4X6QC

An isoform-specific myristylation switch targets riib pka holoenzymes to membranes
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
337
structure length
334
Chain Sequence
SVKEFLAKAKEDFLKKWETPSQNTAQLDQFDRIKTLGTGSFGRVMLVKHKESGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVAGGEMFSHLRRIGRFEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFTEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords cAMP-dependent protein kinase type II-beta regulatory subuni
publication title An Isoform-Specific Myristylation Switch Targets Type II PKA Holoenzymes to Membranes.
pubmed doi rcsb
source organism Mus musculus
total genus 103
structure length 334
sequence length 337
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2014-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4x6qC01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4x6qC02
3E5AA 3PUPA 5LMAA 4BYJA 3JUHA 3BHUA 3NS9A 2W1DA 4ASZA 2YCRA 2PK9A 4BDDA 2VN9A 4FSWA 3QCQA 3BEAA 2A0CX 3M11A 4RIYA 3ULIA 3D7TB 3KRJA 3IECA 2ZM4A 2PE2A 5E90A 5CEKA 5FDPA 3AD4A 4JG8A 2WMBA 4G3EA 4CZYB 3KY2A 4XOYA 5L8JA 3V8TA 5F9EA 5K5XA 2CCHA 5HVKA 2AC3A 4I0TA 2XJ0A 3QKKA 4AWIA 2RFEA 4DCAA 4MQ1A 5L2QA 5TO8A 4BYIA 2X4FA 3FHIA 2CMWA 3BWJA 4FSZA 3WZKA 2ITYA 3SG8A 1NXKA 4YJNA 3FXZA 1NVSA 3R01A 3WYYA 4D58A 4UWYA 2OXDA 2A19B 5F94A 4Q9SA 5TF9A 2GHLA 3A7IA 3D83A 3TUDA 2NO3A 3G15A 3OMVA 1OL5A 2XBJA 4FV5A 1JNKA 4JL9A 4X3FB 5A14A 1JAMA 2XZSA 3KRXA 1CSNA 3LCDA 3PRIA 1H24A 4PMTA 2PU8A 2YLEA 3Q4UA 2QOFA 2OKRA 2XRWA 4NFMA 2BRBA 2C68A 3FLSA 4FTRA 4OTPA 4DHFA 3I5ZA 3I60A 5KX8A 5DMZA 1GZKA 1OUYA 2WELA 5CASA 2B9IA 1XWSA 4ZJIA 5KMOA 2CGVA 1Q24A 4MCVA 2BAQA 2O8YA 3M42A 3MV5A 4IW0A 5C8MA 3V8WA 5JFWA 3HRBA 4BDCA 4WG5A 4C2VA 2E9UA 4FGBA 3LHJA 2I1MA 3PG1A 3KK9A 4XBUA 4LL0A 5CT7A 4ZTSA 5AV1A 2CCIA 5AP4A 3BGPA 4FI1A 4NW6A 2VTJA 3FQSA 1XH7A 3ATTA 1SVGA 2CGWA 3F7ZA 2FO0A 2OJFE 4EYMA 5IZFA 3CQUA 3LFQA 2PMLX 4W4WA 5CAPA 2WQBA 4D1ZA 3IDBA 4RJ7A 2BIKB 2VTQA 3AMAA 3R7UA 3LQ3A 1VEBA 3ZLSA 3II5A 4RJ6A 3WBLA 4CMTA 5HU9A 4EK3A 2QOCA 1OITA 5KNJA 4OBOA 5G1XA 4RIWA 4ALUA 4BF2A 4OTQA 2XNEA 3TCPA 2OSCA 4EQUA 4S30A 5FEQA 4AX8A 2C1BA 4XOZA 4M84A 4DAWA 4I5MA 3CTHA 5AP1A 2C6OA 2J0KA 1FOTA 4HPTE 2G2FA 4GL9A 5ETCA 5EKOA 1OL7A 3MH1A 5EHOA 3EJ1A 2UW3A 3DDPA 4UMTA 3I4BA 5ICPA 3JR1A 2XYUA 3A7JA 3R8MA 1JKKA 1JSUA 3IGOA 3PJ3A 3AMBA 3RI1A 5ETAA 5HTBA 4BIEA 2QKWB 5GJFA 3RZFA 4YC3A 2GNLA 2WO6A 2EB2A 3L9PA 3P7AA 4IAAA 4U97A 3CCNA 3QX4A 4F99A 4YJTA 3SVVA 2IN6A 4WBBB 1STCE 1GOLA 4W8DA 5FDXA 4BTKA 3E3BX 3RK5A 4DEDA 4N57A 4C02A 1LUFA 2VWUA 2WTIA 3QC4A 4QP6A 5I5ZA 4XP0A 3PJ2A 4QTBA 3V5WA 4AT4A 4FSQA 2BFXA 3QYWA 4XLVA 3FMDA 3HZTA 5F20A 3VW6A 2RFNA 5EW3A 4FG9A 4GFOA 5E1SA 3SKCA 3RAIA 4RFMA 3OWLA 3MJ2A 4P90A 1M2QA 3NR9A 2VO7A 1MRYA 3GU5A 2PZYA 3IW4A 4L3LA 5HE1A 3R8VA 4IJ9A 4FTMA 5HLWA 3EQHA 3VC4A 2OW3A 4GJ2A 5KMMA 2GQRA 4ENXA 2F2CB 1V0BA 3DY7A 3G9LX 4R5SA 2XA4A 3ZXTA 2V62A 3HEGA 3LFCA 3OTVA 5BMMA 1W98A 4H05A 3PXRA 3JVSA 3NRMA 4BR3A 2J90A 2HXQA 5CF4A 2ACXA 4RIXB 5BNJA 3K54A 2AYPA 3A7FA 3BZ3A 2WQMA 3DAJA 4FK3A 3GC0A 4E6AA 2B4SB 2GCDA 4U80A 4AZWA 3HP5A 4R3RA 4EBVA 3PSBA 3PLAE 3G0EA 5K4IA 1B39A 4PMSA 4BCFA 4I6BA 5A6OA 5JZJA 4GK2A 5B7VA 2VX0A 4MYGA 3FY2A 3A61A 1TQIA 3N4UA 1KE9A 4RT7A 4IBMA 4O0WA 2BFYA 4OTGA 4ZLOA 1T45A 4FT9A 4IH8A 3L8PA 3RPYA 4PNKA 4RVTA 4QMQA 5A9UA 4FSNA 3KN6A 4LGGA 5DH3A 3I5NA 3Q2JA 4K18A 3SC1A 5HG5A 5I3OA 2GNJA 4ZLYA 2XK6A 1KE7A 3W16A 1UU8A 3KXZA 1JSTA 4I0SA 3EYGA 4AACA 3W32A 3VULA 3GOPA 5FM2A 4Y8DA 5HG8A 5M4FA 2YJSA 4EH8A 1XQZA 5FXRA 1ZY5A 2PVHA 3ELJA 5M55A 1RQQA 2OIDA 3ENHA 3RVGA 1IA8A 3KXXA 3MB7A 4KIKA 2W0JA 3HECA 4MD7E 4NSTA 3P9JA 4QQCA 5BVFA 5KCVA 4PDSA 3D9VA 3TXOA 4TKSA 3TN8A 3VS3A 2H9VA 5HORA 3Q4TA 4HVDA 4DEEA 1YOJA 4O0XA 3RK7A 5BVWA 2F7XE 3ZC6A 4BDKA 3CEKA 4WSQA 4YZBA 1UWJA 3FI4A 3HV6A 2O0UA 2UZEA 3VUIA 5GNKA 4CFFA 2PVKA 1Q8ZA 3ZFYA 4AGWA 3QC9A 5BYYA 4QMSA 3GI3A 3U51A 1VJYA 4ZTHA 4CT2A 2HZIA 3MPMA 1KE5A 4KB8A 5D7VA 4E5BA 2UW5A 4BCKA 4IVAA 4EK8A 1YDSE 2R3MA 4G3CA 3ORLA 4JOAA 3RBWA 1K3AA 3NIEA 4EH5A 3S2PA 3BU3A 3BQRA 3KKVA 4OTFA 4J1RA 4QMZA 4CG9A 1R39A 3ORTA 5AP2A 4RSSA 4NFNA 1SVEA 3S1HA 4FG7A 1WBVA 4WA9A 5K5NA 3TDVA 3WOWA 4D9UA 5DLSA 4ASDA 1WBTA 3DK6A 4TT7A 3FQEA 2PZRA 3JYAA 3ZEPA 5IQGA 1PXKA 1LP4A 1PXIA 4Z7HA 5KO1A 1PRYA 3QX2A 4C4EA 2WIHA 4W8EA 3UDBA 4QQTA 5FG8A 2YERA 2VX1A 5JN2A 4UX9A 5GINE 3OT3A 4K77A 2VTLA 3H9RA 3TV6A 4GEOA 4G1WA 5B2KA 3R83A 4GRBA 3U4WA 2QURA 3GP0A 4RZWA 2ETMA 4QP7A 2ETKA 4FK6A 3QQLA 4WIHA 2XCHA 3H30A 4YSJA 2ZV8A 4MKCA 3L9LA 4AS0A 3UQFA 3V6SA 3LE6A 5EH0A 4ALVA 3A7HA 1MQ4A 3ZZWA 4FKPA 5HIEA 1HCKA 2QHMA 5HTIA 4BI2A 5D7AA 3HLLA 4J99A 1VZOA 2W17A 3IO7A 