 5CEKA 3ZM9A 2WTKC 1YVJA 5E8ZA 5I9WA 2H8HA 4XG4A 5JFVA 2PULA 5CAPA 4CZYB 1Q8TA 4IAYA 4XG8A 2EWAA 1G8SA 2YM8A 3HNGA 4FOCA 4KIOA 4FNWA 2QOFA 2CMWA 4F08A 2HCKA 1LR4A 2X6DA 4W4YA 4I41A 2YACA 4H39A 3ORXA 4O0TA 2YIQA 2B9FA 5HU9A 3TZ8A 2WMWA 2X2LA 3KK9A 5I3RA 3LPBA 4EHGA 4J99A 4P5QA 2VGPA 4C2WA 4H58A 4IZYA 3N4TA 2RG6A 5C9CA 5AP0A 2JKQA 5AP4A 3ZMMA 3PSDA 4C4JA 1M14A 4AZVA 2UW6A 3PA3A 4S33A 1Y6BA 2Y4PA 3MWUA 2WU6A 4YZ9A 2OIQA 3LMGA 3R7IA 3ORZA 4D4SA 4E6DA 4QPMA 1OBDA 4CXAA 3I0OA 2UUEA 4LUEA 4AZTA 1FVVA 5GIPE 3M2WA 4YJPA 4JDJA 2Q0BA 3FYJX 4J97A 1UU8A
chains in the Genus database with same CATH superfamily
1YRPA 4DITA 4HYIA 3OFMA 3ZC6A 2BRGA 2QG5A 2B55A 2KTYA 4KRCA 4X2NA 3L9MA 5AMNA 1H8FA 3FE3A 5CTPA 4ORKA 3ZC5A 4QQCA 2OLCA 5CI6A 3PXZA 4ZZOA 3BYVA 3CXWA 2QG7A 2W06A 4E26A 3R8LA 4DFNA 4ENXA 3LXKA 4DA5A 3WI6A 4WNPA 3BHTA 4KSQA 4DTBA 3OXZA 3I7BA 5AP2A 5L2TA 1KUTA 4ERWA 3ROYA 2F7EE 4PMTA 3LKMA 3R1YA 4O2ZA 3QZGA 5I5ZA 3R1NA 4FE2A 4WNMA 5HICA 1QPEA 4HGSA 5EKNA 2DUVA 2UVYA 3RAKA 2UVXA 2WMRA 1PMUA 4KIKB 3G5DA 3EQPA 2IPXA 4P2KA 3CTJA 4R78A 1YQJA 2V22A 3IKAA 3JPVA 5KUPA 2GHMA 4C33A 4XMOA 2J9MA 3RKBA 2QO7A 4AW2A 1GZKA 4CTBA 1P4OA 4IFGA 4RA4A 4BKYA 2XJ1A 3KL8A 4ITHA 2YCSA 4I0RA 3RVGA 4GT4A 4DINA 3UDBA 3RPSA 4I6QA 5ANOA 5CT0A 4HYUA 3G9LX 4MXAA 3WF7A 4CVAA 3BHUA 4MBJA 4WSYA 3VS2A 5B2LA 2HY0A 2JEDA 3OF0A 4BICA 2W1HA 3FSKA 4CSVA 3DFCB 5H8EA 4L01A 2Y6OA 4KABA 2PYWA 4I6HA 3VWAA 3H3CA 4DF3A 4ALVA 3HMMA 1H4LA 3DA6A 3OY3A 3QRTA 5LMKC 3ZH8A 1YHSA 4HGTA 5HO7A 2IEWA 4FNYA 3QAME 1O6LA 3R7OA 3LFSA 3A4PA 4QMYA 4ACMA 4P4CA 4NSTA 3WILA 4I6FA 4IHPA 2CN5A 4RX7A 3Q53A 2ZOQA 2X1NA 3DZOA 3TV7A 3EIDA 3VW8A 4BHZA 4CZTA 1KE9A 3KC3A 3A62A 4CMTA 3W0MA 1P2AA 2UZUE 1Q3DA 4GUBA 5DWRA 2W9FB 4YHJA 1JLUE 3MVMA 4IBMA 5I0BA 5M57A 4E4MA 