4QP9A

Crystal structure of erk2 in complex with 7-(1-propyl-1h-pyrazol-4-yl)-2-(pyridin-4-yl)-5h-pyrrolo[2,3-b]pyrazine
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
345
structure length
335
Chain Sequence
MVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFELDDLPKEKLKELIFEETARFQPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Mitogen-activated protein kinase 1
publication title Fragment-based discovery of potent ERK2 pyrrolopyrazine inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 110
structure length 335
sequence length 345
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2014-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4qp9A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4qp9A01
3LQ5A 3BU5A 4FKGA 1IA9A 3LFFA 4DH3A 1RW8A 4CZYB 4CMOA 2IZTA 3MFSA 4DITA 5HORA 2XNOA 2XK9A 4FIGA 3Q52A 2RFNA 5DNRA 3Q04A 3PIXA 4ZTLA 4WD5A 4RPVA 4YSJA 4O1OA 4L01A 3LFDA 4V05A 4FVRA 5BYYA 5A46A 3LHJA 3UYSA 1XJDA 1OPJA 3BYVA 3QTXA 3NDMA 4X6RA 3LMGA 3R8MA 5JZJA 2H8HA 2CKEA 2JKKA 5LVPA 1Q61A 4AA5A 1KV1A 1L8TA 3ZLXA 4NJDA 3I1AA 3TG1A 1VYZA 2WTJA 3EWHA 4IZ5A 4U5JA 3G90X 3O96A 4MAOA 4BBFA 5AIKA 4K2RA 3NYOA 4Q5HA 4JIAA 4YC8A 4Z3VA 1J3HA 4F1OA 2UW3A 1JVPP 3BKBA 2EB3A 1P5EA 3ZRMA 3RALA 4GU9A 4RIYB 2IJMA 3B2WA 3MTLA 4TZRA 4H05A 3E63A 4K77A 5GJGA 4R3RA 2C6IA 2CKPA 5EQPA 2X8EA 3B2TA 2JITA 2X7GA 3O71A 4ZLZA 3MA3A 4C38A 5J9YA 3GP0A 4TYGA 2W4JA 4LV5A 4CT1A 5CVHA 4F1TA 4IE9A 3TACA 3SV0A 3W32A 4ALWA 3KY2A 4J8NA 3DGKA 4D9TA 4QYHA 3NNVA 2OZAB 3PXRA 3GVUA 4KIKB 5L2TA 5M4IA 4UY9A 1XH7A 1DI8A 4DTKA 2QOQA 3CXWA 3DA6A 4NZWB 4RZVA 3OVVA 4ZXTA 3MVJA 3ZRLA 1YXTA 5CVGA 4ZSGA 5M56A 3BGQA 3LKMA 2YM5A 4IAZA 3W2SA 3SRVA 3A8WA 5HO8A 5IA3A 4APCA 3DQXA 1ZXEA 3O8UA 3SAYA 2XEYA 3F61A 5EOLA 5AUXA 3L9PA 4M8TA 3VAPA 2CDZA 4F08A 2QOLA 3ORLA 3GCSA 4Q9ZA 5A4QA 4NK9A 4QMOA 3NUUA 4L46A 5E8WA 4BFMA 4XBRA 5L6OA 5IQGA 4QMQA 4XOYA 3FDNA 4TKSA 3OP5A 4BDFA 2B9FA 2QOBA 4I20A 4JDJA 3Q2MA 4E26A 2UW8A 3PP1A 1XH4A 2OK1A 4NIFB 2NRYA 4HZSA 4C36A 4XJ0A 2QU6A 1WBPA 1I09A 4D4SA 4EOLA 4FZFB 4O7WA 2XEZA 5LXMA 2ERKA 4JG6A 3TZ8A 5J9LA 5AR4A 3MI9A 4R1YA 3RAWA 3R0TA 4IW0A 3W2PA 3MH2A 3BYOA 4FKVA 3LAUA 3HMNA 4C7TA 5DOSA 2J90A 4IWPA 2YZAA 4PMMA 1SVGA 3HMOA 4FG8A 5HG9A 5HIEA 3PJ8A 4WNKA 3DPKA 1SVEA 2PL0A 1TQPA 3H0ZA 4QMUA 5KMIA 2IWIA 2A0CX 2JDVA 2JIUA 2OI4X 4Q2AA 2XCKA 3A4OX 2P2IA 3BYMA 3H30A 4S2ZA 4I5PA 2BDJA 3ROCA 2GMXA 1IRKA 4Y8DA 5A4EA 2FGIA 2PE2A 2R3JA 4O86A 3L9NA 5IQIA 5HE1A 3K54A 4BDKA 4NYEA 5LVMA 3ZSIA 4Z55A 2VTIA 4IJ9A 1YDTE 4WUAA 3KRLA 5DIAA 5CU2A 2UZVA 2V0DA 3K2LA 4RIWA 2XIZA 3GC9A 3CP9A 4WUNA 4XP2A 5CEIA 3QUDA 4D4YA 3R1NA 1L3RE 3F82A 3SRVB 5HGIA 5IA1A 2VTQA 2FSOX 2PZIA 3V5LA 4O7TA 4QOXA 3HV3A 3Q6UA 2QHMA 2UZBA 4AZVA 4YJNA 1Q8UA 4F1MA 4CCBA 5EM6A 2W17A 4QQJA 2PVYA 3JY0A 4FOBA 4DLJA 4DH8A 3FUPA 3W8LA 3PLAE 3O51A 4E7WA 5CU6A 5FM3A 2WMQA 3IDCA 5KMJA 3TT0A 1H1RA 2PVLA 4YZ9A 5K3YA 2GS7A 3R30A 4ZJJA 3RINA 4BN1A 4EBWA 1KE8A 3C4FA 5DFPA 5ETIA 4O7ZA 4PL4A 3EQDA 2CSNA 3QCQA 4G31A 1LEZA 3L8VA 3OOMA 2XIKA 4FVPA 4E4LA 4YJSA 2WPAA 3B8QA 4DC2A 4FEVA 3D15A 3ZEWA 2CGUA 1ZZLA 2FSLX 5IQCA 3FAAA 5DEYA 3SG8A 4F09A 5TR6A 3E8DA 3VULA 5KHWA 2ZAZA 2W9FB 2ITNA 4FSUA 1XWSA 1ZYCA 4JI9A 4LL5A 4RGJA 4W4YA 3WOWA 1LP4A 3F7WA 4EH8A 2J9MA 4OTPA 4XP3A 4AZEA 4CFWA 3UODA 4TYIA 4HW7A 4TN6A 4O81A 3DXQA 1XBCA 4ZTNA 5JQ8A 5HX6A 3QUEA 3QD0A 5GNKA 2PVMA 2UZLA 2QURA 3S2PA 4CTBA 3I79A 5IG1A 3KCKA 4BY9E 3U54A 2VTPA 3KEXA 4IM2A 4E5WA 3HGKA 3HMIA 5I3OA 3ZUVA 2BTRA 2PSQA 1BI7A 4Z7GA 3ANQA 3OOGA 4XP0A 2QNJA 4D4VA 4WSYA 2H6DA 3FI8A 1Q8TA 1U4DA 3GQLA 4CLJA 3R9DA 2X2KA 2JFMA 3NUXA 3F69A 3IW4A 2WQEA 5AR3A 2CLXA 2W05A 3P78A 2HZ4A 3QHRA 3W1FA 4BL1A 5A14A 1KUTA 4RIWB 3SLSA 2CGVA 3P79A 3QZGA 4DFBA 2C6EA 2YM6A 2QG7A 5J7HA 3CD3A 3PJ2A 3TN8A 1PXKA 4F6WA 3A62A 5CSPA 5LVOA 1O9UA 4FSQA 3HV4A 1YWVA 4XLVA 4A07A 1F5QA 3ACKA 5C03A 1URWA 3E87A 5ITAA 1UU3A 3HAMA 3S0OA 3RHKA 5JQ5A 3QTQA 4FKSA 3SC1A 4D2TA 2R2PA 2E9OA 3EN5A 3UZRA 3V51A 3GB2A 2R7BA 2XNNA 4PTGA 5HTBA 1M17A 2GNLA 3MWUA 3CC6A 5AP7A 1XKKA 3GOPA 2B0QA 2BKKA 2E9UA 3DKGA 5FG8A 5CSWA 1PXNA 4F9WA 2C6MA 2G2HA 3PA5A 1ZARA 2W96B 3QTZA 3WF9A 5K4IA 1YW2A 4CFUA 4FMQA 4U42A 4FSWA 3W2QA 4ANOA 3FXWA 1RJBA 5CTPA 3BV3A 5IISA 1SNXA 4IX6A 4DLIA 4WSQA 4MEDA 4C35A 4EQUA 2YJSA 5AX9A 3PLSA 3QRIA 3S4QA 2Z8CA 4GFMA 3RK7A 5FD2A 5EI8A 3I0OA 2PMIA 4UALA 1OL5A 4A4OA 1OM1A 3MH0A 3M42A 5L2WA 3WZJA 2RGPA 2X7FA 4BF2A 2OF4A 3WZDA 2GQGA 3VS0A 3NEWA 4EK3A 3RHXA 2CCIA 3LE6A 2IW6A 4TL0A 4XG8A 1KE9A 4WKQA 1QPDA 2C68A 4F0FA 5FEQA 3CQUA 1OVEA 1YI3A 4IC8A 2IVUA 4O27B 1VYWA 4R3CA 5E92A 4DH7A 3NCZA 3ZDUA 4GV1A 3HP5A 4RIXA 1R78A 3TWJA 2VTJA 2QOIA 4FTIA 5JFVA 3DFAA 3R7OA 4QP9A 3F5GA 3R8LA 4QMXA 4BB4A 3QU0A 3DLSA 2C6LA 2WQNA 2QOFA 3QRUA 1OL2A 2CGWA 3ORIA 4FTLA 4I41A 2X4FA 1PHKA 3ACJA 4ZS4A 3MB7A 5CEQA 4ZSEA 3AOXA 3C5IA 4NTSA 4RC2A 3I6UA 4HPTE 3FV8A 3DLZA 4J7BA 5FGKA 3CQEA 2R3LA 4R7HA 3CKXA 4BDJA 4C3RA 2GS2A 4Z7HA 2J50A 3RWPA 1OIUA 4AU8A 2HZIA 4M67A 4IDVA 2EVAA 5DWRA 4XUFA 3KF7A 2YCFA 5I9ZA 2J0KA 4II5A 4MK0A 4C3PA 1OZ1A 5JEBA 3ORMA 2XM9A 4JBQA 