3HRCA 3UMWA 3R00A 4JNWA 5M06A 3IW6A 3NSZA 4MF1A 3VHKA 4DEGA 5E8VA 5TR6A 3QKMA 4HGLA 4ZTRA 2UZTA 2GDOA 4FZ7A 3AD6A 2CLXA 4F7SA 2ITWA 3HDNA 2C5XA 4DE4A 3IK3A 4HNFA 3NZ0A 3U9NA 4ACHA 3C5UA 2G9XA 2Y4PA 1YWVA 2W05A 4QRCA 3ZXZA 1DI8A 5ACKA 4CVAA 3CY3A 3E8CA 3R04A 1FGIA 4QMNA 4NL0A 4O7LA 2OXXA 5FD2A 3FMEA 4UWCA 2OJGA 5EDRA 3SRVB 3U4UA 4QYFA 4P7EA 3W2RA 4BBEA 3TZ7A 1OPLA 3PXQA 3QRJA 4UZDA 3E63A 1REJA 1OPKA 2XRUA 1TKIA 4GK4A 1XH6A 2J5FA 5FBNC 4IQ6A 1JKTA 3NNXA 5AP3A 5IKWA 2VX3A 3TTIA 3MGYA 3B2TA 3UVRA 5AX3A 5CAVA 1Q41A 2J0IA 4TPTA 2ZM3A 4Y95A 4FTIA 3OOGA 5LOHA 3ORPA 3F5UA 3D7ZA 3IOKA 2BMCA 2Z60A 3MFTA 2R3LA 3IQ7A 2QU6A 4RVLA 4XUFA 2DS1A 1XR1A 5TE0A 2A2AA 5KKRB 4IDTA 3U6JA 1QL6A 4K2RA 2C0TA 4W4YA 4LMUA 4D2WA 4RVKA 3OROA 4KBCA 2CN8A 5C9CA 4DC2A 5ANKA 4F9YA 3FPQA 4DLIA 3NX8A 5EHYA 4F70A 2UZBA 1YHWA 2IJMA 4V0GB 3TEIA 3QWKA 2VTMA 3O96A 1FVVA 2JD5A 4I0RA 2QG5A 3R7OA 2RF9A 4F9WA 1WVWA 4O6LA 3SOAA 4DGOA 1A06A 2JDRA 3NUAA 4BGQA 2H8HA 2W1EA 3TNIA 5CSPA 3ZMMA 3LKMA 1F3MC 4APCA 1IR3A 2IZUA 3BBWA 3QTXA 4RWLA 2KTYA 3ULZA 5F1ZA 4O7WA 4DH1A 2YDJA 3BQCA 5TT7A 3QAME 4AF3A 2XIYA 2CKPA 4C36A 3D14A 4NTTA 3AGLA 2HOGA 1SM2A 5CXHA 3C0HA 5CYIA 4F4PA 3WI6A 1IEPA 4LMNA 1NW1A 2YDIA 1Q62A 2O63A 4CCUA 3QTWA 4FA2A 4KRCA 3RPSA 3F3UA 4FVRA 3AC2A 5IH4A 3OWJA 3HKOA 3Q6WA 3R30A 4PTCA 4PDPA 3ERKA 4Z7GA 3QQGA 3VS6A 4H3BA 5D11A 3BE2A 4EOKA 1H1RA 1ZYSA 5AP5A 5EYMA 3EN9A 3RMFA 2RKUA 4AU8A 5FP6A 1AGWA 4MBIA 1PXOA 2C69A 3DBCA 3MYGA 2ZVAA 3NNVA 2UZVA 4LRJA 4PL3A 5E4HA 2YWPA 3PVGA 4WKQA 3QRUA 4RA4A 2WMAA 3EN4A 3SXFA 5ANGA 4RX7A 4X2GA 4ZOGA 4BCOA 3UO6A 4GVAA 4E5WA 2KULA 4DFYA 5BVNA 5L2IA 3SDJA 5J5TA 3HMNA 2V0DA 2Y4IC 5EDQA 4Z16A 3EN5A 3FSKA 1PF8A 3ZUUA 4BWPA 5J9LA 4D55A 5HKMA 1GZOA 3DKGA 3PTGA 1CMKE 2F9GA 3DA6A 3BGQA 3VIDA 3D2IA 4I5CA 2WQEA 3HV7A 1HOWA 4ACDA 4AA5A 4D4VA 5IPJA 2HK5A 4IACA 2F7EE 4IB0A 1YHSA 3HA8A 5LCKA 5L8KA 3UZRA 4PP9A 4XP2A 4LUDA 3SOCA 4ZIMA 3GGFA 3ROYA 4FNXA 4NJDA 2R3OA 1YI3A 4QYGA 4LGHA 1ZLTA 4BIDA 5L8LA 1FBNA 2XB7A 3FL4A 4UY9A 2R9SA 4JQ7A 5E8SA 4BCJA 4L44A 4QD6A 3UZPA 1OKVA 2XNNA 4PF4A 1UNHA 3V5JA 3HYHA 3COKA 4APPA 4ORKA 4S2ZA 3HV3A 2GS2A 4RJ3A 5AUUA 5CF8A 3RCJA 3VUKA 1T46A 4S32A 4KS8A 3KU2A 5H8BA 4YLLA 2ITVA 5CEIA 4M0ZA 5K9IA 5M53A 1G5SA 3G51A 3NMUF 4OLIA 5I0BA 2X7GA 3OF0A 3MTLA 2Q0BA 3BHTA 3RGFA 5C1QB 3TT0A 3DJ7A 1DI9A 4JBOA 3A2CA 2OG8A 3POZA 4HCTA 4CXAA 2J7TA 3O71A 3UIMA 4NCTC 3MA6A 3GUBA 3LCOA 5JFXA 3FI8A 2C5NA 1UU7A 4DGMA 4YP8A 3VW8A 2VGOA 5AUXA 4DG3E 1LR4A 4TWCA 2WHBA 4D2TA 5EG3A 4GU6A 4A07A 3V5TA 4XV9A 2PZIA 5HU3A 5I9XA 2I7QA 5M4UA 3OY3A 1QPDA 5CT0A 3MY1A 3BHYA 4KBAA 4AXAA 3JY0A 3EKNA 4I23A 3WF8A 4CTBA 4EH4A 2F7ZE 3BYUA 5AA8A 3WZJA 1G8AA 2A4LA 4PTEA 3QTSA 1BKXA 2V7AA 4YJUA 3UVPA 3LFEA 3NDMA 3MFSA 5LARA 2ONLC 3GEQA 3O2MA 4XX9A 3TI1A 1R3CA 4BCQA 4F0IA 4V04A 3NVKI 3FC2A 5CSXA 4ANOA 2OH0E 3Q4ZA 2Q0NA 3QQJA 1DS5A 5ETIA 3W2PA 5AIKA 5IF1A 3PWDA 4E4LA 4WT6A 5HE0A 2X8DA 4G9RA 4AT3A 2YIYA 2YAAA 3PSDA 3BEGA 2QO7A 2VWWA 3UODA 1REKA 3UOHA 3AXWA 3OW3A 3PIZA 2J51A 4E73A 3GB2A 1H00A 5EHLA 3RM7A 4A7CA 3UO5A 4F1TA 4F6WA 1J3HA 1GIIA 1WMKA 1H1QA 2OZAB 4FKTA 4R6VA 1SVHA 2BHEA 3F5GA 3R8UA 4EOIA 4DTKA 5HD7A 4EOPA 4EBWA 2CJMA 3KF4A 2EXMA 3R7GA 2WOTA 2CNUA 4HVIA 2J5EA 4IX5A 3A8XA 3NCZA 3ANRA 2Q83A 4AZSA 4DGGA 4I24A 1J1CA 3V5LA 2W5AA 3R8PA 5J95A 2R3PA 4YZ9A 4BRXA 4NM7A 4IWQA 4EHEA 2XIZA 3QGWA 1H4LA 4U6RA 4X2KA 3UOKA 5M07A 5HNBA 4FG8A 4FT3A 4MNFA 1R0PA 4IC8A 4BN1A 3FXWA 4XLIA 4B6LA 2YDKA 4MTAA 4HGTA 2F49A 5AUWA 3SXRA 5EFQA 4C38A 4EZ3A 3P5KA 4O0RA 4J98A 5HCXA 3VBYA 3ZEWA 2PUNA 1XH8A 3HV5A 3PP0A 1UKHA 4YNOA 5HI2A 4XG6A 3ZDUA 2QONA 2I0YA 4Z3VA 1RE8A 1ZMWA 2BILB 4QNAA 2BTRA 5IQBA 4RQKA 2YZAA 2YM4A 4ASXA 2FSMX 4S33A 4R78A 1OIUA 3V5PA 1YWNA 2B52A 2XMYA 4XV3A 3CXWA 4DN5A 5I4NA 4JBQA 1FINA 1PW2A 3DPKA 4G3DA 3FI2A 2RSVA 4EKKA 2B0QA 4O96A 4A9SA 2ITNA 3NUXA 5HTCA 1Q61A 5DR9A 4QMYA 3E8NA 4GIHA 3LLTA 3TZ9A 3FLYA 4Y46A 5DPVA 2EUFB 3TUCA 2R3KA 1JKLA 4HCUA 4O7TA 3QCSA 1PXJA 2W4OA 4B7TA 1IG1A 5IU2A 4C3PA 5CENA 3WF5A 5A46A 2XF0A 3VS7A 2PUUA 3FMLA 4UXQA 3C0GA 2ZV2A 5CU6A 3BYOA 1UNGA 3V6RA 3EYHA 4WNOA 5K4JA 2I6LA 3QL8A 4WNKA 4E4NA 3CC6A 3MIAA 5HGIA 1OKWA 5I9WA 3ZLXA 5M56A 5ETFA 3RALA 3OCSA 3TV4A 5KMIA 5IQFA 4Y73A 3C4WA 4YZCA 2H96A 4EUTA 2B9FA 3DOGA 3LJ0A 3MBLA 4FYNA 3L9NA 4PDOA 4HYSA 3BYMA 2WTVA 3THBA 2OJIA 3LQ8A 2QLQA 2XIXA 2HYYA 3IGGA 3UYSA 4DGNA 4M14A 3CTJA 4MX9A 2OU7A 1UVRA 5A54A 2XS0A 3SG9A 5BPYA 4ZY6A 5A4QA 2UW7A 1G8SA 2WPAA 3C0IA 3KK8A 2QO9A 1H1PA 5EOLA 3SAYA 4CFXA 2O65A 2Y4IB 4BB4A 3V04A 4K1BA 3QKLA 5CU3A 4XEYA 3PIXA 3HAMA 2VWVA 2X1NA 3LVPA 3OXZA 4RMZA 5DFPA 2DYLA 4GUEA 3JY9A 1Z9XA 5LJJA 1M14A 2C6DA 4JJRA 3CLYA 4KA3A 4BFMA 4JX3A 2QOOA 2UW8A 