4QP9A

Crystal structure of erk2 in complex with 7-(1-propyl-1h-pyrazol-4-yl)-2-(pyridin-4-yl)-5h-pyrrolo[2,3-b]pyrazine
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
345
structure length
335
Chain Sequence
b'MVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFELDDLPKEKLKELIFEETARFQPG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 1
publication title Fragment-based discovery of potent ERK2 pyrrolopyrazine inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 110
structure length 335
sequence length 345
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2014-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4qp9A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4qp9A01
3NR9A 4ACGA 3KL8A 1ZWSA 4K8AA 5AP0A 5HIDA 4EOJA 3UGCA 1Y6AA 3BZ3A 2C6IA 4MQ2A 4FODA 5EYCA 5IQBA 3AC8A 3RPVA 1XH4A 2VTAA 2XK3A 3LCKA 5KMOA 3HUBA 4FKLA 3PJCA 5CSWA 4MXZA 3PY1A 5HVJA 4RFYA 2PE0A 2C6MA 3PE2A 1SNUA 2IWIA 4RIWA 4AGUA 4BCKA 3Q6UA 3NDMA 3G9LX 5GZAA 2XIRA 3CXWA 2P0CA 4Q5EA 3ZHPC 4EH6A 2X2LA 2GFSA 3FSKA 4F9WA 4A9SA 3E3BX 3ODYX 2B9IA 3GNIB 3IDBA 3E8CA 2ZV9A 4FUYA 3QUPA 4GFMA 2J9MA 2YABA 4CG9A 2WELA 3R1QA 2R3OA 3SAYA 5EYDA 2CMWA 4ASDA 3FY0A 2VX3A 3MDYA 4KD1A 3TN8A 2Y0AA 4II5A 4CCUA 3VS0A 2IW8A 5IH4A 5JFWA 3ROCA 4TYIA 2W96B 4WRSA 2X8IA 4AA0A 2YHVA 4CFXA 1VR2A 5IA4A 4ZZOA 3SDJA 4C2WA 3WF8A 5KKRC 5AV0A 3KGAA 5E8UA 5KMIA 5CEOA 3JS2A 4DLJA 4KSQA 3OT8A 4FV4A 4HVSA 4HVDA 3R02A 4EEVA 3SHEA 4C8BA 3EN5A 3OY3A 2VNYA 4LOQA 3IGGA 3LXNA 3QTRA 1GZ8A 3C0HA 4FZ7A 4QT1A 3F61A 1F3MC 3GCVA 5A4LA 3CY2A 1Q3DA 4JRNA 4NSTA 4OGRA 4MX9A 4XNEA 5HLPA 3TZMA 4KS7A 4FTRA 4D2RA 4TXCA 3ZBXA 5E8VA 2VWUA 4E5BA 3EQGA 2OLCA 4GFOA 4M68A 1M14A 4PNIA 5LCKA 5DI1A 2OK1A 4KIOA 2BVAA 3LJ2A 3PTGA 1O6KA 1GOLA 3R28A 3F5GA 4KAOA 4J8MA 4GMYA 1H0WA 5EHLA 5M4IA 2R3GA 5GIPE 4NIFB 3PZHA 3U87A 4O7ZA 2R9SA 2JBPA 3HA6A 4RFMA 2WMQA 2UW8A 3FKNA 3E5AA 1BI7A 5HGIA 2XNOA 4XX9A 4I23A 1PYXA 5CU4A 2VGPA 3MV5A 5FRIA 4RA4A 4IDTA 2OF2A 2IPXA 3HLLA 4L53A 5DLSA 3QD2B 4DYMA 4ZAUA 4ZIMA 4G17A 3R71A 4O0VA 4AAAA 1SVEA 3LFDA 4EOOA 1V0BA 4C7TA 5FUTA 4O7NA 3F3UA 2VTQA 4HGTA 3QQFA 3GCPA 3UTOA 5LCJA 2HXQA 3PG3A 3VUIA 4XEYA 1ZXEA 5AM6A 2UZBA 2X9EA 1DI9A 4MVFA 2PWLA 4YC6A 4Q2AA 1QPDA 5KO1A 5GIOE 2BAJA 4NUSA 4F1MA 3OOGA 5JFSA 3G6GA 1BLXA 5H8GA 3HMOA 4WHZA 3TTJA 3BHHA 4B4LA 2PU8A 3TL8A 3PFQA 2JC6A 5CZHA 3Q96A 3MWUA 3QRTA 4MNFA 3IGOA 3ZLWA 4D58A 5HD7A 1H1RA 1WBSA 4R8QA 1YDRE 3VUKA 4OW8A 1A48A 3MY1A 3OUNB 2BHHA 4S2ZA 4WSQA 4FTAA 4CKIA 2GSFA 3DNDA 5TE0A 4N57A 2XCKA 4FT9A 1Y8YA 2WXVA 3Q9WA 5FM2A 2VTLA 5ETIA 4XMOA 2YDJA 4P7EA 4QP4A 3KEXA 5LJJA 3TZ8A 5IG1A 2EWAA 2J0JA 2XMYA 4RRVA 2FVDA 3Q52A 4GYGA 4HYUA 3D94A 1HCKA 2HWPA 4AWIA 2J0IA 4NTSA 4IWQA 4WT6A 3RHKA 2WMAA 3EOCA 1OUYA 3II5A 4TKSA 4FI1A 4KABA 3SQQA 4KSPA 4KWPA 4QPSA 2W1CA 3WOWA 4EOPA 4QP3A 4I5MA 1YI3A 2QNJA 3E93A 3F2RA 2XKCA 3ZCLA 2WMUA 4C57A 4D4SA 3ANQA 1BX6A 3TIYA 4TZRA 1H24A 3DK6A 3HMIA 5J95A 2HYYA 3LFFA 3PY3A 4TT7A 3NYNA 4UWCA 3ZXTA 2QKWB 4IJPA 2I0HA 4OTIA 3K5VA 2GHLA 3AT2A 1OL2A 4DN5A 3DBEA 4FKSA 3GQLA 3ZOSA 3FBVA 3KRXA 2CCIA 3AD6A 3BYOA 3GCSA 5AMNA 5EDPA 3UVPA 4WO5A 1U46A 4I4EA 3RJCA 3KXMA 2GNGA 5IEYA 2OZAB 4CQGA 3JYAA 5CAPA 4IW0A 1PKDA 2HWOA 2RIOA 5IMEA 1JBPE 3EL7A 5CF8A 5I4NA 4U41A 4O7VA 4FG7A 3RCJA 3RALA 3B8RA 3BV2A 4A4XA 3NUUA 2NPQA 1GAGA 4XUFA 3VQUA 4KBKA 3POOA 3PVWA 3RKBA 2JBOA 1PMUA 4B99A 5CASA 2DUVA 1YI6A 2QHNA 3FKLA 1K9AA 1DAYA 1WCCA 3VHKA 1ZZ2A 2J6MA 4LI5A 3ATTA 3C51A 3F82A 4AW0A 3LE6A 3ETAA 2OF4A 1DAWA 4HNFA 4E6AA 4Z16A 3EQBA 3PWDA 1PY5A 3VVHA 1FQ1B 4PP7A 3FMMA 4IC8A 3ZUTA 2R0IA 4CYJA 4EL9A 4GG7A 4KBAA 2C6DA 2ZDUA 4I6QA 3PXFA 1FVRA 1XH6A 2OH4A 3F6XA 4HNIA 1OKWA 3F69A 3DPKA 3QUEA 3ZC6A 4QRCA 4ANNA 4EOMA 4OTRA 1RE8A 3PLSA 4XG4A 3ZDIA 3PZEA 2I6LA 4DH1A 2BTSA 3HYHA 3O17A 4FVPA 3RWPA 5A6OA 3NUNA 3WF6A 4D4RA 1BL7A 4ZTSA 2W1HA 5IMXA 3DKOA 2R3LA 1XH9A 2IW6A 4JDHA 4NEUA 3AT3A 3R7EA 4C38A 4CKJA 3OTUA 1UVRA 5I0BA 4O7RA 3OMVA 1WBTA 1YRPA 4DLIA 2OH0E 3GGFA 3W2QA 2NO3A 5L2TA 2B53A 4FEQA 5D10A 1FVTA 5B2KA 3L8VA 5AP2A 2UW4A 5HO6A 4JXFA 4NM5A 5HLWA 2JKKA 2WU7A 5IQDA 2V55A 3FEGA 3OHTA 4PMPA 2RKUA 2R5TA 3PXKA 2ZMDA 2PVYA 2QLUA 4MXCA 4PTEA 4FT5A 3QX4A 4JBQA 4TYEA 5L2SA 5AR5A 4G6OA 4FG9A 3BPRA 4YP8A 4OAVB 3UIBA 2ZYBA 3I4BA 3MN3A 4R1YA 2XKDA 3QALE 2JAMA 4DGMA 2QURA 2ZOQA 3GB2A 4R7IA 4A9RA 4EWHA 4WSYA 4KIQA 4FTQA 4O1OA 4ANMA 4YSMA 3QCSA 4W4WA 4CT1A 3EN7A 3OXIA 5EM6A 2PVRA 4DFXE 5J5TA 4L3PA 3KA0A 3V5JA 4UMTA 5ANIA 3QD0A 4JOAA 1ZYCA 2QVSE 3DQXA 4RGJA 1XH5A 4A9YA 4XV2A 3UQCA 5EM5A 1P4OA 3BYUA 3VW8A 4LGDA 3P1AA 3A60A 3T8OA 3LQ3A 4RFZA 4X3JA 5BVDA 5GINE 4E5AX 4XG3A 5HCYA 3RAWA 2PK9A 5M56A 3D5UA 3M11A 4PTGA 2UW3A 5DOSA 5AWMA 5J7BA 2JFMA 4X6QC 3KVWA 3BYMA 2WTKB 2J2IB 3H9RA 5EYMA 3P7BA 3C0GA 4TYGA 3GFEA 3ZFMA 1YI4A 5DVRA 4E6QA 4X3FB 1FMKA 4EOSA 3BBWA 2BKKA 3NAXA 1Q4LA 2EB2A 2XCHA 4BR3A 3TDVA 4EHGA 1O6YA 2X6DA 3KRJA 4GL9A 4I0SA 4UYAA 4DFZE 2H8HA 2F57A 3F2NA 5FXRA 2Q0BA 2C3IB 3PY0A 2X6EA 3GU4A 3EN9A 3W33A 4CRLA 4E4LA 4QYEA 1YXSA 3V6RA 3UG1A 3VUDA 5DNRA 4BY9E 3ULZA 3FYKX 4BDBA 3VUGA 4JI9A 2JDSA 