3VVHA 5AAEA 3CJGA 2X7OA 4YC6A 3KL8A 3JUHA 4AACA 1JSUA 3QCYA 3TNPC 3ZFYA 3SW7A 4QTEA 3UOJA 2YERA 2HY0A 4W8EA 5EYMA 2YLFA 4WG4A 4LGGA 4JL9A 3RPSA 4EH9A 2GNGA 4FSNA 4H1JA 3NNWA 4MNEB 4MQ1A 4PTEA 1EH4A 2C47A 3GT8A 4I0TA 5IEXA 2B53A 4LGDA 5LMAA 4NH1A 3RM7A 3HMPA 2O0UA 4R8QA 3D5XA 3RAKA 4MBJA 5EM8A 2IVSA 4AT4A 3THBA 3QF9A 2XK3A 4FSYA 4P4CA 2BZHB 2OLCA 3F3ZA 1M2RA 2I1MA 5EDRA 5C4KA 4ZOGA 3PVUA 4RBLA 4TRLA 3BQCA 1XHAA 1YXVA 5LWMA 3HYHA 4D4RA 4FV3A 3ZU7A 1QPEA 1J7IA 2V7AA 4YLJA 3FXZA 5CU3A 5AP6A 4FZAB 4IANA 4Z16A 1A9UA 3HNGA 4WRGA 4ANSA 3LCKA 3R71A 3FBVA 4EH4A 3T8OA 5CX9A 2IZSA 4L67A 3UC3A 2EU9A 3NYNA 3E8EA 4UMQA 4V0GA 1OBDA 4KRDA 3UOKA 3HX4A 3LFSA 4ONAA 3R9NA 3NVMB 3AC2A 4UZHA 4FR4A 5EYKA 3MFTA 3VJOA 4CZTA 5AUVA 3C0IA 4QP6A 5IQHA 5CSVA 4QMVA 5AM6A 5ETCA 2RKUA 3KMMA 3LJ0A 3ATTA 3T9TA 1PMNA 2VN9A 3MS9A 1R1WA 2A2AA 2XS0A 1YHWA 2WTWA 3PY0A 4IADA 2CNQA 2BHEA 3HAVA 3ALOA 3MGYA 4X7QA 2PYWA 2IN6A 4GFGA 2OJ9A 3V5JA 1ZAOA 3BBTB 3E7VA 2BAQA 3GQIA 4BKJA 5AP3A 5EQEA 3QKLA 4LRKA 4M97A 4EH5A 5E8XA 4AGUA 2Z02A 4EEVA 4EJ7A 4BDDA 5JN2A 3P86A 4LUDA 1Q62A 4KSQA 3DBFA 3E3PA 2GHLA 4JRVA 4CKIA 4EOQA 4QYEA 3UYTA 4QMLA 3MVLA 4ANNA 1PYEA 1YOMA 2Z7SA 1SMHA 4JQEA 3TNIA 3UE4A 4EK5A 3DT1A 4DG3E 2DYLA 3R1YA 3ZO1A 2IO6A 4MD8E 4CV9A 4B6LA 3E92A 4IBMA 4L53A 2JDRA 4NJ3A 4BGGA 3O23A 3HECA 4G6OA 3NUAA 4GK2A 3QA8A 3QKKA 3R21A 4MXCA 3GFWA 3L9MA 2PVJA 1LR4A 4DGGA 4CZUA 4JBOA 4DCEA 3OXZA 4I4EA 3II5A 2P2HA 4IB1A 1OKWA 3D2KA 3V8SA 2XNBA 4LOPA 1QMZA 3ZXZA 4I6QA 2OSCA 2Z2WA 4G2FA 3PSCA 3ULIA 3NRMA 2XKCA 1IEPA 3IW8A 3MY1A 5KCVA 2C1AA 2QO9A 3H9OA 1M2PA 1W0XC 3MH1A 3DQWA 3Q9XA 4KS7A 5ANDA 3D5WA 5EK7A 3DCVA 3KXHA 1ZYLA 4HJOA 1YRPA 4NWMA 4UWBA 5HICA 3TL8A 2YIQA 2BZKB 4UX9A 4K11A 3POZA 3VBXA 4BCOA 5CASA 2R3IA 5I5ZA 3JS2A 4MYGA 3NUYA 2BFXA 2OIDA 3TKUA 3QXOA 4X2FA 3R22A 4MHAA 1GZ8A 1J7LA 3F5UA 2G1TA 1GJOA 1PMVA 3PTGA 4AA4A 5GINE 3GGFA 3G33A 1OB3A 3AC3A 5E8TA 4FZDB 3FSFA 3VJNA 4Q9SA 5AIRA 2R3NA 5M09A 2UW9A 4AQCA 3PWYA 4FIIA 5AEPA 3CGOA 2ZB1A 4FG7A 4U3ZA 3SA0A 4H3BA 5LJJA 3GFEA 4O6EA 1BX6A 4RX8A 5DT0A 3H3CA 4FV9A 4RWIA 5FWKK 5LVLA 1UWHA 5T68A 3TTJA 2YWVA 3DKCA 1JLUE 2ITZA 4FICA 5EHLA 3CPBA 3D83A 2X9FA 2YM3A 4QMWA 5E90A 1FVTA 2YAKA 3G51A 3KVXA 3L8PA 4BGQA 4C33A 3W16A 3HLLA 2R3PA 2JEDA 3UIMA 3U55A 4OT6A 1MUOA 2BAKA 1UVRA 3BQRA 2UV2A 3EQBA 3VBYA 4QMZA 2C4GA 3KMWA 4W4VA 3GC8A 5HO6A 4NFNA 5F9EA 2VWVA 2XBJA 2WHBA 4J95A 3DBEA 4AAAA 2WOUA 3F66A 4FTKA 4JDHA 1BUHA 3OEFX 4W9XA 3G15A 2XKEA 2UVZA 4AGCA 1U46A 2OGVA 1JKTA 2VNWA 4GVAA 4QTCA 4I24A 3NAXA 2OJJA 1DI9A 3KF4A 5CT7A 3KVWA 1FMOE 2NO3A 2VNYA 3TNWA 5K0XA 5EW8A 5T6KA 4AXAA 5M57A 2OJFE 1URCA 3OUKA 4DA5A 4B99A 4MF1A 2YAAA 4IM0A 5BPYA 2F2CB 1NVSA 5EDPA 1RE8A 2JKQA 4FL1A 1S9IA 3N4VA 4IHPA 2BFYA 4FT9A 4LG4A 4CEGA 1J1CA 3UOHA 3AGMA 4JX3A 1AQ1A 4G3GA 1QCFA 3AC4A 3DK3A 4CFXA 3W10A 2ZV8A 4TXCA 5LOHA 4FODA 4BHNA 2BIYA 4M15A 1XBBA 2R3OA 2PMNX 1CDKA 2IZRA 3K3JA 4IAFA 4V01A 4YZBA 1JWHA 2XCHA 4BI1A 4EK4A 1SZMA 3FQHA 4EK8A 3ZC5A 2WIHA 3FZSA 4BTKA 3MJ2A 3FKNA 3COKA 4L3LA 4PV0A 5D12A 1U5RA 1IR3A 2HWOA 3P7BA 2FSMX 4BDHA 4RQVA 5CT0A 4M14A 5EQYA 3LLTA 5E8YA 2QO2A 2J0MB 2XNGA 3PA4A 4XG6A 4FT0A 4MD7E 5KMLA 2CHLA 4F9YA 1JOWB 3AXWA 1G5SA 4HCUA 3U4WA 4FEWA 5LCJA 1Y91A 3R04A 3RCJA 1FGKA 3OTUA 3I4BA 2ITPA 4FV4A 3KXGA 3ZYAA 3HMMA 4IAYA 4ZMFA 3P0MA 4O7RA 3RKBA 3DV3A 4J52A 2XK6A 1FINA 1OUKA 3VWAA 1YXXA 3F5PA 4WO5A 3F2AA 4JR3A 3RJCA 3H10A 4ERKA 3AMYA 3KRWA 5IQDA 2R3RA 3I81A 3DJ7A 4OTFA 2B55A 3NR9A 4PDYA 5FBOA 3UZTA 2VWBA 5J95A 1AGWA 1VEBA 5FM2A 1YVJA 4HGEA 2CKQA 4EZ7A 4FGRA 3D5UA 4EQMA 1PMUA 5M4FA 2CGXA 4DTBA 3LCSA 5A9UA 1K9AA 2B54A 2Y4IC 4IX3A 4WNPA 3WF8A 3PRFA 3DJ5A 3EN9A 2V62A 3VBVA 3GCUA 2XIRA 3ORKA 4LOQA 5DVRA 4EWQA 4IAAA 5DMZA 3UPZA 5L8KA 5G1XA 2H9VA 2FH9A 3F3WA 5AP1A 4HVIA 5CANA 2OU7A 4FEQA 4OTHA 2OJGA 4S34A 3EN6A 1CSNA 1ZY4A 4P5ZA 4CRLA 4QMNA 1KE7A 3MYGA 4I94A 4F70A 2WMSA 5CALA 3C4CA 5D9HA 5AFVA 4YZMA 4FVQA 5AP4A 4IX5A 4RQKA 3ZDIA 3TM0A 3RM6A 3DDPA 4E4NA 2HXLA 3MA6A 4GYGA 5BVNA 1OKZA 2RIOA 5JGAA 3EFLA 1FPUA 3K5VA 4YPSA 5L2IA 3NUPA 4PTCA 3BLQA 2YIYA 1DS5A 1JSTA 3E93A 2OBJA 2YCQA 4FC0A 4AW2A 4O7NA 3EN4A 2BRHA 4AF3A 5K5XA 2VU3A 3QWJA 3MPMA 4DF3A 3LCDA 3ODYX 1LUFA 5J8IA 2B9JA 2OZAA 2WQMA 4O0SA 4FV7A 1UA2A 4O1PA 4QP3A 3U9NA 4CTCA 2PU8A 4O0VA 3U9CA 4AP7A 1IAHA 4DT8A 4L44A 2XF0A 4YLKA 4L52A 3FMMA 4BBEA 2ZV9A 5HOAA 3BWFA 4EL9A 5J9ZA 4ITJA 1FQ1B 1H4LA 3O50A 3QRTA 3FZTA 3KK8A 4KSPA 2O8YA 4DGOA 2XUUA 5KMKA 2CN5A 4B4LA 4DYMA 4JDKA 3RZBA 5IKWA 4PMPA 4O7LA 3IGOA 2C5OA 3R1SA 2QKWB 4B8MA 3FZ1A 2WTCA 3UP2A 4MVFA 5LARA 5EI2A 1WBNA 1GZOA 3U8WA 3GBZA 3AD5A 2EXCX 1XH8A 3C4EA 3COMA 3LXNA 3HKOA 3L1SA 3PVGA 3Q96A 5KZ0A 2VO6A 2C30A 2F7XE 2WQOA 4ACDA 1QPCA 4NIFA 2XKDA 5EG3A 3DAKA 3ZUUA 4N57A 3KXZA 4HPUE 1OGUA 4ZAUA 4ZS0A 4X3FB 1YDSE 1G8SA 2I40A 4QO9A 3ORXA 2WGJA 2DS1A 5EYDA 3RCDA 4YURA 4AS0A 5HX8A 1PXOA 2GFCA 2HAKA 5FP6A 5L8LA 4M68A 4AWIA 3AMAA 4P90A 3FQSA 5ETAA 4UV0A 3D4QA 4BGHA 5CF5A 3QTUA 4E1ZA 3PXFA 2W9ZB 3ZHPC 5JZNA 2QD9A 4FZ6A 4IFCA 4AFEA 4QTBA 4M3QA 3V6RA 4KINA 2YA9A 3QLFA 4DG0E 4BCQA 3DNEA 4XG7A 2ITQA 4FTMA 3BZ3A 