4QYEA 4AOIA 4E1ZA 5DYJA 3UBDA 3CTQA 2FVDA 4X2NA 3EQPA 4W4XA 3HMMA 4H1MA 2Y8OA 3IDPA 4PWNA 1BL6A 4FUXA 1OBDA 4B0GA 2PULA 3HNGA 3IS5A 3UE4A 4ERKA 4ZLZA 3O23A 2YIQA 4O2PA 1ZYCA 4OTRA 4GFGA 4EHGA 4D0WA 1KE8A 3EMGA 3HUCA 4IB5A 3LFFA 2JKKA 4X21A 4PNIA 4USEA 4EWQA 4NEUA 1SMHA 5JFVA 2B7AA 4AW0A 4M15A 1FMOE 2RIOA 5KMJA 3PVUA 4R7BA 4RJ8A 2E2BA 2Z8CA 3MFRA 2Y6OA 5JQ5A 5IQEA 2R3HA 3FV8A 3UIUA 1ZOEA 2HW6A 5GZAA 1WFCA 3MTFA 4XS2A 5H2UA 2FSLX 3T8OA 5CAQA 3AG9A 3CD3A 5J5SA 3SW7A 4BICA 2Z2WA 4C33A 5IUHA 3MA3A 3NUUA 3RM6A 1Y8GA 3DKOA 3ORMA 4IB3A 2B1PA 5FTGA 3ACKA 4F7NA 3EZRA 4ZAUA 3EFJA 1JSVA 2W1GA 3RINA 5BUIA 2PPQA 1YXTA 3EOCA 1CDKA 3FBVA 5AUYA 1XKKA 2WEVA 3WILA 4EYJA 3OXTA 2WMQA 4FIJA 3HUBA 4D1XA 3D2KA 4F9AA 5KBRA 2YIXA 3O7LB 2GTNA 2JLDA 5E92A 3VN9A 4X3JA 3MIYA 3LJ1A 4ZSLA 1GZ8A 3FAAA 3OXIA 5DG5A 4CFNA 2W5HA 2YM6A 3QCXA 4A9RA 4ENYA 2BDFA 3H4JA 4FBXA 3KULA 1YXUA 1UU3A 2PMOX 2H34A 3BCEA 3BX5A 4ZMFA 2O2UA 4NKSA 5E8YA 4V01A 5HO6A 3ZUTA 4D2VA 5D10A 3RAKA 4J8NA 3QF9A 4MXYA 2XNBA 3O50A 3KMUA 3RAHA 3KXMA 3F7WA 5B2MA 3PG3A 5CY3A 2JKQA 2VTOA 2YITA 2X9FA 2PVRA 3BELA 4WNPA 3MI9A 2X2KA 5AX9A 4F1MA 3TZMA 4ARKA 3U55A 1YKRA 1M2RA 2E9VA 3LXNA 4EH7A 3C5IA 1WBSA 4TWPA 3K5VA 4LFIA 4O7ZA 3R7VA 3EQDA 3OEFX 4XRJA 3E87A 1DAWA 4OW8A 3RP9A 4QP9A 5DA3A 4RVMA 4XCUA 5BMSA 2XK9A 4GFMA 4O6EA 3NW7A 3I1AA 5LMBA 3PA4A 3ZYAA 4J53A 3A7GA 3QXPA 1XBAA 4NIFB 4BWXA 4IM3A 3KRWA 2XUUA 5JGAA 4FIIA 4RZVA 4ITHA 3PZEA 2F4JA 2I40A 4KD1A 4YSMA 4M7IA 1O6YA 2OF4A 3LQ5A 3S00A 5DWRA 2YM8A 1UNLA 4FVPA 3DZQA 5EW9A 5BYZA 2OJ9A 2W99B 3EHAA 3CKXA 2FA2A 2JEDA 3E3PA 3G5DA 4P5ZA 3VWAA 4QP3A 4WUNA 4YU2A 2DQ7X 4LV5A 3T3UA 4O7NA 3BU6A 4G17A 4I6QA 2J0JA 5D12A 2GSFA 4XH6A 5EQEA 4CYIA 5DNRA 3V5QA 2WU7A 4YBJA 4GVJA 2QCSA 2ERKA 3HGKA 3DCVA 4MXOA 4BHNA 1MUOA 2IO6A 3R02A 3E8DA 1JWHA 2IZTA 4IEBA 1PYXA 2PHKA 3KN5A 1YXXA 3PJ8A 3HP2A 4MNEA 4O7YA 4FKJA 5LVLA 4FSRA 4AA0A 5HIBA 5M09A 2ITTA 1BMKA 1VYWA 4QTCA 3FSFA 2J9MA 2X4ZA 3CIKA 3MVMA 1R0EA 3PJCA 1YXVA 3ZC5A 4IWDA 1NVRA 2X8IA 4U5JA 4TYHB 3R9OA 2VO6A 4RWJA 4GV1A 5IDPA 1W8CA 4AN2A 5LWMA 3PPZA 4YJPA 3PZHA 3QGYA 4WO5A 2XJ1A 4AA4A 4ANQA 4F9BA 4UALA 2EXEA 3AT3A 3ID6C 4AZVA 5M51A 4DFLA 5KKRC 2QODA 5B0XA 3FMNA 4IFCA 4M8TA 5HLNA 2PZPA 3P08A 3CGFA 3GQLA 1ZYDA 3R1YA 4I21A 3UC3A 5KUPA 4DFXE 5CZHA 3TACA 5IQAA 4FTNA 3AT4A 1JOWB 4XG2A 1J7LA 5AWMA 4G6OA 2W1FA 4U8ZA 4C2WA 5LMKC 5LVNA 1E1XA 4DGLC 1GIJA 5IA0A 1Z5MA 5C8KA 4FV7A 3I7CA 1RW8A 3NPCA 3HRFA 2CKEA 2W5BA 2X0GA 3R9HA 4ZTLA 2UW0A 1PXPA 3OBJA 5CZIA 3DLSA 2QC6A 3ZBXA 2W1IA 4X2JA 2XBAA 4ANLA 4FL3A 4G9CA 4DA5A 1FGKA 2ZV9A 2XK8A 4QTDA 1YI6A 5CNOA 3VBQA 4C4IA 4C35A 1XH4A 2C6LA 3CP9A 3G6GA 4JVGA 3F3TA 4PX6A 3UGCA 1H28A 5FP5A 2CKOA 3VRYA 4AG8A 3LFNA 5GIPE 4XHKB 3ZLWA 5AV2A 3HA6A 3PVBA 4FIHA 5A4TA 1ZAOA 5AUTA 4FF8A 4RPVA 2ERZE 3ATSA 3CBLA 4J52A 3AC1A 3SV0A 4C4JA 4FV8A 5HO7A 1O6LA 3PE1A 1OECA 3UP2A 2XNMA 1Q8TA 4FZDB 4LL5A 3ZU7A 1IASA 3D15A 3KFAA 3C4CA 4L7SA 4IZ5A 4MXZA 4NWMA 4JIAA 3CQEA 3FPMA 4YZDA 2OICA 3DB6A 5T6KA 3DJ5A 1MRUA 4I20A 5FGKA 2C3IB 1U59A 2JDSA 4K9YA 5GZ9A 3RWQA 4G16A 4B9DA 1E9HA 4CG8A 3P4KA 4ACGA 2ZB0A 3K5UA 3TZ8A 4AGDA 4O1PA 5HNIX 2J2IB 4AGCA 5IA2A 4OBPA 4IX6A 2C5VA 1ZY4A 3QFVA 2OWBA 4GIIA 4C57A 5AV0A 4JG7A 2Y0AA 4JQ8A 4OTHA 5DGZA 3GC8A 4BCNA 4GMYA 3NAXA 3OTUA 3LCTA 2GS6A 4YLKA 4CMUA 4EHVA 2YWVA 4ZTNA 3W10A 5CEMA 5CS6A 4D4YA 1UWHA 3ALNA 3KEXA 3GU8A 4OTWA 4I94A 3RHXA 2G1TA 4UMRA 4U0IA 4FEUA 5AADA 2UW4A 2OF2A 5FRIA 3NYOA 2JGZA 2CGUA 3UJGA 4W4VA 2NPQA 3DQXA 2RG5A 1V0OA 1Q99A 4TWOA 2XK7A 4PUZA 3BRBA 2HIWA 4IX3A 2XEYA 3QZGA 5AMNA 3VHEA 4DFZE 3BE9A 3C4ZA 5JK3A 4BTFA 3FE3A 3COMA 4CKIA 3A60A 1Q8YA 2BAJA 4Q9ZA 3NAYA 3Q9YA 4R77A 3D7TA 2WIPA 3QTRA 5CU4A 5K0KA 4KIPA 4O7SA 3PLSA 3HL7A 4YTCA 4OUCA 1GAGA 3GXLA 3N4VA 3P0MA 3R28A 4IHPA 3QZIA 4G6LA 4BDGA 3QBNA 4EK4A 5EQPA 3FYJX 2ONLA 2YEXA 2QR8A 4Y83A 3UVQA 3ZFMA 2WMVA 2XNPA 3C1XA 3MDYA 1RJBA 2C0IA 2ITUA 3DNEA 4X3FA 4EWHA 4QYYA 4D5HA 3RK9A 2W9FB 4CV8A 5ANJA 3FLQA 4A4LA 3KA0A 4FMQA 3ODZX 5CXZA 5HQ0A 1F5QA 5L4QA 2IVVA 3E7VA 4R1YA 4WOVA 4RX8A 1ZRZA 1WVXA 2HZNA 1BI8A 3MY5A 4HOKA 3FYKX 2P55A 5AFVA 4OAUC 4KKGA 3KMMA 5EI8A 2C6EA 4BGHA 3V8SA 3Q2MA 2PUPA 5JZNA 3ORNA 4FTAA 3GU7A 1PXMA 2OI4X 4F1OA 3PVWA 1LPUA 4Q2AA 4YC6A 2PSQA 4GT4A 5BX0A 4FEVA 1Q8WA 4EOLA 4RRVA 5JFSA 4EC8A 5HESA 1AQ1A 3LM5A 4I5HA 4IC7A 3GCSA 5F4NA 3OCBA 2Y9QA 4J71A 3QU0A 2JC6A 3VRZA 5HBJA 3OCTA 5CF6A 4W9WA 2AC5A 2YCQA 3OD6X 4IX4A 4TYJA 4E6QA 3I7BA 3IG7A 4G2FA 3UNZA 2X6DA 1PKDA 3W8LA 4QP2A 3L1SA 4EQCA 1PMUA 4PMPA 5A4EA 2QG7A 5AP7A 3DS6A 3ZSGA 1O9UA 4TYGA 3BGZA 4B99A 2HAKA 2W96B 1Y8YA 3OS3A 4Z55A 2B9JA 3OWPA 2XM8A 3QRTA 3FZTA 3ANQA 3QD3A 2R3JA 4WD5A 3IDCA 5I9YA 4I1ZA 3VO3A 2ZB1A 