3FMEA 3NGAA 4FG7A 2GCDA 4DEDA 2BFXA 4L68A 4FSYA 3SW4A 4PDOA 4AFEA 5A46A 2H34A 4IB0A 5TR6A 4DG3E 4DCAA 4WG4A 4Y73A 2YM7A 5ACBC 2OJFE 4MD9E 2NYAA 1M2RA 3DKGA 5AADA 4DH7A 4X3FC 2OZOA 3FHRA 5EYDA 3RJCA 5LOHA 5L2WA 4AP7A 4GK3A 4IB3A 3FY0A 5K4IA 4FEWA 3R7YA 4AWIA 4FTRA 2F7XE 2VU3A 4F78A 3OHTA 3R7GA 4W8EA 2J5EA 3Q4CA 5AR5A 3UDTA 4EI4A 1ZY4A 4XOYA 4JR7A 3LQ8A 2IF8A 4Y85A 4H1MA 4DDGA 2FYSA 1XH8A 4G5JA 4L67A 2XKEA 4QYGA 5KHXA 2YITA 2VTAA 2A2AA 2EXEA 3S00A 4QTEA 5AA9A 4EOJA 4S30A 1Q5KA 5HG9A 2GFSA 3RWQA 3CD3A 5AP1A 3ORNA 3RNIA 2GSFA 3VQUA 3R01A 3UP7A 3ZUTA 5AV2A 2XK9A 4F0GA 4WUNA 5AUXA 2JITA 3ZS5A 3WBLA 3KN6A 4BCJA 4KIQA 3MH3A 5CVGA 5LMAA 5HNIX 3AC1A 2OIDA 1PYEA 5FQDC 5CZHA 4F9CA 5BYYA 4RQVA 5L6OA 1BX6A 4QP9A 2PZYA 3RPYA 2YM6A 4L7SA 1JVPP 4QP7A 4EZ7A 3AC5A 2ZV2A 3D94A 3T3UA 4KKEA 2W1FA 2C5NA 3DBFA 4P7EA 3VNTA 4E5BA 4MUQA 3NVMB 4IAKA 2VV9A 3KU2A 3F88A 2XUUA 1OI9A 1MP8A 3MVLA 4RIXA 3MH0A 2JC6A 3F7WA 3UTOA 5D12A 2UW8A 3F5GA 3NUXA 3R8ZA 5KKRB 1MUOA 4YZNA 3H9RA 1Q97A 4FR4A 3KQ7A 4XG7A 4D4YA 5FBNC 5H8GA 3TKUA 5IQFA 3D15A 2O3PA 3QZIA 2C1AA 3CPBA 3PG1A 4TWNA 5TKDA 1U59A 2G1TA 3KULB 4TTHB 4YSMA 3OVVA 3LQ3A 4JIAA 3U4UA 3N4UA 4NUSA 4XG2A 2XKDA 2X4ZA 3AC2A 4F99A 5M4CA 1PMVA 2YFXA 3ORTA 2OKRA 4XV2A 2J0KA 1I44A 2ONLA 3NDMA 4UN0C 3H9FA 4U45A 2WXVA 5CX9A 4OW8A 4KBAA 4EH7A 4UY9A 3E8NA 4ZP5A 4PMSA 4QP2A 5ANIA 3EFWA 3RPVA 4IM2A 3TZMA 4FUYA 3SX9A 3TWJA 2W0JA 1SNUA 3P78A 3RINA 5EG3A 4IJPA 2PMLX 3W0QA 4I4EA 1SYKA 3PSCA 5D7VA 1APME 3QTXA 5ANJA 2X6EA 2F9GA 2W5BA 3D7ZA 4EOKA 3HUCA 2V0DA 5CXZA 1XBBA 3MW1A 3C4EA 3QYWA 4RGJA 4BDHA 4PDYA 3NVKI 1DAWA 4CFVA 5HE3A 2C0TA 3H4JA 5F4NA 3V01A 4C4GA 4AZFA 3LVPA 5EM7A 4F4PA 5C8KA 2DQ7X 1ZWSA 3I4BA 3CC6A 2XIYA 1WVWA 3PVGA 4FV8A 4YPDA 5HX6A 5J1WA 5JT2A 2GTMA 3OZ6A 4D5KA 1FOTA 4U42A 