4FIFA 4BZOA 2GHMA 2JKMA 1X8BA 3ENHA 4CSVA 2QC6A 3ZMMA 5GJGA 4M13A 5CEQA 1KOAA 5JT2A 1J91A 4JQ7A 5JEBA 2FSTX 4U44A 4NIFA 1JSVA 3CTJA 1V1KA 4FV9A 5HEZA 4BGQA 5IQAA 4JX3A 4R6VA 4YZMA 4FTJA 3ZM4A 4B8LA 3WIGA 3A7HA 3RAKA 4YMJA 3P7CA 4QQ5A 3D15A 4KRCA 3DOGA 2YWVA 1XBBA 4DH3A 5CF6A 4QNYA 3R9NA 2E2BA 3D2KA 5IUHA 2JIUA 3DTCA 4IANA 5BUEA 4U42A 4DEGA 4L9IA 5DFPA 4IAKA 4FZ6A 2O65A 3FQEA 4E1ZA 1CKPA 3QQLA 4X2GA 4CFNA 4RJ8A 4G3EA 2R3HA 3DK3A 2ITNA 5HKMA 1W98A 1F0QA 2R3IA 2R64A 1H26A 2Q0NA 3U9CA 2X4FA 4FKUA 3BU6A 3LZBA 1BI8A 1T45A 4G3CA 4J8NA 3ZSIA 4ZMFA 3RHXA 5A4EA 5KHWA 4AZWA 4XH6A 4MWIA 3TZ9A 2WD1A 1S9JA 5JFXA 4DGNA 1OKYA 3I81A 4QMNA 5B2LA 1IG1A 2PTKA 3TI1A 5CS6A 5J9YA 4BIDA 1UU3A 1ZMWA 2HZIA 2YAKA 4AOIA 5I9VA 4FL1A 5EQEA 1XH8A 3MPAA 5KE0A 2BDFA 3FXWA 3PVBA 4O0UA 3SA0A 4BKJA 1ZYJA 4O22A 2LAVA 1FGIA 1OIUA 3ACJA 1UWJA 4FIEA 4RX8A 4AUAA 2W99B 3LW0A 1NXKA 3V5PA 4EKLA 2HZ4A 3RWQA 4K1BA 4JBPA 2XYUA 2JGZA 4RX9A 4R3PA 1OM1A 4HYHA 3TT0A 4U7ZA 1XR1A 3CD8A 5I5ZA 3KRRA 2B9JA 4AA5A 3WZDA 5J7HA 4CTBA 2R3MA 4O21A 4IMYA 4RIWB 3V01A 2PVJA 4RX5A 2ZV7A 4ZZMA 5CF4A 5BPYA 2UVZA 5CZIA 5K3YA 5CI7A 3HP5A 4WNOA 2GNHA 2HENA 2B1PA 1H1WA 3E92A 4E4NA 1V0PA 1H07A 3IW5A 4DEEA 3UE4A 4FKIA 4LUEA 2ITWA 2X4ZA 4NZWB 2CDZA 3QC4A 1WVWA 3MTFA 2R3RA 3VIDA 3D9VA 5J1VA 1JOWB 2PHKA 4U9AA 4BWPA 5CF5A 4PL3A 4QO9A 2VWVA 5HOAA 5T3QA 4E20A 4M8TA 2BUJA 3OROA 2GMXA 4YBJA 3PPKA 1BKXA 3OTVA 4CFFA 4XV9A 3ZZEA 2VO0A 2F7ZE 3ZYAA 5E8YA 2YCQA 1XKKA 1Y8GA 4O81A 4CCBA 1ZOGA 2Y6OA 4RZWA 2QO2A 4YTHA 2YM3A 1LPUA 2O3PA 4LV5A 4JS8A 2UZWE 5M08A 4LYNA 3VF9A 3LFQA 2WMXA 3RNIA 2W17A 4ASXA 2FSOX 5DA3A 4G1WA 2Z60A 4FVQA 5HQ0A 3BLRA 3ITZA 5CI6A 5LARA 4NFMA 4ZEGA 4ZY5A 5EQYA 3Q53A 3H0YA 1WAKA 2OXXA 3WE4A 3Q32A 3CSVA 3JUHA 3F3ZA 3NSZA 4C3RA 4IX5A 3SXSA 2O0UA 4W8DA 3FE3A 2VTTA 1H27A 3GCUA 3MA6A 4QP2A 3THBA 3U6HA 5DEYA 4AZEA 4IX3A 4O86A 3I60A 3PVGA 4F08A 1ZMVA 4FV7A 4IZAA 1KUTA 4ZJJA 3VS7A 3TKIA 2VV9A 3ZFYA 1JQHA 1KOBA 3GQIA 3MS9A 3BELA 3VUMA 5F20A 4ACHA 3R04A 3LFAA 4CFUA 3VBQA 3DXPA 5IQGA 4AA4A 4JIAA 3HMPA 1ATPE 4XBRA 3S3IA 4AT5A 3R7UA 4NL0A 5FLFA 3EN6A 5HESA 2XEZA 1NVRA 2UV2A 2WMRA 3RPRA 3QRIA 4I21A 5TR6A 3ELJA 3BX5A 2OIBA 4J99A 5BNJA 2EXCX 4DH8A 2WHBA 4AFEA 5AIRA 3QTQA 4FSMA 4BDGA 3VRZA 3FI8A 3UOHA 3NUSA 3I7CA 4WG3A 4YZNA 3S0OA 1YHVA 5K5NA 2UVYA 1XWSA 2CKPA 5DYJA 1VJYA 4FTLA 3NNWA 4ARKA 2F9GA 4BDIA 2PUNA 4IAAA 5C4LA 4HVIA 3HP2A 3QQKA 1NT2A 4DGOA 3LIJA 4J98A 4FL3A 1JAMA 4M84A 3P4KA 4D0WA 1KE6A 2YISA 2VZ6A 4P5ZA 5IA2A 4IJ9A 4QMPA 5IU2A 4XG6A 3DXQA 3EWHA 4EQCA 5K9IA 3N4TA 4OTWA 3DGKA 4ZSJA 5AEPA 5FTQA 1OBGA 3NX8A 1G3NA 4C4GA 4AF3A 2WGJA 5CYIA 3QQGA 3R9DA 3AMBA 4O1PA 5AUXA 3NPCA 4D5KA 1M2PA 3A62A 5BUJA 1T46A 2VRXA 5EDQA 4ERKA 2C5VA 3CY3A 3O0GA 5HG7A 4EJ7A 3MFUA 4G3GA 4LFIA 4KUJA 5GZ9A 3KVXA 3Q5ZA 5IKWA 4O83A 5HVKA 5I9ZA 2QQ7A 5FEQA 2WOUA 1AD5A 4FSNA 4C36A 1TQPA 2RL5A 4QYGA 4LRKA 4YHFA 1UKIA 3OXZA 2HZ0A 3K3JA 4IZ7A 4XCUA 5IUGA 5DH3A 5BMSA 2R3PA 3SX9A 4DT8A 4D9UA 4D2SA 4RJ4A 3HZTA 4FTMA 4CZTA 4JIKA 1OECA 4QMSA 4H39A 2JDOA 4S34A 5C8MA 3CC6A 2HY81 5F9EA 3UJGA 3WZKA 1Q8WA 4YU2A 3OWKA 3HECA 1DI8A 3TNIA 5K0XA 4F1TA 3AD5A 4O84A 4C33A 4FNYA 4K11A 3PP0A 2YM7A 5F4NA 4IAYA 3KU2A 5AP7A 5HHWA 3PVUA 2H6DA 4YTIA 4E6DA 3RM6A 5IQIA 1YHWA 3QKKA 4JDJA 2AC5A 2BFYA 2OFVA 3CE3A 5AP1A 3QLFA 2OI4X 2OJIA 3BWJA 3IQ7A 3O7LB 3UODA 4EH4A 3PUPA 3LFBA 2XRUA 1Y57A 3MB6A 4IX6A 2WTWA 2HAKA 3P7AA 2UZEA 2H9VA 3NEWA 3Q04A 2BTRA 4TY1A 2ETMA 1AGWA 3OCBA 5M44A 2CN8A 5AM7A 3QWKA 5CANA 2XNNA 3RAHA 3KRLA 1BMKA 4NU1A 5AP3A 4EI4A 4M7IA 4QMVA 4FL2A 4BDFA 3ZDUA 4FEVA 3OS3A 4L67A 4O7LA 2ERZE 4X0MA 5TKDA 5CU3A 4YTFA 3E8NA 3SGCA 4ANOA 2QO7A 4KNBA 4OBQA 4DEBA 2X7FA 3UP7A 4IVAA 3JXWA 4EHZA 4L44A 4I94A 3SW7A 3U54A 3HNGA 4RWKA 5AUUA 4RC2A 3UQFA 4WBBB 5ETCA 3PJ8A 3C4FA 3MESA 3UC4A 3NNXA 3QZGA 4A4OA 4FV0A 4BCFA 3NYVA 1YOJA 2G9XA 3KMUA 2YITA 4F0FA 4QQCA 4MK0A 3VJNA 4B9DA 2YCFA 4QTBA 4FF8A 3FMLA 1YXTA 2VWZA 4YLLA 2Z7LA 2CGUA 3T9IA 1KE7A 3Q9ZA 4YO6A 3UYSA 5GZ8A 1PMVA 3P79A 4APPA 5FEDA 4EKKA 2Z02A 3QTSA 4WNPA 2V5QA 5E8WA 3BGZA 4BGHA 5JGBA 4C3PA 1GIHA 1GZOA 4ANBA 5L2IA 2OXDA 2ZVAA 2DWBA 5T6KA 3KK8A 5AR7A 4BB4A 3TJDA 5IQEA 2CKOA 1AQ1A 1CKJA 2ACXA 1SVGA 4BIBA 2EU9A 2RFNA 2UZTA 3OCGA 3EN4A 3FZ1A 3R6XA 3GC8A 4FC0A 4YNEA 4I6FA 4IWDA 5JRQA 4NK9A 3HRBA 3PRIA 2W1FA 2JDRA 3KULA 3QYWA 3AC5A 4MTAA 2AYPA 3NCZA 3LXLA 4E4XA 5IF1A 1G8SA 4ZJIA 2XZSA 2FB8A 1IRKA 3VQHA 2IVUA 2HIWA 4MD8E 3HVCA 4TRLA 3OT3A 2UW5A 3RBWA 5HTIA 5BUIA 4IC7A 2E9NA 2YZLA 2WAJA 4EOKA 5L4QA 4XP2A 5C9CA 2E9UA 2FGIA 3FXXA 3R7OA 4IQ6A 5L2QA 1W83A 5D41A 2XM9A 4YSJA 4ZTQA 3L1SA 5L6PA 1OMWA 3C0IA 1KSWA 2CSNA 3TCPA 4A4LA 2R2PA 3ORMA 3P23A 4ZXTA 3ZM9A 4BI2A 4XRLA 4BHNA 3OOMA 2UZNA 3Q2MA 3MJ1A 2W1IA 1UA2A 4FYNA 4I3ZA 1FINA 1UV5A 2VWWA 2O8YA 4J97A 4QP8A 5E8ZA 5I9WA 3A99A 1FBNA 5EHOA 4BCOA 2R0UA 3IDCA 2FYSA 5CT7A 1ZY5A 3ORLA 3PLAE 4F64A 4IFCA 5AUZA 1M7QA 1GZKA 3R00A 4FK6A 5TT7A 4RLKA 3FDNA 5AR3A 2V7AA 4U45A 5DN3A 1ZZLA 4DT9A 3ERKA 3CJFA 3QWJA 4H3BA 5L8JA 5CSVA 4RWIA 4CNHA 3UMWA 4FA2A 4O2PA 4G9RA 2WMVA 3LQ5A 2A1AB 5HBEA 2UZLA 4K0YA 3EB0A 4OT5A 5CXHA 