4IZAA 1OI9A 4B9DA 3PVWA 2BCJA 3ZFMA 4GH2A 4G6LA 4E6CA 5L2SA 2GTMA 2CNUA 2WXVA 4H3PA 3CKWA 4RC3A 4BDCA 1H26A 3FMJA 4MX9A 2VX3A 5HE2A 3UVRA 1JQHA 3UG2A 3VO3A 2Y0AA 3H4JA 3TKIA 3ZMMA 3KN6A 3ZO4A 4A9YA 5KKRC 3NW7A 4DEIA 2QOOA 4YR8A 1PYXA 3QLGA 4I92A 3VHKA 2VTOA 4A06A 1Y8YA 3QQHA 4ZTRA 4CGAA 1YI4A 2OH4A 4UMRA 4U81A 1M7NA 1WVXA 4NSTA 5C4LA 3LFBA 4MH7A 3SXSA 3UC4A 3FMDA 4C59A 4MWHA 5HE0A 3WE8A 1PRYA 1CM8A 1JKSA 3D7ZA 3Q32A 3KMUA 3SXFA 4NTTA 3NLBA 4USEA 3CTHA 4UXQA 2W1HA 3DB6A 4JJRA 2W1FA 4FKUA 5HNIX 5HD7A 3N4TA 2P33A 4UXLA 5CENA 2PVHA 3PXKA 3GXLA 3VRZA 4N70A 3I5NA 4E20A 4U41A 4C8BA 4ZK5A 4MXAA 2FUMA 5CNNA 3DK7A 4HVSA 5CAUA 2YISA 2OXYA 3QCSA 2O63A 2XM8A 4ZTMA 3V5PA 5AUWA 3SDJA 3VS1A 2Y8OA 5HLPA 4AGWA 2GFSA 3OZ6A 5KO1A 5IEYA 3VUGA 2HIWA 5CF8A 2PY3A 4ZLOA 3BHUA 4EUTA 5TF9A 4JXFA 1K3AA 4O0RA 1OKYA 2GTNA 5IA2A 2FO0A 4L9IA 4LGHA 4RRVA 3VBWA 4EH7A 5AAGA 2ZVAA 4C58A 3HZTA 3KFAA 2B1PA 5DR2A 3IECA 4CFMA 3EFWA 4LFIA 2GNIA 3KXXA 4A4LA 4D5KA 3JPVA 2X81A 3TDWA 2HENA 4FBXA 1U59A 3GC7A 2ZM3A 5E8VA 4O83A 5E4HA 4S32A 2C5VA 1ZYSA 4MWIA 4U79A 4FKIA 4AN9A 2RF9A 5ANIA 4UYAA 4YBJA 3C4XA 5FP5A 4MD9E 5D1JA 4QYYA 3REPA 4UN0C 4DFUA 3W55A 4IQ6A 2B9HA 3DXPA 4GUEA 4AW0A 2IG7A 3Q5ZA 4LMUA 3RI1A 2JKMA 2JD5A 4JIKA 2VTMA 5IPJA 3AC1A 4R5SA 5AR2A 2PPQA 1WFCA 2I7QA 3D5VA 4O38A 4DEGA 2GHGA 2JAMA 2J0JA 4GW8A 4YBKA 2VTNA 2QVSE 3P5KA 3Q5IA 5DRDA 3R8ZA 4EHZA 1WAKA 2WFYA 4KD1A 2BMCA 4M84A 1QL6A 4IIRA 3CTQA 5BNJA 2GS6A 4FSRA 4D2VA 4H58A 1FBNA 4QMMA 4FT3A 5D41A 2HK5A 3BPRA 3E62A 3KN5A 5AJQA 2P3GX 4QMPA 5CLPA 4YLLA 2QOHA 2BTSA 4GT3A 1STCE 5GJFA 3COIA 3MIAA 3NW6A 4B8LA 5AP2A 4TNBA 5FDXA 3TZ9A 2QR8A 3E8CA 3OHTA 3Q4UA 5HG5A 3FC1X 3NNUA 3BI6A 3OT3A 4APPA 4E5AX 4EOMA 3FLZA 3DS6A 3ZRKA 1KWPA 3Q9ZA 3EQIA 4RLKA 4DEBA 1YHVA 2R5TA 5E9EA 1KSWA 3ZS5A 3Q9WA 5CZHA 5AUTA 3M2WA 4AE9A 3F6XA 4ANQA 5M07A 1Y57A 4AZFA 3EQGA 4ARKA 2OIQA 3QL8A 5HIDA 5ICPA 3NZ0A 4YGAA 2ZM4A 3LQ3A 2HZ0A 3EZRA 5AADA 1PF8A 5IDNA 3HUBA 4PDSA 5M53A 4E6DA 3CR0A 3KXNA 3FEGA 3OEZA 2ETRA 2OH0E 3LXLA 3KC3A 3C1XA 3W33A 4CLIA 3P1AA 3R1QA 4RLLA 3LOKA 3LXPA 1OITA 3G0EA 5AV0A 5F1ZA 4AG8A 5EDQA 1KE5A 4H39A 4RVLA 3FI3A 1T45A 4UMTA 3NAYA 4RFZA 2XP2A 4JLCA 4XG9A 4AE6A 4EKLA 4F99A 3LCOA 2YLEA 3QGYA 4BCMA 5L3AA 3D94A 4FTCA 5HCZA 3V5TA 1BMKA 4RWJA 3G6HA 4QD6A 1CKPA 4XH6A 2JDSA 5DT3A 4BDIA 4FKWA 3A4PA 4DEDA 5J7BA 5KNJA 3ZUTA 4XV1A 4ACCA 3IOKA 2XK7A 2A27A 3OF0A 5DR9A 3ZO3A 3EKNA 1WCCA 4ZJVA 1RQQA 4NW5A 2X0GA 3F3TA 4G9CA 4X2NA 2A1AB 4C02A 4CV8A 1YKRA 4Y85A 4WNOA 2QG5A 3DTCA 4MXXA 4D9UA 1H1PA 4E8AA 1Q3DA 3QYWA 4W8DA 5HVJA 5AM7A 4ORKA 2C5NA 4P5QA 3WYXA 1W82A 2X8DA 4QT1A 4IAIA 4LM5A 2I0VA 4Y83A 2WKMA 5HZNA 3EJ1A 2VAGA 4FX3A 4UEUA 1KV2A 3AT2A 4FTUA 2NRUA 3HV5A 3OG7A 4MNEA 5KBRA 3F2RA 3PPZA 4QPMA 4CMTA 4FIEA 1PY5A 3MIYA 5M44A 2HYYA 5C8NA 3FXXA 5IU2A 3P23A 3R9RA 4LYNA 4AW5A 1HOWA 4HNFA 3VNTA 2QONA 3GUBA 1WBVA 2A19B 2YACA 4PNIA 4CYJA 3IOPA 2PUPA 3WF6A 3Q3BA 3RTPA 4BDGA 5AUYA 5HEZA 4IC7A 4O22A 5HNBA 2HWPA 3O7LB 4EKKA 2WTKC 3E5AA 4O21A 3ZSGA 3AC5A 5B7VA 3BLRA 3LMIA 1ERKA 5L2QA 4FTNA 3I60A 3CCNA 4NU1A 3UNJA 3D0EA 3OT8A 3FMEA 2ZM1A 1NVQA 4N6ZA 4FTOA 2O3PA 4I5CA 3WF5A 4YZDA 2ITOA 2WMVA 3FI2A 5AV2A 5BQ0A 3PXZA 4FNZA 2CKOA 4RJ4A 2XYUA 2PVKA 5D10A 3NUSA 4KIOA 2YHVA 3I6WA 4PUZA 5EM7A 3VS2A 4LRJA 3F88A 3A7HA 1O6KA 5ETFA 1ZLTA 4GJ2A 2WTDA 2B4SB 3VF8A 1Q8YA 4DN5A 4JQ7A 5AUUA 4MQ2A 4Y5HA 2DQ7X 5CY3A 3NUNA 4L42A 5DPVA 5AP0A 3POOA 2UZDA 3WZEA 3PE1A 5BVEA 3PP0A 3R7GA 1XBAA 1F3MC 3R00A 4HVDA 4YZCA 3ORZA 2OIBA 4YC3A 3UGCA 1FGIA 2VD5A 3IG7A 1ATPE 5F20A 4BWKA 2AYPA 4QPAA 4G16A 4HYSA 4YTHA 4EORA 4KABA 3CE3A 4FSTA 4ASXA 3IO7A 4DFZE 2VWXA 3QQGA 3VW8A 1OMWA 1Q24A 4DFXE 1SVHA 2GU8A 2OXXA 3QX2A 4EHVA 2PZPA 5LMKC 3V3VA 2UZUE 5HBEA 4NUSA 5L6WL 4HYHA 4S31A 4MF0A 4A9RA 5C9CA 2GQRA 4BVUA 2XRWA 4M0ZA 4UMUA 4FYOA 3MTFA 3GCVA 4U97A 3FWQA 4QMSA 2JIVA 5C01A 1XO2B 3DBQA 4DHFA 2EB2A 3GCQA 3BGZA 4D28A 2YM8A 3IS5A 5CI6A 4ZEGA 4IWDA 3FYJX 2R7IA 4UWYA 3VC4A 4CQEA 4AT3A 3LFQA 5GZAA 4TWNA 3LJ1A 5I0BA 4BHZA 3D9VA 3VS3A 3P08A 3FPMA 4PWNA 3KCFA 3BEGA 4G1WA 3RGFA 5CXHA 4XV9A 3QZFA 4AFJA 1WBSA 4PMTA 2P4IA 5GZ9A 2VWIA 4G3DA 2J51A 5DA3A 3DOGA 3C7QA 4F0IA 2IVTA 4QP1A 4RVMA 2J6MA 3ZH8A 1ZOEA 3R2BA 4C4IA 3V8WA 3OS3A 3NPCA 3C0HA 3Q4TA 5LMBA 3R7YA 1FOTA 4KBKA 3R83A 2RL5A 3R9HA 4RJ7A 3FLNC 3G6GA 3NNXA 3EL7A 4RWKA 3DBCA 1I44A 1WVWA 1ZRZA 2VV9A 3T3UA 3TJCA 4BTFA 2XIXA 2P0CA 3EL8A 4KB8A 4DH1A 3JR1A 4I6FA 3F3VA 2VTTA 4NFMA 3GC0A 3H9RA 4RC4A 1B39A 4TYHB 1UV5A 3EQHA 2IW8A 4NM7A 2C3JA 3G0FA 4AGDA 1UU9A 2JC6A 3KRJA 4GU6A 1BL7A 5H8EA 1ZMUA 1PJKA 3QQLA 2BAJA 2BRMA 3FY0A 4GFOA 4U40A 5IUIA 3UPXA 5ANJA 2C1BA 3WYYA 5KBQA 2G15A 2IZUA 2YDJA 1ZMWA 4DT9A 4C3FA 4I6HA 1GIHA 1JBPE 1KE6A 4ZTSA 3RK5A 3SOCA 3HDNA 5A54A 4QYFA 4YUQA 2YCRA 1CKIA 4YHFA 2O5KA 2OWBA 3FKLA 2NPQA 3HDMA 5HNGA 1WBOA 4CG8A 4HZRA 4L3PA 3FE3A 1MQBA 3BLHA 4EOOA 1LPUA 4AT5A 4BI2A 1MQ4A 4ITHA 4OTIA 3IQ7A 5GIOE 2WNTA 4RJ8A 3VBQA 3A61A 4L8MA 4C4HA 4D58A 4D1XA 4ZSJA 1BL6A 3CY2A 5IH4A 4YHJA 2BRBA 3A7GA 2XJ0A 3EQFA 1H00A 3CSVA 3LLAA 1HCLA 2ONLA 5BYZA 4FEUA 3N4UA 4DE4A 1P14A 4HOKA 5A3XA 