3KK8A 2OIBA 4MEDA 5JMSA 4IB5A 5CSVA 4PY1A 2YM4A 5LARA 4IMYA 4YUQA 2B9JA 4DFBA 2E9OA 3KMMA 4BRXA 2C47A 5HIBA 3LFQA 4CLJA 4IWDA 5L6PA 3MI9A 4IVDA 4CV8A 4YTCA 3MYGA 4J96A 3DU8A 5A4LA 1R0PA 2RIOA 2ZB0A 3G6GA 2BRBA 4X6QC 1NA7A 1ZYDA 4JDHA 3FI4A 1OM1A 1J1BA 2R3GA 3KXNA 4RVMA 1SVHA 5IEYA 1BYGA 4YBKA 5LMKA 4GVAA 2C6IA 4YPSA 3EQCA 5DFPA 4GV1A 4HOKA 4ACDA 5EOBA 4RLLA 4W9XA 2BHHA 3UIMA 3ZFYA 3R1SA 2CN8A 3QTQA 3R73A 4PPAA 2HY81 4NKSA 4DBNA 4I3ZA 1FGKA 3P08A 4YHTA 4CKRA 5J9YA 2G2HA 1XWSA 5AWMA 4V0GA 3D5XA 4N4SA 2OU7A 3A99A 5L8KA 5J9LA 4FEXA 3EYHA 5HLWA 3RWPA 3WYXA 5AR8A 4ANOA 5TOZA 2BRNA 3NPCA 4AE9A 2OH4A 2RSVA 1O6KA 3DAKA 5HU3A 5L2SA 2WKMA 3FQHA 2HXQA 2QD9A 2JDOA 2ZDTA 2WB8A 1GY3A 3FL5A 3RZFA 1PXIA 4BI2A 3PFYA 3SV0A 4GFMA 4IAAA 4Q2AA 3C5UA 4QYYA 4TT7A 3QQGA 4AZEA 4J1RA 5DI1A 2XM8A 4FVQA 4IM3A 5EYKA 1DM2A 3SXSA 2GQGA 4AUAA 2G01A 4GJ2A 5E91A 2UW3A 4AF3A 1OIYA 2XBAA 4FOBA 4CFFA 4ZAUA 4Q5EA 1ST4A 3HVCA 3KXGA 1YI6A 4BWXA 1W2DA 3BHVA 4TWCA 3DBEA 2VGOA 3MFSA 4PMMA 5E7RA 4MQ1A 2V55A 3O17A 2ZV7A 5M08A 4QP4A 3FQEA 3UVQA 2OSCA 1ZZ2A 4M14A 1YDRE 3CCNA 3BYSA 4OT6A 4ANSA 3OTUA 3R21A 3QTIA 1QL6A 5EW8A 3Q04A 2JAMA 1GZNA 3DV3A 3QQHA 2VWBA 2C68A 4FIEA 4JL9A 2LAVA 4FTTA 4YZDA 3PP1A 4OT5A 2XRWA 3VUKA 4DEGA 5BYZA 3QBNA 3C0GA 3PRIA 2OK1A 4FV5A 4H3PA 3M1SA 4PTEA 4R7HA 3VS3A 4LDTA 5BNJA 4BIBA 3KFAA 5GZ9A 3MH1A 3WF6A 1FMOE 3ZLSA 3CTQA 2J5FA 3OY1A 4AA5A 3VJNA 4O2PA 5E1SA 2ESMA 4FSNA 3EZVA 2VWVA 3W2QA 4GS6A 3QX2A 4JIKA 4YGAA 3SVVA 3VQHA 4BDJA 3C5IA 1JKSA 4RWIA 3L8PA 4K8AA 4ZTRA 2JKOA 1URCA 4EHVA 4UALA 5T3QA 1H27A 3C7QA 3I6WA 3EKKA 3QCSA 3FJQE 2J51A 4EQCA 5EW3A 5AP3A 3ZFXA 1CSNA 5EQPA 2A27A 3ZSHA 5JFSA 3NCZA 3K3IA 1R0EA 4QMMA 4FVPA 3PPZA 4XG6A 5DHJA 1M7QA 5HESA 2IG7A 2J0MB 3LAUA 4PPCA 5CU0A 3P7CA 4NEUA 2YWPA 2PVNA 4U44A 