5DMZA 2RSVA 2BIYA 3F5XA 3PXRA 3IW4A 3LHJA 4BKYA 4A9UA 4EQMA 4BKZA 1GJOA 5M4UA 1PMNA 2C6KA 3EYGA 1GY3A 4RIOA 4RQVA 5LWNA 3PXYA 3ZRMA 4X6RA 5TOZA 2WQMA 2CKQA 3FI4A 3FV8A 3QF9A 2J0MB 3FMHA 3HEGA 3CLYA 3HV4A 4FSUA 3W2CA 4DTAA 2VO6A 3FZTA 2V7OA 3N51A 3GI3A 2OJ9A 2W9FB 4S33A 4YZBA 1U4DA 4AT3A 4BCGA 3QA8A 4AACA 3KK9A 3MYGA 5M07A 4FKPA 3CCNA 5AR2A 5F94A 3G33A 5E7RA 1WMKA 3MVLA 4UV0A 4DCAA 2V62A 2UVXA 3DBQA 4YNOA 1Q97A 5M57A 4PDYA 4OTGA 3KMMA 4ALWA 2XA4A 3P9JA 4RWJA 5CVFA 4ZLYA 5HU9A 4LRMA 5C1QB 1P2AA 4QMTA 3GVUA 3RCDA 5CVHA 2Z2WA 5ETAA 3FLNC 1OI9A 4AZSA 4C02A 3MH2A 3IPHA 5CEPA 4QYFA 2P3GX 2GNLA 4U79A 4IWPA 4C34A 2ITOA 5CEKA 3LJ1A 4G6LA 1H28A 2HCKA 4D2TA 4M0YA 2YM6A 4TL0A 1APME 5A4TA 3VO3A 4CFMA 3KC3A 4IAZA 2ITZA 4RJ3A 1R0EA 4IVBA 4XG8A 2GPHA 2G2IA 3AD4A 4FG8A 3MJ2A 2WTCA 4XOZA 5I9YA 5HE1A 4J1RA 5BVKA 3DBDA 5KMLA 2ETRA 2VWIA 3TJCA 3PA4A 3SG8A 3P08A 4DEAA 4FK3A 5HIBA 4ID7A 4PMMA 2BPMA 5KUPA 2UW6A 3F7WA 4B7TA 5J1WA 3ZU7A 5DRDA 1ZYLA 4D1ZA 3I1AA 3GP0A 2ZV2A 5E9EA 4AW5A 5ANKA 4MHAA 4G2FA 2C1BA 3SV0A 4DGLC 1R39A 4RJ5A 3UZRA 2WQBA 2QOBA 1Q8TA 3QRKA 3W2RA 3FL5A 3KXZA 4EJNA 4F7JA 2CGXA 5L2WA 4YZDA 5M09A 3ANRA 4CTCA 3WF7A 3DK7A 3UZTA 2IZUA 2PSQA 5JFVA 1ND4A 3BYSA 3PJ3A 1H1PA 3SD0A 4ENYA 3R8LA 2VWBA 2BZIB 4N6ZA 1Z9XA 2XK4A 4KKEA 3MIYA 4XV1A 5JZJA 4ACCA 3KN5A 5M4CA 3R9OA 4I5HA 1DM2A 3FMDA 4N0SA 4ACDA 1JKKA 2C3JA 3AC4A 1WBOA 2P2IA 4U81A 5H3QA 2RFDA 3QHRA 3O23A 1Q62A 2ONLA 3ID6C 3R8MA 4MNEA 5EM7A 4CXAA 1I44A 3UO4A 2QU5A 5CEIA 5J87A 3MY0A 1WBPA 3OCSA 4FSWA 3H9FA 2Y4IC 4I0RA 2BROA 3HRCA 4X2FA 2OW3A 5CEMA 3BHVA 3BIZA 2X7OA 3HKOA 4ZMEA 4ASZA 5H2UA 4FV3A 4FV2A 4CD0A 5CSXA 1IA8A 5D7VA 5FP6A 5LQFA 4JRVA 4C37A 3HDNA 5GHVA 4DG0E 5J9LA 5BQ0A 3F3WA 1RW8A 4F9BA 1CMKE 3DFAA 2QLQA 3KMWA 3R0TA 3BYVA 2ZMCA 4QP1A 5IZFA 5DE2A 4ZTLA 3FQHA 5CNOA 4RJ7A 3VAPA 2GQGA 2JITA 1H00A 2WTVA 3PIXA 5LMBA 4FV8A 4C58A 5IISA 2G15A 3MH1A 3S1HA 3Q4TA 2WIPA 2VX1A 2OJFE 5EKNA 3NW6A 3VBWA 5KNJA 3FPMA 4FTOA 4U97A 4DE4A 5IEXA 2OG8A 4QTEA 1RDQE 3I6WA 3QRJA 3SXRA 2PVNA 2YERA 3CP9A 3Q5IA 4NT4A 5IQHA 4L45A 4ONAA 4M3QA 3MW1A 3UVRA 4F6WA 3MI9A 3PE1A 3MGYA 4BCQA 1SMHA 1OKVA 2HELA 2W5BA 2FA2A 4ZY6A 3UC3A 3U4UA 2P55A 5C01A 2I40A 2NNWB 4M97A 4BBFA 2QOHA 4YJOA 3WZJA 3UZPA 4APCA 5AIKA 3PIZA 4BGGA 4X7QA 2C3KA 2J51A 4B8MA 5A46A 5KKRB 3N4UA 1YWVA 3ZEWA 3GFWA 4FIIA 1PXMA 2W7XA 1HOWA 2R4BA 2Y9QA 3ET7A 4E93A 2YZAA 4XBUA 3A8XA 3GU8A 3TZ7A 4X2NA 1OIRA 5F95A 4OBPA 4ERWA 5JQ5A 1ZYDA 4GUBA 3I79A 1CSNA 2B7AA 4QYYA 3OXTA 1ERKA 4D1XA 2CKEA 3OWJA 2QOFA 4YJQA 5E92A 4FTCA 1Q5KA 5C4KA 4EWQA 4ACMA 4FR4A 3AGLA 3R1YA 4ITIA 4IVDA 2JIIA 3NIZA 3Q60A 3O8TA 2YM5A 4UY9A 5AV2A 3LXKA 3BLHA 5M55A 5BVFA 5IDNA 5AP5A 1YOLA 4HYIA 4MXYA 4ZZNA 4DFLA 2CGWA 4ZTMA 3ALNA 5CY3A 5L8KA 4BYIA 3Q9YA 4YJUA 5ACBC 4O7TA 3QQJA 1MUOA 1U5QA 3G9NA 3QCQA 4OR5A 3LLTA 4H1JA 5AV1A 4LMNA 2O64A 1PXLA 3U4WA 4R77A 3CGOA 5AA9A 3U55A 3FZOA 4M0ZA 4WKQA 4JAJA 5BYLA 1ZY4A 3R01A 4XLVA 5JKGA 2SRCA 4D4YA 5C8NA 3NUAA 4EH3A 4FT7A 4Y46A 4E4MA 3BGQA 3ZO4A 3G5DA 3R8UA 4FEUA 2ITUA 4IE9A 4C4HA 3A61A 4FSTA 3DCVA 4YBKA 2YLEA 4MH7A 4ENXA 4Q9SA 3VS3A 2JKOA 5M51A 3L9LA 4IACA 3BHUA 4F63A 4N70A 2PY3A 3T3VA 3VS4A 2UZOA 3AOXA 4I24A 3CPBA 5CNNA 2WO6A 4R1VA 4GK4A 3LFNA 3NNVA 4FNWA 2B4SB 3OVVA 3GBZA 4QMLA 5AP4A 4TYHB 5HG8A 3I6UA 4MKCA 3VBVA 3B2TA 4N4SA 5DPVA 4PPAA 4QP9A 3DJ7A 2I0EA 2YFXA 3ZONA 5J8IA 3IECA 4O6EA 4TPTA 5EW9A 2C5NA 3BV3A 4ZSEA 3V5TA 4C3FA 5DWRA 4C59A 4AE6A 2PMIA 2QCSA 4ZOGA 4CT2A 2JIVA 3TDWA 1JVPP 5KZ0A 4IADA 3M42A 2KULA 2BHEA 4EH9A 3B8QA 3FQSA 3CQEA 1SYKA 3FLWA 2KTYA 4FKJA 4K18A 3KXGA 4HVGA 2RF9A 5C8KA 3Q2JA 4CVAA 4F70A 1OL7A 4JQ8A 3EQCA 4L43A 1QPCA 2DS1A 2XKEA 4W4VA 2RGPA 3TTIA 4C2VA 4MEDA 4PMSA 3T9TA 4KKGA 1WZYA 3PG1A 4U0IA 1BL6A 3DNEA 2GNJA 5CU2A 3MFSA 2GU8A 3ZZWA 2E9OA 4G5PA 1U54A 1RQQA 3I0QA 3DV3A 4FUXA 2RFEA 3CQWA 2V22A 2VTMA 5GNKA 2J0LA 4LRJA 4BCMA 2ESMA 3FLSA 3TWJA 3SKCA 2GFCA 3UOLA 3ORNA 1QPJA 3MIAA 4W9XA 4BCPA 2VNWA 1M52A 2EXMA 1H25A 4FIJA 4NCTA 4U6RA 4V05A 5CQUA 3G0FA 4PY1A 3T3UA 2CHLA 3MH3A 4WBOA 2A0CX 5HE3A 3CTQA 2PMNX 2OU7A 4DTKA 2XIXA 4BYJA 1O9UA 4DINA 5CALA 1OIQA 2EUFB 2ZAZA 3D4QA 3D7TB 3P86A 2G2HA 4OUCA 4G34A 4U80A 4Y83A 3C4XA 4HGEA 1YWRA 3EQFA 1URWA 3PSCA 4M67A 3ZLSA 2XNGA 4TWNA 2CLQA 3I0OA 4BDEA 4U43A 1SVHA 3A4OX 4L8MA 3UIXA 1Z57A 4AXAA 4B6LA 3KULB 3BEGA 3LQ8A 5ANGA 4RA5A 3QQUA 3FZRA 4AQCA 4YJNA 1QMZA 4IAFA 5JGDA 3LKMA 4DBXA 5D12A 3EH9A 4GCJA 3UOJA 4D2PA 2J5EA 2XNBA 3OBGA 4F1OA 2PZ5A 3F9NA 3JY0A 5TO8A 2X2KA 5JMSA 4RIYB 5H8BA 3AG9A 4YZCA 1JWHA 4FNZA 2F49A 3Q4UA 3R7GA 4AZTA 4BF2A 3NYXA 3LCDA 3MSSA 4FKQA 4U5JA 4FGRA 4GT3A 1H0VA 3MH0A 5EQPA 5FD2A 4JG7A 2CJMA 4I1ZA 3SOAA 4P5QA 1PF8A 5L6WL 1J7LA 1WBVA 4UB7A 3DKFA 3DY7A 1W84A 2WNTA 5FDXA 4DCEA 3VBXA 4M15A 1VEBA 2C1AA 5CXZA 3GOKA 3NS9A 4UN0C 3BE2A 5FEEA 2X2MA 3ALOA 3ATSA 1A9UA 4U3YA 3HAVA 3GU7A 5BVOA 2PVHA 2GS6A 2IVTA 1OIYA 4WNMA 5H9BA 4O27B 5DGZA 1IA9A 4CMUA 2PZPA 3BU3A 4G3DA 3H9OA 3D83A 3M2WA 4L6QA 4CFVA 4A7CA 5EG3A 3VS6A 5HG9A 4R3CA 2I0VA 4HVHA 5IQCA 4EC9A 4BCNA 3PP1A 4UZDA 1MRYA 4ANQA 1TQIA 2VWXA 2PZYA 2YCRA 3SXFA 5AUVA 5BVNA 