3U87A 3UIUA 4RFYA 3Q2JA 4JVGA 1SYKA 3R02A 3D7TB 5HIBA 1ZMVA 1MP8A 4BYIA 4F7LA 5IEVA 3UVQA 5CNOA 2XJ2A 2LAVA 2GNJA 1H1SA 2HXQA 5AA9A 3C50A 4O91A 5C8MA 2H34A 1RDQE 1WBWA 3GCPA 4FNWA 1OL1A 5H9BA 3IW6A 4ZY5A 5I4NA 2YZLA 4ZY6A 2PVRA 5G6VA 2C5XA 4I5MA 4J99A 4YJPA 5H8BA 5ACKA 1NY3A 4OT5A 4GCJA 4OTRA 4KNBA 1H27A 2VGPA 4ZZOA 2PVFA 3OBGA 2Y7JA 4FTAA 5ANKA 3QKMA 4BC6A 5HBJA 2NNWB 2E9NA 4NT4A 4E4MA 1REJA 2IVVA 3P4KA 1ZOGA 4FKJA 5CEPA 4QQ5A 4JOAA 4GJ3A 4I23A 4MXZA 3CQWA 4GK3A 2XNEA 3VN9A 4L6QA 3DY7A 4IM3A 1M2QA 4FKTA 5HKMA 3SG9A 3QCXA 3AD4A 4NM0A 4PX6A 2OW3A 4D2SA 4NL0A 3E7OA 3UO4A 1PXJA 4BCFA 1CMKE 2XNPA 4XMOA 3QALE 4X0MA 4GKIA 3EQRA 4FNYA 5M4CA 1GOLA 4E5BA 5EYCA 3AG9A 3R2YA 2XK4A 3VRYA 5J87A 2HCKA 5H8GA 4XRJA 4FKPA 4TPTA 1JKLA 3C0GA 4XNEA 3O0GA 2W4KA 3T9IA 2VO3A 4L7FA 2C69A 5EH0A 4EC9A 2J5FA 4PF4A 2PUUA 3TTIA 4TWOA 4K0YA 3ZONA 3WBLA 4AZWA 5D11A 3LZBA 3ENHA 4N4SA 3R9OA 5C27A 2X6DA 2BPMA 4K9YA 2BUJA 4L45A 2AUHA 2C0IA 5CZIA 1IAJA 3NW5A 4DG2E 2WD1A 3PG3A 2R3KA 2CPKE 4UMPA 5AV3A 1BI8A 2X9EA 4FGBA 2BALA 4KAOA 3RWQA 4EZ5A 2ZV7A 4JS8A 4LRMA 1H28A 4CKRA 3WE4A 1APME 1W84A 3COHA 2WMAA 1G8AA 2C5YA 3UBDA 5IH5A 5L6PA 4M7IA 4J98A 4YO6A 3HVCA 4UZDA 4F4PA 4ZY4A 2WB8A 3MB6A 4EOIA 5BUJA 3NYVA 2BKZA 4MXYA 3TKHA 5DG5A 2C3LA 3FMKA 4F0GA 4O6LA 1J91A 2QLQA 2W0JA 4IB5A 4IJPA 3ZLWA 4U44A 1PXIA 3JY9A 5CAQA 4YPDA 4N0SA 4OBPA 4BIDA 3V04A 3MN3A 5HG8A 3DK6A 1U54B 3QA0A 3Q53A 4I6BA 4JAIA 3PZEA 2OJIA 1J1BA 2DUVA 3TIZA 3V6SA 3VUMA 4QRCA 4TYJA 3LW0A 4BIEA 4H1MA 5JRSA 4YJOA 2YM4A 1H1WA 5FEDA 4U3YA 5CSHA 4WRSA 1PMEA 3C4WA 3DAJA 4J53A 3PFQA 3DXNA 5L4QA 1JKKA 3AGLA 5D7VA 4RA4A 2YM7A 3AT4A 1OL7A 4JBPA 5DT4A 4YP8A 5TOZA 5J5TA 2XZSA 4HGLA 4EH6A 2PTKA 3A99A 1W98A 4RX9A 4XV2A 5B2KA 2VTSA 1ND4A 2R3QA 2W1CA 4R1VA 1H07A 4FTQA 4J1RA 2XIYA 5KE0A 5BX0A 4JQ8A 4Y95A 1U5QA 2VTRA 3E88A 4KIPA 4EZ3A 3ZXTA 2WMTA 5E1EA 4CSVA 3L9LA 2UW6A 4XG4A 4YU2A 3LXKA 4R3PA 3NWWA 4WT6A 4L3JA 5FEEA 1Z5MA 4HYUA 5BVWA 2P55A 4I5HA 1OECA 3MV5A 2R0IA 3JYAA 3KULB 5CI7A 4F9CA 3BHHA 4ZMEA 4U80A 3UMXA 2QQ7A 1ZOHA 2B7AA 3ZM9A 2OZOA 5HCXA 2JDOA 1X8BA 3HRCA 2EUFB 3QTSA 4YO4A 5I9WA 1GY3A 1UWJA 1YOJA 4QTAA 4X3FA 1Z57A 3R8PA 3W2CA 4EYJA 5JKGA 4W4WA 1AD5A 3UO5A 4EYMA 4RX5A 5AWMA 2XVDA 2DWBA 2ITYA 4D55A 4OLIA 3A60A 3BYSA 2NP8A 1WMKA 4X21A 2VGOA 4YMJA 2PUNA 2R3HA 3FY2A 3SD0A 1NW1A 3S95A 5AR7A 2OFUA 5HTIA 2Z7RA 5JGBA 2VO0A 1YDRE 3LIJA 2RSVA 3FPQA 2GNHA 1YXSA 4NM3A 1K2PA 4BCNA 2ZOQA 3OMVA 4NCTA 5IZFA 4QMYA 5I9UA 3QC9A 3PWDA 2CCHA 4EUUA 4LL0A 5FTQA 4JG7A 4PMSA 3PXQA 4N6YA 4GRBA 3SKCA 3TZ7A 4OAUC 3C13A 4ASDA 5CEMA 3Q6WA 4X2GA 2UZEA 5CEKA 5IUHA 3UOLA 5JH6A 2KULA 1OBGA 4O7SA 1NXKA 5AR5A 5HHWA 4NW6A 2ZDTA 5CS6A 2F7ZE 5JSMA 1OIQA 4HGTA 4ALUA 1H25A 2G01A 4YZNA 3PPKA 2Y4IB 5E7RA 4FV2A 4TWPA 5HG7A 2YITA 4ZZNA 2ERZE 1V1KA 3WF7A 3NMUF 3R63A 4MBLA 4BCJA 3BELA 1O6YA 3EN7A 5J1VA 1UNGA 4Z9LA 5HVKA 4ASEA 2W5AA 1HCKA 4W9WA 3AMBA 4FE2A 4QP7A 1FVRA 2G2FA 3EQCA 3TUCA 4PPAA 3PA3A 1W7HA 2R4BA 1MRUA 4YTIA 4BIBA 3QXPA 4Y72A 3DDQA 2Q83A 2QKRA 3ZZWA 3TV6A 3HUCA 4BKZA 5M08A 2WIPA 2FVDA 5K0KA 4CRSA 2F49A 4CQGA 5IF1A 3C9WA 2CMWA 5AMNA 5JGDA 2Y6MA 3ET7A 3KXMA 3QC4A 1KOAA 3E8NA 4U9AA 4CFVA 5CWZA 3R8VA 3KU2A 4C37A 2O64A 3U4UA 1A48A 3UQCA 1VJYA 3QGWA 5DLSA 4EJNA 4IH8A 2O2UA 3TCPA 4BYJA 4BRXA 3UVPA 4DCAA 2X4ZA 2Y4PA 2C3IB 5B2MA 3DAEA 3DBDA 2WO6A 5JK3A 4DBXA 3P7CA 4D0XA 1B38A 4XBUA 4FIJA 4QP2A 3WZKA 5FDPA 3GOKA 3C5UA 2UW7A 4K33A 3BU3A 3R8UA 4WNMA 3M1SA 3VS7A 5HQ0A 3S00A 4FKOA 3MSSA 3VF9A 4JT3A 4Y73A 2B52A 2RG6A 5ANOA 3QBNA 4IZ7A 4O84A 3PJCA 1SM2A 1TQMA 3QD4A 4WBBB 4FK3A 4QYGA 4BCKA 5E8SA 4O7YA 4I3ZA 2GHMA 3R01A 5KZIA 2OFVA 3CY3A 2QLUA 1P4FA 3QZHA 5K9IA 4XS2A 4NKAA 2W1ZA 3N51A 4XOZA 4KA3A 4OTDA 3DU8A 5BVOA 3AD6A 2RG5A 2BR1A 2WEVA 4OW8A 2PMOX 2W1DA 3RP9A 1R39A 3PG1A 3G9LX 3R28A 5EOBA 3VQHA 3OD6X 2VTHA 4TNDA 2BHHA 2WTIA 4BDBA 2CNVA 3UZPA 3GU5A 3QHWA 2QOKA 3UQGA 4MNFA 3TUBA 3EIDA 4I1ZA 4QQCA 3QTWA 4DAWA 1H0VA 4EONA 5IMXA 5TE0A 3ELJA 2Z7LA 3Q60A 4PP9A 3QQFA 4WHZA 5EHYA 5F95A 4AW1A 2BZIB 5CU4A 1PXLA 2UZNA 4FV0A 5EHOA 1Q4LA 1YQJA 3QD3A 4RWLA 4TTHB 4C4GA 3ZBXA 4O96A 5J5SA 3W8QA 3OROA 5C26A 5BUIA 5CAVA 4A7CA 4FV1A 3PRIA 3M11A 4GG7A 3TUDA 2PK9A 2YABA 2I0EA 2Q0NA 3O8TA 4JNWA 4XEYA 4RJ6A 2W4OA 2F57A 3F9NA 3WI6A 1Y6AA 4K1BA 5A4TA 1JSVA 3FQEA 3LM0A 4RVKA 2VRXA 4V04A 3OFMA 4TW9A 4P2KA 4O2ZA 3FSKA 4WG5A 1V0OA 4E93A 4O0XA 2XMYA 4IFGA 4QNYA 5J79A 4XLIA 4F63A 3FL5A 3PJ1A 2V22A 4G3FA 1UU7A 5KKRB 3UIXA 5M06A 4MKCA 3UTOA 3W2OA 2R3MA 3UO6A 4F6SA 4I93A 2KTYA 4S30A 5BVKA 3TXOA 3UNKA 2XH5A 5HESA 4R77A 2EXMA 5FLFA 3NIZA 2UVXA 1JPAA 3A7IA 4GVJA 3TDVA 2WAJA 1GIIA 3OCBA 2X6EA 3H0YA 2VX1A 4AOIA 2QC6A 5EW3A 1DAYA 3FLWA 3BV2A 4R6VA 4UB7A 4DFLA 4JR7A 3I7CA 1YWNA 5B0XA 3K3IA 2WMWA 1V0PA 5M55A 4EOSA 2REIA 1YHSA 4WIHA 4F7NA 4ID7A 5E91A 2J7TA 3EYHA 3BX5A 3VS4A 3ZOSA 5IH6A 3I7BA 5FTOA 4BCPA 3LQ8A 3Q9YA 2BRGA 1XH9A 2W5BA 4FTTA 4IACA 3ODZX 5M4UA 3HV6A 4RMZA 3L8SA 3SOAA 4GIHA 4FZ7A 2OO8X 3QTIA 4DEHA 2UZTA 3PVBA 1BLXA 1M52A 4GT4A 4OTQA 5IQEA 3CS9A 3BCEA 3GU7A 1ZWSA 4AZSA 2XBAA 3LMHA 4XG2A 3CPCA 4YNOA 5DEWA 5BMMA 2BRNA 4IDTA 