4FZFB 3THBA 5LVMA 2WZJA 2R64A 1O9UA 3C4XA 1OL6A 4V05A 2WTVA 3R9DA 5KMIA 4FEUA 4IADA 4YTIA 3K54A 3R83A 3ULIA 3VBVA 4FGRA 3RMFA 3D2IA 4FT5A 4FSRA 4HNFA 4ERKA 3HV6A 1CDKA 1Q99A 4PL4A 3UJGA 2OXXA 4EOIA 3LLAA 3TM0A 1JKLA 3GU5A 4C3PA 4M97A 1LUFA 4AQCA 5IH5A 3DK6A 4RJ4A 5KKRC 4UX9A 4ZSEA 5CEPA 2IJMA 2RG5A 3I60A 4FODA 4KIPA 4YTFA 2XS0A 2F49A 3QD0A 3Q52A 4RVLA 4MTAA 2QR7A 1SZMA 3LCOA 4MD8E 2BALA 1XHAA 5DGZA 3PXRA 4E1ZA 2QQ7A 3WZDA 1AD5A 4II5A 3SKCA 1Q3WA 4BYIA 5HCZA 4DC2A 3FDNA 4H3QA 4DN5A 3FMNA 3CKWA 3HX4A 2VNWA 4RJ5A 3ZBXA 4C3RA 4ENYA 5M4UA 3VAPA 3QQUA 3BZ3A 3OWJA 2C69A 3OCGA 4IWPA 1U5RA 3HV7A 3UPXA 5IEXA 2QOLA 3NNWA 4ZXTA 2HK5A 3VRYA 3O2MA 4FTLA 3MPAA 4IVBA 4FI1A 4EONA 4CD0A 5E8YA 2PVHA 2RGPA 1JSUA 3VS6A 4ZOGA 3E92A 1I09A 2BILB 1STCE 4OR5A 4H1JA 3CD8A 4TNBA 4WG3A 2BDWA 3IOPA 2A4LA 4RC3A 2J0IA 1FBNA 4GFOA 3CQWA 3TZ9A 5CSWA 2XKFA 2X9EA 4F7JA 3K5VA 5AP7A 3ODYX 1CKJA 2ACXA 1K2PA 3LM5A 3CGOA 2G9XA 3DJ7A 3R8PA 5EYMA 3B8RA 1YOJA 4LOQA 3VBYA 2YLFA 3NAYA 1J7UA 1BI8A 4PWNA 4C62A 3TDVA 3TNHA 4D55A 2XEYA 1XJDA 3OOGA 4DFUA 5JKGA 4I6BA 5AEPA 4BJJA 3ZSIA 2CCHA 3HEGA 1H25A 4APCA 5DR2A 3G0EA 5HNBA 3T8OA 2GFCA 2X0QA 4RT7A 4GW8A 3NEWA 2YJSA 3OUKA 4NFNA 2VTHA 5M4IA 1J7IA 2VTSA 3CPCA 1JWHA 2HW6A 5L4QA 3MTFA 3RBWA 1IA8A 2I0EA 3FKNA 3FXWA 2XYNA 3DLZA 3FZRA 4RFMA 3TL8A 3FPQA 1HCKA 2QKWB 4TYHA 5K0KA 4AU8A 4Y5HA 4H05A 4JDKA 3KXHA 4A07A 4X2FA 2YM3A 4GJ3A 5EM5A 4MF1A 1CM8A 3EMGA 1MQ4A 3UVPA 4ID7A 2WTIA 4UYAA 2BR1A 4YJOA 3GI3A 3U6IA 1REKA 4MF0A 1QCFA 5EDRA 3KXXA 5L3AA 4KKHA 3V04A 4RJ6A 3F5XA 2PZIA 3ANQA 5E8UA 4IANA 4KS8A 3VULA 4E6QA 3ATSA 4CMOA 5DNRA 4FF8A 4EOPA 2WTKB 2OF2A 3KRLA 2EB3A 2GS2A 5DPVA 3V8SA 4QT1A 4U80A 3QUEA 3R7UA 3BLQA 4R7BA 2VTOA 5TT7A 2PZ5A 2O8YA 4DTAA 5CNNA 2IN6A 3LHJA 4GK2A 3E7OA 3BU5A 4GH2A 3IDPA 