4XP0A 4FV1A 3PWYA 4OTHA 3V8WA 2ITPA 2ZV8A 4PTCA 3UNJA 2BAQA 3A8WA 1UNGA 1U5RA 1JSTA 1DS5A 3WBLA 2WTIA 4C4FA 4RQKA 4BDJA 5ICPA 3PDTA 2W1EA 5JZNA 3LM0A 3AGMA 1H08A 2F2UA 3A7JA 2QI8A 3FC2A 2EXEA 4DF3A 2Y4PA 3FSFA 3RPYA 1YWNA 1YHSA 3LPBA 4FX3A 4GJ2A 1CTPE 2BDJA 1L3RE 3F88A 4GYIA 4FSRA 5ANDA 2ITTA 2Y7JA 3V5QA 4P90A 4IDVA 4EK3A 3V8SA 4GV1A 4BTMA 2XK6A 2XM8A 4NTTA 2VTIA 3DJ5A 4WA9A 3D14A 3WZEA 1R0PA 2BZHB 3ZO2A 2R3FA 4O91A 3FHRA 3QC9A 4NJ3A 4CGAA 3KXNA 2HOGA 3OW4A 2QOKA 4OTDA 1HCLA 5E1EA 4EH7A 4ZLZA 2W1DA 4IX4A 5AR8A 5GJFA 5AFVA 2XS0A 4OT6A 1K3AA 4XV3A 4Z7GA 1ZARA 3G6HA 4PMTA 3KFAA 1REJA 5G6VA 3O71A 3FY2A 2BDWA 4ZP5A 3SLSA 3E7OA 3Q3BA 4H58A 4PDSA 4R5YA 4AN3A 3EMGA 3QTWA 4TTHB 3ROYA 5TF9A 4QTAA 3S4QA 3DU8A 4ANLA 3O8UA 5DT3A 4ZY4A 2X39A 1W7HA 4FZFB 1ZOEA 3AMYA 4O0RA 2B55A 3R2YA 4QP6A 2IVVA 5DR9A 4K9YA 3SRVA 3HGKA 4MYGA 3E87A 4BBEA 4YHJA 4JG8A 3RK7A 3W2OA 4F65A 1OL1A 3CTHA 4I22A 4QD6A 5G1XA 3VF8A 3DXNA 5HU3A 5BMMA 4RSSA 4ALVA 3TACA 5HNIX 2J50A 3EYHA 2NRYA 2R3KA 3BQCA 5AP6A 4G16A 4Y8DA 4RIXB 3COKA 3QZFA 3HV7A 4BI1A 2YCSA 3VS1A 1JKLA 1Q41A 1UNHA 1L8TA 2ITXA 5E8SA 5EDRA 3G0EA 3U9NA 2XIZA 2BCJA 3EL8A 3D5WA 4FTNA 4V01A 4Y73A 1BUHA 1YXVA 2WQEA 5ANJA 3W8LA 4JR3A 1KWPA 3DAEA 1CM8A 4FTUA 3RINA 4CMOA 3W55A 1FVVA 4DBNA 2BRHA 3W2SA 3NCGA 5AAFA 4MNEB 2GQSA 2WTDA 5HORA 2F7XE 2P2HA 2QONA 3DAKA 2GDOA 2OGVA 4JBOA 4UXQA 4DEHA 3ZC5A 4AOTA 3W18A 3LFEA 1UWHA 3NW5A 2C6LA 2XBAA 3MB7A 2QOQA 3RAIA 4EBWA 5I9UA 1H1QA 3UIMA 2CCHA 3CKWA 4EK5A 4IXPA 1O6LA 3OC1A 3PJ2A 4D2WA 5A4CA 3LFCA 4TYHA 4TNDA 4WIHA 4X2KA 4O0WA 4FVRA 2YDIA 3MY5A 1PRYA 3ORIA 3HMNA 3P78A 4CV9A 5I3RA 2QOLA 3FAAA 4MF0A 2R7IA 3VUTA 1H1SA 2PVLA 4KKHA 3CR0A 3KN6A 5IH6A 3CD3A 5FM3A 2C68A 3DDQA 4H36A 2ETKA 3EQPA 3O8PA 1MP8A 4I20A 4LM5A 1PXKA 2REIA 4NW5A 3O7LD 3HA8A 2BRMA 3P5KA 3NZ0A 2XYNA 3A2CA 3RK5A 3G15A 1J7IA 2OBJA 3QL8A 3M1SA 5DBXA 3V8TA 5J5SA 4L68A 2XH5A 4I0TA 3VJOA 5FDPA 1JLUE 5J9ZA 3OEFX 4KINA 3QTZA 4BL1A 2X0GA 3W8QA 3DJ6A 1OUKA 1YKRA 3RPOA 3ZBFA 3ZUVA 4L46A 3FLQA 4DFNA 2VTSA 4IAIA 4HZRA 3R22A 4G5JA 4L7SA 4FSZA 2BRGA 1B38A 3UNKA 2QOCA 4EC8A 2YACA 4ALUA 1JNKA 4K77A 3DLSA 3PA3A 4BDDA 4UX9A 3RI1A 3EQRA 4CRSA 4EOQA 2Q83A 3O2MA 5C27A 4BHZA 4EH8A 1NY3A 4O0YA 5EH0A 3COHA 2OKRA 4FTKA 2WPAA 2P33A 4GT4A 3UIUA 1TVOA 4L01A 3D7TA 3FWQA 3CPCA 3C1XA 4IB0A 3ZEPA 1FOTA 3HV6A 4F6UA 4YHTA 2X81A 4D4VA 4QYHA 3VHEA 1ZAOA 3H30A 3BWFA 4AE9A 4RG0A 1PXJA 3TV7A 3ORTA 4WD5A 4YPSA 2O63A 4BIEA 4AX8A 5IA0A 5LVMA 2UZVA 4GVJA 1Q3WA 3CIKA 3I7BA 4QMUA 5E8XA 2J4ZA 2C0IA 4H05A 5EW3A 4ITHA 3VS2A 3CQUA 3OEZA 4RZVA 2J7TA 3IOPA 4O0TA 5AA8A 5DIAA 3V3VA 1H4LA 2XF0A 3V51A 3CS9A 5I3OA 3PYYA 3F7ZA 3C5UA 2VTJA 4LGGA 2CPKE 2W05A 2XRWA 3D0EA 4Y72A 3VW6A 4W9WA 4EUTA 3ORZA 4GVAA 4HPTE 4H3QA 3CKXA 4FYOA 1V0OA 4Z9LA 3WARA 4CQEA 4F7SA 5KMNA 4AP7A 4MD7E 4TW9A 4RIYA 2PMLX 3MVHA 3D5XA 2WIHA 2A27A 3FI2A 3SG9A 2OICA 3DT1A 4BCIA 5BVWA 3U6IA 4IB3A 3AT4A 4R78A 3E8EA 3ZO1A 4NM0A 5HVYA 2R3JA 3FL4A 4FZAB 4QMXA 5FGKA 4BN1A 4AW1A 4EOLA 3ZUUA 2JLDA 4FOCA 3GC0A 5EI8A 4F9YA 3IG7A 4D2VA 4EONA 5A54A 5DRBA 5JGAA 5C03A 3AC1A 3PIYA 5FQDC 5HBJA 2WFYA 2PZIA 4IH8A 1XQZA 4BDHA 5LOHA 4AGWA 1FMOE 4PL4A 2F2CB 2YLFA 3QTUA 4XYFA 1Q8YA 3ZH8A 2GQRA 4I41A 5LMAA 4Q5HA 5FWKK 2OWBA 2HW6A 1FGKA 2ZM3A 3QXPA 4LUDA 5T68A 4XJ0A 1XBAA 2QOIA 3HV3A 3PRFA 1URCA 4D28A 4RT7A 5KBRA 1J1BA 2JEDA 3GXLA 5D7AA 3BU5A 4AU8A 3LMIA 4I6BA 3Q9XA 3W16A 2RG6A 4H1MA 3KKVA 2XNPA 4XLIA 2BZJA 2YIWA 2C3LA 3Q6WA 4A06A 5ITAA 2BILB 2C6TA 4Y95A 4MQ1A 4BVUA 4BWXA 1KE8A 4BWKA 2UW7A 3FXZA 4E73A 4MBLA 1S9IA 4YC3A 2HW7A 3PXQA 1UU8A 5IA1A 3WILA 4A07A 4V04A 5EOBA 1XH7A 3BKBA 2QG7A 4UXLA 2XNMA 5HCZA 4P2KA 4O96A 1EH4A 4I5CA 4U40A 2C5OA 2WU6A 4FKGA 1E1VA 2UUEA 4JJRA 5FBNC 4O6LA 2R3NA 3PXZA 5EI2A 1U54B 1OGUA 3G51A 3GU6A 3A7IA 4IB5A 3BI6A 2C0OA 4RX7A 2JDTA 2GCDA 4GG5A 4G31A 1UU7A 5EK7A 1ZYSA 2PL0A 4NM7A 3KB7A 5AX9A 5HIEA 1M7NA 4XOYA 1W82A 2XP2A 3WE8A 3NYOA 1PXOA 5AR4A 4O7YA 2W4OA 2CLXA 1Q8ZA 4JT3A 4IBMA 5KZIA 4NH1A 5CWZA 5LVOA 4ZTHA 3F5UA 3R9HA 3QCYA 5HTCA 3R83A 2C4GA 4UYNA 2PUIA 1MRVA 2HY0A 1LR4A 1QCFA 1MQ4A 3NGAA 5KX8A 3C13A 5F1ZA 3UP2A 2WOTA 5DR2A 5LMKC 3OWLA 2OXYA 4IEBA 4F7LA 3BCEA 2WTKC 2J0KA 2VU3A 3L8XA 4FEXA 4PL5A 4ZTNA 2R3QA 1F5QA 5HD4A 4JL9A 5K4IA 3R21A 3QYZA 4X3FC 3VRYA 4CZYB 3TUBA 4GW8A 3VN9A 3AXWA 3ORKA 3OUKA 3EKNA 4FGBA 4UZHA 4BTFA 2BZKB 4QNAA 5K5XA 4C0TA 4KIKB 1MQBA 3RNYA 3HL7A 2QG5A 2Y6MA 4ZLOA 4WOVA 4YJSA 2YM4A 4YJVA 4OTQA 3IS5A 3GC9A 2VAGA 2X8EA 1B6CB 2Z7RA 3LFSA 5FXQA 3PPZA 4OTFA 3OP5A 3G2FA 3QKMA 2Z7QA 3SOCA 2CNVA 2OSCA 3MPMA 1WVYA 4ZSGA 3UPZA 4WG4A 4C4IA 5HX6A 1Q61A 1JPAA 4X2JA 4CEGA 4RIXA 3R1SA 3U8WA 2ERKA 4UBAA 2BR1A 4YZ9A 4W4XA 3UNZA 4A9TA 5IA3A 4EK8A 2YWPA 2VUWA 4NM3A 1SM2A 2R7BA 4E6CA 3EFKA 4WNKA 3D7ZA 3F5PA 2J5FA 4QOXA 3U6JA 2NRUA 5B2MA 1STCE 1P4FA 3C4WA 4L42A 2C0TA 4WG5A 4PNKA 2JDVA 4UMRA 5KMMA 2WEIA 5HICA 4MBJA 3TNQB 4QPMA 2YIYA 2XK7A 1JSUA 2VGOA 4EH2A 3EJ1A 2ITVA 3C5IA 2IVSA 3QTXA 2BFXA 5A14A 1NVSA 2WMSA 3FMNA 3FMJA 3ULIA 2PUPA 2WTJA 2XB7A 5BYZA 4QQTA 2QR8A 2IZSA 2G1TA 4PUZA 5DHJA 4UMUA 3COIA 3IO7A 4IIRA 4ZS4A 3ZS5A 3DBCA 