4X6QC

An isoform-specific myristylation switch targets riib pka holoenzymes to membranes
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
337
structure length
334
Chain Sequence
SVKEFLAKAKEDFLKKWETPSQNTAQLDQFDRIKTLGTGSFGRVMLVKHKESGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVAGGEMFSHLRRIGRFEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFTEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cAMP-dependent protein kinase type II-beta regulatory subuni
publication title An Isoform-Specific Myristylation Switch Targets Type II PKA Holoenzymes to Membranes.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 103
structure length 334
sequence length 337
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2014-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4x6qC01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4x6qC02
1M17A 4G3FA 5F4NA 4F7LA 3QKKA 4JRNA 2C5NA 1KV1A 2PWLA 3R28A 4NEUA 3UQCA 4D1XA 3ZU7A 4RMZA 4MF0A 2HIWA 2CKOA 3ORPA 5BQ0A 3VBTA 5JFVA 3BU5A 2WB8A 4M3QA 5FDXA 4YURA 4FR4A 3B8RA 4IB5A 2QOBA 1PYXA 3EMGA 4IBMA 4GK3A 2O2UA 4MBLA 4D9TA 5L2IA 2A0CX 1OI9A 2OO8X 3K54A 4J1RA 1PJKA 2ONLC 5HICA 3JY0A 5JQ5A 3NS9A 3BHVA 4EK3A 3PXYA 2WTDA 4J8MA 4O38A 3V3VA 4YJQA 3SX9A 4BCMA 4AN3A 3HGKA 4C4GA 3VBWA 4M12A 4UV0A 2PTKA 4IWQA 4UXQA 3EN9A 2H6DA 1S9IA 3E3PA 4BDGA 4K9YA 3D4QA 4A06A 5M4IA 4DEHA 1CTPE 2X9EA 2WMVA 4W9WA 5HD4A 1XBCA 2W06A 3RVGA 3L9MA 4RIOA 2NP8A 2EB2A 2C6LA 4A9RA 4I6QA 1YXUA 1RE8A 2PSQA 2WTIA 2UW6A 4FV4A 3C0HA 3KGAA 1P5EA 2XNBA 3WZJA 4MBIA 3F5GA 4DFUA 3HUBA 3V6SA 5GIPE 3ANQA 3BHYA 4RJ4A 2VAGA 5AP5A 5HCZA 2B1PA 2VWYA 3G2FA 1UNLA 4IX5A 3QU0A 4BZNA 3KEXA 4B7TA 2HW7A 3PRIA 2C30A 2Z7RA 3NIZA 1H08A 1WMKA 1H1PA 3TV4A 4ANQA 1PXPA 4IAAA 1SYKA 2XK7A 5BUJA 5AWMA 4DEAA 5IQHA 1IASA 2UZDA 4DFZE 1H25A 4V0GA 2R4BA 4JDHA 4FTMA 2WMBA 2OGVA 2BKZA 3Q4UA 2YFXA 4R7IA 4S2ZA 2BKKA 3ENHA 3WYYA 3P78A 1H0WA 4M68A 4AE6A 5M57A 1SVGA 3NNUA 2XUUA 4X2FA 4A7CA 4YJTA 4GK2A 1XH4A 4MWHA 3NR9A 3NYXA 2H34A 2RFNA 4CQGA 4CKIA 4MWIA 4HPTE 5HI2A 3TNQB 3UO4A 3DXPA 4FOBA 3VW8A 4YZDA 4YJSA 5K9IA 3A4PA 1T45A 3F3UA 4MCVA 3P9JA 3ZMMA 3QHRA 3IS5A 3RM7A 3R7EA 3SC1A 4EBVA 2XIYA 5J95A 4WSYA 4USEA 1H1WA 1OIQA 4QMWA 2C5OA 2R2PA 4DEEA 5CSHA 2XK9A 4G9CA 4O0UA 1YOMA 2YLFA 3LFQA 2XYUA 4FV3A 4IEBA 3UOLA 3T3UA 3V5WA 4QP8A 4UX9A 3FC2A 3E8NA 4FKPA 3MPAA 2ETKA 5GJDA 2XNGA 5JN2A 4BBMA 3NPCA 4D9UA 1U5QA 3RI1A 1WBSA 3UC4A 3EQIA 3GVUA 3UPXA 4WUNA 2G9XA 4ITJA 4FIHA 4QMTA 3OOMA 3QLFA 4FTQA 5I9VA 2VO3A 5CF5A 3V8WA 4AT5A 4PP7A 2VTMA 4IX3A 3UZTA 2PZYA 2G1TA 2C6KA 2JKKA 5C01A 1H00A 3FI8A 3EN6A 3A61A 3QCYA 4E6AA 4G5PA 5AM6A 4NWMA 2FSMX 5HBEA 2QHNA 3FQSA 4QMMA 1K2PA 1Q3DA 4AZVA 3CTHA 3MI9A 3ZM4A 5M09A 4DBXA 4C34A 4V01A 3OFMA 3GEQA 4ALWA 3E7OA 3DJ5A 4O7WA 4AU8A 4Y72A 3K3JA 1NA7A 3KRWA 4FT7A 4L3LA 4XEYA 4IVAA 3BI6A 5IKWA 4YZ9A 1TQMA 3LPBA 5M4UA 4RIYA 1QMZA 1OBGA 3VULA 2JDVA 3FYKX 4RVKA 3UOKA 4PQNA 4C0TA 4AF3A 4YU2A 2R3HA 3BGZA 3NW6A 4IAFA 3TCPA 4JR7A 2XBAA 4O2PA 3G0EA 5CZIA 2X8IA 4G6LA 3ZLSA 3P1AA 2PMNX 4GW8A 2HELA 3I1AA 4RQVA 3EN4A 3HA8A 4EYJA 3PIXA 3HL7A 3KREA 3F69A 4XHKB 2ZYBA 4O7LA 2Z7SA 3SHEA 2XJ1A 1Q5KA 4I0RA 4MNFA 4EHVA 3R8PA 4IC8A 4BIEA 2CKQA 4BRXA 4YJUA 5AP6A 3KK9A 4D2VA 4IE9A 4TT7A 4R1YA 4YUQA 4FMQA 3C0GA 3VC4A 3WE4A 2VO0A 2RG5A 2I1MA 4GG7A 5C1QB 3EQRA 2Y4PA 4I94A 4GFOA 5FEEA 1H0VA 2WEVA 2VD5A 3UVQA 3TWJA 4KINA 2YDIA 3DNDA 3Q6UA 5EM8A 5HTCA 4MYGA 4WA9A 2XK4A 5AP7A 4DH1A 4LGDA 1WCCA 3NW7A 4FUXA 4EK5A 3JR1A 4M66A 4ALVA 3DLSA 5CEMA 5KUPA 3QCSA 4DTKA 3PA3A 2WNTA 4BCJA 4FK3A 1PKDA 2BILB 4CGAA 2WTJA 2BDJA 3CJGA 5J5TA 3QF9A 4R77A 4NIFA 2XVDA 4ZZNA 2QLQA 3M11A 3F88A 4CV9A 4U6RA 2YHVA 2JD5A 4O27B 4ZP5A 4UMPA 1KWPA 5HTBA 4ZTMA 2PMLX 4ZK5A 2J4ZA 1ZZ2A 2W17A 5TKDA 3BIZA 3R8UA 1ZXEA 4EHGA 1CKIA 2QOCA 2WIPA 3QQHA 3FLSA 3VRYA 4FTJA 3GOKA 3QRKA 3HUCA 5HE3A 2G2HA 4FKQA 3SXSA 5CNOA 3ATTA 5CXHA 2W99B 3EFLA 5EOLA 5M4CA 1YVJA 4X6RA 5D9HA 4FSQA 4FZ6A 3UC3A 4WD5A 3ZSHA 4JX3A 5FG8A 3DK7A 2XMYA 4B0GA 4DFNA 4ZJVA 5KMLA 1Z57A 2YABA 3JPVA 3O96A 4N6ZA 3W2CA 3WF5A 4XV1A 3HP5A 5CF6A 1FQ1B 2J90A 3T9IA 4C3PA 2EU9A 3NYVA 4UEUA 4PRJA 4C3FA 4C7TA 4KS7A 3BX5A 5FGKA 3CC6A 3VS2A 3WF8A 3FQEA 3D0EA 2C6MA 3D5WA 4WG5A 3PPJA 4DGOA 4QMNA 2GTNA 3C4EA 4IWDA 3BKBA 4XG8A 4EH9A 5E8TA 4TNBA 1PMUA 3EQCA 3SRVA 2QVSE 2B7AA 3GP0A 1A06A 5CF8A 4QO9A 4RA4A 4RIWA 1YDTE 2BRHA 4EL9A 2FA2A 3WZDA 2W1ZA 3LFFA 4EH2A 1OL2A 5DN3A 4LGHA 5CU2A 2QR8A 4YTFA 4UWBA 1CMKE 3H9FA 2R3IA 3KC3A 3G9NA 2BAKA 3DK3A 5EHYA 3VQHA 3FMLA 2HXQA 2R3JA 3ALNA 4AZEA 3UIXA 2C3JA 2P3GX 2XF0A 3E93A 2YCRA 4FKLA 4M69A 4W9XA 3PZEA 3JYAA 5CWZA 4WT6A 4D4SA 3MFRA 4O0RA 3SOCA 5ANOA 5AV4A 2OZAA 2P2IA 4NKSA 4HVIA 3FXZA 5KX8A 3TM0A 2C4GA 4Q9SA 1GIIA 4JX7A 4IC7A 1DAYA 3NUUA 3PYYA 4PV0A 3PLAE 5G1XA 5EKOA 4E93A 5AV3A 4DBNA 4E73A 4YC3A 1QPJA 4A9TA 2I0HA 2HCKA 2PE2A 2GS6A 4JDJA 4QTDA 4UY9A 4EONA 3Q9YA 2WQMA 4EUTA 1M2RA 1QL6A 4ANLA 4ZJJA 4I4FA 5E8SA 1WBOA 4AZWA 4TZRA 3VS0A 4QPSA 3RHXA 4LRJA 4DFYA 4K0YA 5J7BA 3ZM9A 5EM6A 3PSCA 2PYWA 1M2PA 2ITXA 3PE1A 4TTHB 2HENA 4FEVA 1CKJA 3NLBA 2CGVA 3OWLA 4BI1A 1M7NA 2UW7A 