3BWFA 2ETKA 3A4OX 3MDYA 5FM2A 4GKHA 4O7LA 5AM6A 5FD2A 4HGEA 2C6EA 3HECA 5FXSA 3VN9A 1W2FA 2B9IA 3AG9A 4IACA 4QMUA 4L46A 4EJNA 3ZUVA 5CF8A 1RW8A 2R0UA 2OO8X 3BEGA 3HKOA 1B6CB 4Y8DA 3U9CA 3MTLA 5AV4A 1PKGA 1TQMA 4ZSGA 1OUYA 2Z02A 4FTKA 4AGDA 3PJCA 1PRYA 5C8NA 2ITVA 4HVIA 3GCUA 2HW7A 1JSTA 3ULZA 5M53A 4OUCA 4HPTE 3E62A 4CV9A 4KSPA 5FTOA 4U81A 3PFQA 4XV3A 3TI1A 2OGVA 2QVSE 3BE2A 3KIOC 1GAGA 1UU7A 4N6ZA 3A8XA 2ERKA 5AM7A 3I81A 3DNEA 3TIZA 4BCIA 3COIA 4JX7A 4EYJA 3F2AA 2WELA 3MIYA 4FTIA 2R3RA 5IQBA 2W4JA 3HMPA 4L3LA 5D7AA 2YHVA 4QMXA 1RQQA 3PVUA 4FV2A 3S3IA 4U43A 3WF5A 2WHBA 4KBCA 5CAQA 4ZSJA 4NJDA 2XM9A 2I7QA 5HEZA 3R8VA 4DFLA 4LMUA 4L8MA 3UOJA 1KSWA 2X39A 3ERKA 3I1AA 4AXDA 3CIKA 5A54A 4HYSA 1SNXA 4MXZA 2PMIA 3BV3A 4HCVA 5JQ5A 4XP0A 2B53A 2XB7A 2XKCA 1YOMA 3QX4A 3KMUA 3ZO3A 4I5HA 3V5JA 5B7VA 5H2UA 1V0PA 3OCBA 3F3ZA 3H9OA 3QA8A 4BBEA 3QC4A 4FEQA 3WF8A 4ACGA 2FH9A 4KAOA 5LCJA 4FICA 1DI8A 5FEDA 3ZXZA 4XG9A 2JIUA 3NIEA 3GENA 2B4SB 5A6OA 4OBOA 5M09A 4B4LA 4QYHA 4DFZE 4UWYA 3CGFA 2WEVA 2W99B 4MKCA 4CTCA 1PY5A 1W7HA 3EN6A 2A1AB 4O4BB 2EB2A 2BZHB 3FLNC 4O1OA 3KKVA 3R7EA 4PTCA 5TE0A 5I4NA 3GCPA 1W82A 3GEQA 4YC6A 4RIYA 1YDTE 1XH6A 3OEFX 3QUDA 5CVFA 4DGOA 4LRJA 3MFRA 3N9XA 4BTJA 5K9IA 2CKQA 4MBLA 5CU4A 2PVFA 4OAUC 5DMZA 3EQBA 3Q96A 4GFGA 5CENA 5HKMA 3VS5A 5BQ0A 4NL0A 5JRSA 4FKUA 5IA2A 5EK7A 4AACA 3E3BX 4F1TA 4Z55A 4AOJA 4BBFA 4APPA 2W1CA 4AZWA 4O0XA 4C37A 4JQ7A 4FSUA 5KHWA 3R63A 4NJ3A 4BB4A 3UNZA 4A9UA 5CF4A 1KE5A 3EL8A 4ZTQA 4R5SA 3FZTA 4FSZA 3HAVA 2CKEA 3MJ1A 2XAOA 3PJ3A 5AA8A 2PVJA 3UBDA 4TNDA 3HMNA 2PUPA 2PWLA 1MRUA 5J8IA 1UNGA 3DQWA 3DBQA 3RI1A 3TJDA 1O6YA 5E4HA 2W05A 5HO6A 3HP2A 4BJJB 3UIUA 4BTFA 5IZFA 3BEAA 4WD5A 4ONAA 1CTPE 3F3WA 4ZSLA 3WZKA 4NIFA 1Y6AA 2Z7RA 4XOZA 2VTNA 3R04A 4Y95A 