3MPAA 4FG9A 4G5JA 4I21A 4TYEA 3G2FA 4CVAA 1PXMA 4AN2A 3SHEA 2UW4A 3BHTA 5F4NA 2JBOA 3GU4A 3QWKA 4DH5A 5KX8A 3I0QA 3ULZA 4DGNA 5A4LA 1ZYJA 4USDA 3FJQE 3NGAA 5DE2A 3UG1A 2E9PA 5FXSA 3V5WA 4LUEA 4ZIMA 3RNIA 5CQUA 3WIGA 3CLYA 3NCGA 2PZRA 2JFLA 3JVSA 3KREA 2JBPA 3K5UA 4D1ZA 4XX9A 3ZBFA 2XYNA 2ACXA 4FOCA 1H8FA 3CBLA 2BIKB 3IGGA 3KGAA 4TY1A 4PPBA 3A7JA 4I22A 1TQIA 1OPKA 3HEGA 3OTVA 4U6RA 5BMSA 4YTFA 3PDTA 3FHIA 3U6JA 4FSZA 4BTJA 4HYIA 3ZCLA 3WZUA 4IXPA 3P9JA 3OCTA 4M66A 4CG9A 5AUZA 3OWKA 2C0TA 2JIIA 3F2NA 4I0SA 3VQUA 4QP8A 1BKXA 2E9VA 3QQKA 5CQWA 2HW6A 2OF2A 3R6XA 2FB8A 2X39A 5EW9A 4XCUA 3RZFA 3UDBA 2R64A 4HNIA 2HELA 5IUGA 4BR3A 4DFNA 5HLNA 5HLWA 4KKEA 4LMNA 5A6OA 2VWUA 2C0OA 4AA0A 3OBJA 4PNKA 4KBAA 3AQVA 4NEUA 2QO7A 3H9FA 1PXPA 4Y46A 3U6HA 3LFNA 1JNKA 5ANGA 2WTVA 3KRRA 4GK4A 5IA0A 3FMLA 4F9AA 4KUJA 4F65A 3VUKA 4PP7A 4BZOA 4BWXA 3PYYA 4ANBA 4GKHA 4R7BA 2R0UA 3MY5A 5AV4A 2GDOA 4TWCA 5K4JA 5HTCA 4BDAA 4HVGA 3R7VA 3GU6A 5DYJA 1P4OA 4JX7A 4YJQA 2F7EE 3QZIA 1ZZ2A 2YJRA 4J96A 1IASA 2PMLX 4X2KA 1J7UA 2FA2A 2XA4A 4F64A 4L7SA 3BE9A 3OCGA 4S33A 4GL9A 1ZY5A 3BHYA 3GU8A 3IONA 3MW1A 2QHNA 3IDPA 3P7AA 4HVHA 2V5QA 3OWJA 4C61A 1H0WA 1PKGA 2ITTA 5M51A 4BDEA 4M13A 3JVRA 5ACBC 4JG8A 3FHRA 4YJTA 4QTDA 2YWPA 4YHTA 3WARA 4ACHA 2C6TA 3VHEA 4FV6A 3S3IA 5HBHA 4U7ZA 1UKHA 2I6LA 3A7FA 4FKQA 2WU7A 4DGLC 2VWYA 4G3CA 4YNEA 3ZZEA 3BE2A 3KRXA 1E9HA 3OWPA 3UNZA 1IG1A 2Z60A 3W18A 4HCTA 3ANRA 4RG0A 3ALNA 4XG3A 2UW5A 2JKOA 3ZSHA 2Q0BA 3OWLA 4MTAA 4EHEA 4B0GA 1OIRA 4CT2A 3BIZA 4GT5A 3IW5A 5DHJA 4ZTQA 3R7EA 3FZPA 4CMUA 2HY81 3LM5A 4BBMA 4E4XA 5CAOA 5JFWA 2YN8A 2I0YA 5HD4A 1XH5A 4GSBA 5DH3A 3GNIB 5GJDA 4C57A 1R0PA 1WBTA 4QNAA 5GZ8A 5K5NA 3FZOA 1A06A 3IW7A 3TNQB 4RFMA 3VUIA 2ZYBA 4FT7A 4GG5A 4D5HA 2YIXA 4CCUA 4EOPA 3CEKA 1VR2A 4U45A 4IVDA 1O6LA 1Q97A 2J2IB 2X2LA 4USFA 4NM5A 2ETMA 1Q5KA 3L8XA 3NX8A 3E64A 3HV7A 2J0IA 4FL3A 4FSMA 3UIBA 2PHKA 3LFAA 3ZEPA 2PUIA 3DKFA 4H36A 1F0QA 3VBTA 1YXUA 1BYGA 3EFKA 1XR1A 3O8PA 2WMUA 4IAKA 5D7AA 4CNHA 3HRBA 4TYHA 4CKJA 4G5PA 4EWHA 2UZWE 2V7OA 3ZM4A 2W5HA 3MVMA 4E6QA 3SQQA 1PW2A 4R78A 1Z9XA 4JRNA 3CJFA 3FKOA 5E8ZA 5EFQA 4IVAA 4ENYA 5LMKA 1VZOA 3TNHA 3PJ3A 5CYIA 3EB0A 4O0TA 2ESMA 3CTJA 4UBAA 4C2WA 3PIYA 2QODA 3ERKA 5GHVA 2OG8A 2WMRA 1P2AA 4R5YA 5IA5A 4FUXA 4FV8A 2ITVA 4C4FA 5KMMA 2SRCA 1MRVA 4ZTHA 4ENXA 1IA8A 4WBOA 1R0EA 4A9SA 4ZZMA 3VS5A 4FKLA 3U51A 2O65A 3FC2A 2WTKB 2BROA 3PY3A 4EH2A 3MESA 2LGCA 1UU8A 1W8CA 4X2JA 3ATSA 4MBIA 4DTAA 5FBNC 2UW0A 3EZVA 3DZOA 3VUHA 3ROYA 5AA8A 5CU0A 5IDPA 1OKVA 2YFXA 4L00A 4FL2A 5AP5A 4FTJA 3RPVA 4GIIA 4DFYA 2G2IA 3OY3A 5LVNA 3GI3A 5AAFA 2AC3A 5FXQA 5DI1A 4CFNA 1R3CA 4RX7A 3ORPA 2J0LA 5DN3A 2HOGA 2WMXA 4WOVA 4G34A 1CTPE 3D7TA 3FL4A 1FMKA 5EM5A 4X3JA 4O0WA 2YDKA 3SW4A 3QRKA 4BI0A 4BZNA 3UMWA 4CD0A 4BWPA 2JGZA 3CIKA 3NS9A 3RPOA 3D2IA 5FTGA 4F7JA 4JDIA 2PE1A 4PL3A 4WG3A 2W99B 1Q3WA 3SX9A 2BDWA 4LQMA 3DZQA 3PPJA 2ZMDA 5AR8A 1W83A 4ALVA 2WZJA 5JFSA 5IQAA 5IQFA 2FYSA 1LEWA 5LWNA 1NVRA 5JT2A 2F2UA 2QCSA 2AC5A 3KKVA 3SGCA 1GIJA 3BHVA 2BILB 4RZWA 4D1SA 4O82A 4IMYA 4RIXB 5AV1A 2XB7A 2VWZA 3TV4A 2GPHA 2R3FA 3HA8A 3LJ2A 1H01A 3MH3A 5HO7A 4X6QC 2ETKA 3JXWA 3DB8A 3FMHA 5ANEA 2RFEA 1CKJA 3O17A 3BBWA 4FI1A 4OUCA 4ANMA 3BU6A 4AOTA 2HW7A 5I9VA 3VUTA 2OXDA 4E6AA 2WELA 4AX8A 5JFXA 3HL7A 1DAWA 2GSFA 3FLSA 3O2MA 4PDPA 4WA9A 5TO8A 3TZMA 5KMNA 3FYKX 4OBOA 3EFJA 5H3QA 3QD2B 4DEAA 4O7VA 2RFDA 3R73A 2ZB0A 4B7TA 3UJGA 2RFSA 1M7QA 4BKYA 4C34A 5E1SA 4O0YA 5JRQA 5E8UA 3QYZA 2J4ZA 2X1NA 3ENMA 4C4EA 5IQBA 4NKSA 1Q8ZA 5GIPE 1UKIA 3CGFA 4FV5A 3V01A 2YCSA 5LCKA 3BWJA 3ZLSA 3V8TA 3QX4A 4ZSLA 3W2RA 1GZKA 4A9UA 5BVDA 2QOCA 2VZ6A 3TV7A 1TKIA 4Q5EA 2CLQA 4ZP5A 4ZJIA 4D2WA 5FXRA 2IPXA 5J1WA 2JAVA 3PUPA 3ORNA 2V55A 4ANLA 2W1IA 3ZLYA 1WZYA 5FRIA 5CF4A 5H2UA 5C8KA 1JAMA 3EKKA 3BEAA 4FF8A 4IVCA 3RVGA 3PY1A 2YDIA 3I5ZA 4EHGA 2BVAA 2R3GA 4BCGA 3EOCA 2XNMA 5DRBA 3PSBA 4I4FA 3NSZA 3FI4A 4W4XA 3RPRA 3MPTA 5A6NA 3EMGA 1SNUA 3F3UA 3TJDA 4CFFA 2OICA 1XH6A 2J5EA 5CSXA 3QTRA 2WEIA 4GS6A 1OPLA 1U54A 4OTWA 2Y9QA 3KQ7A 4ERWA 2PULA 5BVFA 5CAPA 4L43A 5EKOA 2PE0A 3RPYA 4YJVA 4YTCA 2PZ5A 3WILA 1T46A 2WU6A 4ZLYA 3EQPA 1OL6A 2E2BA 1M14A 2ONLC 3FLYA 4XYFA 5AX3A 2GCDA 5JMSA 4KWPA 1H08A 5HU9A 5CXZA 3EH9A 4V0GB 2ZV2A 4EK6A 2EWAA 2XRUA 1GZNA 2X2MA 3DTWA 4D2RA 5IMEA 3FLQA 4HCVA 5KHXA 4FEXA 1Q41A 4EBVA 3MY0A 1H1QA 4O0UA 4EOJA 4IB3A 4XV3A 3O7LD 3C4ZA 4YJRA 2Z7QA 3FMNA 4ACMA 3ETAA 4GUBA 4GYIA 4G6NA 5L8JA 4P7EA 4DINA 3KK9A 3RK9A 4IEBA 2CN8A 4RVTA 2BDFA 2JLDA 2QR7A 4FKRA 1E1VA 5T3QA 2WOTA 5HU3A 5LQFA 3NVKI 3DFCB 1OUYA 3VUDA 1MRYA 4RA5A 2PWLA 3Q4ZA 1Q99A 2EXEA 2OKRA 4CXAA 4GEOA 3N9XA 2FSTX 4U43A 5HVYA 5CEOA 1H24A 4PPCA 4OBQA 3KULA 3VW6A 4UYNA 4OTGA 3GEQA 5A4CA 5CF6A 3NIEA 5IA4A 4PDOA 1Y6BA 4PL5A 3TI1A 1V0BA 3HP2A 4EH3A 1DM2A 4LV8A 1YWRA 3D14A 3F7ZA 2W7XA 3MVHA 2C6KA 4FNXA 4C62A 1E1XA 3IPHA 3SVVA 2VUWA 1TVOA 1Q8WA 2WMBA 3OXIA 4EI4A 3IKAA 3U6IA 3RMFA 2Y6OA 3SXRA 4A4XA 3G9NA 4BICA 3QAME 4KRCA 4ACGA 2YEXA 2C6OA 2UVYA 3C51A 2XKFA 3TEIA 5CVFA 3UP7A 3ID6C 3RAHA 1YI6A 2XK8A 3NYXA 2JDTA 4F6UA 2B9IA 3IK3A 1GAGA 5BUEA 2VO7A 