2XS0A 2RFEA 2WTVA 1OIYA 2J50A 1DS5A 4BDHA 4EKKA 4NM5A 3V8TA 3OP5A 2JBPA 4IHPA 3FLQA 4P5ZA 3T3VA 2C3IB 4J98A 4G3EA 3QUPA 3E87A 4EUUA 3G90X 4X2NA 5HTIA 3OMVA 4HGEA 3REPA 2OIDA 5ETAA 4FV8A 3R83A 3MY5A 3VO3A 2CJMA 3ELJA 1F5QA 3K2LA 5AIRA 4F7JA 4K8AA 4USFA 5JGAA 2E9NA 2WMWA 4LYNA 3LIJA 4FEQA 4L46A 5CT7A 5AR4A 4F1TA 1H8FA 4DCEA 1IAJA 3D5UA 2BMCA 4J7BA 3W55A 4O1OA 5E8VA 4FKJA 3QYZA 1J7LA 5KZ0A 4KWPA 4EOIA 3BRBA 5IH6A 1GZ8A 2V62A 1PYEA 4PWNA 2IZRA 4FSRA 4IFGA 5KMOA 2IO6A 5J9YA 3BPRA 3D7ZA 3FL5A 4NFNA 1OBDA 4NCTC 5DEWA 3PPZA 5LCKA 4GU9A 2IWIA 5A4LA 3PZHA 3NAXA 2CGXA 1WBPA 3MYGA 4DGGA 5FWKK 1A48A 2XNMA 3Q9ZA 4X6QC 1KE7A 4U45A 2WTCA 3UG2A 3PJ8A 4QMUA 4AUAA 4IM3A 4ZTQA 4O86A 3F3ZA 3VF9A 3ZC5A 4IM0A 3PVGA 1JKTA 3FKNA 5H2UA 2BZKB 5IG1A 3SG8A 3QGWA 4X3FB 1RDQE 3UVRA 4G17A 4FTUA 2AC5A 2CNQA 4NW5A 1K3AA 3ZUVA 4QD6A 1LUFA 4UYAA 4ID7A 3BLQA 3BV2A 4PTCA 2V7OA 3G6GA 5K3YA 4QMYA 3UE4A 3FLWA 2CHLA 4XOZA 4E20A 1OL5A 4R78A 4R8QA 1PMEA 4HW7A 2XZSA 3ZC6A 4BZOA 1WBTA 4JLCA 3HMPA 3QKLA 4H58A 5CY3A 2OW3A 2GHLA 5LWNA 4QPMA 2GCDA 3WZUA 3NCGA 1J1CA 3E63A 5FEQA 3VUDA 4EZ3A 4RGJA 3KCKA 4XS2A 5EM7A 1M2QA 5KKRB 4L68A 2X39A 4BDDA 5A4TA 3UO5A 3IGOA 4EOKA 2UZVA 4JT3A 2Y0AA 2VTPA 4CZUA 3O50A 3DTWA 3DGKA 3NCZA 3EHAA 1ZYDA 3DU8A 4X2GA 4X3JA 5LMKA 4DH3A 2PHKA 5AP3A 5EW9A 2W1HA 4EKLA 4GIIA 2WHBA 1JLUE 2XKFA 4OT5A 4QQJA 3JS2A 1W82A 2IJMA 3NIEA 4ZLZA 2X8DA 4QRCA 1F0QA 4I0TA 4S33A 3VS6A 3BYUA 4RVTA 5LVPA 1ZOEA 4U0IA 4AAAA 3DJ7A 5KHXA 4EC8A 1OVEA 3O2MA 4F6UA 2P2HA 5HLWA 4IWOA 3OEZA 4I6HA 3CD8A 2VV9A 4K33A 5CXZA 1QPEA 2BRMA 2O8YA 1JAMA 3K5UA 5ANJA 5I9YA 5IH4A 3PWYA 5DWRA 5C9CA 2R3NA 3G9LX 4EYMA 2EWAA 4CKJA 1IA8A 3TIYA 4I41A 2J0JA 1OIRA 4FNXA 4EOJA 5M56A 4ZAUA 5LMBA 2X4FA 4X2KA 4U81A 3CE3A 5C27A 3G15A 4TWPA 4H36A 2CLQA 1IRKA 2OSCA 5GJFA 3L1SA 2PVYA 1UU9A 3W1FA 2LGCA 5CALA 4XRLA 5CU3A 3A7GA 3CXWA 3MVMA 2VNYA 4R3CA 3UP2A 3Q52A 5EM5A 4F0GA 2JLDA 4O81A 4RJ5A 4J97A 1Q8YA 3R7GA 3QQJA 3U55A 2GNFA 5B0XA 4BTJA 5IQCA 4FKGA 1P2AA 4GFMA 4GV1A 3HV6A 3I7BA 2X6DA 3QTSA 4FZ7A 3L9PA 1ZYJA 4JI9A 5IA3A 5BNJA 2C6IA 4F9CA 3SAYA 3KY2A 4GH2A 4I5HA 3VBXA 5EYDA 3LJ2A 3L8PA 4FTTA 1YKRA 1BLXA 1J91A 4IJ9A 4LV5A 3CKWA 2WTKC 4XG7A 1RJBA 3VNTA 4AGWA 5KMJA 2DS1A 1VZOA 4EEVA 1BUHA 4BF2A 1E1XA 1IR3A 3F2AA 1H07A 2IVVA 4FKIA 4R3RA 4AW1A 4BCOA 3R63A 2Z60A 2CNVA 4JQEA 5HE2A 1H1RA 2R3MA 3KB7A 4FSZA 3BWFA 4E4XA 5IISA 3BBTB 4D2SA 3GCPA 2W1EA 1FMOE 4RX9A 1VEBA 4AX8A 3QBNA 4E26A 2WPAA 2HY0A 5C03A 2QOKA 3ANRA 3LFNA 2R9SA 4DLJA 3CTJA 2XJ2A 2J9MA 4CFNA 4WBOA 5DLSA 1A9UA 3D94A 1SM2A 1JNKA 4AACA 3FXWA 3DNEA 3ACKA 3UMXA 4N6YA 3TUCA 4FT3A 5E1SA 5FP5A 3NUYA 3Q5IA 4U7ZA 2OJGA 4Z3VA 4E6DA 1STCE 4ZIMA 4QMZA 2JKOA 2X7OA 3GB2A 5D10A 3F5XA 3ZXTA 4AA5A 4FODA 3ENMA 5HOAA 2OXDA 4K77A 1O6LA 3PXFA 3TZ8A 4ASZA 4F1OA 1VYZA 5HORA 3LFBA 4MEDA 5DMZA 4YLJA 1REJA 5BVNA 2W0JA 2OIQA 3ACJA 2XK8A 3GCQA 4XG6A 3RK5A 2QU5A 3CLYA 5HU3A 2V0DA 3HZTA 5JT2A 4D5KA 4DAWA 3NW5A 3W2QA 5HNBA 3UQGA 2GHGA 5DA3A 5IU2A 4F64A 3ZBFA 2E9UA 5AR7A 1FBNA 1WVWA 4L42A 4QMSA 4CVAA 4O91A 4C61A 2QG5A 4JG6A 4GEOA 2JKMA 3A4OX 1KOBA 2ZB1A 3I4BA 4XOYA 2F9GA 2OJJA 4O7TA 5K5XA 4W4YA 5L8KA 2QU6A 3OZ6A 4P5QA 2IW8A 3UODA 1NVRA 3F3TA 4ACGA 2RFDA 3EFKA 4FTIA 1RQQA 4M8TA 4FC0A 4E5BA 3MBLA 2OXYA 3UIBA 1IG1A 4JQ8A 4CTCA 4ZMFA 2C5YA 3Q9XA 3GFEA 2JDRA 4YNOA 2OLCA 3ORMA 4F6SA 1PKGA 4ZJIA 2WO6A 3RPRA 1DAWA 2F2CB 4C35A 3LFCA 1Q97A 3PXZA 5A9UA 2BAJA 4DEBA 2PE1A 4NTTA 2XEZA 4ZEGA 4I3ZA 5HEZA 4AOIA 5CTPA 3C4ZA 3QUDA 1ZY4A 3D5XA 4OTGA 2E9OA 3NX8A 2F4JA 2BHHA 2R7BA 1W8CA 3QA8A 3P86A 4CEGA 5CVFA 2VO6A 2ZM4A 3IQ7A 2QKWB 4U3YA 2OFVA 5DYJA 3CP9A 3D2IA 5ITAA 4BKZA 3A99A 4MXCA 4Y5HA 4MXAA 3FMEA 4C4HA 1QPCA 1YXSA 2NPQA 2X7GA 4M15A 3ZFYA 4BKJA 1P14A 2JFLA 3O8PA 2BTSA 4BVUA 2WQBA 3GT8A 4ANBA 4BGGA 2XNNA 2ITYA 4GG5A 1JPAA 4ERWA 3PP1A 3PJCA 1IA9A 4FZAB 2QOQA 4G1WA 3H3CA 3P0MA 3H9RA 4CYIA 4D4YA 3GU5A 3OWJA 3MPTA 3ROYA 5I5ZA 4D28A 4MTAA 1HCLA 4H3PA 3UVPA 1OKWA 3CGOA 5HG7A 5AAGA 2YLEA 3ETAA 4UALA 1BI7A 1PMNA 3PXQA 3QL8A 1Y91A 4IIRA 3FZ1A 3KA0A 5EI6A 3P7CA 3RNYA 3OROA 4AOJA 3Q96A 4KKHA 2XEYA 2C47A 3PLSA 1LEZA 1XH7A 5LARA 3QCXA 1YHWA 3AOXA 5ANIA 5JZNA 4DC2A 2VO7A 4FX3A 3HMMA 2GQRA 1W0XC 3GOPA 3ZTXA 4XCUA 3MFUA 4JNWA 2P55A 3P7AA 4H1JA 3OCGA 3WE8A 3D7TB 3RAHA 2QODA 3I0QA 5BVOA 4FYNA 4GT4A 3LCDA 3EQBA 5FXSA 5CAUA 3CQUA 2J7TA 2PZ5A 2XM9A 2Y4IB 3E5AA 2IW6A 3EYHA 4YHFA 5C8NA 3F61A 3OTUA 4A4OA 4EORA 4P4CA 2ONLA 1H4LA 5AAFA 2EXMA 4S34A 4BCGA 4HZRA 5CEKA 4MNEA 3TXOA 3PY0A 5BYZA 3QTZA 3QWJA 2ZDTA 3R1QA 2JC6A 4QYGA 5L2QA 4F9WA 3HV7A 3PE2A 3MFSA 4K6ZA 5JFSA 3SV0A 2YCQA 3KXGA 4O7YA 4PMTA 1FVRA 3NMUF 3PIYA 1XJDA 4W8EA 3VRZA 4F7NA 3W33A 2BROA 3HRFA 3JVSA 4JAIA 4XV9A 5BVDA 3VUIA 4D55A 5AR8A 3ZRLA 3CGFA 1Q24A 2RF9A 4IQ6A 4LOPA 4TY1A 3RMFA 4U5JA 4UZDA 3NVMB 4DE4A 2QOLA 3AG9A 4EWQA 3FZPA 2R3FA 3QZGA 3P79A 4YZMA 4LUEA 3N4UA 4ZXTA 3E8EA 3RP9A 4MVFA 5JGDA 4YJNA 2ZV8A 3BU6A 3Q9WA 4QP9A 3G5DA 5F20A 2WQOA 3VQUA 5FUTA 2HZIA 4WNMA 5IDNA 3EL8A 2IVUA 1W98A 2W9ZB 2QC6A 1OM1A 4EHZA 1VJYA 3R7VA 4I6FA 2W1GA 4R6VA 4WNPA 3F3VA 2UVYA 2PPQA 3SLSA 1ND4A 5CENA 4O82A 1OPJA 3PTGA 1R0PA 2OH4A 