3VS4A 3LXLA 4ZK5A 2XNNA 3W2OA 3LIJA 5IQIA 5HG7A 3VF8A 4MCVA 2ITQA 5FXQA 3FEGA 5HGIA 4FKWA 5B0XA 4CFUA 1V0BA 4RSSA 4TYHB 3UZTA 1YXXA 2IZUA 2W5HA 3PVBA 4KNBA 4TZRA 2C5VA 4A9YA 3FL4A 3ID6C 2PVLA 5M07A 5CEMA 3OG7A 2YAAA 1OKZA 3KA0A 1Q24A 3ZBFA 2LGCA 4JG8A 3PY1A 4L44A 2YLEA 4IAIA 3FHIA 5J9ZA 5K5XA 4I5PA 3VRZA 2O63A 4C59A 3DZQA 2W1EA 2ITZA 5LVNA 3EZRA 3Q9WA 5EQYA 5AJQA 2ITOA 5AAEA 3L8VA 5CU2A 4J52A 3LFDA 4L7FA 5B2KA 1PJKA 4PL3A 4BKJA 1Y91A 3R28A 2UZWE 1ZLTA 4H36A 4XX9A 4IX5A 5DT3A 5AUVA 2IW9A 3TACA 1U46A 2VUWA 4PMPA 3LM0A 1WFCA 2VD5A 3FKLA 4ASEA 3F7ZA 3V5LA 4FTJA 4NM7A 3QZFA 4OGRA 3PVWA 4BWKA 4U7ZA 1PKDA 2VTTA 3D2KA 3QRIA 4O86A 1WZYA 1ZMVA 3LW0A 4HCTA 4M13A 3LMIA 2O5KA 4G17A 3PLAE 3EN5A 3UNKA 1MRYA 3CJFA 3KRXA 4LRKA 5F9EA 4O21A 2ETRA 2H6DA 3JXWA 5HBHA 4HZRA 5HHWA 3DOGA 4RPVA 1SVEA 1P4FA 2JAVA 5A3XA 2PPQA 4O7WA 1SM2A 4O0VA 2AYPA 3CS9A 2QODA 4X3FB 4I92A 5HE1A 4V04A 4Q9ZA 2VTRA 3RM6A 4I5MA 4R1VA 4I24A 3NNUA 3ATTA 5BYLA 2X9FA 4CT1A 4X6RA 1E1XA 3EQGA 4K18A 4LV5A 4E3CA 1H00A 3O51A 2PVKA 3PY3A 3BWJA 5HE2A 5IQCA 2YABA 5EM6A 3TZ7A 4O7NA 1YXVA 4FX3A 4C2VA 4AW5A 3HAMA 4I23A 4YMJA 3AXWA 3FWQA 4CKIA 3W2RA 4C0TA 1BI7A 4R6VA 4RJ8A 3OUNB 1XBAA 3WOWA 3BELA 3EQDA 3C1XA 1PXMA 4NWMA 3BRBA 4XP2A 4U3ZA 4D1ZA 5LXMA 2WEIA 3K5UA 2XK3A 3DJ5A 2YEXA 3QL8A 3TNPC 4ANQA 5FEQA 4MNEA 1IR3A 3W10A 2I0VA 4C02A 4UMPA 3QCYA 4O91A 1H1RA 4QO9A 5JZJA 3AKLA 3PY0A 4QPSA 5E92A 3S2PA 4B99A 4X3FA 3U55A 3FC2A 4TWPA 3SRVB 1PXKA 4BWPA 5FDPA 4O22A 3FV8A 5IA1A 2IW8A 4IM0A 3RGFA 5CU3A 4ALWA 2I1MA 5CSHA 3DGKA 5FDXA 2HYYA 4JRVA 3EYGA 4C4EA 4FYNA 2HELA 3C13A 4QDVA 3NUAA 2QI8A 5BUIA 4LMNA 3ENHA 5DG5A 4ZS0A 4F6UA 3QKLA 4TYJA 3OP5A 4FV0A 4QMTA 5DT0A 4FL1A 4GCJA 4J8MA 4E8AA 4F9BA 4IC8A 2UW7A 5HQ0A 4G6LA 4JS8A 3QTRA 4UWBA 4FKIA 4B0GA 3D5UA 3IK3A 