3W33A 3F3VA 3H9OA 3ZUVA 3LPBA 4CQGA 4USFA 4YO4A 4B4LA 5AM6A 2EB3A 3CJFA 3QLFA 4YJOA 3OHTA 4AW5A 4NM5A 4QQ5A 3ZCLA 2GHMA 3SX9A 3R9DA 3FZSA 3R73A 3D5WA 3DGKA 2YN8A 5CALA 3F82A 5EKNA 4CLJA 4M97A 4NT4A 5DI1A 4CZUA 1SNUA 3HV4A 4F64A 3DK7A 4A9TA 4C4HA 3OZ6A 3TJCA 3UTOA 3O0GA 2ZM1A 3HDMA 4F7LA 3RPRA 1KOAA 4R7IA 5KMNA 1WZYA 3GU4A 3H10A 4FKOA 5AR8A 5CNNA 3EL8A 2R0IA 2Z7LA 4IVDA 5G6VA 1OIRA 5FUTA 5HVJA 2NP8A 4ALWA 4ZTMA 4XV1A 5ANEA 2BZIB 3B8RA 2BALA 4G3FA 4E4XA 4AW2A 4MBLA 3GCUA 1H0WA 3D5UA 4LV8A 4RC4A 4E8AA 3AD5A 3FZRA 5CI6A 4U42A 3ZRLA 5CVFA 4ZXTA 4CQEA 4L9IA 4GCJA 4B8MA 3QWJA 3ZRKA 5J1WA 4OT6A 4RIXA 4YHFA 2HWOA 3CGOA 4ANNA 2VU3A 4K33A 3U87A 2HENA 4CKRA 2LAVA 1W84A 4WBOA 1JKSA 5AR2A 4TXCA 1WCCA 3NUPA 4LOOA 1K9AA 2JKMA 3FL5A 5AJQA 5DVRA 3LFDA 3C4FA 4EI4A 5IA1A 3R7EA 3EN6A 3OEZA 3VS4A 2VO0A 3U6HA 2VRXA 1G3NA 5JSMA 4FV0A 1PXLA 5HOAA 2HW7A 5FTQA 5BVKA 1KV2A 4UMUA 3ZO4A 2P2HA 5E8XA 4C4GA 4GU9A 4P5QA 4ZY5A 3R1QA 2GTMA 2YISA 4IANA 2JIVA 3ZLYA 4ZSEA 3FJQE 4FTTA 4FL2A 4GG7A 3F88A 3TKHA 2PVMA 3D5XA 3LXLA 1U54B 4FYOA 3R1SA 2CN5A 2GNFA 4K0YA 1J7IA 2CNQA 2P0CA 3F9NA 5IQCA 3QLGA 2BDWA 1JPAA 3EQFA 4XJ0A 5CQUA 4ZSGA 3W18A 4FKRA 4FV9A 1LEWA 3KRLA 2BAKA 4L8MA 4XRLA 3G90X 2GNIA 3AMYA 4NKAA 4X2FA 1YVJA 3ZBFA 5AEPA 4E93A 2XP2A 2X2MA 3FZPA 3UNJA 1NT2A 4KUJA 3FC1X 2BRMA 2BRHA 2IWIA 3C9WA 2ZDUA 4JBVA 4PV0A 3HVCA 2ZMCA 4RX9A 2R2PA 3E64A 1WBWA 3PXYA 4GT3A 5DT4A 4QOXA 4AP7A 3O51A 4FNWA 3B8QA 4FSUA 3I6UA 1R1WA 3BYSA 4LRMA 3A8WA 5HO8A 2WMTA 4ZTQA 4F63A 4GSBA 4MHAA 4ZS0A 4EONA 3NGAA 3HMPA 4UV0A 5KHWA 3KXNA 2I0HA 2R3NA 2YFXA 2FUMA 3AC5A 3F66A 3N9XA 4FV3A 4LRKA 4LQMA 2B54A 2O64A 3EH9A 4FICA 4GJ3A 5HBEA 3WIGA 1ZMVA 4D2RA 4DT8A 5JRQA 4MD8E 3UG2A 5JMSA 3L8XA 5H8GA 4OTIA 1JVPP 4M12A 2PWLA 3F5XA 4EH3A 1IRKA 2GFSA 4GS6A 3TKIA 4HYIA 5AR4A 3FMJA 2R7BA 3ZFXA 3TKUA 3TNHA 3KCKA 4IDVA 4YJRA 3LMIA 5EM6A 5KZ0A 5IA3A 4IM2A 3RZBA 4FTUA 1ZYLA 5HX6A 5IQIA 3MFUA 3R9NA 4BBMA 4F6SA 3WYXA 5KZIA 2VTSA 5HG7A 3AC3A 4JDKA 4EOOA 3QTZA 3NW6A 2XNOA 1MRVA 4L52A 2BUJA 3P78A 5C01A 3NCGA 4NJ3A 4NK9A 5FXQA 5IQDA 4FX3A 4XMOA 3NYNA 5CEPA 4CFVA 5GZ8A 4RIYB 4BCPA 2VTNA 4DITA 4MWHA 5DBXA 4WSYA 3T3VA 3F61A 4M67A 4XG9A 4WNMA 4AW1A 4DTBA 4GUBA 3LCSA 4RFYA 2WEIA 4O7VA 2XM9A 2WOUA 3QQKA 4W9XA 2WMUA 4K11A 4JQEA 2UZNA 3LJ2A 3TM0A 4HW7A 2W1ZA 4I93A 2G2IA 2R7IA 3U54A 3QHWA 5E8WA 4RFZA 2XK3A 4PMMA 5IEYA 4IMYA 4R8QA 2RL5A 5L2WA 3VBXA 1H1SA 2C30A 4PL4A 3IW5A 4I3ZA 5KBQA 3O8TA 4YZNA 1OL6A 1ZZ2A 5E8UA 1W0XC 2PE1A 5HLPA 3OCGA 2QR7A 3RPVA 5HD4A 5K0XA 2XIKA 3KREA 2QKRA 3LFAA 3OWKA 5E91A 1OUKA 5HHWA 2GU8A 5GJGA 3CKWA 3GQIA 1CKPA 1YDRE 3Q52A 3SRVA 3GT8A 4BDFA 3LLAA 2QHNA 3BKBA 3DV3A 4HZRA 4AN9A 3SLSA 4IAYA 4BKYA 4D2PA 3DKCA 3VBVA 1Q3DA 1A9UA 4UMPA 4ZJVA 3I81A 4L42A 4FSMA 2UUEA 3E7OA 4X0MA 3EQCA 5CU0A 1PMEA 3UIXA 2HWPA 2VD5A 4A06A 3CS9A 3KRRA 4RIWB 5EI6A 1YDTE 5HE2A 4R3CA 3DXNA 3VVHA 1DM2A 2J0LA 5F95A 5FXSA 2R3IA 1PHKA 4U45A 3I0QA 3MESA 3P7CA 2P3GX 2WXVA 2XH5A 1U5QA 3NUSA 4YJSA 1XBBA 4YHJA 3FHRA 4EJ7A 2I0EA 5BVDA 1URCA 4PRJA 3PY1A 2OLCA 1ZYJA 4YBKA 4PP7A 3MJ1A 3BHHA 3VS2A 5LMKA 3G6HA 3VBTA 2JBPA 3QD4A 4HGEA 5HICA 3TNPC 1SYKA 4V0GA 3VJOA 2V5QA 3EN7A 4YR8A 5EM5A 3MH0A 2ZMDA 3E93A 2JAVA 3QYZA 4EC9A 5AR5A 4TWNA 3R8LA 4YLJA 3WF9A 5L6WL 1VR2A 2RFDA 3OP5A 3TTJA 3CD8A 3HX4A 3UPXA 4DH7A 2CNVA 1IAHA 3VAPA 1OI9A 3KC3A 3D5VA 3T9TA 2FSTX 3Q53A 4BZOA 1P4FA 4QYHA 5JRSA 4AZEA 5AAGA 2J4ZA 2UVYA 3NLBA 4ERWA 1VYZA 4XNEA 4O81A 5FQDC 4DCEA 3K3JA 5DOSA 1J1BA 5CI7A 4JAJA 2UVXA 4TW9A 3LAUA 2YLFA 1YRPA 4ASEA 2VWXA 4J7BA 4EZ7A 3B2WA 3C13A 2FH9A 2R64A 2QI8A 2UZLA 3G33A 4HJOA 3Q60A 3WZUA 4F65A 3KMWA 1GZNA 3QQUA 5J9ZA 3ROCA 3PY3A 5DRDA 2X2LA 3F3ZA 5EDPA 4UB7A 2QQ7A 3DBQA 4IFGA 4ZZNA 5BQ0A 1OIYA 2VTIA 4HYUA 1DAYA 1H8FA 3BU5A 1PJKA 3L9MA 2FSOX 3OY1A 4TN6A 1TVOA 4HVGA 5EM8A 5E9EA 5CVGA 4CEGA 2A27A 1Q5KA 4DINA 5KHXA 1GNGA 4TTHB 5DN3A 4JAIA 4M3QA 3CQWA 4F0GA 2OGVA 4NZWB 4BCGA 4FUYA 4BTMA 3DAEA 4EL9A 3W2OA 1W83A 2CSNA 3A4PA 3QD0A 4U3YA 2A1AB 3DXPA 4LOPA 1CKIA 1W7HA 2YJRA 5D9HA 4DLJA 2BPMA 4GKIA 4O7RA 2WMXA 1RDQE 4PQNA 1BYGA 4QMTA 5AV3A 2GS7A 3BV3A 3BPRA 4KS7A 5LVOA 4FL1A 3OG7A 3G0FA 4MBJA 3C51A 3IW8A 4IAKA 4K8AA 2VUWA 3E88A 4KKHA 4S31A 5CSHA 5DT3A 4UEUA 4LOQA 5I9UA 4TNBA 3VNTA 3SD0A 5C8NA 4E4MA 2HY0A 4C8BA 5BUJA 5I3RA 4I22A 2QU5A 5M4IA 4XG8A 5AUZA 4BI0A 4DEHA 1XBCA 5JT2A 4DT9A 2I0VA 2IW8A 5A4LA 4BCMA 3W55A 3RNIA 3MH2A 4L00A 2QOKA 5IH6A 2XJ2A 2XNGA 3I0OA 4KIKB 4U40A 3Q32A 5EM7A 2VTHA 1NY3A 4FNYA 4DG0E 4QT1A 4WRSA 3DT1A 1H1WA 5IA5A 4ZSAA 4AUAA 3OC1A 4O82A 5L6OA 3OUNB 3AC8A 3AOXA 5K3YA 4XBRA 3CR0A 3KVXA 4FTQA 4JG6A 4ANBA 4U79A 2YCFA 4LM5A 2E9NA 2IVUA 4FKUA 2XK4A 5AAEA 5ANDA 1WBNA 1P14A 4DH5A 4FVQA 2WTKC 3M2WA 