3GFWA 3NWWA 4LOQA 5DR6A 3UJGA 5CAPA 4GYGA 2JIIA 1Q8UA 5FM2A 3LMGA 3QA0A 3E7VA 3QX4A 4UB7A 5AX9A 2A2AA 4E6QA 3W2OA 4YTCA 4YSMA 2J0KA 3OCBA 3R1SA 4PUZA 3U6IA 3KFAA 4KBCA 3VBVA 5IDPA 4A9YA 5CEPA 3DB8A 3E62A 1YWRA 4NW6A 3RWQA 5EQEA 3FL4A 4FTRA 4RJ7A 4TRLA 5EOBA 4DG2E 3C4XA 3R7YA 4TWOA 1NVQA 5AUXA 3TNPC 3TTJA 3UYSA 3ZCLA 3KU2A 3LQ8A 4Q2AA 4Q5EA 4OR5A 3TL8A 3FY2A 5CI6A 2EUFB 4FG7A 4EBWA 3BV3A 1ZYSA 3BYOA 3CJFA 1H1SA 4YJVA 4HVSA 2F2UA 3DBFA 4JR3A 5HBHA 2JDTA 3RK9A 3L9NA 3PJ1A 4USDA 4MXXA 2XIKA 2GS2A 5EI2A 4YPDA 1XBBA 3FKLA 3QZHA 1R39A 4ZS0A 3VIDA 4C2WA 3VJNA 5L6PA 3IW7A 2FB8A 3LFEA 3F7WA 5E9EA 4FNWA 5HGIA 4BICA 1YXVA 5C8KA 1YRPA 2CGWA 3QQFA 5IA1A 4GMYA 2CDZA 2XYNA 2QD9A 2Y9QA 5HCXA 3TI1A 2PUUA 4G3GA 2ZDUA 3QALE 3MVJA 4O84A 5J9ZA 2HZ4A 1YXTA 4EOMA 2XP2A 2WOTA 3EH9A 3AXWA 4CSVA 3UP7A 5AAEA 2W5HA 1CM8A 3GCUA 3NDMA 3EIDA 2IVSA 3Q32A 4YBJA 1O9UA 3BE2A 4QYYA 3TUBA 4BY9E 2DUVA 5AM7A 4TYJA 3A2CA 5IA2A 3KK8A 2C6DA 3G33A 3R30A 4RBLA 4F1MA 5EG3A 2G01A 4RX7A 5LMAA 2PUPA 1J7IA 3I6WA 3AMAA 3R8LA 4IB3A 2W4KA 3N51A 4FIFA 4LG4A 4RWIA 4AXAA 4B4LA 2O64A 2XH5A 2HZNA 3HYHA 4LRMA 3E92A 3OW4A 3GXLA 3KULB 3QTIA 5KMNA 5E8UA 3VUMA 3W16A 1E9HA 4XP0A 3UPZA 3M1SA 3PY1A 2GU8A 3KMUA 4S31A 5CSXA 2HZ0A 5DGZA 4JDKA 1Q4LA 3MSSA 3VS1A 4XG2A 1I09A 4EK6A 3R71A 4CNHA 5CANA 4PDYA 5EQPA 5BYLA 3D2KA 4EJ7A 3AQVA 4CFFA 1AGWA 3LAUA 1XH6A 1UA2A 1PXJA 2GNGA 4ZY6A 3MA3A 3ZRKA 3A7JA 5C4KA 2W1FA 3QTQA 1SNUA 2RFSA 1OKYA 2QO7A 5EHLA 3R7UA 4ZSAA 2Z7LA 3MH2A 5TE0A 3PJ2A 1GY3A 4O0TA 3DFAA 5G6VA 3RKBA 3ZH8A 5CEIA 4IDTA 2IVTA 1Q61A 3IKAA 4XG4A 3SOAA 4ACCA 5AV2A 5EYCA 3WZKA 2X1NA 2UV2A 1KE8A 2VTOA 3DPKA 4JBVA 5CZHA 2O65A 5IQIA 2B9HA 2W1CA 4O7SA 5C4LA 3F9NA 3PWDA 2WMUA 4WIHA 5I0BA 1Y8GA 5IMEA 4EJNA 5L8LA 5AUVA 3S2PA 1ZYCA 2OXXA 2FVDA 4WG3A 2C3LA 1OIUA 2HOGA 1NXKA 1G5SA 4O2ZA 4EOPA 3EQPA 3PVWA 3NUNA 4ZTNA 5BVFA 2I7QA 1W7HA 4XLIA 2VTRA 4FEUA 1Z9XA 3UZPA 4BDEA 3DZOA 4X2JA 3NGAA 4QPAA 4PNIA 4ZTRA 2CN5A 2G2FA 3OG7A 4YHTA 1OGUA 3CBLA 3O8UA 1UU7A 3FUPA 1OMWA 5ETCA 3RTPA 4N57A 3FZOA 2YM3A 3AC2A 4BBEA 1Q8ZA 3UNZA 3EOCA 4ACHA 5HG9A 1Z5MA 1YWNA 4H3BA 4OW8A 2GSFA 2X4ZA 4FTCA 4PPBA 5AA9A 2CMWA 2BFXA 4JS8A 2YDKA 2VWUA 4IZ5A 4KNBA 3TKIA 4AGDA 5EHOA 2IG7A 2NNWB 3I0OA 3Q04A 3DQXA 4PDPA 2WMQA 2BALA 2W7XA 2CCHA 4QP3A 2YERA 2C5VA 3GC9A 3WIKA 4D2RA 5T6KA 4CMUA 3V5JA 2VTNA 3OOGA 4G31A 3DTCA 2Y4IC 1WVXA 2P0CA 4PDSA 4PPCA 4RIXB 4D0WA 4DLIA 5JQ8A 2E2BA 4BCKA 4CTBA 3ATSA 3S0OA 3GU4A 3RZFA 3MWUA 5I9ZA 3FLZA 3QD0A 5DT3A 2X7FA 3COIA 4MF1A 3V01A 4JBQA 2YM5A 3QRJA 3R2YA 2W9FB 5DBXA 1Q3WA 4OBOA 3S95A 4IAKA 3W2RA 1KUTA 2PVRA 5A6OA 2J5EA 2XB7A 4KSPA 4TNDA 3QXOA 2VX3A 3R73A 4JQ7A 5EKNA 3S1HA 3PSBA 3VS3A 5L3AA 4I1ZA 1V0BA 2JBOA 4W4VA 3FWQA 3MFTA 3ZZEA 4JDIA 3OBGA 5AMNA 1SVEA 5GZAA 3HMIA 4RQKA 1R78A 4BYIA 3MN3A 5GIOE 2PUNA 4YO4A 2UZBA 3FMNA 4DFXE 3HAMA 4PL3A 1PHKA 1UVRA 3E88A 3O17A 4WKQA 5KE0A 4BCHA 2X2KA 4CZYB 4S32A 3O71A 5F1ZA 4PF4A 5E4HA 3U54A 3HRCA 3F7ZA 3L8XA 3WYXA 4CG9A 3R9DA 2GTMA 2PVKA 2C6EA 2R3RA 4KIKB 5JZJA 3V8SA 3R21A 3BELA 5AUYA 4AGCA 4BKYA 3NUSA 3NYOA 3FV8A 4RJ3A 3QD2B 3VBQA 4DITA 2GFSA 3KMWA 3TZMA 1R1WA 3A8WA 1UU8A 3M42A 2QR7A 4L45A 4MQ2A 2OJIA 4BHNA 5JEBA 3HX4A 5KMIA 2GPHA 4LGGA 5I9UA 3F82A 3SDJA 5DR9A 4C4EA 1BL6A 4CT1A 2CKPA 4PDOA 3TKUA 4MHAA 1FOTA 1PXLA 3I79A 3U4UA 4BFMA 4OTRA 2YM7A 3BEAA 5HD7A 3C4CA 4BCFA 4RWKA 5IQDA 4NH1A 3EJ1A 2UZTA 3II5A 2W1DA 3OTVA 2GMXA 4JVGA 5D7VA 3S3IA 5IQGA 4K1BA 2BR1A 4B6LA 4IX4A 4FG8A 3TNWA 3COHA 1L8TA 3ZO3A 3KXZA 4YO6A 1MQBA 2YM4A 1G3NA 2JFMA 3B2WA 2X2LA 3HP2A 4OLIA 5HG5A 1RW8A 4B8MA 1YI6A 2P33A 1NVSA 3LCKA 4M7IA 4L3JA 4II5A 2W05A 4QNYA 4E1ZA 4JIKA 4TW9A 3VBYA 1MUOA 4BC6A 2G15A 3PG1A 1AD5A 1GZKA 4HCUA 4K18A 4NCTA 5FLFA 4IB0A 1KV2A 4L52A 4WG4A 4OGRA 1U54B 2GFCA 4JXFA 2WQEA 1R0EA 5AR3A 3ZDUA 4F9AA 4BDFA 2IZSA 1FMKA 5AP4A 1U59A 4EOLA 4AA4A 3Q60A 3BU3A 1B39A 2H9VA 2QLUA 4H3QA 4L8MA 3WF9A 3WIGA 4A9UA 3C13A 3ORKA 5IH5A 2YEXA 4FG9A 4BGHA 4HZSA 3ORLA 2ZM1A 3BGQA 4BCPA 4ZTHA 4LOOA 3TKHA 3LQ5A 2O0UA 2X0GA 4XP3A 2FSOX 4N0SA 4FIEA 2YJRA 4CXAA 2PVMA 4H05A 4TYHB 4MH7A 1W84A 4UXLA 3PA4A 4Z7HA 4GYIA 4RX8A 2ZVAA 3P23A 4JOAA 5M51A 2QCSA 4FKOA 2PUIA 3ERKA 4C37A 5DHJA 1UKIA 3R0TA 4O7ZA 4BBFA 4TKSA 2OKRA 2PU8A 3EQHA 4LI5A 3BCEA 3EN5A 3AD5A 3DKFA 3JVRA 4WO5A 4DEGA 4XUFA 4PX6A 3QTRA 5IQFA 1Q99A 4MX9A 3U9NA 3SG9A 2OK1A 4GIHA 1VYWA 3IECA 3R22A 4QP6A 2WU7A 4MXYA 1PMVA 4GKIA 2XKDA 4XBUA 5E8YA 2V22A 2WMAA 4HVHA 4GFGA 4TXCA 2OBJA 4Y5QA 4CMOA 2ZV7A 4UYNA 5J87A 4QQCA 4CFMA 2JDSA 4D2PA 4C4IA 3F3WA 4LV8A 5IUHA 4EZ5A 5CQWA 3I5NA 3R02A 2UZLA 5FTQA 3Q2MA 5FQDC 3RAIA 4BL1A 4C4FA 4F9BA 3AGMA 5IMXA 4XMOA 1OKVA 5CYIA 5KZIA 3ZHPC 1HCKA 4KBKA 5HQ0A 2BTRA 2VTJA 5EK7A 2ITOA 2PMOX 5EW8A 4O0YA 3D5VA 4G3DA 3COMA 3OY3A 2YDJA 4IAYA 4U3ZA 4QP2A 4LL0A 2FSLX 4RIXA 1T46A 1Q62A 4O22A 5I3OA 4BI2A 4HCTA 1X8BA 2UW0A 1WVYA 4ASXA 4XRJA 2A27A 3VHEA 3DA6A 3OF0A 1F3MC 4EK8A 2RL5A 4NU1A 3QD4A 3V51A 4APPA 3PJ3A 5GZ8A 3UOJA 2BZJA 3KN5A 3QQUA 5CU4A 2XRWA 2OJ9A 5A4EA 1MRYA 3W32A 3IW5A 3DV3A 1WBWA 3VS7A 4ACDA 4AWIA 2W96B 3PRFA 4O0SA 3TG1A 3R04A 4QNAA 3UQFA 4FE2A 4YGAA 5AX3A 3MA6A 4BTFA 