1ZOHA 2XJ1A 5CU0A 3NUPA 2VN9A 3KREA 3DQWA 5HI2A 3E64A 4EQUA 2WB8A 4DGGA 1OKZA 1IEPA 2CNQA 3UPXA 3F2AA 2JFLA 4OAUC 3BBTB 4F9CA 1R78A 5L8LA 1Q99A 1IR3A 2IN6A 3LOKA 4AW2A 3JY9A 3KRWA 3P0MA 3WYXA 4Y5HA 1E1XA 4RJ6A 4J53A 2LGCA 2PYWA 4FTTA 4GJ3A 4QMWA 1PXIA 2C5XA 4F9AA 5K4JA 2YJRA 3FUPA 3BQRA 4CMTA 4C4JA 5JH6A 3EFLA 3UG2A 3DKCA 2OIQA 4HJOA 1LUFA 4AN2A 4AN9A 4E5WA 2OJJA 2PVMA 2QHMA 2QOOA 4ZJVA 3DA6A 4UALA 2E9VA 2JD5A 2UZDA 2VTPA 4P4CA 5D1JA 1QPEA 1Y91A 2BALA 3ORXA 4OLIA 3BE9A 4QTCA 3SW4A 3VWAA 4AOJA 5HO8A 2HXLA 1B39A 4TWPA 3UO5A 1UKHA 3DKGA 4JBVA 4MXXA 4C62A 3LXPA 2ZB0A 3R63A 4HCTA 5KMJA 3FMEA 3PA5A 2GNIA 3AMAA 5ETFA 4MD9E 1IASA 3QLGA 2QU6A 3QTIA 4NW6A 3ZRKA 2GNFA 3C4CA 4QP7A 1G8AA 3H4JA 4FT0A 4GU9A 4XRJA 3TIZA 3DB6A 4XG9A 4YJTA 3ENMA 3NLBA 3NUYA 2YJSA 3NIEA 4W8EA 1W0XC 3EFWA 3IK3A 4IB1A 4AFJA 4L00A 5E1SA 5FXSA 3R7IA 4DG2E 4Q9ZA 5HLNA 2WMWA 3H0ZA 3S2PA 1KE5A 4H3PA 4CG8A 3ZSGA 1TKIA 3HDMA 2UW0A 5BYYA 5CAQA 3E8DA 3RPSA 4DC2A 4GKHA 1WBNA 4BC6A 4HPUE 4NJDA 3QHWA 3RZFA 5A6NA 5CQWA 4NYEA 5LVNA 1E9HA 5E90A 2XK8A 3R8ZA 4CZUA 3F3VA 5HNGA 4O0XA 4PF4A 2CGVA 4TWCA 5CT0A 3S00A 2IJMA 3SRVB 4U8ZA 5HTBA 2X7GA 3IOKA 5I9XA 4R7BA 4M69B 3TNHA 3E88A 4LL0A 2I1MA 4HYSA 3QRUA 4U3ZA 1OB3A 3JR1A 4GEOA 4JDKA 2GS7A 4MF1A 4FKWA 3ZXZA 3UQGA 4Z7HA 3NMUF 3I5ZA 3L9PA 3NNUA 5BX0A 4BZNA 2X9FA 4FIGA 2YAAA 4IM2A 2DYLA 2ITQA 3OZ6A 4S31A 4FMQA 3ZTXA 1KV2A 2BRNA 3K3IA 3F66A 5IQFA 2C5YA 4YURA 4Z3VA 3NRMA 4M14A 3UBDA 2F7EE 5DT4A 2BKZA 2A19B 5JQ8A 3CJGA 4MAOA 2ZB1A 2FSMX 2XBJA 2Y8OA 3OW3A 4IVCA 4JQEA 4RVMA 5A9UA 4RVKA 4LQMA 4JLCA 4AZFA 2W1ZA 5IEVA 2ZJWA 3E62A 3DZQA 1U59A 5LVPA 3DFCB 2IG7A 3RK9A 4PP9A 4DA5A 4ASEA 5LWMA 4O7WA 4HGSA 3EQHA 3IDPA 3R8PA 4Z55A 4UWBA 3RTPA 5A4QA 1Q8UA 5EKOA 1LP4A 1YW2A 3UMXA 3QQHA 4EK6A 1XBCA 2VX0A 1OPKA 4J7BA 5AUYA 2O2UA 3V5WA 4L3LA 3IW6A 3RVGA 4AGCA 4C35A 5B7VA 4I4FA 3IONA 3CGFA 4YUQA 4FBXA 2F4JA 4YJRA 4GIHA 3EKKA 3WIKA 5AADA 2FO0A 2PE1A 2IO6A 4X21A 5JK3A 2YM8A 2WQNA 4D9TA 5AAEA 1P14A 1GIIA 4BCHA 1YXXA 4V0GB 3QXOA 3NWWA 4QMZA 4EZ3A 3ZO3A 4AZVA 5HE0A 2XIYA 3R9RA 3W1FA 2JKQA 4D55A 4EUUA 5JRSA 4QMOA 3VNTA 4KBCA 5B0XA 3O51A 3REPA 4DHFA 2ZDTA 3ZLYA 3NUXA 4G6NA 4F7NA 5FTOA 3DB8A 3BHYA 4JX7A 3QD3A 3W10A 4BDAA 1REKA 5E91A 4DTBA 1K2PA 2XEYA 3MFTA 4GH2A 4BBMA 2PZRA 4F0GA 3AC3A 3FLYA 3F3TA 5AUWA 4D5HA 4HOKA 3LM5A 5HNBA 3FMKA 3V6SA 2W4KA 4G9CA 4QTDA 4IZYA 3DLZA 1YVJA 3QGWA 4FNXA 3LCSA 3QFVA 2VD5A 5CX9A 4I6HA 4CKRA 4L52A 4XHKB 1IAJA 4LMUA 3OCTA 3QCXA 5IUIA 2Z8CA 2IZRA 3LCTA 3KCKA 5AX3A 3TUDA 5IH5A 3O50A 1H01A 2J90A 2JAVA 2YIQA 4DFYA 3EQDA 2VTHA 1M2RA 3WYYA 1J1CA 3HAMA 4TNBA 3IW7A 4DEDA 3EHAA 3ZLXA 2YN8A 4USFA 4BDKA 2C6EA 2Y4IB 5CSPA 3BRBA 2IZTA 4XG7A 1W8CA 3SVVA 3VUHA 2X8DA 4O7SA 3E3PA 2B9HA 4FT3A 4M12A 2ONLC 3SC1A 2O5KA 4EYJA 2CNUA 3FYJX 2W0JA 3D5VA 3MFRA 3MBLA 3VBTA 3H3CA 4KS8A 4M66A 4PPBA 2Z7SA 4QQJA 2PVFA 3LAUA 3L8SA 3TNWA 4RVLA 2A2AA 4I92A 4JAIA 4KIKA 4NWMA 3C9WA 4GK2A 5DG5A 3W2PA 1OBDA 3HUCA 1ZLTA 1KE9A 2XIKA 4GT5A 4RVTA 3I5NA 3EIDA 3FI3A 4GS6A 2WMBA 2BRBA 4O2ZA 4RWLA 4DITA 5LVLA 3L8PA 2B54A 2W1GA 1GZNA 4O38A 3QA0A 1QL6A 4BICA 2OIDA 4EOIA 5EW8A 4I5PA 4BTJA 3NVKI 1NW1A 3KXHA 3UVQA 4FIHA 3C50A 5EM8A 5KBQA 4DFUA 3BHTA 3IW8A 2FH9A 3QUDA 3GU5A 3ODZX 4YC8A 3AC2A 3BEAA 5JSMA 1UU9A 3PPJA 4QMQA 3R8VA 2EB3A 4ZSLA 5AV3A 4EZ7A 3R7YA 2QR7A 4FKRA 2OZOA 3FJQE 1JKTA 5ANOA 5FG8A 4QMMA 4NKAA 3ZRLA 3HX4A 2G01A 3QD4A 3GT8A 4HGLA 2RG5A 3DZOA 4FICA 5CVGA 3EFJA 3OD6X 5ACKA 3PJ1A 3KF7A 3FLZA 2W06A 1MRUA 2WQOA 1XHAA 3KCFA 4RMZA 5CTPA 3S95A 4MBIA 4BCJA 4GKIA 5E4HA 3FZSA 3G90X 4YJPA 4HW7A 5CAUA 3N9XA 5CENA 5CAVA 3JVSA 3R30A 4FTIA 3OY1A 4GK3A 4MXAA 5CSHA 4QPAA 4AGDA 2PMOX 3LLAA 1J3HA 1Y6BA 4BFMA 1RJBA 4BRXA 2BMCA 3DS6A 4KRDA 1WFCA 4F6SA 2C30A 5FBOA 4DEIA 3RP9A 4LG4A 5L6OA 2BIKB 4FV5A 4TN6A 3TKHA 2QO9A 3QKLA 2W4JA 1OL6A 4UEUA 4BDCA 4JVGA 5KCVA 3WF5A 1KV1A 5D9HA 3MA3A 1NA7A 4RLLA 4FSQA 3GOPA 4BZDA 3FKOA 3R1NA 2OZAA 5HX8A 2GTMA 4FKVA 4TWOA 5GJDA 4K33A 4PQNA 4EHEA 5LXMA 3E63A 4J71A 2XJ2A 3EZVA 2VTOA 2VWYA 3KQ7A 1PJKA 2QODA 3UOKA 3R73A 3CBLA 1M2QA 4JR7A 4EH5A 2XVDA 1PXNA 1GNGA 4DAWA 4IM0A 3TG1A 4ANSA 4CYIA 3B2WA 5HE2A 1GIJA 2C6OA 4OBOA 1SNXA 5H8EA 4FZDB 2WEVA 3LJ0A 1A06A 2VO7A 3KY2A 4WUAA 1PKGA 3WI6A 3K2LA 2XUUA 4FOBA 2W5AA 2GTNA 4CV8A 4EYMA 2UW9A 4LGHA 4E7WA 2DQ7X 4MXOA 3RZBA 1BYGA 5M4FA 4CLIA 1XJDA 4K6ZA 3VBYA 2IW9A 1Q24A 5BVEA 1G5SA 3C4EA 4RC4A 4UMPA 4USEA 3UO6A 4TYJA 4FV6A 4S32A 2FSLX 3HV5A 3TKUA 4E26A 4J52A 4UWYA 3IKAA 1YDTE 3UDBA 4PDPA 2B52A 2OO8X 3HRFA 4R7HA 5AJQA 2G2FA 1TQMA 4N6YA 3VULA 2FUMA 3LMGA 3RMFA 2XK9A 4QMYA 3TEIA 1YDSE 4IFGA 4D1SA 5DR6A 2C47A 3JPVA 2WMTA 2ZM4A 3QBNA 4O0SA 4Y5QA 3OF0A 4D0XA 4HZSA 4FE2A 1VZOA 2C69A 3TV4A 2ITYA 2W9ZB 4GUEA 5AAGA 3AQVA 1XO2B 3RM7A 4M69A 5JN2A 2PVKA 3OBJA 1PHKA 2OJGA 2YIRA 3E7VA 4E3CA 4IHPA 4ORKA 4J95A 5IPJA 4PRJA 2PE2A 4LOOA 2AUHA 3A7GA 3NVMB 4Y85A 5HZNA 2H96A 1YOMA 2V0DA 4R3RA 4C61A 2A4LA 3MPTA 5KMKA 4AS0A 3POZA 1LEWA 3D2IA 5EOLA 3ZSHA 1M17A 3FZPA 2B9FA 3QZIA 4LL5A 4MWHA 3N4VA 3TM0A 5A3XA 4GU6A 1CDKA 4ITJA 3W32A 1VYZA 1WVXA 4DFBA 5J79A 2X1NA 4F0IA 2E9PA 2VTNA 