2C3KA 3G5DA 3QRJA 4MXOA 4XHKB 4E3CA 3OXTA 3EYGA 4RJ3A 4FUYA 4F7SA 4G3EA 1WVYA 3KB7A 3OW4A 3VS6A 4J97A 1NT2A 1ZYDA 1REKA 4LOOA 5I9XA 3S1HA 1B6CB 1UNHA 3LFCA 4M69A 3RAIA 4Y5QA 3V5QA 3MBLA 1G3NA 4K8AA 4QQTA 3R7IA 3ITZA 4KIQA 4AUAA 2WQBA 3PZHA 4ZSAA 3ZTXA 1S9JA 4FT5A 4L68A 3EHAA 4IX4A 3PIZA 2W06A 3PSDA 5DBXA 2UUEA 4TT7A 2ITUA 2ZJWA 3F5XA 4G9RA 5BYLA 2QI8A 4RT7A 5F94A 4KBCA 4PY1A 3OCSA 5C1QB 2H96A 4ASZA 2F4JA 4DBNA 2CJMA 4FK6A 3HA6A 4IWOA 1YOLA 4PQNA 2XJ1A 3VIDA 4QP4A 2PZYA 3E3BX 1KOBA 3ZFXA 5EI6A 4U0IA 1UNLA 3KA0A 3DNDA 4IB0A 4U8ZA 4BCHA 4OR5A 4K18A 4FIFA 4RJ5A 1NA7A 4ITIA 4KKHA 4AZTA 2I0HA 3B8RA 3TIYA 4H3QA 4RSSA 3QQUA 2G9XA 2QU5A 3A2CA 3LCTA 4FYNA 3BGPA 4KS8A 4M0YA 4M12A 4BTMA 3WIKA 2YIRA 4EC8A 4OGRA 4IWQA 4DGMA 2VTLA 4F9BA 5KMOA 5DR6A 3MJ1A 3ORTA 5I3RA 4C2VA 4IZYA 3A8XA 4O2PA 3AC8A 4QMTA 4EOKA 3PXYA 3ZC6A 3ZO2A 3OC1A 4JBVA 4CYIA 2PVNA 2R9SA 4G17A 4HGSA 4OAVB 5HI2A 3RNYA 4UWCA 3QQJA 4E73A 4D2PA 5DGZA 1FVVA 5TT7A 3R7UA 5KUPA 3MFRA 3OUNB 3QFVA 3QUPA 3LFEA 3LPBA 4GMYA 4PRJA 2W1GA 2IW9A 4C0TA 2ZDUA 4JAJA 5B2LA 3OY1A 4J8MA 2ITXA 2VWWA 2BZJA 2GNFA 2A4LA 3FZRA 4M69B 4RIYA 5TKDA 3T3VA 5EKNA 1QPJA 2C6DA 3HRFA 4AN3A 4DEEA 4K6ZA 4C4JA 4AOJA 4X3FC 4D0WA 4A9TA 2W1EA 4FIHA 2VTAA 4FA2A 2VX0A 5I9YA 3DKOA 5HE3A 4RIOA 2ZMCA 2HZNA 4QPSA 3LVPA 1XQZA 2UZOA 3MDYA 3IDBA 4EQCA 3AT3A 1PKDA 2F9GA 3RBWA 4MCVA 5FUTA 2X8IA 4KIKA 3Q4CA 3CD8A 4BCIA 3BYUA 4LI5A 1GNGA 4XRLA 3OW3A 4IVBA 4J71A 4FTRA 5FQDC 4KKGA 3PE2A 4BZDA 2GQSA 4NCTC 4YJUA 3GENA 3MFUA 1OIYA 2ITWA 4I0RA 4R7IA 3UQFA 2YIWA 4YSMA 5HCYA 3BRBA 3DJ6A 1Y8GA
chains in the Genus database with same CATH superfamily
3LQ5A 3BU5A 4FKGA 1IA9A 3LFFA 4DH3A 1RW8A 4CZYB 4CMOA 2IZTA 3MFSA 4DITA 3W0OA 5HORA 2XNOA 2XK9A 4FIGA 3Q52A 2RFNA 5DNRA 3Q04A 3PIXA 4ZTLA 4WD5A 4RPVA 4YSJA 4O1OA 4L01A 3LFDA 4V05A 4FVRA 5BYYA 5A46A 3LHJA 3UYSA 1XJDA 1OPJA 3BYVA 3QTXA 3NDMA 4X6RA 3LMGA 3R8MA 5JZJA 2H8HA 2CKEA 2JKKA 5LVPA 1Q61A 4AA5A 1KV1A 1L8TA 3ZLXA 4NJDA 3I1AA 3TG1A 1VYZA 2WTJA 3EWHA 4IZ5A 4U5JA 3G90X 3O96A 4MAOA 4BBFA 5AIKA 3O5AA 4K2RA 3NYOA 4Q5HA 4JIAA 4YC8A 4Z3VA 1J3HA 4F1OA 2UW3A 1JVPP 3BKBA 2EB3A 1P5EA 3ZRMA 3RALA 4GU9A 4RIYB 2IJMA 3B2WA 3MTLA 4TZRA 4H05A 3E63A 4K77A 5GJGA 4R3RA 2C6IA 2CKPA 5EQPA 2X8EA 3B2TA 4JMQA 2JITA 2X7GA 3O71A 4ZLZA 5BV3A 3MA3A 4C38A 5J9YA 3GP0A 4TYGA 2W4JA 4LV5A 4CT1A 5CVHA 4F1TA 4IE9A 3TACA 3SV0A 3W32A 4ALWA 3KY2A 4J8NA 3DGKA 4D9TA 4QYHA 3PUFC 3NNVA 2OZAB 3PXRA 3GVUA 4KIKB 5L2TA 5M4IA 4UY9A 1XH7A 1DI8A 4DTKA 2QOQA 3CXWA 3DA6A 4NZWB 4RZVA 3OVVA 4ZXTA 3MVJA 3ZRLA 1YXTA 5CVGA 4ZSGA 2X0PA 5M56A 3BGQA 3LKMA 2YM5A 4IAZA 3W2SA 3SRVA 3A8WA 5HO8A 5IA3A 4APCA 3DQXA 1ZXEA 3O8UA 3SAYA 2XEYA 3F61A 5EOLA 5AUXA 3L9PA 4M8TA 3VAPA 2CDZA 4F08A 2QOLA 3ORLA 3GCSA 4Q9ZA 5A4QA 4NK9A 4QMOA 3NUUA 4L46A 5E8WA 4BFMA 4XBRA 5L6OA 3W0NA 5IQGA 4QMQA 4XOYA 3FDNA 4TKSA 3OP5A 4BDFA 2B9FA 2QOBA 4I20A 4JDJA 3Q2MA 4E26A 4BJJA 2UW8A 3PP1A 1XH4A 2OK1A 4NIFB 2NRYA 4HZSA 4C36A 4XJ0A 2QU6A 1WBPA 1I09A 4D4SA 4EOLA 4FZFB 4O7WA 2XEZA 5LXMA 2ERKA 4JG6A 3TZ8A 5J9LA 5AR4A 3MI9A 4R1YA 3RAWA 3R0TA 4IW0A 3W2PA 3MH2A 3BYOA 4FKVA 3LAUA 3HMNA 4C7TA 5DOSA 2J90A 4IWPA 2YZAA 4PMMA 1SVGA 3HMOA 4FG8A 5HG9A 5HIEA 3PJ8A 4WNKA 3DPKA 1SVEA 2PL0A 1TQPA 3H0ZA 4QMUA 5KMIA 2IWIA 2A0CX 2JDVA 2JIUA 2OI4X 4Q2AA 2XCKA 3A4OX 2P2IA 3BYMA 3H30A 4S2ZA 4I5PA 3TMOA 2BDJA 3ROCA 2GMXA 1IRKA 4Y8DA 5A4EA 2FGIA 2PE2A 2R3JA 4O86A 3L9NA 5IQIA 5HE1A 3K54A 4BDKA 4NYEA 5LVMA 3ZSIA 4Z55A 2VTIA 4IJ9A 1YDTE 4WUAA 3KRLA 5DIAA 5CU2A 2UZVA 2V0DA 3K2LA 4RIWA 2XIZA 3GC9A 3CP9A 4WUNA 4XP2A 5CEIA 3QUDA 4D4YA 3R1NA 1L3RE 3F82A 3SRVB 5HGIA 5IA1A 2VTQA 2FSOX 2PZIA 3V5LA 4O7TA 4QOXA 3HV3A 3Q6UA 2QHMA 2UZBA 4AZVA 4YJNA 1Q8UA 4F1MA 4CCBA 3NFFB 5EM6A 2W17A 4QQJA 2PVYA 3JY0A 4FOBA 4DLJA 4DH8A 3FUPA 3W8LA 3PLAE 3O51A 4E7WA 5CU6A 5FM3A 2WMQA 3IDCA 5KMJA 3TT0A 1H1RA 2PVLA 4YZ9A 5K3YA 2GS7A 3R30A 4ZJJA 3RINA 4BN1A 4EBWA 1KE8A 3C4FA 5DFPA 5ETIA 4O7ZA 4PL4A 3EQDA 2CSNA 3QCQA 4G31A 1LEZA 3L8VA 3OOMA 2XIKA 4FVPA 4E4LA 4YJSA 2WPAA 3B8QA 4DC2A 4FEVA 3D15A 3ZEWA 2CGUA 1ZZLA 2FSLX 5IQCA 3FAAA 5DEYA 3SG8A 4F09A 5TR6A 3E8DA 3VULA 5KHWA 2ZAZA 2W9FB 2ITNA 4FSUA 1XWSA 1ZYCA 4JI9A 4LL5A 4RGJA 4W4YA 3WOWA 1LP4A 3F7WA 4EH8A 2J9MA 4OTPA 4XP3A 4AZEA 4CFWA 3UODA 4TYIA 4HW7A 4TN6A 4O81A 3DXQA 1XBCA 4ZTNA 5JQ8A 5HX6A 3QUEA 3QD0A 5GNKA 2PVMA 2UZLA 2QURA 3S2PA 4CTBA 3I79A 5IG1A 3KCKA 4BY9E 3U54A 2VTPA 3KEXA 4IM2A 4E5WA 3HGKA 3HMIA 5I3OA 3ZUVA 2BTRA 2PSQA 1BI7A 4Z7GA 3ANQA 3OOGA 4XP0A 2QNJA 4D4VA 4WSYA 2H6DA 3FI8A 1Q8TA 1U4DA 3GQLA 4CLJA 3R9DA 2X2KA 2JFMA 3NUXA 3F69A 3IW4A 2WQEA 5AR3A 2CLXA 2W05A 3P78A 2HZ4A 3QHRA 3W1FA 4BL1A 5A14A 1KUTA 4RIWB 3SLSA 2CGVA 3P79A 3QZGA 4DFBA 2C6EA 2YM6A 2QG7A 5J7HA 4LV7A 3CD3A 3PJ2A 3TN8A 1PXKA 4F6WA 3A62A 5CSPA 5LVOA 1O9UA 4FSQA 3HV4A 1YWVA 4XLVA 4A07A 1F5QA 3ACKA 5C03A 1URWA 3E87A 5ITAA 1UU3A 3HAMA 3S0OA 3RHKA 5JQ5A 3QTQA 4FKSA 3SC1A 4D2TA 2R2PA 2E9OA 3EN5A 3UZRA 3V51A 3GB2A 2R7BA 2XNNA 4PTGA 5HTBA 1M17A 2GNLA 3MWUA 3CC6A 5AP7A 1XKKA 3GOPA 2B0QA 2BKKA 2E9UA 3DKGA 5FG8A 5CSWA 1PXNA 4F9WA 2C6MA 2G2HA 3PA5A 1ZARA 2W96B 