2GQSA 5LWMA 4N70A 4WOVA 4BDAA 3AC4A 4UN0C 3EN7A 2V55A 4Y95A 3OXTA 3DKOA 4AA0A 3GC8A 4I92A 2DYLA 1ZOHA 3KF4A 4AZSA 1PXMA 4FV1A 1H1QA 4ENXA 2YZLA 2WEIA 2RSVA 4GK4A 4F9YA 4J96A 4PNKA 3QTUA 4XV2A 3QZFA 3GGFA 1QPDA 3OWKA 1TVOA 4WNKA 5AV0A 3QX2A 3HDNA 3C9WA 4L7SA 2WOUA 2R3GA 2ZB0A 3PY3A 4KIQA 4ZLOA 5ICPA 3R1YA 3I81A 4MXOA 5L6WL 1SZMA 3EFJA 3T9TA 3E3BX 4ZSEA 4CYJA 1FINA 3FZRA 4L67A 5AUZA 4F0IA 5TF9A 3LMIA 4XP2A 2KTYA 2UW4A 3ALOA 1ZY5A 5BVWA 4B9DA 4EH3A 5H8GA 3OS3A 4YZNA 3H0YA 1GZNA 4Y85A 4OAUC 5JK3A 4C2VA 4YZBA 2BDFA 3NUPA 2VTSA 4FT5A 3DAJA 1H28A 4NZWB 2UVXA 4A4XA 3DAEA 5IQBA 4FIJA 3U8WA 4AE9A 4DFLA 4HJOA 4QMQA 4RPVA 3EQGA 3W8QA 3BWJA 4FIGA 4I5PA 5AP2A 5EDPA 1FGKA 2WTWA 2QNJA 2B4SB 4DGNA 4RRVA 4DT9A 1PF8A 5I4NA 3LCSA 4YC6A 5ACKA 4ASEA 1OL1A 4FSYA 2ZV9A 5JRQA 3COKA 2XM8A 4O83A 1ZYLA 1LP4A 4I5MA 4FKTA 2VRXA 3TIZA 3U4WA 4FOCA 1OL6A 2PVNA 4MD7E 4WRGA 5KNJA 4HOKA 3FZSA 3VS4A 2R7IA 2YITA 5HE1A 3FMHA 3VUHA 3ZS5A 4YJOA 5K5NA 3LCOA 3LCTA 2YACA 3MH3A 4KSQA 2WGJA 3DBQA 4LFIA 3IDPA 4MXZA 3DKCA 5JFWA 3DB6A 3DCVA 4ZY5A 4NM3A 4CKRA 4YTHA 1JBPE 4D4RA 4JBOA 1O6YA 1YDRE 5KHWA 3GUBA 3AC8A 4KS8A 5K4JA 4QYFA 4ZSGA 4BI0A 4IAIA 2BZIB 1PRYA 2XIRA 4DHFA 1YXXA 1BKXA 3MY0A 2IN6A 4O96A 4WNOA 2R3OA 4DG3E 3FMMA 2XIXA 3Q53A 4QOXA 4AG8A 3QRUA 4MK0A 4QMLA 3PXRA 4FSUA 3DFCB 4FV0A 4L9IA 4OAVB 3F5UA 2V7AA 4OBQA 4JRVA 1JSUA 2Q0BA 4L01A 5E8ZA 5EI8A 5KBQA 3RCJA 3H4JA 1TQIA 2W5BA 2PMIA 3CCNA 3ORTA 1Q8TA 4D2WA 5IEVA 2Z8CA 4V0GB 5AUTA 4RG0A 4U40A 3GI3A 4HVGA 4R1VA 2VGOA 2XK6A 5LOHA 1PXOA 2XKEA 2ITQA 4IJPA 2J2IB 2YA9A 3D15A 4XG9A 4Z16A 4OTPA 3CD3A 5J5SA 1IAHA 4CMTA 1BMKA 3FQHA 2UVZA 4ANNA 4EOSA 2BRGA 3R1NA 4CG8A 4DH5A 4YLKA 4D1ZA 2PVJA 3RK7A 4AZTA 5FP6A 4F4PA 3V5TA 3RPYA 3ZZWA 1UNGA 3E64A 3RAKA 2YWVA 2C1AA 2YIRA 2HYYA 3PIZA 4PL4A 4PY1A 4WUAA 2UZWE 3SVVA 2O3PA 4FVRA 3FAAA 2HK5A 3DBEA 2FH9A 4GCJA 4I93A 5ANDA 3ZBXA 3ZO4A 4HPUE 4AN9A 4Z55A 5AJQA 4I4EA 2E9PA 2EXCX 1PXNA 3JXWA 4P90A 3IO7A 4X3FA 4EH4A 4U79A 2VU3A 4DFBA 3Q3BA 3MTLA 4EK4A 1JKSA 1K9AA 2BVAA 1Q41A 3NZ0A 1FGIA 1V0OA 2VWZA 3HA6A 4Y73A 5ANGA 5LVLA 4C62A 3DZQA 3NNVA 4G9RA 3D83A 5B2KA 4I22A 2W4JA 4Q9ZA 2XKCA 1KE5A 4NYEA 1DM2A 4MD8E 2JEDA 5DOSA 2BZHB 2IW9A 3P7BA 2OFUA 3A7FA 3KL8A 1MP8A 1SNXA 2WKMA 1GOLA 3LXLA 4FT9A 4MAOA 4D4VA 5K0XA 4BWPA 5DH3A 4TWCA 1XH9A 3RBWA 2R3QA 4RJ6A 1H26A 3V04A 2HW6A 1PW2A 4I20A 4E7WA 1UV5A 2ZJWA 2OU7A 2WELA 4O7VA 1MRVA 4K11A 3MVLA 1TKIA 4X3FC 5FTGA 1AQ1A 3RHKA 1ZOGA 5GHVA 4YR8A 3GC7A 4HNFA 2C0OA 4IM2A 1YQJA 5BVKA 3VF8A 3LM5A 3NRMA 1XR1A 4FKWA 4RX5A 4P7EA 5IA5A 3QC4A 3OCTA 1OL7A 3HMNA 1YOLA 3MTFA 4RIYB 3ZEPA 1BL7A 4FBXA 5KO1A 5M07A 5DEYA 1XBAA 4BHZA 4C59A 3VJOA 4JL9A 3ZOSA 1XWSA 2QOOA 4EH5A 5D7AA 4H39A 4BDJA 3MH0A 2VTQA 4BGQA 2AC3A 1OPKA 3CQEA 5ETFA 4RWLA 5A6NA 5LJJA 2VTTA 1H27A 5KKRC 2HXLA 3RCDA 2WZJA 3KQ7A 3TACA 3UDBA 4FK6A 3KXXA 4GVAA 4U8ZA 5CEQA 4BDKA 2ESMA 3AT4A 1UKHA 1MRUA 2WMSA 4D2TA 2AUHA 4K2RA 3GCSA 4QYEA 3W10A 4G34A 3PXKA 3QFVA 4GJ3A 2PZRA 4DH7A 4UMRA 4KABA 2ACXA 4BWKA 5CI7A 4DT8A 5BYYA 2J6MA 2ITZA 2J51A 4YNEA 4UWCA 3ZLYA 5HKMA 4FKVA 4RZVA 4FIIA 2QQ7A 3LXPA 5I9XA 3FBVA 2UW9A 3OCSA 3A60A 5HE0A 4F70A 5E1EA 3CPCA 5JSMA 3LLAA 2QI8A 3KF7A 5HVYA 4FVQA 2PZIA 5CAQA 4WSQA 3BLHA 3FI4A 4NIFB 4XV3A 4YZCA 1WBVA 2BCJA 2XBJA 4I5CA 3R9OA 3PUPA 4DN5A 4LRKA 4F7SA 2JGZA 4I21A 2I6LA 5AV1A 5HNIX 2BFYA 5IEXA 2Y8OA 2CKEA 4C57A 4H1MA 4FTNA 3B2TA 3WILA 4NL0A 4RC4A 4FYOA 3O7LB 2GNJA 1S9JA 4IWPA 3ROCA 4B8LA 3AMBA 4DH8A 2R3LA 5L4QA 2YISA 1URCA 3LM0A 3PP0A 3FJQE 5L8JA 3T8OA 2IPXA 3FSFA 3FXXA 4FV5A 2PL0A 3FMJA 4V05A 5L2SA 5HIBA 3I6UA 3RPVA 3QCQA 3F6XA 3CR0A 4FSTA 4CFWA 4J52A 2J0MB 1JVPP 2REIA 4FVPA 3BHUA 2GQGA 4NT4A 4ZOGA 2B54A 4CLIA 3ZDIA 4MD9E 4D58A 4DTBA 1U46A 3EFWA 3ZRMA 4TYEA 2NO3A 5IUGA 3NUAA 3IPHA 5AP1A 5T3QA 4M0ZA 3EWHA 5M55A 4MKCA 3ZEWA 3C50A 3RPOA 4X0MA 2VWWA 5TO8A 4D0XA 5C26A 1LPUA 3MPMA 3NAYA 1U5RA 3SRVB 2HY81 4F08A 3DJ6A 5LVMA 5KMMA 2QOIA 3DT1A 3HV5A 2SRCA 3QAME 4FSWA 4LL5A 5HIDA 4RIWB 3RALA 4AW5A 3OBJA 4DG0E 2CLXA 3Q2JA 4HYSA 4FICA 4XYFA 4FL2A 5HLNA 2C6OA 4FV7A 4GJ2A 2C69A 1BX6A 3ZO1A 5A3XA 3FC1X 3FHIA 4O0WA 5D11A 4YP8A 3G51A 3LFSA 5CS6A 4NTSA 5B7VA 4AZFA 4G6NA 4L53A 3DK6A 3FMDA 2I0VA 3H9OA 4BCIA 4M69B 1ZRZA 1Y57A 3LZBA 5BUEA 3F2NA 3HAVA 3RZBA 3F2RA 4RA5A 4APCA 2OZAB 3GQLA 4QP4A 3AC3A 3ZONA 4HGTA 4YJRA 2F49A 5IQAA 4BR3A 2JAVA 5E92A 3UGCA 2IZTA 3OVVA 4E8AA 5AR2A 2VX1A 4FT0A 4FKRA 2BUJA 2BIKB 4FGBA 3LLTA 2XIZA 3OW3A 5DNRA 1UU3A 4O0VA 3DLZA 5HO6A 3BHTA 2ETRA 3LW0A 1JQHA 1LEWA 2B53A 4U42A 3R8MA 4I24A 3OUKA 3IDCA 5F9EA 3HV3A 2ETMA 5AR5A 3TT0A 3KRLA 1APME 4EWHA 1KSWA 2BPMA 3BEGA 3S4QA 4AP7A 2ITVA 4NM0A 3TV7A 4DGLC 4BTMA 3POZA 3IGGA 4CZTA 5A46A 3ITZA 4N4SA 5DRBA 4DA5A 1FVTA 2GS7A 4ITIA 1PXIA 1CDKA 4E5AX 4EOOA 4GT3A 5T68A 3FLNC 4JJRA 1KOAA 1XO2B 2PY3A 3DKGA 4M67A 4XJ0A 4M97A 4ALUA 5AUWA 2ITUA 5CVGA 4AFEA 3BYMA 2EXEA 3BBWA 2QO2A 3QRTA 4FNZA 5K0KA 4U9AA 2B9IA 2Z7QA 3FI3A 4ZZMA 4ANMA 4EQCA 2JKQA 2XJ0A 3EKKA 4PL5A 3R9RA 4FSMA 2CGUA 2RG6A 5J1VA 4ZY4A 3QQLA 4ERKA 5LVOA 4NK9A 1OUKA 3AD4A 2RKUA 4IXPA 4ZSLA 4QMXA 3D7TA 2X9FA 2W1IA 3TNHA 5FXQA 4HGSA 4ENYA 2XA4A 