4MH7A 4MK0A 2BKKA 1OZ1A 5CQWA 3UPZA 4Y5QA 4PPCA 2YM3A 4PTGA 3HAVA 3GENA 1Z57A 4DTAA 1P4OA 5KE0A 5JEBA 4EH9A 4FTLA 3TNWA 4IVCA 5IQHA 4KINA 3R6XA 2F57A 1XJDA 3FMMA 2PTKA 4D1SA 4FEXA 2PVFA 2RGPA 3BV2A 3QUDA 3UNKA 2UVZA 2PVJA 4ZJJA 2IZRA 3DBDA 4PPAA 5EYDA 3O8UA 4QP8A 3UG1A 4EOMA 3WIKA 2G15A 3ALOA 3QA8A 3MW1A 4WG3A 3V3VA 1B38A 4E5AX 4IVBA 3CSVA 5DR2A 3DXQA 3K3IA 5DEYA 1K2PA 3I79A 4FGRA 3PXKA 2HZ4A 3R22A 2C5YA 3ZZEA 1ZMUA 4DEBA 5AA9A 4R5YA 5T3QA 3KVWA 4P4CA 2NNWB 4N6YA 4GKHA 2BR1A 3ZO3A 3H9FA 4BZNA 1JLUE 3QQHA 5A3XA 3FKNA 5IDNA 3FQHA 3R21A 2C6KA 3DLZA 2ESMA 2QO2A 3KL8A 5FWKK 1M7QA 3VUHA 2ITOA 3RHKA 4O2ZA 4HGSA 3UOLA 4UBAA 2OZAA 2VWZA 3R63A 1KUTA 4U81A 3RJCA 4DBXA 1I09A 4YJQA 2YZLA 1FVTA 2C6MA 4GG5A 3ZRMA 4G31A 4CFUA 3BHVA 1QPEA 2VTPA 4N70A 2PE0A 1ZOHA 3DTWA 2ETRA 3QD2B 3GOKA 4C3RA 3D4QA 4N0SA 4WHZA 3ZDIA 5L3AA 4YTFA 4YPSA 1ZARA 4XP3A 3QXOA 2GHGA 1PKGA 4RWIA 5EYKA 1H08A 3NNWA 2JKOA 2W1CA 5EI2A 2NRYA 3AC4A 4QMWA 4MEDA 3FKLA 3UOJA 3EFKA 4FR4A 1LEZA 4JS8A 2C3LA 3ORKA 4O0SA 1YOMA 1SNXA 3MWUA 3QRKA 4D4RA 4O0TA 3NEWA 3OBGA 2BVAA 2OIBA 2X7FA 5FTOA 3W2CA 4FV4A 4R1VA 3DTCA 3W1FA 3MVJA 5ANOA 2ZAZA 3FZ1A 4RC3A 2NRUA 4ZP5A 3LMHA 3P1AA 3WF7A 5IH5A 1OB3A 5HZNA 1KSWA 3C7QA 3L8VA 4TNDA 4EJNA 2O5KA 4ITIA 3U8WA 2WMSA 2GQSA 3EQRA 3HMIA 4L46A 3N51A 4X6RA 3GC7A 3QUPA 4FV6A 4Y5HA 4X6QC 3VUGA 5FM3A 4MF0A 3VS1A 4QO9A 1ZWSA 2WQNA 4RIOA 3R8ZA 3K2LA 4YNEA 1WBPA 4IZAA 4O84A 4FTKA 1W82A 4U9AA 3DAKA 4K6ZA 3PWYA 3E8EA 1ZXEA 4LGDA 3V01A 4QMLA 3AGMA 3VQUA 2WZJA 5JGBA 2IZSA 3R7YA 4BGGA 2OIQA 4I41A 4MXAA 3VBWA 5CEOA 5CU2A 3BLQA 4DH8A 5M4CA 4CTCA 5FEDA 3LIJA 3DNDA 3ORXA 1APME 2W4JA 4ANMA 4L53A 4IZ7A 3IOPA 4MAOA 3CPCA 3KGAA 5BUEA 3W2QA 4KSPA 5CF5A 2OK1A 4FKVA 4I5PA 4TRLA 4LUEA 3VF8A 4BBFA 2QOQA 4N6ZA 3QALE 5TKDA 5A4CA 5IA4A 1AD5A 4CV9A 2YM7A 4BKJA 5BVEA 1GY3A 4C0TA 3LFBA 5E7RA 2CPKE 4CFWA 5HCYA 3O17A 3Q5ZA 4C7TA 4JRVA 5IG1A 2X6EA 2OXYA 2AUHA 2W4KA 1OMWA 2VV9A 3BYVA 1A48A 2ZV7A 2C0OA 2IVTA 3GU6A 3AQVA 2R3QA 4ZZMA 4F08A 3MVLA 3VJNA 5BYLA 2HXLA 3ZM4A 1U5RA 4I92A 4AFEA 1OPJA 3ZM9A 2JFMA 5HG9A 3SW4A 5I9VA 3NVMB 3R2BA 3F69A 1OBGA 3UC4A 2UZUE 3GCVA 2C1AA 2H6DA 2P2IA 2UW9A 3SHEA 5D41A 4C61A 4YTIA 4ONAA 5LVMA 4AOJA 5KMLA 4EORA 3DU8A 4WG4A 1Q3WA 2R3RA 3PA3A 3PE2A 4NH1A 1QPCA 4AGUA 4CCBA 3RNYA 2WTWA 3TJDA 4ZEGA 4HPUE 4FZ6A 3WZEA 4OAVB 4E20A 2R0UA 3A62A 3RPOA 4GYGA 5E8TA 3NWWA 3GCQA 1EH4A 4A9UA 3CY2A 2XKDA 3FZOA 3Q4CA 3P7BA 2IG7A 2ITXA 2QNJA 3FEGA 1NA7A 3EKKA 4IAFA 3IONA 4BDIA 2OFUA 5HX8A 3QUEA 1YXSA 3ITZA 1M2PA 4QMVA 1J7UA 4D28A 3F6XA 1OKYA 4NW5A 3SQQA 3DFAA 5DIAA 3REPA 3Q6UA 3GC9A 4E6DA 1PYEA 4XV2A 2XCKA 5AR3A 3NUYA 2GPHA 3Q3BA 2W9ZB 2ZOQA 5L6PA 3ORZA 1NVQA 3QRIA 4FZAB 3W8QA 4F09A 2EU9A 4EK5A 1XH9A 3FMKA 5AP0A 3HMOA 4FT5A 1R78A 3H3CA 4X7QA 4NCTA 4ACMA 4G5PA 3FXXA 4JT3A 2C6TA 1XHAA 5CLPA 4S34A 5LXMA 2JDOA 3P79A 4L7FA 3ET7A 4IB1A 3BI6A 2WMRA 4A9YA 4AE9A 4AQCA 4O91A 2WTKB 4JIKA 4MXXA 3BBTB 3DK3A 2QVSE 3LOKA 2GFCA 5DE2A 3OFMA 4YHTA 4OR5A 4AZFA 2X8EA 3R0TA 4J95A 5CX9A 3QTQA 4F6UA 3LCKA 3PXZA 1YW2A 3ETAA 5EK7A 5AR7A 4MXCA 4QMXA 3WE8A 3RAWA 4BDHA 3FI3A 3LM0A 3Q96A 3TV7A 5CTPA 2WB8A 4EOSA 1BI7A 3ZSHA 4YURA 3GFWA 1F0QA 2Z7SA 3E62A 2YACA 3MPTA 1SZMA 2OH4A 2Z7QA 3DJ6A 4UN0C 1L8TA 2CDZA 2UV2A 3NUNA 5CANA 2VTAA 2RG6A 1H26A 4F0FA 4CLIA 2E9OA 1CM8A 3PPKA 4NUSA 4KSQA 5FBOA 5J9YA 4WRGA 3S95A 4DH3A 3A4OX 5L2TA 3QQFA 1Q4LA 4BKZA 5TOZA 4BCIA 2C3JA 4U43A 1H0VA 3UZTA 4Z9LA 3RKBA 4I4EA 1V1KA 2WTCA 4AZTA 3TWJA 4D2SA 2X39A 5IISA 4KNBA 4Y85A 4ZS4A 2YIRA 2PVLA 5DR6A 4NIFA 4NYEA 2VTTA 4EH6A 3EQGA 2VO3A 2B53A 5EW8A 1GJOA 4TL0A 3TUBA 2JIIA 3MH3A 1P5EA 1TQMA 4OT5A 1HCLA 3S0OA 4RJ4A 2JBOA 5DHJA 4QP4A 3U9CA 4BDJA 2W1HA 2F2UA 2WAJA 5CWZA 1KE6A 1PY5A 2REIA 5E8ZA 2BZHB 2R3GA 4HVHA 1IAJA 2R5TA 3O8PA 2C6IA 5HCZA 4G3GA 2EVAA 2WFYA 5E1EA 4Q5EA 4IZYA 4LI5A 4QPMA 4BI1A 4RLKA 4II5A 2YIWA 5T68A 4M68A 1TQPA 2C4GA 3S3IA 4AE6A 5M44A 3TNQB 4RA5A 4E3CA 4M69B 2BTSA 2JFLA 2ZJWA 4O0YA 4P2KA 5M08A 2JIUA 1QPJA 3MY0A 4AOTA 2B9HA 2VWIA 2HZ0A 4L43A 3ORIA 5J79A 1KV1A 1S9JA 2BZJA 2BZKB 2XIRA 3RCDA 4LYNA 4CMOA 1P2AA 4TYHA 1YOLA 2YHVA 2V7OA 5C4KA 2B55A 2ZDTA 1ND4A 2LGCA 3PPJA 1MP8A 3EFLA 2VTRA 4BDBA 1QMZA 3F2NA 5AM7A 3EQIA 4HVSA 4O0VA 4FTCA 4F7JA 2BRNA 3EWHA 5HIDA 4NU1A 4D0XA 4L67A 4JDIA 2WU6A 4EEVA 4IWOA 3WZDA 2DUVA 4KBKA 4HNIA 4CT1A 4CKJA 2R3FA 2BCJA 4E7WA 2EXCX 3H0YA 1ATPE 4CRSA 1FMKA 4IIRA 4RG0A 4C3FA 4C62A 4G34A 1M52A 3F2RA 4FKIA 1M17A 4MD9E 2QOHA 4XG7A 4D5KA 5J87A 3KQ7A 4KIQA 4BZDA 3OT8A 3RWPA 2J6MA 4BDEA 5JQ8A 5LVPA 3IKAA 3DQWA 5C03A 3VS5A 5ITAA 4CGAA 2PVNA 2O3PA 4KKEA 3FWQA 4BCHA 2C5OA 5HE3A 2X81A 1S9IA 3L8SA 4HCVA 4GYIA 4OGRA 2WMWA 3TL8A 4L3PA 2J0MB 2BKZA 3O7LD 5BVOA 4OBQA 2CLQA 