5FP5A 4TKSA 4USEA 1VLRA 4F7LA 3CP9A 2IWIA 5HLNA 5ANKA 2Y0AA 4UXQA 4DFXE 3PXQA 1P5EA 2R5TA 2GNIA 4O0SA 4RFYA 4FTOA 4YJVA 5HIDA 4CEGA 4DG2E 4IWOA 4G3CA 4MQ2A 5DRBA 2W96B 2BKZA 4DEAA 4NW5A 4NH1A 3E88A 1OBGA 2XALA 3IGGA 2VTMA 4C38A 4FUXA 3W2SA 4WRSA 3COHA 2C6MA 2RKUA 3ACKA 4Y46A 3V3VA 4D0WA 2V7OA 4MX9A 4GL9A 4BVUA 4HW7A 4F0FA 1JOWB 4F6WA 2H96A 3COKA 4FRFA 5HTIA 3IG7A 4LGHA 4MXOA 1IAHA 3QHRA 4BCPA 5BVNA 3TIYA 4S2ZA 3QRKA 3UZRA 4G9CA 3CKXA 4U79A 4QP8A 2JIIA 2FO0A 3B2WA 3BQCA 3FMDA 2GNLA 3IW4A 3NW5A 5EQEA 1YXTA 5FEEA 4BY9E 3VBTA 1HOWA 5CASA 5LVOA 2J90A 3ETAA 2CDZA 5BVDA 3WARA 1HCLA 4IQ6A 2XF0A 3FMJA 2J7TA 5JRQA 3Q4UA 3RPRA 3RAIA 3F2NA 1W0XC 3OCTA 4IDTA 4QMNA 4ZTHA 4XRLA 3EQFA 2QURA 4XYFA 2X8EA 3VHEA 3DK7A 2VO0A 4DEBA 4DHIB 4ZLOA 4BCQA 5KBQA 3EN9A 3C4WA 5HIEA 4U97A 3S0OA 3V5TA 2W1ZA 3GCSA 4L6QA 5CQWA 2ZMDA 2WQOA 4E6AA 3BCEA 3LOKA 3R71A 4RMZA 5EOLA 4ZLZA 2JBOA 2VTQA 4NTSA 5BUJA 4M0YA 5H3QA 4TRLA 5L2QA 5C4KA 2UW9A 3IW7A 5E8VA 4FIJA 2FSMX 4JG6A 4E5AX 4KRDA 4FKOA 3UIBA 2BIKB 2YCRA 4FKJA 5F20A 2W1GA 4G6OA 4Q9SA 5C03A 2A0CX 3D4QA 4C58A 3NRMA 4PRJA 4F7NA 4PX6A 5IF1A 5G1XA 3IECA 4G6NA 3FBVA 3R2YA 2VAGA 3F6XA 2ITPA 4GT5A 3ZLXA 2WQNA 4FV3A 3U4WA 3DJ6A 3VS7A 5IQEA 4LI5A 4WSQA 3VBWA 4BFMA 2VX1A 1F3MC 4KD1A 3Q4TA 2PMOX 5DEYA 3CEKA 2AQXA 1LPUA 5A4EA 2FUMA 1WBOA 3FSFA 3TMOA 2HZIA 2VWZA 2PMNX 4OTWA 4O1PA 4YNOA 3A7GA 3WZEA 3NFGB 1JPAA 2WO6A 3N51A 4X2JA 4AOIA 1OPLA 4YJRA 2XK7A 2XNBA 2ITXA 4FTAA 4JJRA 4XV9A 3IOKA 2F2UA 4RJ7A 1W83A 3W8LA 3ZOSA 5CQUA 3G33A 2YISA 5AR2A 1GIJA 4UXLA 4DCEA 4TYIA 1ZYCA 4HCUA 3UYSA 1AQ1A 2UW0A 2H9VA 3A60A 2O65A 4AT4A 4D2WA 1YWNA 1OPJA 3SA0A 3DCVA 2IVUA 4K2RA 5E8TA 1URWA 4RIOA 5GNKA 4F0IA 3PZEA 2OBJA 3U51A 4OTGA 3TG1A 4DT9A 4K9YA 4DHFA 4F09A 5BVKA 4BDCA 3GQLA 3KXZA 3PRFA 1REJA 1PXOA 