3LCOA 2BAKA 5M06A 4CFWA 4XS2A 2I7QA 1OVEA 3MTLA 3QZHA 3NAYA 4O82A 4FSYA 2AC3A 4ZSAA 4LV8A 4YGAA 1SZMA 5HBHA 3FC1X 3L9NA 3TNPC 1J7UA 1PMEA 3LMHA 1OZ1A 4AT4A 5KHXA 1OPLA 1Z5MA 2ZM1A 3HMMA 4AG8A 1OPJA 3GEQA 3GCQA 5DT0A 3OWPA 2H34A 3KF4A 5EFQA 4NKSA 3LVPA 3MVMA 1ZRZA 4MCVA 2CN5A 5DEWA 4CLJA 2PPQA 3EZRA 4YPDA 5LMKA 4NCTC 1H8FA 4ZTRA 4LOPA 4S30A 2WZJA 3BLQA 4K2RA 3CEKA 2P4IA 3DTWA 3DBFA 5E8TA 4KA3A 2YEXA 1CKIA 5ANEA 4JNWA 4RPVA 4X3FA 4DH7A 3K5UA 3TUCA 2YDKA 5FP5A 1YXUA 5C26A 5CLPA 1PYEA 1WBWA 3FPQA 3R7VA 3QAME 4BI0A 4V0GA 3KXXA 3TXOA 4YTCA 2I0YA 2GS2A 3K54A 4YLJA 2PULA 3H10A 4F4PA 4HCUA 4XG2A 3VC4A 3COMA 4USDA 4YLKA 2GHGA 3R2BA 2QD9A 1UNLA 4B0GA 4PV0A 3TV6A 4C4EA 3JVRA 3ZFXA 3EQIA 4E8AA 4YO4A 5EHYA 3C7QA 1P5EA 1R3CA 2EVAA 2YIXA 3Q4CA 3OG7A 4IM3A 5AUTA 2VO3A 4ZK5A 2OFUA 2W5HA 3GUBA 4BTKA 4EORA 1LEZA 4GIIA 4JG6A 4ZS0A 4EHVA 1ZMUA 1NVQA 2HZNA 2RFSA 3A7FA 2VTRA 4W4YA 5CU6A 4PX6A 5M53A 1OL5A 5EI6A 2XNEA 5D11A 5L3AA 3QGYA 3DDPA 5HO7A 4IZ5A 4OTPA 1FPUA 3QX2A 4GSBA 1PW2A 2UZUE 4JDIA 3U51A 1PXPA 5FTGA 4L3JA 5AV4A 5EYKA 3WZUA 3PSBA 4IWOA 4XP3A 3DAJA 4GFGA 4J96A 5K0KA 3O96A 2QKRA 2HK5A 4DH5A 4UMQA 3WF9A 4R5SA 1JKSA 3GC7A 4KIPA 3BGPA 4RC3A 4EK4A 2PUUA 4HCVA 4F09A 4WUNA 5IA5A 3L9MA 3V04A 2NP8A 1R1WA 3Q4ZA 1I09A 4G3FA 4FKTA 4PDOA 3RGFA 1YQJA 4F99A 4GRBA 3FHIA 3OFMA 3GENA 4KB8A 4L7FA 4FKOA 4EZ5A 5IDPA 2B0QA 3VS5A 3C4ZA 1VYWA 4YR8A 3V5LA 4FEWA 2XJ0A 4DG3E 3PSDA 5CAOA 2XKFA 1OITA 5HCXA 1IAHA 3A4PA 4EBVA 4PWNA 4WRGA 5HG5A 3ACKA 3NW7A 4RBLA 3ORPA 3MVJA 4NFNA 3UYTA 2YA9A 3QU0A 4PPCA 4I93A 2WKMA
chains in the Genus database with same CATH superfamily
3NR9A 4ACGA 3KL8A 1ZWSA 4K8AA 5AP0A 5HIDA 4EOJA 3UGCA 1Y6AA 3BZ3A 2C6IA 4MQ2A 4FODA 5EYCA 5IQBA 3AC8A 3RPVA 3PUFC 1XH4A 2VTAA 2XK3A 3LCKA 5KMOA 3HUBA 4FKLA 3PJCA 5CSWA 4MXZA 3PY1A 5HVJA 4RFYA 2PE0A 2C6MA 3PE2A 1SNUA 2IWIA 4RIWA 4AGUA 4BCKA 3Q6UA 3NDMA 3G9LX 5GZAA 2XIRA 3CXWA 2P0CA 4Q5EA 3ZHPC 4EH6A 2X2LA 2GFSA 3FSKA 4F9WA 4A9SA 3E3BX 3ODYX 2B9IA 3GNIB 3IDBA 3E8CA 2ZV9A 4FUYA 3QUPA 4GFMA 2J9MA 2YABA 4CG9A 2WELA 3R1QA 2R3OA 3SAYA 5EYDA 2CMWA 4ASDA 3FY0A 2VX3A 3MDYA 4KD1A 3TN8A 2Y0AA 4II5A 4CCUA 3VS0A 2IW8A 5IH4A 5JFWA 3ROCA 4TYIA 2W96B 4WRSA 2X8IA 4AA0A 2YHVA 4CFXA 1VR2A 5IA4A 4ZZOA 3SDJA 4C2WA 3WF8A 5KKRC 5AV0A 3KGAA 5E8UA 5KMIA 5CEOA 3JS2A 4DLJA 4KSQA 3OT8A 4FV4A 4HVSA 4HVDA 3R02A 4EEVA 3SHEA 4C8BA 3EN5A 3OY3A 2VNYA 4LOQA 3IGGA 3LXNA 3QTRA 1GZ8A 3C0HA 4FZ7A 4QT1A 3F61A 1F3MC 3GCVA 5A4LA 3CY2A 1Q3DA 4JRNA 4NSTA 4OGRA 4MX9A 4XNEA 5HLPA 3TZMA 4KS7A 4FTRA 4D2RA 4TXCA 3ZBXA 5E8VA 2VWUA 4E5BA 3EQGA 2OLCA 4GFOA 4M68A 1M14A 4PNIA 5LCKA 5DI1A 2OK1A 4KIOA 2BVAA 3LJ2A 3PTGA 1O6KA 1GOLA 3R28A 3F5GA 4KAOA 4J8MA 4GMYA 1H0WA 5EHLA 5M4IA 2R3GA 5GIPE 4NIFB 3PZHA 3U87A 4O7ZA 2R9SA 2JBPA 3HA6A 4RFMA 2WMQA 2UW8A 3FKNA 3E5AA 1BI7A 5HGIA 2XNOA 4XX9A 4I23A 1PYXA 5CU4A 2VGPA 3MV5A 5FRIA 4RA4A 4IDTA 2OF2A 2IPXA 3HLLA 4L53A 5DLSA 3QD2B 4DYMA 4ZAUA 4ZIMA 4G17A 3R71A 4O0VA 4AAAA 1SVEA 3LFDA 4EOOA 1V0BA 4C7TA 5FUTA 4O7NA 3F3UA 2VTQA 4HGTA 3QQFA 3GCPA 3UTOA 5LCJA 2HXQA 3PG3A 3VUIA 4XEYA 1ZXEA 5AM6A 2UZBA 2X9EA 1DI9A 4MVFA 2PWLA 4YC6A 4Q2AA 1QPDA 5KO1A 5GIOE 2BAJA 4NUSA 4F1MA 3OOGA 5JFSA 3TMOA 3G6GA 1BLXA 5H8GA 4AAYA 3HMOA 4WHZA 3TTJA 3BHHA 4B4LA 4QEBA 2PU8A 3TL8A 3PFQA 2JC6A 5CZHA 3W0NA 3Q96A 3MWUA 3QRTA 4MNFA 3IGOA 3ZLWA 4D58A 5HD7A 1H1RA 1WBSA 4R8QA 1YDRE 3VUKA 4OW8A 1A48A 3MY1A 3OUNB 2BHHA 4S2ZA 4WSQA 4FTAA 4CKIA 2GSFA 3DNDA 5TE0A 4N57A 2XCKA 4FT9A 1Y8YA 2WXVA 3Q9WA 5FM2A 2VTLA 5ETIA 4XMOA 2YDJA 4P7EA 4QP4A 3KEXA 5LJJA 3TZ8A 5IG1A 2EWAA 2J0JA 2XMYA 4RRVA 2FVDA 3Q52A 4GYGA 4HYUA 3D94A 1HCKA 2HWPA 4AWIA 2J0IA 4NTSA 4IWQA 4WT6A 3RHKA 2WMAA 3EOCA 1OUYA 3II5A 4TKSA 4FI1A 4KABA 3SQQA 4KSPA 4KWPA 4QPSA 4AXDA 2W1CA 3WOWA 4EOPA 4QP3A 4I5MA 1YI3A 2QNJA 3E93A 3F2RA 2XKCA 3ZCLA 2WMUA 4C57A 4D4SA 3ANQA 1BX6A 3TIYA 4TZRA 1H24A 3DK6A 3HMIA 5J95A 2HYYA 3LFFA 3PY3A 4TT7A 3NYNA 4UWCA 3ZXTA 2QKWB 4IJPA 2I0HA 4OTIA 3K5VA 2GHLA 3AT2A 1OL2A 4DN5A 3DBEA 4FKSA 3GQLA 3ZOSA 3FBVA 3KRXA 2CCIA 3AD6A 3BYOA 3GCSA 5AMNA 5EDPA 3UVPA 4WO5A 1U46A 4I4EA 3RJCA 3KXMA 2GNGA 5IEYA 2OZAB 4CQGA 3JYAA 5CAPA 4IW0A 1PKDA 2HWOA 2RIOA 5IMEA 1JBPE 3EL7A 5CF8A 5I4NA 4U41A 4O7VA 4FG7A 3RCJA 3RALA 3B8RA 3BV2A 4A4XA 3NUUA 2NPQA 1GAGA 4XUFA 3VQUA 4KBKA 3POOA 3PVWA 3RKBA 2JBOA 1PMUA 4B99A 5CASA 2DUVA 1YI6A 2QHNA 3FKLA 1K9AA 1DAYA 1WCCA 3VHKA 1ZZ2A 2J6MA 4LI5A 3ATTA 3C51A 3F82A 4AW0A 3LE6A 3ETAA 2OF4A 1DAWA 4HNFA 4O4CA 4E6AA 3EQBA 3PWDA 1PY5A 4Z16A 3VVHA 1FQ1B 4PP7A 3FMMA 4IC8A 3ZUTA 2R0IA 4CYJA 4EL9A 4GG7A 4KBAA 2C6DA 2ZDUA 4I6QA 3PXFA 1FVRA 1XH6A 2OH4A 3F6XA 4HNIA 1OKWA 3F69A 3DPKA 3QUEA 3ZC6A 4QRCA 4ANNA 4EOMA 4OTRA 1RE8A 3PLSA 4XG4A 3ZDIA 3PZEA 2I6LA 4DH1A 2BTSA 3HYHA 3O17A 4FVPA 3RWPA 5A6OA 3NUNA 3WF6A 4D4RA 1BL7A 4ZTSA 2W1HA 5IMXA 3DKOA 2R3LA 1XH9A 2IW6A 4JDHA 4NEUA 3AT3A 3R7EA 4C38A 4CKJA 3OTUA 1UVRA 5I0BA 4O7RA 3OMVA 1WBTA 1YRPA 1ST4A 4DLIA 2OH0E 3GGFA 3W2QA 2NO3A 5L2TA 2B53A 4FEQA 5D10A 1FVTA 5B2KA 3L8VA 5AP2A 2UW4A 5HO6A 4JXFA 4NM5A 5HLWA 2JKKA 2WU7A 5IQDA 2V55A 3FEGA 3OHTA 4PMPA 2RKUA 2R5TA 