3IPHA 5KMKA 4L3JA 3COIA 4FNZA 4O22A 3A99A 3GBZA 4U44A 5GHVA 2ZYBA 4FV2A 2Z7RA 4IE9A 3LFSA 3PA5A 4CD0A 1JBPE 5FLFA 2YM5A 2BDJA 5H9BA 3WE4A 4L01A 4PY1A 2BROA 3PSCA 3FLWA 1UU9A 4FKWA 4FTJA 1X8BA 3U6IA 3TIZA 4BHZA 4FEQA 2XKEA 1CTPE 4L68A 1PXNA 2W7XA 4U41A 3KF7A 4JDJA 1Y6AA 5IUIA 4FOCA 2JAMA 5AUVA 4M66A 4FV1A 2VGPA 3POOA 5CSWA 3R7IA 2GNGA 3TDWA 4CZTA 4USDA 1ERKA 4IJPA 3BLRA 4U7ZA 4YPDA 4A4XA 4BWKA 4Y72A 2G01A 2WNTA 4JR7A 4IAIA 1E1VA 3FY0A 3Q04A 3P86A 5DT0A 5EYCA 3RTPA 4UYNA 3QHRA 4H36A 4QMPA 4UXLA 1Y57A 3C4XA 3ODYX 4YUQA 3F3WA 1M7NA 4ZMEA 4C59A 4JRNA 4UZHA 3JPVA 4JLCA 3Q9ZA 4HZSA 3R9RA 3FKOA 4H39A 2OZOA 4IAZA 1FVRA 2YA9A 5L2SA 3MVHA 4QPSA 4G5JA 3M1SA 2WGJA 1U46A 1PMVA 3FUPA 3Q9XA 4O38A 3OW4A 4BVUA 1WAKA 2WD1A 3TG1A 3ZSIA 4ZSJA 2CHLA 2VAGA 3R2YA 3UQGA 3ZONA 4FIEA 5DRBA 4AN3A 4EHZA 5FEEA 3BWFA 2EWAA 3ZO2A 3C50A 3DBEA 3NW5A 4EZ5A 3FLNC 4JBPA 4QMMA 3FMHA 4UMQA 3COHA 1IA9A 3ZOSA 4ACCA 4OTDA 2W06A 4MQ2A 4B8LA 2HCKA 2BIYA 5IMEA 3TIYA 4QTEA 2XEZA 2HY81 4DF3A 4CSVA 4L45A 2P33A 2IW9A 3VS0A 2XYNA 2PY3A 1Y6BA 4HYHA 4I4FA 4C58A 4RGJA 2CKQA 4FIGA 3EL7A 4XYFA 3DB8A 3GFEA 4KWPA 4LG4A 4PDYA 5J1VA 1YWRA 3KULB 2WQOA 3PFQA 1Q97A 4JR3A 4MWIA 3LW0A 5C4LA 2JDTA 4NM3A 1H07A 2WTDA 3MSSA 4E26A 4E6CA 3T9IA 2ITPA 2SRCA 4EOJA 1KWPA 4O86A 3EQBA 5CAOA 1H01A 1U4DA 4H1JA 3UMXA 2XKFA 3NYVA 2VZ6A 2YABA 1FQ1B 3ACJA 3D0EA 4IM0A 4JDHA 4BIBA 2OJJA 3JS2A 1JQHA 2GMXA 4RLLA 5AV4A 4QMOA 4X3FC 2G2HA 3LXPA 3PJ1A 2OFVA 4FODA 2QD9A 4V05A 1V0PA 2R4BA 2PMNX 4NTSA 3DBFA 4TYIA 2UZDA 3VUDA 3WARA 2Z02A 4QPAA 4AT5A 2VWYA 1B6CB 4EOQA 3V51A 4DG2E 1BUHA 4U3ZA 4YMJA 3F5PA 4D4SA 4MVFA 2CGXA 4DYMA 3QTIA 5JH6A 5I9ZA 4FOBA 3UYTA 3JXWA 1L3RE 3FLZA 3JVRA 1J91A 1MQBA 4FT7A 4QTAA 4FE2A 3PRFA 4FTOA 4ZY4A 4NM0A 1GIHA 4C4FA 2ITQA 5AIRA 4FZFB 2Y6MA 4PPBA 4QNYA 3ZS5A 5ACBC 5H8EA 4M69A 4BL1A 2WKMA 5HEZA 2IVSA 2X7OA 3QCYA 2PVYA 4ITJA 5IUGA 4JXFA 4FSYA 4YO6A 1OL2A 3LZBA 1Y91A 5C26A 5LWNA 2GNHA 2GQGA 3CE3A 3E92A 3FDNA 4FKGA 4DFBA 1WVYA 4GW8A 4DEIA 2RFSA 4DEAA 1XH5A 3Q9WA 3QZHA 4O21A 4GK3A 3UO4A 2QOLA 2E9PA 5GJDA 1WBOA 3OVVA 4FKQA 2ITZA 3ZTXA 3QTUA 4H58A 2UZOA 4C34A 4MNEB 4QP1A 4QQJA 4TZRA 1FPUA 4YGAA 4EKLA 5IMXA 4XG3A 5EOBA 2FGIA 2V22A 2C47A 3EZVA 4N4SA 2YAKA 3BIZA 4UWBA 2WTJA 3D94A 3NYXA 5DEWA 2UW6A 3ENMA 4TY1A 3VUTA 2XVDA 5GIOE 4ZK5A 4KRDA 2P4IA 4GH2A 4O0UA 2UZWE 3CPBA 4CNHA 2HELA 5M57A 4FKSA 4D9TA 4CFMA 3UIBA 1H27A 1YI4A 4CRLA 4O1OA 3UQCA 2V55A 4ANSA 4FKLA 5LCJA 2QOBA 2PYWA 1Q8UA 1OKZA 3PDTA 4FIFA 2PL0A 5C27A 5HBHA 2FB8A 4KIOA 5J7HA 4IWPA 4I6HA 4J8MA 4L6QA 1CKJA 3IW7A 3MS9A 3Q5IA 3MB6A 4IXPA 3OUKA 5JGDA 2PUIA 2C3KA 3KB7A 5JKGA 1KOBA 3EB0A 2VNYA 3CJGA 5CAUA 1BL7A 1UA2A 3SXSA 2JDVA 1YHVA 2BHHA 1QCFA 4M0YA 1UKIA 4M13A 4R3PA 5CVHA 2BRGA 4JX7A 4AFJA 3SA0A 4O83A 4BDAA 2FYSA 4FC0A 4TYEA 3UP7A 1OM1A 4FT0A 3PY0A 4C37A 4AAAA 5J7BA 2Y7JA 2IW6A 3MPAA 1OVEA 1PMNA 4ID7A 4R7HA 4Q5HA 3GNIB 2X9EA 5HNGA 4H3QA 3N4TA 1ZOGA 1OGUA 1U54A 3NNUA 3H0ZA 4A4OA 4DFUA 2JITA 1I44A 4EK6A 3EFWA 3R71A 3PXFA 5A6NA 2PZ5A 4YJVA 3SGCA 2DWBA 1XO2B 4RJ5A 5HVYA 3W2SA 3DZOA 4G6NA 3VUMA 4ZZOA 4RBLA 3PIYA 5LQFA 1BX6A 3EIDA 5CSVA 3DKFA 3PYYA 3PP1A 2PMIA 4DFNA 3QA0A 4IADA 3ZHPC 3G2FA 4H3PA 1OL1A 3NIZA 3P23A 3BLHA 4J97A 1ZZLA 3G9NA 3LXKA 3VQHA 5IEXA 5H3QA 3I6WA 3S4QA 4RQVA 4O27B 3KCFA 1O6KA 3LMGA 3ZO1A 2J50A 2VWBA 5D1JA 4WUAA 4UYAA 1H25A 3R1NA 3WF6A 4BC6A 4CYJA 4EH2A 4EQMA 4BY9E 4KAOA 3F2AA 5ANIA 1URWA 4EUUA 5AAFA 3AT2A 4FEWA 2QLUA 4F9CA 1OIQA 2YCSA 3DDQA 3KXGA 4YTHA 3DFCB 1YQJA 4RX5A 4RC2A 2VNWA 4FSTA 3VF9A 4J96A 4BTJA 4GT5A 3MN3A 2OO8X 4I6FA 3KXHA 4DBNA 2IPXA 2QOIA 3GVUA 4JI9A 5EQYA 4YZMA 2OBJA 3C4EA 3ZH8A 4PL5A 4RWKA 5B2LA 3OOMA 1BLXA 4KABA 3GCPA 1UV5A 4XG4A 5AP6A 2XKCA 4YC8A 5IEVA 3QZFA 5CEQA 5J8IA 4QMUA
chains in the Genus database with same CATH superfamily
3E5AA 3PUPA 5LMAA 4BYJA 4DHIB 3JUHA 3BHUA 3NS9A 2W1DA 4ASZA 2YCRA 2PK9A 4BDDA 2VN9A 4FSWA 3QCQA 3BEAA 2A0CX 3M11A 4RIYA 3ULIA 3D7TB 3KRJA 3IECA 2ZM4A 2PE2A 5E90A 5CEKA 5FDPA 3AD4A 4JG8A 2WMBA 4G3EA 4CZYB 3KY2A 4XOYA 5L8JA 3V8TA 5F9EA 5K5XA 2CCHA 5HVKA 2AC3A 4I0TA 2XJ0A 3QKKA 4AWIA 2RFEA 4DCAA 4MQ1A 5L2QA 5TO8A 4BYIA 2X4FA 3FHIA 2CMWA 3BWJA 4FSZA 3WZKA 2ITYA 3SG8A 1NXKA 4YJNA 3FXZA 1NVSA 3R01A 3WYYA 4D58A 4UWYA 2OXDA 2A19B 5F94A 4Q9SA 5TF9A 2GHLA 3A7IA 3D83A 3TUDA 2NO3A 3G15A 3OMVA 1OL5A 2XBJA 4FV5A 1JNKA 4JL9A 4X3FB 5A14A 1JAMA 2XZSA 3KRXA 1CSNA 3LCDA 3PRIA 1H24A 4PMTA 2PU8A 2YLEA 3Q4UA 2QOFA 2OKRA 2XRWA 4NFMA 2BRBA 2C68A 3FLSA 4FTRA 4OTPA 4DHFA 3I5ZA 3I60A 5KX8A 5DMZA 1GZKA 1OUYA 2WELA 5CASA 2B9IA 1XWSA 4ZJIA 5KMOA 2CGVA 1Q24A 4MCVA 2BAQA 2O8YA 3M42A 3MV5A 4IW0A 5C8MA 3V8WA 5JFWA 3HRBA 4BDCA 4WG5A 4C2VA 2E9UA 4FGBA 3LHJA 2I1MA 3PG1A 