4FV9A 3VBQA 5CEOA 2ZYBA 1G8KA 2QOHA 1Q8YA 2QHMA 2Y7JA 3F5UA 3Q6UA 2FB8A 1NVSA 3HV5A 2QNJA 1XBCA 2BRHA 3VF9A 2BRMA 1ND4A 3G6HA 3W1FA 4YBJA 3TUBA 5KMLA 2WOTA 3I5ZA 5CEIA 1IASA 2GS6A 3QKMA 4QQTA 4DG0E 2PY3A 4PPBA 3E93A 2OW3A 3O8UA 4R77A 1KWPA 2UVZA 2WOUA 4EOOA 3PWYA 4LRMA 5FP6A 4KB8A 2GS7A 3PZHA 1R39A 4AGUA 2OJ9A 3MB7A 4USFA 5CS6A 1UNLA 5FTGA 4DAWA 3PUFC 3I6UA 5JEBA 3R2BA 3P7AA 4IC7A 3V8TA 4BCHA 2V62A 5AX9A 4CYIA 2XARA 4O6EA 3UQGA 5BVEA 4DT8A 2DS1A 5FLFA 4NFMA 4AXAA 1TQPA 4C4HA 3BBWA 1UU3A 4Z9LA 3FKOA 3ZRKA 4EC9A 4IVCA 4AGWA 1FINA 4BDGA 4K1BA 4YR8A 2ZB1A 3TT0A 1K3AA 5IMEA 3S4QA 5ITAA 2X8IA 4XJ0A 2B54A 5HX8A 1WBPA 4XBUA 4FSTA 4HYHA 5K0XA 2Y6MA 3FLYA 3FZPA 3GU8A 4BTKA 3EWHA 1E9HA 3KCKA 3DY7A 4L43A 4WO5A 5AIKA 3QA0A 4Y5QA 2GNFA 1J3HA 5BUEA 4RC4A 2ZVAA 5D10A 4B7TA 4MK0A 3R0TA 4IH8A 4RX8A 5ETAA 3BHYA 1CKIA 4LG4A 5A4CA 5LVPA 4XP3A 3PIXA 4O0RA 3FY2A 4C35A 4MAOA 4QMPA 1A9UA 3GC8A 4KINA 4E93A 4EWHA 2WTCA 1ZMUA 1KE6A 2XJ2A 4S31A 4EHZA 3BL7A 4UZDA 3NX8A 4IEBA 5J79A 4MD7E 1ERKA 4A4LA 1H0WA 4D5HA 4O6LA 4RA5A 3Q9XA 2XIRA 3NYVA 4Z16A 4C3FA 3DAEA 4FG9A 3UP2A 4AXFA 4EYMA 3RHKA 3AGMA 3V6SA 3LCTA 1PXLA 2WAJA 5JSMA 4RX9A 5KNJA 4U3YA 3MFUA 1OL2A 4V01A 4B6LA 4D2SA 4IB1A 3PPKA 4E4XA 2UZVA 4M8TA 2WIHA 1P14A 3IW6A 3JVRA 3HV4A 4BHNA 5A4TA 4EH4A 3LMHA 1B38A 4DHZA 1OGYA 2UZOA 3BIZA 4AA4A 4LUDA 3H30A 4CNHA 4EJ7A 1XH9A 4PF4A 3IO7A 1OUKA 4PUZA 4ANNA 4PDSA 3BX5A 4YC8A 3WZUA 4B8MA 5CSPA 3LJ0A 3IDCA 3HA8A 4UV0A 4M69A 4FV4A 3GGFA 3Q32A 4M15A 3MPTA 5DVRA 1NT2A 3WZJA 4FKSA 4TY1A 4U0IA 3VC4A 5J5SA 1MRVA 3O7LD 2PL0A 4EH2A 2WMBA 4AX8A 2ZM4A 3HUBA 3CR0A 5KZ0A 4A9SA 4ZMEA 4WG5A 3EFLA 4G1WA 3HMOA 1PMEA 3D14A 2C5OA 4J71A 4EOSA 3F2RA 4NZWB 1VJYA 4BCKA 3KF4A 4R1YA 1OVEA 5IPJA 3EQIA 3E7VA 4F1MA 4RIWA 3NW6A 1ZAOA 3Q5ZA 3QXOA 1H1SA