3PXKA 2ZMDA 2PVYA 2QLUA 4MXCA 4PTEA 4FT5A 3QX4A 4JBQA 4TYEA 5BV3A 5L2SA 5AR5A 4G6OA 4FG9A 3BPRA 4YP8A 4OAVB 3UIBA 2ZYBA 3I4BA 3MN3A 4R1YA 2XKDA 3QALE 2JAMA 4DGMA 2QURA 2ZOQA 3GB2A 4R7IA 4A9RA 4EWHA 4WSYA 4KIQA 4FTQA 4O1OA 4ANMA 4YSMA 3QCSA 4W4WA 4CT1A 3EN7A 3OXIA 5EM6A 2PVRA 4DFXE 5J5TA 4L3PA 3KA0A 3V5JA 4UMTA 5ANIA 3QD0A 4JOAA 1ZYCA 2QVSE 3DQXA 4RGJA 1XH5A 4A9YA 4XV2A 3UQCA 5EM5A 1P4OA 3BYUA 3VW8A 4LGDA 3P1AA 3A60A 3T8OA 3LQ3A 4RFZA 4X3JA 5BVDA 5GINE 4E5AX 4XG3A 5HCYA 3RAWA 2PK9A 5M56A 3D5UA 3M11A 4PTGA 2UW3A 5DOSA 5AWMA 5J7BA 2JFMA 4X6QC 3KVWA 3BYMA 2WTKB 2J2IB 3H9RA 5EYMA 3P7BA 3C0GA 4TYGA 3GFEA 3ZFMA 1YI4A 5DVRA 4E6QA 4X3FB 1FMKA 4EOSA 3BBWA 2BKKA 3NAXA 1Q4LA 2EB2A 2XCHA 4BR3A 3TDVA 4EHGA 1O6YA 2X6DA 3KRJA 4GL9A 4I0SA 4UYAA 4DFZE 3W0RA 2H8HA 3W0QA 2F57A 3F2NA 5FXRA 2Q0BA 2C3IB 3PY0A 2X6EA 3GU4A 3EN9A 3W33A 4CRLA 4E4LA 4QYEA 1YXSA 3V6RA 3UG1A 3VUDA 5DNRA 4BY9E 3ULZA 3FYKX 4BDBA 3VUGA 4JI9A 2JDSA 4FIFA 4BZOA 2GHMA 2JKMA 1X8BA 3ENHA 4CSVA 2QC6A 3ZMMA 5GJGA 4M13A 5CEQA 1KOAA 5JT2A 1J91A 4JQ7A 5JEBA 2FSTX 4U44A 4NIFA 1JSVA 3CTJA 1V1KA 4FV9A 5HEZA 4BGQA 5IQAA 4JX3A 4R6VA 4YZMA 4FTJA 3ZM4A 4B8LA 3WIGA 3A7HA 3RAKA 4YMJA 3VONA 3P7CA 4QQ5A 3D15A 4KRCA 3DOGA 2YWVA 1XBBA 4DH3A 5CF6A 4QNYA 3R9NA 2E2BA 3D2KA 5IUHA 1XMLA 2JIUA 3DTCA 4IANA 5BUEA 4U42A 4DEGA 4L9IA 5DFPA 4IAKA 4FZ6A 2O65A 3FQEA 4E1ZA 1CKPA 3QQLA 4X2GA 4CFNA 4RJ8A 4G3EA 2R3HA 3DK3A 2ITNA 5HKMA 1W98A 1F0QA 2R3IA 2R64A 1H26A 2Q0NA 3U9CA 2X4FA 4FKUA 3BU6A 2IF8A 3LZBA 1BI8A 1T45A 4G3CA 4J8NA 3ZSIA 4ZMFA 1W2CA 3RHXA 5A4EA 5KHWA 4AZWA 4XH6A 4MWIA 3TZ9A 2WD1A 1S9JA 5JFXA 4DGNA 1OKYA 3I81A 4QMNA 5B2LA 1IG1A 2PTKA 3TI1A 5CS6A 5J9YA 4BIDA 1UU3A 1ZMWA 2HZIA 2YAKA 4AOIA 5I9VA 4FL1A 5EQEA 1XH8A 3MPAA 5KE0A 2BDFA 3FXWA 3PVBA 4O0UA 3SA0A 4BKJA 1ZYJA 4O22A 2LAVA 1FGIA 1OIUA 3ACJA 1UWJA 4FIEA 4RX8A 4AUAA 2W99B 3LW0A 1NXKA 3V5PA 4EKLA 2HZ4A 3RWQA 4K1BA 4JBPA 2XYUA 2JGZA 4RX9A 4R3PA 1OM1A 4HYHA 3TT0A 4U7ZA 1XR1A 3CD8A 5I5ZA 3KRRA 2B9JA 4AA5A 3WZDA 5J7HA 4CTBA 2R3MA 4O21A 3AKJA 4IMYA 4RIWB 3V01A 2PVJA 4RX5A 2ZV7A 4ZZMA 5CF4A 5BPYA 2UVZA 5CZIA 5K3YA 5CI7A 3HP5A 4WNOA 2GNHA 2HENA 2B1PA 1H1WA 3E92A 4E4NA 1V0PA 1H07A 3IW5A 4DEEA 3UE4A 4FKIA 4LUEA 2ITWA 4BJJB 2X4ZA 4NZWB 2CDZA 3QC4A 1WVWA 3MTFA 2R3RA 3VIDA 3D9VA 5J1VA 1JOWB 2PHKA 4U9AA 4BWPA 5CF5A 4PL3A 4QO9A 2ZFYA 2VWVA 5HOAA 5T3QA 4E20A 4M8TA 2BUJA 3OROA 2GMXA 4YBJA 3PPKA 1BKXA 3OTVA 4CFFA 4XV9A 3ZZEA 2VO0A 2F7ZE 3ZYAA 5E8YA 2YCQA 1XKKA 1Y8GA 4O81A 4CCBA 1ZOGA 2Y6OA 4RZWA 2QO2A 4YTHA 2YM3A 1LPUA 2O3PA 4LV5A 4JS8A 2UZWE 5M08A 4LYNA 3VF9A 3LFQA 2WMXA 3RNIA 2W17A 4ASXA 2FSOX 5DA3A 4G1WA 2Z60A 4FVQA 5HQ0A 3BLRA 3ITZA 5CI6A 5LARA 4NFMA 4ZEGA 4ZY5A 5EQYA 3Q53A 3H0YA 1WAKA 2OXXA 3WE4A 4DDGA 3Q32A 3CSVA 3JUHA 3F3ZA 3NSZA 4C3RA 4IX5A 3SXSA 2O0UA 4W8DA 3FE3A 2VTTA 1H27A 3GCUA 3MA6A 4QP2A 3THBA 3U6HA 5DEYA 4AZEA 4IX3A 4O86A 3I60A 3PVGA 4F08A 1ZMVA 4FV7A 4IZAA 1KUTA 4ZJJA 3VS7A 3TKIA 2VV9A 3ZFYA 1JQHA 1KOBA 3GQIA 3MS9A 3BELA 3VUMA 5F20A 4ACHA 3R04A 3LFAA 4CFUA 3VBQA 3DXPA 5IQGA 4AA4A 4JIAA 3HMPA 1ATPE 4XBRA 3S3IA 4AT5A 3R7UA 4NL0A 5FLFA 3EN6A 5HESA 2XEZA 1NVRA 2UV2A 2WMRA 3RPRA 3QRIA 4I21A 5TR6A 3ELJA 3BX5A 2OIBA 4J99A 5BNJA 2EXCX 4AXEA 4DH8A 2WHBA 4AFEA 5AIRA 3QTQA 4FSMA 4BDGA 3VRZA 3FI8A 3UOHA 3NUSA 3I7CA 4WG3A 4YZNA 3S0OA 1YHVA 5K5NA 2UVYA 1XWSA 2CKPA 5DYJA 1VJYA 4FTLA 3NNWA 4ARKA 2F9GA 4BDIA 2PUNA 4IAAA 1ST0A 5C4LA 4HVIA 3HP2A 3QQKA 1NT2A 4DGOA 3LIJA 4J98A 3PFYA 4FL3A 1JAMA 4M84A 3P4KA 4D0WA 1KE6A 2YISA 2VZ6A 4P5ZA 5IA2A 4IJ9A 4QMPA 5IU2A 4XG6A 3DXQA 3EWHA 4EQCA 5K9IA 3N4TA 4OTWA 3DGKA 4ZSJA 5AEPA 5FTQA 1OBGA 3NX8A 1G3NA 4C4GA 4AF3A 2WGJA 5CYIA 3QQGA 3R9DA 3AMBA 3P5JC 4O1PA 5AUXA 3NPCA 4D5KA 1M2PA 3A62A 5BUJA 1T46A 2VRXA 5EDQA 4ERKA 2C5VA 3CY3A 3O0GA 5HG7A 4EJ7A 3MFUA 4G3GA 4LFIA 4KUJA 5GZ9A 3KVXA 3Q5ZA 5IKWA 4O83A 5HVKA 5I9ZA 2QQ7A 5FEQA 2WOUA 1AD5A 4FSNA 4C36A 1TQPA 2RL5A 4QYGA 4LRKA 4YHFA 1G8JA 1UKIA 3OXZA 2HZ0A 3K3JA 4IZ7A 4XCUA 5IUGA 5DH3A 5BMSA 4DHJA 2R3PA 3SX9A 4DT8A 4D9UA 4D2SA 4RJ4A 3HZTA 4FTMA 4CZTA 4JIKA 1OECA 4QMSA 4H39A 2JDOA 4S34A 5C8MA 3CC6A 2HY81 5F9EA 3UJGA 3WZKA 1Q8WA 4YU2A 3OWKA 3HECA 1DI8A 3TNIA 5K0XA 4F1TA 3AD5A 4O84A 4C33A 4FNYA 4K11A 3PP0A 2YM7A 5F4NA 4IAYA 3KU2A 5AP7A 5HHWA 3PVUA 2H6DA 4YTIA 4E6DA 3RM6A 5IQIA 1YHWA 3QKKA 4JDJA 2AC5A 2BFYA 2OFVA 3CE3A 5AP1A 3QLFA 2OI4X 2OJIA 3BWJA 3IQ7A 3O7LB 3UODA 4EH4A 3PUPA 3TYKA 3LFBA 2XRUA 1Y57A 3MB6A 4IX6A 2WTWA 2HAKA 3P7AA 2UZEA 2H9VA 3NEWA 3Q04A 2BTRA 4TY1A 2ETMA 1AGWA 3OCBA 5M44A 2CN8A 5AM7A 3QWKA 5CANA 2XNNA 3RAHA 3KRLA 1BMKA 4NU1A 5AP3A 4EI4A 3KIOC 4M7IA 4QMVA 4FL2A 4BDFA 3ZDUA 4FEVA 3OS3A 4L67A 4O7LA 2ERZE 4X0MA 5TKDA 5CU3A 4YTFA 3E8NA 3SGCA 4ANOA 2QO7A 4KNBA 4OBQA 4DEBA 2X7FA 3UP7A 4IVAA 3JXWA 4EHZA 4L44A 4I94A 3SW7A 3U54A 3HNGA 4RWKA 5AUUA 4RC2A 3UQFA 4WBBB 5ETCA 3PJ8A 3C4FA 3MESA 3UC4A 3NNXA 3QZGA 4A4OA 4AXFA 4FV0A 2A98A 4BCFA 3NYVA 1YOJA 2G9XA 3KMUA 2YITA 4F0FA 4QQCA 4MK0A 3VJNA 4B9DA 2YCFA 4QTBA 4FF8A 3FMLA 1YXTA 2VWZA 4YLLA 2Z7LA 2CGUA 3T9IA 1KE7A 3Q9ZA 4YO6A 3UYSA 5GZ8A 1G8KA 1PMVA 3P79A 4APPA 5FEDA 