3KK9A 4XBUA 4LL0A 5CT7A 4ZTSA 5AV1A 2CCIA 5AP4A 3BGPA 4FI1A 4NW6A 2VTJA 3FQSA 1XH7A 3ATTA 1SVGA 2CGWA 3F7ZA 2FO0A 2OJFE 4EYMA 5IZFA 3CQUA 3LFQA 2PMLX 4W4WA 5CAPA 4LV7A 2WQBA 4D1ZA 3IDBA 4RJ7A 2BIKB 2VTQA 3AMAA 3R7UA 3LQ3A 3UDSA 1VEBA 3ZLSA 3II5A 4RJ6A 3WBLA 4CMTA 5HU9A 4EK3A 2QOCA 1OITA 5KNJA 4OBOA 4I6LA 5G1XA 4RIWA 4ALUA 4BF2A 4OTQA 2XNEA 3TCPA 2OSCA 4EQUA 4S30A 5FEQA 4AX8A 2C1BA 4XOZA 3AKLA 4M84A 4DAWA 4I5MA 3CTHA 5AP1A 2C6OA 2J0KA 1FOTA 4HPTE 2G2FA 4GL9A 5ETCA 5EKOA 1OL7A 3MH1A 5EHOA 3EJ1A 2UW3A 3DDPA 4UMTA 3I4BA 5ICPA 1G8KA 3JR1A 2XYUA 3A7JA 3R8MA 1JKKA 1JSUA 3IGOA 3PJ3A 3AMBA 3RI1A 5ETAA 5HTBA 4BIEA 2QKWB 5GJFA 3RZFA 4YC3A 2GNLA 2WO6A 2EB2A 3L9PA 3P7AA 4IAAA 4U97A 3CCNA 3QX4A 4F99A 4YJTA 3SVVA 2IN6A 4WBBB 1STCE 1GOLA 4W8DA 5FDXA 4BTKA 3E3BX 3RK5A 4DEDA 4N57A 4C02A 1LUFA 2VWUA 2WTIA 3QC4A 4QP6A 5I5ZA 4XP0A 3PJ2A 4QTBA 3V5WA 4AT4A 4FSQA 2BFXA 3QYWA 4XLVA 3FMDA 3HZTA 5F20A 3VW6A 2RFNA 5EW3A 4FG9A 4GFOA 5E1SA 3SKCA 3RAIA 4RFMA 3OWLA 3MJ2A 4P90A 1M2QA 3NR9A 2VO7A 1MRYA 3GU5A 2PZYA 3IW4A 4L3LA 5HE1A 3R8VA 4IJ9A 4FTMA 5HLWA 3EQHA 3VC4A 2OW3A 4GJ2A 5KMMA 2GQRA 4ENXA 2F2CB 1V0BA 3DY7A 4F78A 3G9LX 4R5SA 2XA4A 3ZXTA 2V62A 3HEGA 3LFCA 3OTVA 5BMMA 1W98A 4H05A 3PXRA 3JVSA 3NRMA 4BR3A 2J90A 2HXQA 5CF4A 2ACXA 4RIXB 5BNJA 3K54A 2AYPA 3A7FA 3BZ3A 2WQMA 3DAJA 4FK3A 3GC0A 4E6AA 2B4SB 2GCDA 4U80A 4AZWA 3HP5A 4R3RA 4EBVA 3PSBA 3PLAE 3G0EA 5K4IA 1B39A 4PMSA 4BCFA 4I6BA 5A6OA 5JZJA 4GK2A 5B7VA 2VX0A 4MYGA 3FY2A 3A61A 1TQIA 3N4UA 1KE9A 4RT7A 4IBMA 4O0WA 2BFYA 4OTGA 4ZLOA 1T45A 4FT9A 4IH8A 3L8PA 3RPYA 4PNKA 4RVTA 4QMQA 5A9UA 4FSNA 3KN6A 4LGGA 5DH3A 3I5NA 3Q2JA 4K18A 3SC1A 5HG5A 5I3OA 2GNJA 4ZLYA 2XK6A 1KE7A 3W16A 1UU8A 3KXZA 1JSTA 4I0SA 3EYGA 4AACA 3W32A 3VULA 3GOPA 5FM2A 4FJVA 4Y8DA 5HG8A 5M4FA 2YJSA 4EH8A 1XQZA 5FXRA 1ZY5A 2PVHA 3ELJA 5M55A 1RQQA 2OIDA 3ENHA 3RVGA 1IA8A 3KXXA 3MB7A 4KIKA 2W0JA 3HECA 4MD7E 4NSTA 3P9JA 4QQCA 5BVFA 5KCVA 4PDSA 3D9VA 3TXOA 4TKSA 3TN8A 3VS3A 2H9VA 5HORA 3Q4TA 4HVDA 4DEEA 3F2RA 1YOJA 4O0XA 3RK7A 5BVWA 2F7XE 3ZC6A 4BDKA 3CEKA 4WSQA 4YZBA 1UWJA 3FI4A 3HV6A 2O0UA 2UZEA 3VUIA 5GNKA 4CFFA 2PVKA 1Q8ZA 3ZFYA 4AGWA 3QC9A 5BYYA 4QMSA 3GI3A 3U51A 1VJYA 4ZTHA 4CT2A 2HZIA 3MPMA 1KE5A 4KB8A 5D7VA 4E5BA 2UW5A 4BCKA 4IVAA 4EK8A 1YDSE 1VLRA 2R3MA 4G3CA 3ORLA 4JOAA 3RBWA 1K3AA 3NIEA 4EH5A 3S2PA 3BU3A 3BQRA 3KKVA 4OTFA 4J1RA 4QMZA 4CG9A 1R39A 3ORTA 5AP2A 4RSSA 4NFNA 1SVEA 3S1HA 4FG7A 1WBVA 4WA9A 5K5NA 3TDVA 3WOWA 4D9UA 5DLSA 4ASDA 1WBTA 3DK6A 4TT7A 3FQEA 2PZRA 3JYAA 3ZEPA 4DDIA 1PXKA 5IQGA 1LP4A 1PXIA 4Z7HA 5KO1A 1PRYA 3QX2A 4C4EA 2WIHA 4W8EA 3UDBA 4QQTA 5FG8A 2YERA 2VX1A 5JN2A 4UX9A 5GINE 3OT3A 4K77A 2VTLA 3H9RA 3TV6A 4GEOA 4G1WA 5B2KA 3R83A 4GRBA 3U4WA 2QURA 3GP0A 4RZWA 2ETMA 4QP7A 2ETKA 4FK6A 3QQLA 4WIHA 2XCHA 3H30A 4YSJA 2ZV8A 2XAOA 4MKCA 3L9LA 4AS0A 3UQFA 3BLAA 3V6SA 3LE6A 5EH0A 4ALVA 3A7HA 1MQ4A 3ZZWA 4FKPA 5HIEA 1HCKA 2QHMA 5HTIA 4BI2A 5D7AA 3HLLA 4J99A 1VZOA 2W17A 3IO7A 3HRCA 3UMWA 3R00A 4JNWA 5M06A 3IW6A 3NSZA 4MF1A 3VHKA 4DEGA 5E8VA 5TR6A 3QKMA 4HGLA 4ZTRA 2UZTA 2GDOA 4FZ7A 3AD6A 2CLXA 4F7SA 2ITWA 3HDNA 2C5XA 4DE4A 3IK3A 4HNFA 3NZ0A 3U9NA 4ACHA 3C5UA 2G9XA 2Y4PA 1YWVA 2W05A 4QRCA 3ZXZA 1DI8A 5ACKA 4CVAA 3CY3A 3E8CA 3R04A 1FGIA 4QMNA 4NL0A 4O7LA 2OXXA 5FD2A 3FMEA 4UWCA 2OJGA 5EDRA 3SRVB 3U4UA 4QYFA 4P7EA 3W2RA 4BBEA 3TZ7A 1OPLA 3PXQA 3QRJA 4UZDA 3E63A 1REJA 1OPKA 2XRUA 1TKIA 4GK4A 1XH6A 2J5FA 5FBNC 4IQ6A 1JKTA 3NNXA 5AP3A 5IKWA 2VX3A 3TTIA 3MGYA 3B2TA 3UVRA 5AX3A 5CAVA 1Q41A 2J0IA 4TPTA 2ZM3A 4Y95A 4FTIA 3OOGA 5LOHA 3ORPA 3F5UA 3D7ZA 3IOKA 2BMCA 2Z60A 3MFTA 2R3LA 3IQ7A 2QU6A 4RVLA 4XUFA 2DS1A 1XR1A 5TE0A 2A2AA 5KKRB 4IDTA 3U6JA 1QL6A 4K2RA 2C0TA 4W4YA 4LMUA 4D2WA 4RVKA 3OROA 4KBCA 2CN8A 5C9CA 4DC2A 5ANKA 4F9YA 3FPQA 4DLIA 3NX8A 5EHYA 4F70A 2UZBA 4AXEA 1YHWA 2IJMA 4V0GB 3TEIA 3QWKA 2VTMA 3O96A 1FVVA 2JD5A 4I0RA 2QG5A 3R7OA 2RF9A 3W0SA 4F9WA 1WVWA 4O6LA 3SOAA 4DGOA 1A06A 2JDRA 3NUAA 4BGQA 2H8HA 2W1EA 3TNIA 5CSPA 3ZMMA 3LKMA 1F3MC 4APCA 1IR3A 2IZUA 3BBWA 3QTXA 4RWLA 2KTYA 3ULZA 5F1ZA 4O7WA 4DH1A 2YDJA 3BQCA 5TT7A 3QAME 4AF3A 2XIYA 2CKPA 4C36A 3D14A 4NTTA 3AGLA 2HOGA 1SM2A 5CXHA 3C0HA 5CYIA 4F4PA 3WI6A 1IEPA 4LMNA 1NW1A 2YDIA 1Q62A 2O63A 4CCUA 3QTWA 4FA2A 4KRCA 3RPSA 3F3UA 4FVRA 3AC2A 5IH4A 3OWJA 3HKOA 3Q6WA 3R30A 4PTCA 4PDPA 3ERKA 4Z7GA 3QQGA 3VS6A 4H3BA 5D11A 3BE2A 4EOKA 1H1RA 1ZYSA 5AP5A 5EYMA 3EN9A 3RMFA 2RKUA 4AU8A 5FP6A 1AGWA 4MBIA 1PXOA 2C69A 3DBCA 3MYGA 2ZVAA 3NNVA 2UZVA 4LRJA 4PL3A 5E4HA 2YWPA 3PVGA 3TMOA 4WKQA 3QRUA 4RA4A 2WMAA 3EN4A 3SXFA 5ANGA 4RX7A 4X2GA 4ZOGA 4BCOA 3UO6A 4GVAA 4E5WA 2KULA 4DFYA 5BVNA 5L2IA 3SDJA 5J5TA 3HMNA 2V0DA 2Y4IC 5EDQA 4Z16A 3EN5A 3FSKA 1PF8A 