3IDBA 3BHHA 3MESA 5F94A 1O6KA 1HOWA 4UZHA 4E3CA 4QMPA 2QOFA 2VTIA 3C5IA 3IK3A 4IDVA 2GDOA 1JSVA 2UZOA 3OT3A 4RT7A 4W4XA 3I5ZA 4EH7A 5EQYA 3QC9A 4LMUA 2Y7JA 4PTGA 5KBRA 2UUEA 5D12A 3FEGA 2WU6A 3QXPA 1ATPE 2BDWA 2ERZE 4R3PA 4TYIA 1JOWB 4FF8A 3N4TA 5H8EA 3QKMA 2C6TA 4FTOA 2QONA 4FSNA 3TN8A 3EKNA 5BMSA 3W18A 4FA2A 3L8VA 5AIKA 2Y6MA 3GU6A 1XHAA 3RJCA 3FE3A 4FEXA 3V5LA 2OIBA 3R9HA 1VR2A 4IACA 4R7HA 4I0SA 2UZNA 3ZSIA 3SA0A 1YHVA 3DXQA 1UNHA 5E7RA 2J0IA 3KRRA 2GNIA 2VGPA 5IQEA 4FNYA 5IZFA 5E91A 3MY1A 1M14A 4QMOA 5DVRA 4YMJA 2BHEA 5CASA 5DG5A 5IPJA 3I7CA 4XX9A 5CEOA 3U6HA 4OT6A 4QTAA 4BCQA 2ZMDA 3S00A 1PY5A 3HMOA 3DQWA 4O7RA 3TJDA 3DS6A 3OT8A 4BDIA 5H9BA 1NY3A 2JIUA 3QZIA 4M14A 3SXRA 4QQTA 3KXHA 3UYTA 5J9LA 3LJ1A 4Y83A 1GJOA 4IZYA 4RLLA 4P2KA 4CRLA 2WMRA 1XKKA 2ITWA 2RIOA 3GBZA 4U43A 4FZDB 4TPTA 4QTEA 4ZZOA 2KULA 2YZAA 1NT2A 4ITHA 2Y6OA 5CU0A 3LXNA 2I0YA 4M0YA 5LQFA 3R01A 4HNIA 3KKVA 5H8BA 3E8CA 3Q5ZA 3IG7A 4KAOA 4XG3A 3P4KA 4UWYA 5DPVA 3TZ7A 4IB1A 2DWBA 1DI9A 4F0FA 5JKGA 3CS9A 3THBA 3MW1A 4CQEA 3EQDA 2XCKA 3NSZA 2CNUA 2WFYA 2VTHA 2UW5A 2ZOQA 3ODZX 3QD3A 4G3CA 3FDNA 3TZ9A 4C36A 2HWPA 4J71A 2VWVA 3MJ2A 3WF7A 3BYVA 3NVKI 4AFJA 4GUBA 4YTIA 4L00A 3DBCA 4W4WA 2F7ZE 2F57A 4AGUA 4C33A 4EH8A 2OI4X 3DDPA 5HVKA 3P5KA 2PE0A 1QCFA 4OUCA 4BWXA 2UZUE 3TTIA 4UMTA 5HCYA 4ZTLA 4AW0A 4KIPA 3BLRA 3TV6A 3R7IA 3FSKA 4HVDA 5BX0A 5FXRA 5LXMA 4IVBA 3MB6A 3OXIA 5EYKA 3MDYA 3C5UA 4FGRA 5B2MA 4GSBA 5BPYA 3MIAA 4JBPA 3VUKA 2WTKB 3FY0A 3FPQA 3RNIA 5HO8A 3QGYA 3TDVA 1UWJA 5CX9A 1JSTA 5FM3A 5L2WA 4U44A 4D1SA 5A14A 5M4FA 4QMVA 5DT4A 5F95A 4PPAA 4GRBA 2ZAZA 4OTHA 3ZXZA 2JAMA 3K3IA 4LM5A 4FV6A 4RVMA 3VUTA 1I44A 5CLPA 2QURA 1B38A 3F66A 3IW8A 4CD0A 4ORKA 1ERKA 2W4OA 2VWBA 2NRYA 3O51A 3A7HA 3AT3A 4ZSJA 5GJGA 3KXNA 2XCHA 5FBOA 3PDTA 3POOA 2G2IA 4U97A 4CCBA 1KE9A 4MQ1A 3KRJA 4CFXA 2H96A 3SGCA 2Z02A 4YPSA 5KCVA 4UMQA 1IEPA 3HDMA 4IX6A 3BQRA 4Q5HA 4EH6A 1JKLA 1Y8YA 3AC1A 5AFVA 3CY2A 3MV5A 5HHWA 2RGPA 4YLLA 1ZMWA 4WRSA 4BIDA 3FLYA 1ZAOA 4TWNA 5I3RA 3NEWA 3ORZA 1GIJA 3Q6WA 3IOPA 5CU6A 3MVHA 4M13A 1Y6BA 4FL1A 5L2TA 3H30A 5CAOA 3UZRA 1CSNA 2WMTA 4FTLA 4HYIA 3U87A 2C5XA 3GU8A 4IVDA 4OTQA 4RSSA 1B6CB 4XNEA 5TOZA 3OY1A 2B0QA 2R64A 3KULA 5GZ9A 2VUWA 1J1BA 2XK3A 4RWJA 1E1VA 4A9SA 2FGIA 4EOQA 3LE6A 3IW4A 4Y46A 1WAKA 1ZMVA 3C7QA 3IW6A 1OECA 1GIHA 4NJ3A 2YCFA 3Q4ZA 4R5SA 4R5YA 4RC2A 4AT3A 4RC3A 5AEPA 5ACBC 5BVEA 1YW2A 5D41A 3ZFXA 3ZYAA 3DAKA 4XBRA 3WI6A 4F99A 2EB3A 5IUIA 5HZNA 3ZFMA 5FTOA 2X6EA 4UMUA 1JWHA 1UWHA 4BDBA 3A7IA 3LQ3A 1EH4A 1WFCA 3AMYA 4O6LA 5LVNA 4LUDA 1ZLTA 3VWAA 2QOHA 3P08A 2A19B 4C38A 3K5VA 3GENA 3NYNA 3SD0A 2OWBA 3HRBA 5M44A 4IFCA 5A4QA 5K4IA 4YHJA 2O5KA 1REKA 4F63A 5HVJA 1OKZA 2I40A 3IOKA 4MBJA 3LOKA 5H3QA 3HLLA 4BCNA 2X81A 4QP1A 4ZMEA 3IONA 5LCJA 4EQUA 4GS6A 2LAVA 1OPLA 3WBLA 5HNGA 1PXKA 4L44A 5BMMA 3UOHA 2P4IA 5HX6A 4JG8A 2VNWA 1M52A 1R3CA 5EDRA 3UO6A 3ZLWA 4AOTA 4BTKA 4TN6A 2UW3A 4EI4A 3R9NA 2A1AB 1M7QA 3ET7A 4J95A 3FZTA 3NNXA 4Y8DA 5M06A 4FTKA 2PZPA 2Q83A 4JIAA 5CVHA 4YBKA 2BRBA 4IANA 4C02A 5A4CA 4CLJA 1P4FA 4O21A 5HU9A 4G2FA 4BB4A 4E4MA 2WAJA 3LMHA 4OTFA 1V1KA 3A8XA 4PMSA 4ARKA 3R6XA 3U9CA 4CFVA 3MJ1A 3PSDA 4XH6A 4RFMA 4TL0A 2YIYA 4DGMA 3UMWA 2PK9A 2WMXA 4KIOA 3G6HA 3H10A 3D9VA 1DI8A 3D14A 2B9FA 4GT5A 4GVJA 5A54A 3OWPA 5IF1A 4QT1A 3SQQA 5M53A 3QQKA 4KBAA 2J0LA 3VVHA 3BQCA 1ZZLA 3TEIA 1XH5A 2R0IA 3OXZA 4O0XA 3HKOA 4QP7A 5DR2A 3UG1A 4GUEA 4BIBA 3QLGA 3CY3A 3LVPA 4CFUA 4FTAA 4FKUA 2JIVA 3DY7A 3QRIA 4A4LA 4DEIA 2I0EA 2WD1A 4AW2A 1BYGA 4QTBA 5IA4A 1OB3A 3UIMA 2PVFA 4V04A 4ACMA 3SW4A 5IA0A 3CTQA 5J8IA 3WARA 1YI3A 3KCFA 3NNWA 2XNEA 1MQ4A 5E8WA 4C3RA 3UBDA 2BIYA 3HECA 3PA5A 2OICA 3PFQA 4E4LA 2QHMA 3ORNA 3JY9A 4GU6A 4X21A 5EDQA 4E6CA 5L6OA 3BYSA 1YWVA 2C68A 2GNLA 4R7BA 3EYGA 2YCSA 3QHWA 3EL7A 4ZS4A 4OTIA 4PMMA 5DT0A 2OZOA 3L9LA 3O7LD 3RM6A 4QTCA 4NM7A 3R7OA 2IZUA 2CSNA 5J7HA 4S30A 3R2BA 3V6RA 3HV4A 5B2LA 3QYWA 3OEFX 4X7QA 2YWPA 4C8BA 4MNEB 2ZMCA 1ZMUA 3MH1A 4O7NA 4DF3A 1WZYA 3CEKA 2H8HA 3O23A 5TT7A 4AS0A 5FDPA 4NFMA 3C1XA 4IZ7A 4KRCA 3VS5A 2GHMA 4L7FA 1U4DA 1YDSE 5FBNC 3PVUA 2X8EA 2YAKA 4PP9A 3WF6A 3ZUUA 3OUNB 1YOJA 3KVXA 4YC8A 5AA8A 4KIKA 4QYHA 3ORXA 4G5JA 5ETIA 4I6BA 2W5AA 4DCAA 4NJDA 2VZ6A 2NRUA 4FV9A 4HCVA 5DE2A 5EFQA 4CRSA 2VTAA 4FZFB 4FV2A 2ITPA 2FSTX 3C4WA 3KN6A 3LFAA 3PPKA 3AT2A 5LMKC 4IAZA 5JGBA 3ZUTA 5GNKA 5CT0A 3Q4CA 3RAWA 3UNKA 3QTWA 2FUMA 2CCIA 1LR4A 3UIUA 3VUGA 3EB0A 5HBJA 4KRDA 3LJ0A 4TYGA 5CSVA 3WZEA 4E4NA 4NKAA 3KRXA 3F5PA 5AP0A 3LKMA 3VHKA 2WIHA 2B55A 5TR6A 4KKEA 4HGLA 3RPSA 4YJPA 2F7XE 1G8SA 4F09A 5HESA 3QUEA 4BYJA 4ZLYA 5CQUA 1H24A 3BE9A 3I60A 4HYHA 3VAPA 3FYJX 2YIQA 3WOWA 4AN2A 5AADA 3HVCA 3ZO2A 4D5HA 4B99A 3TJCA 2XRUA 4ASDA 2YN8A 3G0FA 4IMYA 3GNIB 3VW6A 3EZVA 4IZAA 3N9XA 1FPUA 2XNPA 2R3PA 4BDCA 4C58A 5D1JA 3Q4TA 2OJFE 5M08A 4FUYA 3R8VA 5E8XA 3AD6A 4HYUA 5ANEA 1FVVA 2PVHA 4L43A 5JMSA 3SW7A 5GINE 2B52A 2Q0NA 3C4FA 1YHSA 1GZOA 2JITA 3SXFA 3ULIA 3OD6X 4OTDA 4YSJA 5HLPA 5HIEA 5EW3A 3DDQA 3BGPA 2C0IA 4L6QA 4OTWA 2CPKE 3CIKA 4O1PA 4DINA 2QG7A 4ANOA 2WQNA 1JKKA 3MB7A 2E9VA 1U54A 3FPMA 1BI8A 5JFXA 