4EKKA 2Z02A 3QTSA 4WNPA 2V5QA 5E8WA 3BGZA 4BGHA 5JGBA 4C3PA 1GIHA 1GZOA 4ANBA 5L2IA 2OXDA 2ZVAA 2DWBA 5T6KA 3KK8A 5AR7A 4BB4A 3TJDA 5IQEA 2CKOA 1AQ1A 1CKJA 2ACXA 1SVGA 4BIBA 2EU9A 2RFNA 2UZTA 3OCGA 3EN4A 3FZ1A 3R6XA 3GC8A 4FC0A 4YNEA 4I6FA 4IWDA 5JRQA 4NK9A 3HRBA 3PRIA 2W1FA 2JDRA 3KULA 3QYWA 3AC5A 4MTAA 2AYPA 3NCZA 3LXLA 4E4XA 5IF1A 1G8SA 4ZJIA 2XZSA 2FB8A 1IRKA 3VQHA 2IVUA 2HIWA 4MD8E 3HVCA 4TRLA 3OT3A 2UW5A 3RBWA 5HTIA 5BUIA 4IC7A 2E9NA 2YZLA 2WAJA 4EOKA 5L4QA 4XP2A 5C9CA 2E9UA 2FGIA 3FXXA 3R7OA 4IQ6A 5L2QA 1W83A 5D41A 2XM9A 4YSJA 4ZTQA 3L1SA 5L6PA 1OMWA 4BJJA 3C0IA 4LDTA 1KSWA 2CSNA 3TCPA 4A4LA 2R2PA 3ORMA 3P23A 4ZXTA 3NFFB 3ZM9A 4BI2A 4DHIB 4XRLA 4BHNA 3OOMA 2UZNA 3Q2MA 3MJ1A 2W1IA 1UA2A 4FYNA 4I3ZA 1FINA 1UV5A 2VWWA 2O8YA 4J97A 4QP8A 5E8ZA 5I9WA 3A99A 1FBNA 5EHOA 4BCOA 2R0UA 3IDCA 2FYSA 5CT7A 1TFFA 1ZY5A 3ORLA 3PLAE 4F64A 4IFCA 5AUZA 1M7QA 1GZKA 3R00A 4FK6A 5TT7A 4RLKA 3FDNA 5AR3A 2V7AA 4U45A 5DN3A 1ZZLA 4DT9A 3ERKA 3CJFA 3QWJA 4H3BA 5L8JA 5CSVA 4RWIA 4CNHA 3UMWA 4FA2A 4O2PA 4G9RA 2WMVA 3LQ5A 2A1AB 5HBEA 2UZLA 4K0YA 3EB0A 4OT5A 5CXHA 5DMZA 2RSVA 2BIYA 3F5XA 3PXRA 3IW4A 3LHJA 4BKYA 4A9UA 4EQMA 4BKZA 1GJOA 5M4UA 1PMNA 2C6KA 3EYGA 1GY3A 4RIOA 4RQVA 5LWNA 3PXYA 3ZRMA 4X6RA 5TOZA 2WQMA 2CKQA 3FI4A 3FV8A 3QF9A 2J0MB 3FMHA 3HEGA 3CLYA 3HV4A 4FSUA 3W2CA 4DTAA 2VO6A 3FZTA 2V7OA 3N51A 3GI3A 2OJ9A 2W9FB 4S33A 4YZBA 1U4DA 4AT3A 4BCGA 3QA8A 4AACA 3KK9A 3MYGA 5M07A 4FKPA 3CCNA 5AR2A 5F94A 3G33A 5E7RA 1WMKA 3MVLA 4UV0A 4DCAA 2V62A 2UVXA 3DBQA 4YNOA 1Q97A 5M57A 4PDYA 4OTGA 3KMMA 4ALWA 2XA4A 3P9JA 4RWJA 5CVFA 4ZLYA 5HU9A 4LRMA 5C1QB 1P2AA 4QMTA 3GVUA 3RCDA 5CVHA 2Z2WA 5ETAA 3FLNC 1OI9A 4AZSA 4C02A 3MH2A 3IPHA 5CEPA 4QYFA 2P3GX 4QDVA 2GNLA 4U79A 4IWPA 4C34A 2ITOA 5CEKA 3LJ1A 4G6LA 1H28A 2HCKA 4D2TA 4M0YA 2YM6A 4TL0A 1APME 5A4TA 3VO3A 4CFMA 3KC3A 4IAZA 2ITZA 4RJ3A 1R0EA 4IVBA 4XG8A 2GPHA 2G2IA 3AD4A 4FG8A 3MJ2A 2WTCA 4XOZA 5I9YA 5HE1A 4J1RA 5BVKA 3DBDA 5KMLA 2ETRA 2VWIA 3TJCA 3PA4A 3SG8A 3P08A 4DEAA 4FK3A 5HIBA 4ID7A 4PMMA 2BPMA 5KUPA 2UW6A 3F7WA 4B7TA 5J1WA 3ZU7A 5DRDA 1ZYLA 4D1ZA 3I1AA 3GP0A 2ZV2A 5E9EA 4AW5A 5ANKA 4MHAA 4G2FA 2C1BA 3SV0A 4DGLC 1R39A 4RJ5A 3UZRA 2WQBA 2QOBA 1Q8TA 3QRKA 3W2RA 3FL5A 3KXZA 4EJNA 4F7JA 2CGXA 5L2WA 4YZDA 5M09A 3ANRA 4CTCA 3WF7A 3DK7A 3UZTA 2IZUA 2PSQA 5JFVA 1ND4A 3BYSA 3PJ3A 1H1PA 3SD0A 4ENYA 3R8LA 2VWBA 2BZIB 4N6ZA 1Z9XA 2XK4A 4KKEA 3MIYA 4XV1A 5JZJA 4ACCA 3KN5A 5M4CA 3R9OA 4I5HA 1DM2A 3FMDA 4N0SA 4ACDA 1JKKA 2C3JA 3AC4A 1WBOA 2P2IA 4U81A 5H3QA 2RFDA 3QHRA 3O23A 1Q62A 2ONLA 3ID6C 3R8MA 4MNEA 5EM7A 4CXAA 1I44A 3UO4A 2QU5A 5CEIA 5J87A 1VLRA 3MY0A 1WBPA 3OCSA 4FSWA 3H9FA 2Y4IC 4I0RA 2BROA 3HRCA 4X2FA 2OW3A 5CEMA 3BHVA 3BIZA 2X7OA 3HKOA 4ZMEA 4ASZA 5H2UA 4FV3A 4FV2A 4CD0A 5CSXA 1IA8A 5D7VA 5FP6A 5LQFA 4JRVA 4C37A 3HDNA 5GHVA 4DG0E 5J9LA 5BQ0A 3F3WA 1RW8A 2AQXA 4F9BA 1CMKE 3DFAA 2QLQA 3KMWA 3BL9A 3R0TA 3BYVA 2ZMCA 4QP1A 5IZFA 5DE2A 4ZTLA 3UDSA 3FQHA 3BL7A 5CNOA 4RJ7A 3VAPA 2GQGA 2JITA 1H00A 2WTVA 3PIXA 5LMBA 4FV8A 4C58A 5IISA 2G15A 3MH1A 3S1HA 3Q4TA 2WIPA 2VX1A 2OJFE 5EKNA 3NW6A 3VBWA 5KNJA 3FPMA 4FTOA 4U97A 4DE4A 5IEXA 2OG8A 4QTEA 1RDQE 3I6WA 3QRJA 3SXRA 2PVNA 2X0PA 2YERA 3CP9A 3Q5IA 4NT4A 5IQHA 4L45A 4ONAA 4M3QA 3MW1A 3UVRA 4F6WA 3MI9A 3PE1A 3MGYA 4BCQA 1SMHA 1OKVA 2HELA 2W5BA 2FA2A 4ZY6A 3UC3A 3U4UA 2P55A 5C01A 2I40A 2NNWB 4M97A 4BBFA 2QOHA 4YJOA 3WZJA 3UZPA 4APCA 5AIKA 3W0MA 3PIZA 4BGGA 4X7QA 2C3KA 2J51A 4B8MA 5A46A 5KKRB 3N4UA 1YWVA 3ZEWA 4JMQA 3GFWA 4FIIA 1PXMA 2W7XA 1HOWA 2R4BA 2Y9QA 3ET7A 4E93A 2YZAA 4XBUA 3A8XA 3GU8A 3TZ7A 4X2NA 1OIRA 5F95A 4OBPA 4ERWA 5JQ5A 1ZYDA 4GUBA 3I79A 1CSNA 2B7AA 4QYYA 3OXTA 1ERKA 4D1XA 2CKEA 3OWJA 2QOFA 4YJQA 5E92A 4FTCA 1Q5KA 5C4KA 4EWQA 4ACMA 4FR4A 3AGLA 3R1YA 4ITIA 4IVDA 2JIIA 3NIZA 3Q60A 3O8TA 2YM5A 4UY9A 5AV2A 3LXKA 3BLHA 5M55A 5BVFA 5IDNA 5AP5A 1YOLA 4HYIA 4MXYA 4ZZNA 4DFLA 2CGWA 4ZTMA 3ALNA 5CY3A 5L8KA 4BYIA 3Q9YA 4YJUA 5ACBC 4O7TA 3QQJA 1MUOA 1U5QA 3G9NA 3QCQA 4OR5A 3LLTA 4H1JA 5AV1A 4LMNA 2O64A 1PXLA 3U4WA 4R77A 3CGOA 5AA9A 3U55A 3FZOA 4M0ZA 4WKQA 4JAJA 5BYLA 1ZY4A 3R01A 4XLVA 5JKGA 2SRCA 4D4YA 5C8NA 3NUAA 4EH3A 4FT7A 4Y46A 4E4MA 3BGQA 3ZO4A 3G5DA 3R8UA 3NFGB 4I6LA 4FEUA 2ITUA 4IE9A 4C4HA 3A61A 4FSTA 3DCVA 4YBKA 2YLEA 4MH7A 4ENXA 4Q9SA 3VS3A 2JKOA 5M51A 3L9LA 4IACA 3BHUA 4F63A 4N70A 2PY3A 3T3VA 3VS4A 2UZOA 3AOXA 4I24A 3CPBA 5CNNA 2AEGA 2WO6A 2XAOA 4R1VA 4GK4A 3LFNA 3NNVA 4FNWA 2B4SB 4LV7A 3OVVA 3GBZA 4QMLA 5AP4A 4TYHB 5HG8A 3I6UA 4MKCA 3VBVA 3B2TA 4N4SA 5DPVA 4PPAA 4QP9A 3DJ7A 2I0EA 2YFXA 3ZONA 5J8IA 3IECA 4O6EA 4TPTA 5EW9A 2C5NA 3BV3A 4ZSEA 3V5TA 4C3FA 5DWRA 4C59A 4AXCA 4AE6A 2PMIA 2QCSA 4ZOGA 4CT2A 2JIVA 3TDWA 1JVPP 5KZ0A 4IADA 3M42A 2KULA 2BHEA 4EH9A 3B8QA 3FQSA 3CQEA 1SYKA 3FLWA 2KTYA 4FKJA 4K18A 3KXGA 4HVGA 2RF9A 5C8KA 3Q2JA 4CVAA 4F70A 1OL7A 4JQ8A 3EQCA 4L43A 1QPCA 2DS1A 2XKEA 4W4VA 2RGPA 3TTIA 4C2VA 4MEDA 4PMSA 3T9TA 4KKGA 1WZYA 3PG1A 4U0IA 1BL6A 3DNEA 2GNJA 5CU2A 3MFSA 2GU8A 3ZZWA 2E9OA 4G5PA 1U54A 1RQQA 3I0QA 3DV3A 4FUXA 2RFEA 3CQWA 2V22A 2VTMA 5GNKA 2J0LA 4LRJA 4BCMA 2ESMA 3FLSA