3QTZA 3WF9A 5K4IA 1YW2A 4CFUA 4FMQA 4U42A 4FSWA 3W2QA 4ANOA 3FXWA 1RJBA 5CTPA 3BV3A 5IISA 1SNXA 4IX6A 4DLIA 4WSQA 4MEDA 4C35A 4EQUA 2YJSA 5AX9A 3PLSA 3QRIA 3S4QA 2Z8CA 4GFMA 3RK7A 5FD2A 5EI8A 3I0OA 2PMIA 4UALA 1OL5A 4A4OA 1OM1A 3MH0A 3M42A 5L2WA 3WZJA 2RGPA 2X7FA 4BF2A 2OF4A 3WZDA 2GQGA 3VS0A 3NEWA 4EK3A 3RHXA 2CCIA 3LE6A 2IW6A 4TL0A 4XG8A 1KE9A 4WKQA 1QPDA 2C68A 4F0FA 5FEQA 3CQUA 1OVEA 1YI3A 4IC8A 2IVUA 4O27B 1VYWA 4R3CA 5E92A 4DH7A 3NCZA 3ZDUA 4GV1A 3HP5A 4RIXA 1R78A 3TWJA 2VTJA 2QOIA 4FTIA 5JFVA 3DFAA 3R7OA 4QP9A 3F5GA 3R8LA 2IF8A 4QMXA 4BB4A 3QU0A 3DLSA 2C6LA 2WQNA 2QOFA 3QRUA 1OL2A 2CGWA 3ORIA 4FTLA 4I41A 2X4FA 1PHKA 3ACJA 4ZS4A 3MB7A 5CEQA 4ZSEA 3AOXA 3C5IA 4NTSA 4RC2A 3I6UA 4HPTE 3FV8A 3DLZA 4J7BA 5FGKA 3CQEA 2R3LA 4R7HA 3CKXA 4BDJA 4C3RA 2GS2A 4Z7HA 2J50A 3RWPA 1OIUA 4AU8A 2HZIA 4M67A 4IDVA 2EVAA 5DWRA 4XUFA 3KF7A 2YCFA 5I9ZA 2J0KA 4II5A 4MK0A 4C3PA 1OZ1A 5JEBA 3ORMA 2XM9A 4JBQA 3VVHA 2X0OA 5AAEA 3CJGA 2X7OA 4YC6A 3KL8A 3JUHA 4AACA 1JSUA 3QCYA 3TNPC 3ZFYA 3SW7A 4QTEA 3UOJA 2YERA 2HY0A 4W8EA 5EYMA 2YLFA 4WG4A 4LGGA 4JL9A 3RPSA 4EH9A 2GNGA 4FSNA 1ST4A 4H1JA 3NNWA 4MNEB 4MQ1A 4PTEA 1EH4A 2C47A 3GT8A 4I0TA 5IEXA 2B53A 4LGDA 5LMAA 4NH1A 3RM7A 3HMPA 2O0UA 4R8QA 3D5XA 3RAKA 4MBJA 5EM8A 2IVSA 4AT4A 3THBA 3QF9A 2XK3A 4FSYA 4P4CA 2BZHB 2OLCA 3F3ZA 1M2RA 2I1MA 5EDRA 5C4KA 4ZOGA 3PVUA 4RBLA 4TRLA 3BQCA 1XHAA 1YXVA 5LWMA 3HYHA 4D4RA 4FV3A 3ZU7A 1QPEA 1J7IA 2V7AA 2A98A 4YLJA 3FXZA 5CU3A 5AP6A 4FZAB 4IANA 4Z16A 1A9UA 3HNGA 4WRGA 4ANSA 3LCKA 3R71A 3FBVA 4EH4A 3T8OA 5CX9A 2IZSA 4L67A 3UC3A 2EU9A 1G8KA 3NYNA 3E8EA 4UMQA 4V0GA 1OBDA 4KRDA 3UOKA 3HX4A 3LFSA 4ONAA 3R9NA 3NVMB 3AC2A 4UZHA 4FR4A 5EYKA 3MFTA 3VJOA 4CZTA 5AUVA 3C0IA 4QP6A 5IQHA 5CSVA 4QMVA 5AM6A 5ETCA 4DDGA 2RKUA 3KMMA 3LJ0A 3ATTA 3T9TA 1PMNA 2VN9A 3MS9A 1R1WA 2A2AA 2XS0A 1YHWA 2WTWA 3PY0A 4IADA 2CNQA 2BHEA 3HAVA 3ALOA 3MGYA 4X7QA 2PYWA 2IN6A 4GFGA 2OJ9A 3V5JA 1ZAOA 3BBTB 3E7VA 2BAQA 3GQIA 4BKJA 4FRFA 5AP3A 5EQEA 3QKLA 4LRKA 4M97A 4EH5A 5E8XA 4AGUA 2Z02A 4EEVA 4EJ7A 4BDDA 5JN2A 3P86A 4LUDA 1Q62A 4KSQA 3DBFA 3E3PA 2GHLA 4JRVA 4CKIA 4EOQA 4QYEA 3UYTA 4QMLA 3MVLA 4ANNA 1PYEA 1YOMA 2Z7SA 1SMHA 4JQEA 3TNIA 3UE4A 4EK5A 3DT1A 4DG3E 2DYLA 3R1YA 3ZO1A 2IO6A 4MD8E 4CV9A 2XAOA 4B6LA 3E92A 4IBMA 4L53A 2JDRA 4NJ3A 4BGGA 3O23A 3HECA 4G6OA 3NUAA 4GK2A 3QA8A 3QKKA 3R21A 4MXCA 3GFWA 3L9MA 2PVJA 1LR4A 4DGGA 4CZUA 4JBOA 4DCEA 3OXZA 4I4EA 3II5A 2P2HA 4IB1A 1OKWA 3D2KA 3V8SA 2XNBA 4LOPA 1QMZA 3ZXZA 4I6QA 2OSCA 2Z2WA 4G2FA 3PSCA 3ULIA 3NRMA 2XKCA 1IEPA 3IW8A 3MY1A 5KCVA 2C1AA 2QO9A 3H9OA 1M2PA 1W0XC 3MH1A 3DQWA 3Q9XA 4KS7A 5ANDA 3D5WA 5EK7A 3DCVA 3KXHA 1ZYLA 4HJOA 1YRPA 4NWMA 4UWBA 5HICA 3TL8A 2YIQA 2BZKB 4UX9A 4K11A 3POZA 3VBXA 4BCOA 5CASA 2R3IA 5I5ZA 3JS2A 4MYGA 3NUYA 3W0QA 2BFXA 2OIDA 3TKUA 3QXOA 4X2FA 4AXEA 3R22A 4MHAA 1GZ8A 1J7LA 3F5UA 4DHIB 2G1TA 1GJOA 1PMVA 3PTGA 4AA4A 5GINE 3GGFA 3G33A 1OB3A 3AC3A 5E8TA 4FZDB 3FSFA 3VJNA 4Q9SA 5AIRA 2R3NA 5M09A 2UW9A 4AQCA 3PWYA 4FIIA 5AEPA 3CGOA 2ZB1A 4FG7A 4U3ZA 3SA0A 4H3BA 5LJJA 3GFEA 4O6EA 1BX6A 4RX8A 5DT0A 3H3CA 4FV9A 4RWIA 5FWKK 5LVLA 1UWHA 5T68A 3TTJA 2YWVA 3DKCA 1JLUE 2ITZA 4FICA 5EHLA 3CPBA 3D83A 2X9FA 2YM3A 4QMWA 5E90A 1FVTA 2YAKA 3G51A 3KVXA 3L8PA 4BGQA 4C33A 3W16A 3HLLA 2R3PA 2JEDA 3UIMA 3U55A 4OT6A 1MUOA 2BAKA 1UVRA 3BQRA 2UV2A 3EQBA 3VBYA 4QMZA 2C4GA 3KMWA 4W4VA 3GC8A 5HO6A 4NFNA 5F9EA 2VWVA 2XBJA 2WHBA 4J95A 3DBEA 4AAAA 2WOUA 3F66A 4FTKA 4JDHA 1BUHA 3OEFX 4W9XA 3G15A 2XKEA 2UVZA 4AGCA 1U46A 2OGVA 1JKTA 2VNWA 4GVAA 4QTCA 4I24A 3NAXA 2OJJA 1DI9A 3KF4A 5CT7A 3KVWA 1FMOE 2NO3A 2VNYA 3TNWA 5K0XA 3BL7A 5EW8A 5T6KA 4AXAA 5M57A 2OJFE 1URCA 3W0RA 3OUKA 4DA5A 4B99A 4MF1A 2YAAA 4IM0A 5BPYA 2F2CB 1NVSA 5EDPA 1RE8A 2JKQA 4FL1A 1S9IA 3N4VA 4IHPA 2BFYA 4FT9A 4LG4A 4CEGA 1J1CA 3UOHA 3AGMA 4JX3A 1AQ1A 4G3GA 1QCFA 3AC4A 3DK3A 4CFXA 3W10A 2ZV8A 4TXCA 5LOHA 4FODA 4BHNA 2BIYA 4M15A 1XBBA 2R3OA 2PMNX 1CDKA 2IZRA 3K3JA 4IAFA 4V01A 4YZBA 1JWHA 2XCHA 4BI1A 4EK4A 1SZMA 3FQHA 4QEBA 4EK8A 3ZC5A 2WIHA 3FZSA 4BTKA 3MJ2A 3FKNA 3COKA 4L3LA 3W0MA 4PV0A 5D12A 1U5RA 1IR3A 2HWOA 3P7BA 2FSMX 4BDHA 1TFFA 4RQVA 5CT0A 4M14A 5EQYA 3LLTA 5E8YA 2QO2A 2J0MB 2XNGA 3PA4A 4XG6A 4FT0A 4MD7E 5KMLA 2CHLA 4F9YA 1JOWB 3AXWA 1G5SA 4HCUA 3U4WA 4FEWA 5LCJA 1Y91A 3R04A 3RCJA 1FGKA 3OTUA 3I4BA 2ITPA 4FV4A 3KXGA 3ZYAA 3HMMA 4AXCA 4IAYA 4ZMFA 3P0MA 4O7RA 3RKBA 3DV3A 4J52A 2XK6A 1FINA 1OUKA 3VWAA 1YXXA 3F5PA 4WO5A 3F2AA 4JR3A 3RJCA 3H10A 4ERKA 3AMYA 3KRWA 5IQDA 2R3RA 3I81A 3DJ7A 4OTFA 2B55A 3NR9A 2XALA 4PDYA 4AXDA 5FBOA 3UZTA 2VWBA 5J95A 1AGWA 1VEBA 3AKLA 5FM2A 1YVJA 4HGEA 2CKQA 4EZ7A 4FGRA 3D5UA 4EQMA 1PMUA 5M4FA 2CGXA 4DTBA 3LCSA 5A9UA 1K9AA 2B54A 2Y4IC 4IX3A 4WNPA 3WF8A 3PRFA 3DJ5A 3EN9A 2V62A 3VBVA 3GCUA 2XIRA 3ORKA 4LOQA 5DVRA 4EWQA 4IAAA 5DMZA 3UPZA 4DHJA 5L8KA 5G1XA 2H9VA 2FH9A 3F3WA 5AP1A 4HVIA 5CANA 2OU7A 4FEQA 4OTHA 2OJGA 4S34A 3EN6A 1CSNA 1ZY4A 4P5ZA 4CRLA 4QMNA 1KE7A 3MYGA 4I94A 4F70A 2WMSA 5CALA 3C4CA 5D9HA 5AFVA 4YZMA 4FVQA 5AP4A 4IX5A 4RQKA 2AQXA 3ZDIA 3RM6A 3TM0A 3DDPA 4E4NA 2HXLA 3MA6A 4GYGA 5BVNA 1OKZA 