3FI2A 3KVWA 2ERKA 3JUHA 3MS9A 4AQCA 2YM6A 3L8SA 4KUJA 1YI4A 1OITA 5CSPA 1ZARA 4J99A 4J53A 5CSWA 3TNIA 4AT4A 4FEWA 5DIAA 1GAGA 4GKHA 2OF2A 4RLKA 3ODYX 3W2SA 1J7UA 4Z9LA 1H01A 4QQ5A 4EC9A 1ZWSA 2YM8A 3GU7A 4DYMA 3QWKA 4EZ7A 1KE6A 3HEGA 4IVCA 2C1BA 4GL9A 3DBDA 4TYHA 2EVAA 3UTOA 2X2MA 4ZTSA 4CCUA 4Z7GA 4G6OA 5EYMA 1URWA 2UW8A 2C0TA 4CV8A 2FO0A 1G8AA 3GC0A 4CT2A 2ZV2A 1L3RE 2HWOA 1WBNA 4NUSA 2B9JA 2FYSA 3V5PA 5E90A 3FHRA 5JRSA 4FKSA 4FL3A 4A07A 3ULZA 1XH8A 2YIXA 2WXVA 3OC1A 5FEDA 3PVBA 4RJ8A 5DRDA 3AGLA 3TUDA 2AYPA 2R5TA 4KB8A 5DI1A 4EQMA 2V5QA 4XLVA 4PTEA 4EHEA 3CQWA 3MIYA 1OUYA 2OG8A 5J79A 3CKXA 4JAJA 3RGFA 4DEDA 5CAVA 2BAQA 3H0ZA 3ZSGA 4IH8A 4RFZA 5AUUA 3W2PA 3KXMA 4F65A 2HAKA 4FI1A 3EQFA 3E8DA 2J5FA 4O6EA 3ID6C 5I9WA 3BZ3A 3AC5A 3NUXA 3R8ZA 4WBBB 4WHZA 3VN9A 2VWIA 1XQZA 2VWXA 2UZEA 4KKGA 4U80A 3O0GA 4LQMA 3M2WA 4DTAA 3FMKA 2ITNA 2GNHA 2F7EE 2Z2WA 3RINA 4W8DA 1P4OA 1CKPA 3ZLXA 4JG7A 3OHTA 2YAAA 5FD2A 3V5QA 4C4JA 5KMKA 2VX0A 4J8NA 3LFDA 4L3PA 1GNGA 2PVLA 5C8MA 3GQIA 4ONAA 3R00A 2YJSA 4RZWA 5CF4A 1Y6AA 3U6JA 2R3KA 3N4VA 3EZRA 3FKOA 1Q8WA 2QKRA 5J1WA 4OBPA 3MGYA 1NW1A 3HNGA 1TQPA 3LHJA 2ITTA 4BN1A 2XNOA 2VN9A 2YIWA 3B8QA 3TDWA 2DQ7X 4KA3A 3ORIA 4KD1A 4G16A 1SVHA 2C3KA 4LMNA 5HX8A 5HG8A 4BZDA 5BUIA 4IADA 5CNNA 5FRIA 5HO7A 3QQGA 3C0IA 3DXNA 5DFPA 2O63A 5JH6A 3C51A 3SKCA 2PULA 4RVLA 3LXKA 5IEYA 5ANKA 1SMHA 2VTLA 3PG3A 2QO9A 1OZ1A 4M84A 1V0PA 2ZM3A 3CSVA 4E5WA 4PMPA 4RFYA 2OH0E 5EH0A 2OF4A 2A4LA 3A62A 2JDOA 3RWPA 4ANSA 1J3HA 3DOGA 3QTXA 4I23A 3U51A 3CPBA 4U41A 3GCVA 4NSTA 3KMMA 2CN8A 4UBAA 3UNJA 3W8LA 1W83A 4F6WA 2R0UA 4IW0A 3O8TA 2BRNA
chains in the Genus database with same CATH superfamily
1M17A 4G3FA 5F4NA 4F7LA 3QKKA 4JRNA 2C5NA 1KV1A 2PWLA 3R28A 4NEUA 3UQCA 4D1XA 3ZU7A 4RMZA 4MF0A 2HIWA 2CKOA 3ORPA 5BQ0A 3VBTA 5JFVA 3BU5A 2WB8A 4M3QA 5FDXA 4YURA 4FR4A 3B8RA 4IB5A 2QOBA 1PYXA 2AQXA 3EMGA 4IBMA 4GK3A 2O2UA 4MBLA 4D9TA 5L2IA 2A0CX 1OI9A 2OO8X 3K54A 4J1RA 1PJKA 2ONLC 5HICA 3JY0A 5JQ5A 3NS9A 3BHVA 4EK3A 3PXYA 2WTDA 4J8MA 4O38A 3V3VA 4YJQA 3SX9A 4BCMA 4AN3A 3HGKA 4C4GA 2XAOA 4BJJA 3VBWA 4M12A 4UV0A 2PTKA 4IWQA 4UXQA 3EN9A 2H6DA 1S9IA 3E3PA 4BDGA 4K9YA 3D4QA 4A06A 5M4IA 4DEHA 1CTPE 2X9EA 2WMVA 4W9WA 5HD4A 1XBCA 2W06A 3RVGA 3L9MA 4RIOA 2NP8A 2EB2A 2C6LA 4A9RA 4I6QA 1YXUA 1RE8A 2PSQA 2WTIA 2UW6A 4FV4A 3C0HA 3KGAA 1P5EA 2XNBA 3WZJA 4MBIA 3F5GA 4DFUA 3HUBA 3V6SA 5GIPE 3ANQA 3BHYA 4RJ4A 2VAGA 5AP5A 5HCZA 2B1PA 2VWYA 3G2FA 1UNLA 4IX5A 3QU0A 4BZNA 3KEXA 4B7TA 2HW7A 3PRIA 2C30A 2Z7RA 3NIZA 1H08A 1WMKA 1H1PA 3TV4A 4ANQA 1PXPA 4IAAA 1SYKA 2XK7A 5BUJA 5AWMA 4DEAA 5IQHA 1IASA 2UZDA 4DFZE 1H25A 4V0GA 2R4BA 4JDHA 4FTMA 2WMBA 2OGVA 2BKZA 3Q4UA 2YFXA 4R7IA 4S2ZA 2BKKA 3ENHA 3WYYA 3P78A 1H0WA 4M68A 4AE6A 5M57A 1SVGA 3NNUA 2XUUA 4X2FA 4A7CA 4YJTA 4GK2A 1XH4A 4MWHA 3NR9A 3NYXA 2H34A 2RFNA 4CQGA 4CKIA 4MWIA 4HPTE 5HI2A 3TNQB 3UO4A 3DXPA 4FOBA 3VW8A 4YZDA 4YJSA 5K9IA 3A4PA 1T45A 3F3UA 4MCVA 3P9JA 3ZMMA 3QHRA 3IS5A 3RM7A 3R7EA 3SC1A 4EBVA 2XIYA 5J95A 4WSYA 4USEA 1H1WA 1OIQA 4QMWA 2C5OA 2R2PA 4DEEA 5CSHA 2XK9A 4G9CA 4O0UA 1YOMA 2YLFA 3LFQA 2XYUA 4FV3A 4IEBA 3UOLA 3T3UA 3V5WA 4QP8A 4UX9A 3FC2A 3E8NA 4FKPA 3MPAA 2ETKA 5GJDA 2XNGA 5JN2A 4BBMA 3NPCA 4D9UA 1U5QA 3RI1A 1WBSA 3UC4A 3EQIA 3GVUA 3UPXA 4WUNA 2G9XA 4ITJA 4FIHA 4QMTA 3OOMA 3QLFA 4FTQA 5I9VA 2VO3A 5CF5A 3V8WA 4AT5A 4PP7A 2VTMA 4IX3A 3UZTA 2PZYA 2G1TA 2C6KA 2JKKA 5C01A 1H00A 3FI8A 3EN6A 3A61A 3QCYA 4E6AA 4G5PA 2X0PA 5AM6A 4NWMA 2FSMX 5HBEA 2QHNA 3FQSA 4QMMA 1K2PA 1Q3DA 4AZVA 3CTHA 3MI9A 3ZM4A 5M09A 4DBXA 4C34A 4V01A 3OFMA 3GEQA 4ALWA 3E7OA 3DJ5A 4O7WA 4AU8A 4Y72A 3K3JA 1NA7A 3KRWA 4FT7A 4L3LA 4XEYA 4IVAA 3BI6A 5IKWA 4YZ9A 1TQMA 3LPBA 5M4UA 4RIYA 1QMZA 1OBGA 3VULA 2JDVA 3FYKX 4RVKA 3UOKA 4PQNA 4C0TA 4AF3A 4YU2A 2R3HA 3BGZA 3NW6A 4IAFA 3TCPA 4JR7A 2XBAA 4O2PA 3G0EA 5CZIA 2X8IA 4G6LA 3ZLSA 3P1AA 2PMNX 4GW8A 2HELA 3I1AA 4RQVA 3EN4A 3HA8A 4EYJA 3PIXA 3HL7A 3KREA 3F69A 4XHKB 2ZYBA 4O7LA 2Z7SA 3SHEA 2XJ1A 1Q5KA 4I0RA 4MNFA 4EHVA 3R8PA 4IC8A 4BIEA 2CKQA 4BRXA 4YJUA 5AP6A 3KK9A 4D2VA 4IE9A 4TT7A 4R1YA 4YUQA 4FMQA 3W0NA 3C0GA 3VC4A 3WE4A 2VO0A 2RG5A 2I1MA 4GG7A 5C1QB 3EQRA 2Y4PA 4I94A 4GFOA 5FEEA 1H0VA 2WEVA 2VD5A 3UVQA 3TWJA 4KINA 2YDIA 3DNDA 3Q6UA 5EM8A 5HTCA 4MYGA 4WA9A 2XK4A 5AP7A 4DH1A 3TMOA 4LGDA 1WCCA 3NW7A 4FUXA 4EK5A 3JR1A 4M66A 4ALVA 3DLSA 5CEMA 5KUPA 3QCSA 4DTKA 3PA3A 2WNTA 4BCJA 4FK3A 1PKDA 2BILB 4CGAA 2WTJA 2BDJA 3CJGA 5J5TA 3QF9A 4R77A 4NIFA 2XVDA 4ZZNA 2QLQA 3M11A 3F88A 4CV9A 4U6RA 2YHVA 2JD5A 4O27B 4ZP5A 4UMPA 1KWPA 5HTBA 4ZTMA 2PMLX 4ZK5A 2J4ZA 1ZZ2A 2W17A 5TKDA 3BIZA 3R8UA 1ZXEA 4EHGA 1CKIA 2QOCA 2WIPA 3QQHA 3FLSA 3VRYA 4FTJA 3GOKA 3QRKA 3HUCA 5HE3A 2G2HA 4FKQA 3SXSA 5CNOA 3ATTA 5CXHA 2W99B 3EFLA 5EOLA 5M4CA 1YVJA 4X6RA 5D9HA 4FSQA 4FZ6A 3UC3A 4WD5A 3ZSHA 4JX3A 5FG8A 3DK7A 2XMYA 4B0GA 4DFNA 4ZJVA 5KMLA 1Z57A 2YABA 3JPVA 3O96A 4N6ZA 3W2CA 3WF5A 4XV1A 3HP5A 5CF6A 1FQ1B 2J90A 3T9IA 4C3PA 2EU9A 3NYVA 4UEUA 4PRJA 4C3FA 4C7TA 4KS7A 3BX5A 5FGKA 3CC6A 3VS2A 3WF8A 3FQEA 3D0EA 2C6MA 3D5WA 4WG5A 3PPJA 4DGOA 4QMNA 2GTNA 3C4EA 4IWDA 3BKBA 4XG8A 4EH9A 5E8TA 4TNBA 1PMUA 3EQCA 3SRVA 2QVSE 2B7AA 3GP0A 1A06A 5CF8A 4QO9A 4RA4A 4RIWA 1YDTE 2BRHA 4EL9A 2FA2A 3WZDA 2IEWA 2W1ZA 3LFFA 4EH2A 1OL2A 5DN3A 4LGHA 5CU2A 2QR8A 4YTFA 4UWBA 1CMKE 3H9FA 2R3IA 3KC3A 3G9NA 2BAKA 3DK3A 5EHYA 4JMQA 3VQHA 3FMLA 2HXQA 2R3JA 3ALNA 4AZEA 3UIXA 2C3JA 2P3GX 2XF0A 3E93A 2YCRA 4FKLA 4M69A 4W9XA 3PZEA 3JYAA 5CWZA 4WT6A 4D4SA 3MFRA 4O0RA 3SOCA 5ANOA 5AV4A 2OZAA 2P2IA 4NKSA 4HVIA 3FXZA 5KX8A 3TM0A 2C4GA 4Q9SA 1GIIA 4JX7A 4IC7A 1DAYA 3NUUA 3PYYA 4PV0A 3PLAE 5G1XA 5EKOA 4E93A 5AV3A 4DBNA 4E73A 4YC3A 1QPJA 4A9TA 2I0HA 2HCKA 2PE2A 2GS6A 4JDJA 4QTDA 4UY9A 4EONA 3Q9YA 2WQMA 4EUTA 1M2RA 1QL6A 3AKLA 3W0OA 4ANLA 4O4DA 4I4FA 4ZJJA 5E8SA 1WBOA 4AZWA 4TZRA 3VS0A 4QPSA 3RHXA 4LRJA 4DFYA 4K0YA 5J7BA 3ZM9A 5EM6A 3PSCA 2PYWA 1M2PA 2ITXA 3PE1A 4TTHB 2HENA 4FEVA 1CKJA 3NLBA 2CGVA 3OWLA 4BI1A 1M7NA 2UW7A 2XS0A 2RFEA 2WTVA 1OIYA 2J50A 1DS5A 4BDHA 4EKKA 4NM5A 3V8TA 3OP5A 2JBPA 4IHPA 3FLQA 4P5ZA 3T3VA 2C3IB 4J98A 4G3EA 3QUPA 3E87A 4EUUA 3G90X 4X2NA 5HTIA 3OMVA 4HGEA 3REPA 2OIDA 5ETAA 4FV8A 3R83A 3MY5A 3VO3A 2CJMA 3ELJA 1F5QA 3K2LA 5AIRA 4F7JA 4K8AA 4USFA 5JGAA 2E9NA 2WMWA 4LYNA 3LIJA 4FEQA 4L46A 5CT7A 5AR4A 4F1TA 1H8FA 4DCEA 1IAJA 3D5UA 2BMCA 4J7BA 3W55A 4O1OA 5E8VA 4FKJA 3QYZA 1J7LA 5KZ0A 4KWPA 4EOIA 3BRBA 5IH6A 1GZ8A 2V62A 1PYEA 4PWNA 2IZRA 4FSRA 4IFGA 5KMOA 2IO6A 5J9YA 3BPRA 3D7ZA 3FL5A 4NFNA 1OBDA 4NCTC 5DEWA 3PPZA 5LCKA 4GU9A 2IWIA 5A4LA 3PZHA 3NAXA 2CGXA 1WBPA 3MYGA 4DGGA 5FWKK 1A48A 2XNMA 3Q9ZA 4X6QC 1KE7A 4U45A 2WTCA 3UG2A 3PJ8A 4QMUA 4AUAA 4IM3A 4ZTQA 4O86A 3F3ZA 3VF9A 3ZC5A 4IM0A 3PVGA 1JKTA 3FKNA 5H2UA 2BZKB 5IG1A 3SG8A 3QGWA 4X3FB 1RDQE 3UVRA 4G17A 4FTUA 2AC5A 2CNQA 4NW5A 1K3AA 3ZUVA 4QD6A 1LUFA 4UYAA 4ID7A 3BLQA 3BV2A 4PTCA 2V7OA 3G6GA 5K3YA 4QMYA 3UE4A 3FLWA 2CHLA 4XOZA 4E20A 1OL5A 4R78A 4R8QA 1PMEA 4HW7A 2XZSA 3ZC6A 4BZOA 1WBTA 4JLCA 3HMPA 3QKLA 4H58A 5CY3A 2OW3A 2GHLA 5LWNA 4QPMA 2GCDA 3WZUA 3NCGA 1J1CA 3E63A 5FEQA 3VUDA 4EZ3A 4RGJA 3KCKA 4XS2A 5EM7A 1M2QA 5KKRB 4L68A 2X39A 4BDDA 5A4TA 3UO5A 3IGOA 4EOKA 2UZVA 4JT3A 2Y0AA 2VTPA 4CZUA 3O50A 3DTWA 3DGKA 3NCZA 3EHAA 1ZYDA 3DU8A 4X2GA 4X3JA 5LMKA 4DH3A 2PHKA 5AP3A 5EW9A 2W1HA 4EKLA 4GIIA 2WHBA 1JLUE 2XKFA 4OT5A 4QQJA 3JS2A 1W82A 2IJMA 3NIEA 4ZLZA 2X8DA 4QRCA 1F0QA 4I0TA 4S33A 3VS6A 3BYUA 3NFGB 4RVTA 5LVPA 1ZOEA 4U0IA 4AAAA 3DJ7A 5KHXA 4EC8A 1OVEA 3O2MA 4F6UA 2P2HA 5HLWA 4IWOA 3OEZA 4I6HA 3CD8A 2VV9A 4K33A 5CXZA 1QPEA 2BRMA 2O8YA 1JAMA 3K5UA 5ANJA 5I9YA 5IH4A 3PWYA 5DWRA 1XMLA 5C9CA 2R3NA 3G9LX 4EYMA 2EWAA 4CKJA 1IA8A 3TIYA 4I41A 2J0JA 1OIRA 4FNXA 4EOJA 5M56A 4ZAUA 5LMBA 2X4FA 4X2KA 4U81A 3CE3A 5C27A 3G15A 4TWPA 4H36A 2CLQA 1IRKA 2OSCA 5GJFA 3L1SA 2PVYA 1UU9A 3W1FA 2LGCA 5CALA 4XRLA 5CU3A 3A7GA 3CXWA 3MVMA 2VNYA 4R3CA 3UP2A 3Q52A 5EM5A 4F0GA 2JLDA 4O81A 4RJ5A 4J97A 1Q8YA 3R7GA 3QQJA 3U55A 4DDGA 2GNFA 5B0XA 4BTJA 5IQCA 4FKGA 1P2AA 4GFMA 4GV1A 3HV6A 3I7BA 2X6DA 3QTSA 4FZ7A 3L9PA 1ZYJA 4JI9A 5IA3A 5BNJA 2C6IA 4F9CA 3SAYA 3KY2A 4GH2A 4I5HA 3VBXA 5EYDA 3LJ2A 3L8PA 4FTTA 1YKRA 1BLXA 1J91A 4IJ9A 4LV5A 3CKWA 2WTKC 4XG7A 1RJBA 3VNTA 4AGWA 5KMJA 2DS1A 1VZOA 4EEVA 1BUHA 4BF2A 1E1XA 1IR3A 3F2AA 1H07A 2IVVA 4FKIA 4R3RA 4AW1A 4BCOA 3R63A 2Z60A 2CNVA 4JQEA 5HE2A 1H1RA 2R3MA 3KB7A 4FSZA 3BWFA 4E4XA 5IISA 3BBTB 4D2SA 3GCPA 2W1EA 1ST4A 1FMOE 4RX9A 1VEBA 4AX8A 3QBNA 4E26A 2WPAA 2HY0A 5C03A 2QOKA 3ANRA 3LFNA 2R9SA 4DLJA 3CTJA 2XJ2A 2J9MA 4CFNA 4WBOA 5DLSA 1A9UA 3D94A 1SM2A 1JNKA 4AACA 3FXWA 3DNEA 3ACKA 3UMXA 4N6YA 3TUCA 4FT3A 5E1SA 5FP5A 3NUYA 3Q5IA 4U7ZA 2OJGA 4Z3VA 4E6DA 1STCE 4ZIMA 4QMZA 2JKOA 2X7OA 3GB2A 5D10A 3F5XA 3ZXTA 4AA5A 4FODA 3ENMA 5HOAA 2OXDA 4K77A 1O6LA 3PXFA 3TZ8A 4ASZA 4F1OA 1VYZA 5HORA 3LFBA 4MEDA 5DMZA 4YLJA 1REJA 5BVNA 2W0JA 2OIQA 3ACJA 2XK8A 3GCQA 4XG6A 3RK5A 2QU5A 3CLYA 5HU3A 2V0DA 3HZTA 5JT2A 4D5KA 4DAWA 3NW5A 3NFFB 3W2QA 3W0SA 5HNBA 3UQGA 2GHGA 5DA3A 5IU2A 4F64A 3ZBFA 2E9UA 5AR7A 1FBNA 1WVWA 4L42A 4QMSA 4CVAA 4O91A 4C61A 2QG5A 4JG6A 4GEOA 2JKMA 3A4OX 1KOBA 2ZB1A 3I4BA 4XOYA 2F9GA 2OJJA 2NYAA 4O7TA 5K5XA 4W4YA 5L8KA 2QU6A 3OZ6A 4P5QA 2IW8A 3UODA 1NVRA 3F3TA 4ACGA 2RFDA 3EFKA 4FTIA 1RQQA 4M8TA 4FC0A 4E5BA 3MBLA 2OXYA 3UIBA 1IG1A 4JQ8A 4CTCA 4ZMFA 2C5YA 3Q9XA 3GFEA 2JDRA 4YNOA 2OLCA 3ORMA 4F6SA 1PKGA 4ZJIA 2WO6A 3RPRA 1DAWA 2F2CB 4C35A 3LFCA 1Q97A 3PXZA 5A9UA 2BAJA 4DEBA 2PE1A 4NTTA 2XEZA 4ZEGA 4I3ZA 5HEZA 4AOIA 5CTPA 3C4ZA 3QUDA 1ZY4A 3D5XA 4OTGA 2E9OA 3NX8A 2F4JA 2BHHA 2R7BA 1W8CA 3QA8A 3P86A 4CEGA 5CVFA 2VO6A 2ZM4A 3IQ7A 2QKWB 4U3YA 2OFVA 5DYJA 3CP9A 3D2IA 5ITAA 4BKZA 3A99A 4MXCA 4Y5HA 4MXAA 3FMEA 4C4HA 1QPCA 1YXSA 2NPQA 2X7GA 4M15A 3ZFYA 4BKJA 1P14A 2JFLA 3O8PA 2BTSA 4BVUA 2WQBA 3GT8A 4ANBA 4BGGA 2XNNA 2ITYA 4GG5A 1JPAA 4ERWA 4DHIB 3PP1A 3PJCA 1IA9A 4FZAB 2QOQA 4G1WA 3H3CA 3P0MA 3H9RA 4CYIA 4D4YA 3GU5A 3OWJA 3MPTA 3ROYA 5I5ZA 4D28A 4MTAA 1HCLA 4H3PA 3UVPA 1OKWA 2XARA 3CGOA 5HG7A 5AAGA 2YLEA 3ETAA 4UALA 1BI7A 1PMNA 3PXQA 3QL8A 1Y91A 4IIRA 3FZ1A 3KA0A 5EI6A 3P7CA 3RNYA 3OROA 4AOJA 3Q96A 4KKHA 2XEYA 2C47A 3PLSA 1LEZA 1XH7A 5LARA 3QCXA 1YHWA 3AOXA 5ANIA 5JZNA 4DC2A 2VO7A 4FX3A 3HMMA 2GQRA 1W0XC 3GOPA 3ZTXA 