2RIOA 5JGAA 3EFLA 1FPUA 3K5VA 4YPSA 5L2IA 3NUPA 4PTCA 3BLQA 2YIYA 1DS5A 1JSTA 3E93A 2OBJA 2YCQA 4FC0A 4AW2A 4O7NA 3EN4A 2BRHA 4AF3A 5K5XA 2VU3A 3QWJA 3MPMA 4DF3A 3LCDA 3ODYX 1LUFA 5J8IA 2B9JA 2OZAA 2WQMA 4O0SA 4FV7A 1UA2A 4O1PA 4QP3A 3U9NA 4CTCA 2PU8A 4O0VA 3U9CA 3KIOC 4AP7A 1IAHA 4DT8A 4L44A 2XF0A 4YLKA 4L52A 3FMMA 4BBEA 2ZV9A 5HOAA 3UDTA 3BWFA 4EL9A 5J9ZA 4ITJA 1FQ1B 1H4LA 3O50A 3QRTA 3FZTA 3KK8A 4KSPA 2O8YA 4DGOA 2XUUA 5KMKA 2CN5A 4B4LA 4DYMA 4JDKA 3RZBA 5IKWA 4PMPA 4O7LA 3IGOA 2C5OA 3R1SA 2QKWB 4B8MA 3FZ1A 2WTCA 3UP2A 4MVFA 5LARA 5EI2A 1WBNA 1GZOA 3U8WA 3GBZA 3AD5A 2EXCX 1XH8A 3C4EA 3COMA 3LXNA 3HKOA 3L1SA 3PVGA 3Q96A 5KZ0A 2VO6A 3W0PA 2C30A 2F7XE 2WQOA 4ACDA 1QPCA 4NIFA 2XANA 2XKDA 5EG3A 3DAKA 3ZUUA 4N57A 3KXZA 4HPUE 1OGUA 4ZAUA 4ZS0A 4X3FB 1YDSE 1G8SA 2I40A 4QO9A 3ORXA 2WGJA 2DS1A 5EYDA 3RCDA 4YURA 4AS0A 5HX8A 1PXOA 2GFCA 2HAKA 5FP6A 4MUQA 5L8LA 4M68A 4AWIA 3AMAA 4P90A 3FQSA 5ETAA 4UV0A 3D4QA 4BGHA 5CF5A 3QTUA 4E1ZA 3PXFA 2W9ZB 3ZHPC 5JZNA 2QD9A 4FZ6A 4IFCA 4AFEA 4QTBA 4M3QA 3V6RA 4KINA 2YA9A 3QLFA 4DG0E 4BCQA 3DNEA 4XG7A 2ITQA 4FTMA 3BZ3A 4IZAA 1OI9A 4B9DA 1VLRA 3PVWA 2BCJA 3ZFMA 4GH2A 4G6LA 4E6CA 5L2SA 2GTMA 2CNUA 2WXVA 4H3PA 3CKWA 4RC3A 4BDCA 1H26A 3FMJA 4MX9A 2VX3A 5HE2A 3UVRA 1JQHA 3UG2A 3VO3A 2Y0AA 3H4JA 3TKIA 3ZMMA 3KN6A 3ZO4A 4A9YA 5KKRC 3NW7A 4DEIA 2QOOA 4YR8A 1PYXA 3QLGA 4I92A 3VHKA 2VTOA 4A06A 1Y8YA 3QQHA 4ZTRA 4CGAA 1YI4A 2OH4A 4UMRA 4U81A 1M7NA 1WVXA 4NSTA 5C4LA 3LFBA 4MH7A 3SXSA 3UC4A 3FMDA 4C59A 4MWHA 5HE0A 3WE8A 1PRYA 1CM8A 1JKSA 3D7ZA 3Q32A 3KMUA 3SXFA 4NTTA 3NLBA 4USEA 3CTHA 4UXQA 2W1HA 3DB6A 4JJRA 2W1FA 4FKUA 5HNIX 5HD7A 3N4TA 2P33A 4UXLA 5CENA 2PVHA 3PXKA 3GXLA 3VRZA 4N70A 3I5NA 4E20A 4U41A 4C8BA 4ZK5A 4MXAA 2FUMA 5CNNA 3DK7A 4HVSA 5CAUA 2YISA 2OXYA 3QCSA 2O63A 2XM8A 4ZTMA 3V5PA 5AUWA 3SDJA 3VS1A 2Y8OA 5HLPA 4AGWA 2GFSA 3OZ6A 5KO1A 5IEYA 3VUGA 2HIWA 5CF8A 2PY3A 4ZLOA 3BHUA 4EUTA 5TF9A 4JXFA 1K3AA 4O0RA 1OKYA 2GTNA 5IA2A 2FO0A 4L9IA 4LGHA 4RRVA 3VBWA 4EH7A 5AAGA 2ZVAA 4C58A 3HZTA 3KFAA 2B1PA 5DR2A 3IECA 3P5JC 4CFMA 3EFWA 3W0SA 4LFIA 2GNIA 3KXXA 4A4LA 4D5KA 3JPVA 2X81A 3TDWA 2HENA 4FBXA 1U59A 3GC7A 2ZM3A 5E8VA 4O83A 5E4HA 4S32A 2C5VA 1ZYSA 4MWIA 4U79A 4FKIA 4AN9A 2RF9A 5ANIA 4UYAA 4YBJA 3C4XA 5FP5A 4MD9E 5D1JA 4QYYA 3REPA 4UN0C 4DFUA 3W55A 4IQ6A 2B9HA 3DXPA 4GUEA 4AW0A 2IG7A 3Q5ZA 4AQKA 4LMUA 3RI1A 2JKMA 2JD5A 4JIKA 2VTMA 5IPJA 3AC1A 4R5SA 5AR2A 2PPQA 1WFCA 2I7QA 3D5VA 4O38A 4DEGA 2GHGA 2JAMA 2J0JA 4GW8A 4YBKA 2VTNA 2QVSE 3P5KA 3Q5IA 5DRDA 3R8ZA 4EHZA 1WAKA 2WFYA 4KD1A 2BMCA 4M84A 1QL6A 4IIRA 3CTQA 5BNJA 2GS6A 4FSRA 4D2VA 4H58A 1FBNA 4QMMA 4FT3A 5D41A 2HK5A 3BPRA 3E62A 3KN5A 5AJQA 2P3GX 4QMPA 5CLPA 4YLLA 2QOHA 2BTSA 4GT3A 1STCE 5GJFA 3COIA 3MIAA 3NW6A 4B8LA 5AP2A 4TNBA 5FDXA 3TZ9A 2QR8A 3E8CA 3OHTA 3Q4UA 4LDTA 5HG5A 3FC1X 3NNUA 3BI6A 3OT3A 4APPA 4E5AX 4EOMA 3FLZA 3DS6A 3ZRKA 1KWPA 3Q9ZA 3EQIA 4RLKA 4DEBA 1YHVA 2R5TA 5E9EA 1KSWA 3ZS5A 3Q9WA 5CZHA 5AUTA 3M2WA 4AE9A 3F6XA 4ANQA 5M07A 1Y57A 4AZFA 3EQGA 4ARKA 2OIQA 3QL8A 5HIDA 5ICPA 3NZ0A 4YGAA 2ZM4A 3LQ3A 2HZ0A 3EZRA 5AADA 1PF8A 5IDNA 3HUBA 4PDSA 5M53A 4E6DA 3CR0A 3KXNA 3FEGA 3OEZA 2ETRA 2OH0E 3LXLA 3KC3A 3C1XA 3W33A 4CLIA 3P1AA 3R1QA 4RLLA 3LOKA 3LXPA 1OITA 3G0EA 5AV0A 5F1ZA 4AG8A 5EDQA 1KE5A 4H39A 4RVLA 3FI3A 1T45A 4UMTA 3NAYA 4RFZA 2XP2A 4JLCA 4XG9A 4AE6A 4EKLA 4F99A 3LCOA 2YLEA 3QGYA 3VONA 4BCMA 5L3AA 3D94A 4FTCA 5HCZA 3V5TA 1BMKA 4RWJA 3G6HA 4QD6A 1CKPA 4XH6A 2JDSA 5DT3A 4BDIA 4FKWA 3A4PA 4DEDA 5J7BA 5KNJA 3ZUTA 4XV1A 4ACCA 3IOKA 2XK7A 2A27A 3OF0A 5DR9A 3ZO3A 3EKNA 1WCCA 4ZJVA 1RQQA 4NW5A 2X0GA 3F3TA 4G9CA 4X2NA 2A1AB 4C02A 4CV8A 1YKRA 4Y85A 4WNOA 2QG5A 3DTCA 4MXXA 4D9UA 1H1PA 4E8AA 1Q3DA 3QYWA 4W8DA 5HVJA 5AM7A 4ORKA 2C5NA 4P5QA 3WYXA 1W82A 2X8DA 4QT1A 4IAIA 4LM5A 2I0VA 4Y83A 2WKMA 5HZNA 3EJ1A 2VAGA 4FX3A 4UEUA 1KV2A 3AT2A 4FTUA 2NRUA 3HV5A 3OG7A 4MNEA 5KBRA 3F2RA 3PPZA 4QPMA 4CMTA 4FIEA 1PY5A 3MIYA 5M44A 2HYYA 5C8NA 3FXXA 5IU2A 3P23A 3R9RA 4LYNA 4AW5A 1HOWA 1TZDA 4HNFA 3VNTA 2QONA 3GUBA 1WBVA 2A19B 2YACA 4PNIA 4CYJA 3IOPA 2PUPA 3AKJA 3WF6A 3Q3BA 3RTPA 4BDGA 5AUYA 5HEZA 4IC7A 4O22A 5HNBA 2HWPA 3O7LB 4EKKA 2WTKC 4O4FA 3E5AA 4O21A 3ZSGA 3AC5A 5B7VA 3BLRA 3LMIA 1ERKA 5L2QA 4FTNA 3I60A 4AAYA 3CCNA 4NU1A 3UNJA 3D0EA 4DDIA 3OT8A 3FMEA 2ZM1A 1NVQA 1W2CA 4N6ZA 4FTOA 2O3PA 4I5CA 3WF5A 4YZDA 2ITOA 2WMVA 3FI2A 5AV2A 5BQ0A 3PXZA 4FNZA 2CKOA 4RJ4A 2XYUA 2PVKA 5D10A 3NUSA 4KIOA 2YHVA 3I6WA 4PUZA 5EM7A 3VS2A 4LRJA 3F88A 3A7HA 1O6KA 5ETFA 1ZLTA 4GJ2A 2WTDA 2B4SB 3VF8A 1Q8YA 4DN5A 4JQ7A 5AUUA 4MQ2A 4Y5HA 2DQ7X 5CY3A 3NUNA 4L42A 5DPVA 5AP0A 3POOA 2UZDA 3WZEA 3PE1A 5BVEA 3PP0A 3R7GA 1XBAA 1F3MC 3R00A 4HVDA 4YZCA 3ORZA 2OIBA 4YC3A 3UGCA 1FGIA 2VD5A 3IG7A 1ATPE 5F20A 4BWKA 2AYPA 4QPAA 4G16A 4HYSA 4YTHA 4EORA 4KABA 3CE3A 4FSTA 4ASXA 3IO7A 4DFZE 2VWXA 3QQGA 3VW8A 1OMWA 1Q24A 4DFXE 1SVHA 2GU8A 2OXXA 3QX2A 4EHVA 2PZPA 5LMKC 3V3VA 2UZUE 5HBEA 4NUSA 5L6WL 4HYHA 4S31A 4MF0A 4A9RA 5C9CA 2GQRA 4BVUA 2XRWA 4M0ZA 4UMUA 4FYOA 3MTFA 3GCVA 4U97A 3FWQA 4QMSA 2JIVA 5C01A 4DHZA 1XO2B 3DBQA 4DHFA 2EB2A 3GCQA 3BGZA