4XCUA 3MFUA 4JNWA 2P55A 3P7AA 4H1JA 3OCGA 3WE8A 3D7TB 3RAHA 2QODA 3I0QA 5BVOA 4FYNA 4GT4A 3LCDA 3EQBA 5FXSA 5CAUA 2J7TA 3CQUA 2PZ5A 2XM9A 2Y4IB 3E5AA 2IW6A 3EYHA 4YHFA 5C8NA 3F61A 3OTUA 4A4OA 4EORA 4P4CA 2ONLA 1H4LA 5AAFA 2EXMA 4S34A 3BL9A 4BCGA 4HZRA 5CEKA 4MNEA 3TXOA 3PY0A 5BYZA 3QTZA 4O4EA 3QWJA 2ZDTA 3R1QA 2JC6A 4QYGA 5L2QA 4F9WA 3HV7A 3PE2A 3MFSA 4K6ZA 5JFSA 3SV0A 2YCQA 3KXGA 4O7YA 4PMTA 1FVRA 3NMUF 3PIYA 1XJDA 4W8EA 3VRZA 4F7NA 3W33A 2BROA 3HRFA 3JVSA 4JAIA 4XV9A 5BVDA 3VUIA 4D55A 5AR8A 3ZRLA 3CGFA 1Q24A 2RF9A 4IQ6A 4LOPA 4TY1A 3RMFA 4U5JA 4UZDA 3NVMB 4DE4A 2QOLA 3AG9A 4EWQA 3FZPA 2R3FA 3QZGA 3P79A 4YZMA 4LUEA 3N4UA 4ZXTA 3E8EA 3RP9A 4MVFA 5JGDA 4YJNA 2ZV8A 3BU6A 3Q9WA 4QP9A 3G5DA 5F20A 2WQOA 3VQUA 5FUTA 2HZIA 4WNMA 5IDNA 3EL8A 2IVUA 1W98A 2W9ZB 2QC6A 1OM1A 4EHZA 1VJYA 3R7VA 4I6FA 2W1GA 4R6VA 4WNPA 3F3VA 2UVYA 2PPQA 3SLSA 1ND4A 5CENA 4O82A 1OPJA 3PTGA 1R0PA 2OH4A 3GFWA 3NWWA 4LOQA 5DR6A 3UJGA 5CAPA 4GYGA 2JIIA 1Q8UA 5FM2A 3LMGA 3QA0A 3E7VA 3QX4A 4UB7A 5AX9A 2A2AA 4E6QA 3W2OA 4YTCA 4YSMA 2J0KA 3OCBA 3R1SA 4PUZA 3U6IA 3KFAA 4KBCA 3VBVA 5IDPA 4A9YA 5CEPA 3DB8A 3E62A 1YWRA 4NW6A 3RWQA 5EQEA 3FL4A 4FTRA 4RJ7A 4TRLA 5EOBA 4DG2E 3C4XA 3R7YA 4TWOA 1NVQA 5AUXA 3TNPC 3TTJA 3UYSA 3ZCLA 3KU2A 3LQ8A 4Q2AA 4Q5EA 4OR5A 3TL8A 3FY2A 5CI6A 2EUFB 4FG7A 4EBWA 3BV3A 1ZYSA 3BYOA 3CJFA 1H1SA 4YJVA 4HVSA 4I6LA 2F2UA 3DBFA 4JR3A 5HBHA 2JDTA 3RK9A 3L9NA 3PJ1A 4USDA 4MXXA 2XIKA 2GS2A 5EI2A 4YPDA 1XBBA 3FKLA 3QZHA 1R39A 4ZS0A 3VIDA 4C2WA 3VJNA 5L6PA 3IW7A 2FB8A 3LFEA 3F7WA 5E9EA 4FNWA 5HGIA 4BICA 1YXVA 5C8KA 1YRPA 2CGWA 3QQFA 5IA1A 4GMYA 2CDZA 2XYNA 2QD9A 2Y9QA 5HCXA 3TI1A 2PUUA 4G3GA 2ZDUA 3QALE 3MVJA 4O84A 5J9ZA 2HZ4A 1YXTA 4EOMA 2XP2A 1XMMA 2WOTA 3EH9A 3AXWA 4CSVA 3UP7A 5AAEA 2W5HA 1CM8A 3GCUA 3NDMA 3EIDA 2IVSA 3Q32A 4YBJA 1O9UA 3BE2A 4QYYA 3TUBA 4BY9E 2DUVA 5AM7A 4TYJA 3A2CA 5IA2A 3KK8A 2C6DA 3G33A 3R30A 4RBLA 4F1MA 5EG3A 2G01A 4RX7A 5LMAA 2PUPA 1J7IA 3I6WA 3AMAA 3R8LA 4IB3A 2W4KA 3N51A 4FIFA 4LG4A 4RWIA 4AXAA 4B4LA 2O64A 2XH5A 2HZNA 3HYHA 4LRMA 3E92A 3OW4A 3GXLA 3KULB 3QTIA 5KMNA 5E8UA 3VUMA 3W16A 1E9HA 4XP0A 3UPZA 3M1SA 3PY1A 2GU8A 3KMUA 4S31A 5CSXA 2HZ0A 5DGZA 4JDKA 1Q4LA 3MSSA 3UDTA 3VS1A 4XG2A 1I09A 4EK6A 3R71A 4CNHA 5CANA 4PDYA 5EQPA 5BYLA 3D2KA 4EJ7A 3AQVA 4CFFA 1AGWA 3LAUA 1XH6A 3AKJA 1UA2A 1PXJA 2GNGA 4ZY6A 3MA3A 3ZRKA 3A7JA 5C4KA 2W1FA 3QTQA 1SNUA 2RFSA 1OKYA 2QO7A 5EHLA 3R7UA 4ZSAA 1OGYA 2Z7LA 3MH2A 5TE0A 3PJ2A 1GY3A 4O0TA 3DFAA 5G6VA 3RKBA 3ZH8A 5CEIA 4IDTA 2IVTA 1Q61A 3IKAA 4XG4A 3SOAA 4ACCA 5AV2A 5EYCA 3WZKA 2X1NA 2UV2A 1KE8A 2VTOA 3DPKA 4JBVA 5CZHA 2O65A 5IQIA 2B9HA 2W1CA 4O7SA 5C4LA 3F9NA 3PWDA 2WMUA 4WIHA 5I0BA 1Y8GA 5IMEA 4EJNA 5L8LA 5AUVA 3S2PA 1ZYCA 2OXXA 1VLRA 2FVDA 4WG3A 2C3LA 1OIUA 2HOGA 1NXKA 1G5SA 4O2ZA 4EOPA 3EQPA 3PVWA 3NUNA 4ZTNA 5BVFA 2I7QA 1W7HA 4XLIA 2VTRA 4FEUA 1Z9XA 3UZPA 4BDEA 3DZOA 4X2JA 3NGAA 4QPAA 4PNIA 4ZTRA 2CN5A 2G2FA 3OG7A 4YHTA 1OGUA 3CBLA 3O8UA 1UU7A 3FUPA 1OMWA 5ETCA 3RTPA 4N57A 3W0MA 3FZOA 2YM3A 3AC2A 4BBEA 1Q8ZA 3UNZA 3EOCA 4ACHA 5HG9A 1Z5MA 1YWNA 4H3BA 4OW8A 2GSFA 2X4ZA 4FTCA 4PPBA 5AA9A 2CMWA 2BFXA 4JS8A 2YDKA 2VWUA 4IZ5A 4KNBA 3TKIA 4AGDA 5EHOA 2IG7A 2NNWB 3I0OA 3Q04A 3DQXA 4PDPA 2WMQA 2BALA 2W7XA 2CCHA 4QP3A 2YERA 2C5VA 3GC9A 3WIKA 4D2RA 5T6KA 4CMUA 3V5JA 2VTNA 3OOGA 4G31A 3DTCA 2Y4IC 1WVXA 2P0CA 4PDSA 4PPCA 4RIXB 4D0WA 4DLIA 5JQ8A 2E2BA 4BCKA 4CTBA 3ATSA 3S0OA 3GU4A 3RZFA 4LV7A 4AAYA 3MWUA 5I9ZA 3FLZA 3QD0A 1TFFA 5DT3A 2X7FA 3COIA 4MF1A 3V01A 4JBQA 2YM5A 3QRJA 3R2YA 2W9FB 5DBXA 1Q3WA 4OBOA 3S95A 4IAKA 3W2RA 1KUTA 2PVRA 5A6OA 2J5EA 2XB7A 4KSPA 4TNDA 3QXOA 2VX3A 3R73A 4JQ7A 5EKNA 3S1HA 3PSBA 3VS3A 5L3AA 4I1ZA 1V0BA 2JBOA 4W4VA 3FWQA 3MFTA 3ZZEA 4JDIA 4AXCA 3OBGA 5AMNA 1SVEA 5GZAA 3HMIA 4RQKA 1R78A 4BYIA 3MN3A 5GIOE 2PUNA 4YO4A 2UZBA 3FMNA 4DFXE 3HAMA 4PL3A 1PHKA 1UVRA 3E88A 3O17A 4WKQA 5KE0A 4BCHA 2X2KA 4CZYB 4S32A 3O71A 5F1ZA 4PF4A 5E4HA 3U54A 3HRCA 3F7ZA 3L8XA 3WYXA 4CG9A 3R9DA 2GTMA 2PVKA 2C6EA 2R3RA 4KIKB 5JZJA 3V8SA 3R21A 3BELA 5AUYA 4AGCA 4BKYA 3NUSA 3NYOA 3FV8A 4RJ3A 3QD2B 3VBQA 4DITA 2GFSA 3KMWA 3TZMA 1R1WA 3A8WA 1UU8A 3M42A 2QR7A 4L45A 4MQ2A 2OJIA 4BHNA 5JEBA 3HX4A 5KMIA 2GPHA 4LGGA 5I9UA 3F82A 3SDJA 5DR9A 4C4EA 1BL6A 4CT1A 2CKPA 4PDOA 3TKUA 4MHAA 1FOTA 1PXLA 1W2CA 3I79A 3U4UA 4OTRA 4BFMA 4QDEA 2YM7A 3BEAA 5HD7A 3C4CA 4BCFA 4RWKA 5IQDA 4NH1A 3EJ1A 2UZTA 3II5A 2W1DA 3OTVA 2GMXA 4JVGA 1W2DA 5D7VA 3S3IA 5IQGA 4K1BA 2BR1A 4B6LA 4IX4A 4FG8A 3TNWA 3COHA 4FRFA 1L8TA 3ZO3A 3KXZA 4YO6A 1MQBA 2YM4A 1G3NA 2JFMA 3B2WA 2X2LA 3HP2A 4OLIA 5HG5A 1RW8A 4B8MA 1YI6A 2P33A 1NVSA 3LCKA 4M7IA 4L3JA 4II5A 2W05A 4QNYA 4E1ZA 4JIKA 4TW9A 3VBYA 1MUOA 4BC6A 2G15A 3PG1A 1AD5A 1GZKA 4HCUA 4K18A 4NCTA 5FLFA 3BL7A 4IB0A 1KV2A 4L52A 4WG4A 4OGRA 1U54B 2GFCA 4JXFA 2WQEA 1R0EA 5AR3A 3ZDUA 4F9AA 4BDFA 2IZSA 1FMKA 5AP4A 1U59A 4EOLA 4AA4A 3Q60A 3BU3A 1B39A 2H9VA 2QLUA 4H3QA 4L8MA 3WF9A 3WIGA 4A9UA 3C13A 3ORKA 5IH5A 1G8JA 2YEXA 4FG9A 4BGHA 4HZSA 3ORLA 2ZM1A 3BGQA 4BCPA 4ZTHA 4LOOA 3TKHA 3LQ5A 2O0UA 2X0GA 4XP3A 2FSOX 4N0SA 4FIEA 2YJRA 4CXAA 2PVMA 4H05A 4TYHB 4MH7A