3ZUUA 4BWPA 5J9LA 4LDTA 4D55A 5HKMA 1GZOA 3DKGA 3PTGA 1CMKE 2F9GA 3DA6A 3BGQA 3VIDA 3D2IA 4I5CA 2WQEA 3HV7A 1HOWA 4ACDA 4AA5A 4D4VA 5IPJA 2HK5A 4IACA 2F7EE 4IB0A 1YHSA 3HA8A 5LCKA 5L8KA 3UZRA 4PP9A 4XP2A 4LUDA 3SOCA 4ZIMA 3GGFA 3ROYA 4FNXA 4NJDA 2R3OA 1YI3A 4QYGA 4LGHA 1ZLTA 4BIDA 5L8LA 1FBNA 2XB7A 3FL4A 4UY9A 2R9SA 4JQ7A 5E8SA 4BCJA 4L44A 4QD6A 3UZPA 1OKVA 2XNNA 4PF4A 1UNHA 3V5JA 3HYHA 4AXDA 1XMLA 3COKA 4APPA 4ORKA 4S2ZA 3HV3A 2GS2A 4RJ3A 5AUUA 5CF8A 3RCJA 3VUKA 1T46A 4S32A 4KS8A 3KU2A 5H8BA 4YLLA 2ITVA 5CEIA 4M0ZA 5K9IA 5M53A 1G5SA 3G51A 3NMUF 4OLIA 3BL7A 5I0BA 2X7GA 3OF0A 3MTLA 2Q0BA 3BHTA 3RGFA 5C1QB 3TT0A 3DJ7A 1DI9A 4JBOA 3A2CA 2OG8A 3POZA 4HCTA 4CXAA 2J7TA 3O71A 3UIMA 4NCTC 3MA6A 3GUBA 3LCOA 5JFXA 3FI8A 2C5NA 1UU7A 4DGMA 4YP8A 3VW8A 2VGOA 5AUXA 4DG3E 1LR4A 4TWCA 2WHBA 4D2TA 5EG3A 4GU6A 4A07A 3V5TA 4XV9A 2PZIA 5HU3A 5I9XA 2I7QA 5M4UA 3OY3A 1QPDA 5CT0A 3MY1A 3BHYA 4KBAA 4AXAA 3JY0A 3EKNA 4I23A 3WF8A 4CTBA 4EH4A 2F7ZE 3BYUA 5AA8A 3WZJA 1G8AA 2A4LA 4PTEA 3QTSA 1BKXA 2V7AA 4YJUA 3UVPA 3LFEA 3NDMA 3MFSA 5LARA 1W2FA 2ONLC 3GEQA 3O2MA 4XX9A 3TI1A 1R3CA 4BCQA 4F0IA 4V04A 3NVKI 3FC2A 5CSXA 3KIOC 4ANOA 2OH0E 3Q4ZA 3NFGB 2Q0NA 4BJJB 3QQJA 1DS5A 5ETIA 3W2PA 5AIKA 5IF1A 3PWDA 4E4LA 4WT6A 5HE0A 2X8DA 4G9RA 4AT3A 2YIYA 2YAAA 3PSDA 3BEGA 2QO7A 2VWWA 3UODA 1REKA 3UOHA 3AXWA 3OW3A 3PIZA 2J51A 4E73A 3GB2A 1H00A 5EHLA 3RM7A 4A7CA 3UO5A 4F1TA 4F6WA 1J3HA 1GIIA 1WMKA 1H1QA 2OZAB 4FKTA 4R6VA 1SVHA 2BHEA 3F5GA 3R8UA 4EOIA 4DTKA 5HD7A 4EOPA 4EBWA 2CJMA 3KF4A 2EXMA 3R7GA 2WOTA 2CNUA 4HVIA 2J5EA 4IX5A 3A8XA 3NCZA 1ST0A 3ANRA 2Q83A 4AZSA 4DGGA 4I24A 1J1CA 3V5LA 2W5AA 3R8PA 5J95A 2R3PA 4YZ9A 4BRXA 4NM7A 4IWQA 4EHEA 2XIZA 3QGWA 1H4LA 4U6RA 4X2KA 3UOKA 5M07A 5HNBA 4FG8A 4FT3A 4MNFA 1R0PA 4IC8A 4BN1A 3FXWA 4XLIA 4B6LA 2YDKA 4MTAA 4HGTA 2F49A 5AUWA 3SXRA 5EFQA 4C38A 4EZ3A 3P5KA 4O0RA 4J98A 5HCXA 3VBYA 3ZEWA 2PUNA 1XH8A 3HV5A 3PP0A 1UKHA 4YNOA 5HI2A 4XG6A 3ZDUA 2QONA 2I0YA 4Z3VA 1RE8A 1ZMWA 2BILB 4QNAA 2BTRA 5IQBA 4RQKA 2YZAA 2YM4A 4ASXA 2FSMX 4S33A 4R78A 1OIUA 3V5PA 1YWNA 2B52A 2XMYA 4XV3A 3CXWA 4DN5A 5I4NA 3W0MA 4JBQA 1FINA 1PW2A 3DPKA 4G3DA 3FI2A 2RSVA 4EKKA 2B0QA 2A98A 4O96A 4A9SA 2ITNA 3NUXA 5HTCA 1Q61A 5DR9A 4QMYA 3E8NA 4GIHA 3LLTA 3TZ9A 3FLYA 4Y46A 5DPVA 2EUFB 3TUCA 2R3KA 1JKLA 4HCUA 4O7TA 3QCSA 1PXJA 2W4OA 4B7TA 1IG1A 5IU2A 4C3PA 5CENA 3WF5A 5A46A 2XF0A 3VS7A 2PUUA 3FMLA 4UXQA 3C0GA 2ZV2A 5CU6A 3BYOA 1UNGA 3V6RA 3EYHA 4WNOA 5K4JA 2I6LA 3QL8A 4WNKA 4E4NA 3CC6A 3MIAA 5HGIA 1OKWA 5I9WA 3ZLXA 5M56A 5ETFA 3RALA 3OCSA 3TV4A 5KMIA 3VONA 5IQFA 4Y73A 3C4WA 4YZCA 2H96A 4EUTA 2B9FA 3DOGA 3LJ0A 3MBLA 4FYNA 3L9NA 4PDOA 4HYSA 3BYMA 2WTVA 3THBA 2OJIA 3LQ8A 2QLQA 2XIXA 2HYYA 3IGGA 3UYSA 4DGNA 4M14A 3CTJA 4MX9A 2OU7A 1UVRA 5A54A 2XS0A 3SG9A 5BPYA 4ZY6A 5A4QA 2UW7A 1G8SA 2WPAA 3C0IA 3KK8A 2QO9A 1H1PA 5EOLA 3SAYA 4CFXA 2O65A 2Y4IB 4BB4A 3V04A 4K1BA 3QKLA 5CU3A 4XEYA 3PIXA 3HAMA 2VWVA 2X1NA 3LVPA 3OXZA 4RMZA 5DFPA 2DYLA 4GUEA 3JY9A 1Z9XA 5LJJA 1M14A 2C6DA 4JJRA 3CLYA 4KA3A 4BFMA 4JX3A 2QOOA 2UW8A 4QYEA 4AOIA 4E1ZA 5DYJA 3UBDA 3CTQA 2FVDA 4X2NA 3EQPA 4W4XA 3ML1A 3HMMA 4H1MA 2Y8OA 3IDPA 4PWNA 1BL6A 4FUXA 1OBDA 4B0GA 2PULA 3HNGA 3IS5A 3UE4A 4ERKA 4ZLZA 3O23A 2YIQA 4O2PA 1ZYCA 4OTRA 4GFGA 4EHGA 4D0WA 1KE8A 3EMGA 3HUCA 4IB5A 3LFFA 2JKKA 4X21A 2X0OA 4PNIA 4USEA 4EWQA 4NEUA 1SMHA 5JFVA 2B7AA 4AW0A 4M15A 1FMOE 2RIOA 5KMJA 3PVUA 4R7BA 4RJ8A 2E2BA 2Z8CA 3MFRA 2Y6OA 5JQ5A 5IQEA 2R3HA 3FV8A 3UIUA 1ZOEA 2HW6A 5GZAA 1WFCA 3MTFA 4XS2A 5H2UA 2FSLX 3T8OA 5CAQA 3AG9A 3CD3A 5J5SA 3SW7A 4BICA 2Z2WA 4C33A 5IUHA 3MA3A 3NUUA 3RM6A 1Y8GA 3DKOA 3ORMA 4IB3A 2B1PA 5FTGA 3ACKA 4F7NA 3EZRA 4ZAUA 3EFJA 1JSVA 2W1GA 3RINA 5BUIA 2PPQA 1YXTA 3EOCA 1CDKA 3FBVA 5AUYA 1XKKA 2WEVA 3WILA 4EYJA 3OXTA 2WMQA 4FIJA 3HUBA 4D1XA 3D2KA 4F9AA 5KBRA 2YIXA 3O7LB 2GTNA 2JLDA 5E92A 3VN9A 4X3JA 3MIYA 3LJ1A 4ZSLA 1GZ8A 3FAAA 3OXIA 5DG5A 4CFNA 2W5HA 2YM6A 3QCXA 4A9RA 4ENYA 2BDFA 3H4JA 4FBXA 3KULA 1YXUA 1UU3A 2PMOX 2H34A 3BCEA 3BX5A 4ZMFA 2O2UA 4NKSA 5E8YA 4V01A 5HO6A 3ZUTA 4D2VA 5D10A 3RAKA 4J8NA 3QF9A 4MXYA 2XNBA 3O50A 3KMUA 3RAHA 3KXMA 3F7WA 5B2MA 3PG3A 4DHJA 5CY3A 2JKQA 2VTOA 2YITA 2X9FA 2PVRA 3BELA 4WNPA 3MI9A 2X2KA 5AX9A 4F1MA 3TZMA 4ARKA 3U55A 1YKRA 1M2RA 2E9VA 3LXNA 4EH7A 3C5IA 1WBSA 4TWPA 3K5VA 4LFIA 4O7ZA 3R7VA 3EQDA 3OEFX 4XRJA 3E87A 1DAWA 4OW8A 3RP9A 4QP9A 5DA3A 4RVMA 4XCUA 5BMSA 2XK9A 4GFMA 4O6EA 3NW7A 3I1AA 5LMBA 3PA4A 3ZYAA 4J53A 3A7GA 3QXPA 1XBAA 4NIFB 4BWXA 4IM3A 3KRWA 2XUUA 5JGAA 4FIIA 4RZVA 4ITHA 3PZEA 2F4JA 2I40A 4KD1A 4YSMA 3AKJA 4M7IA 1O6YA 2OF4A 3LQ5A 3S00A 5DWRA 2YM8A 1UNLA 4FVPA 3DZQA 4AAYA 5EW9A 5BYZA 2OJ9A 2W99B 3EHAA 3CKXA 2FA2A 2JEDA 3E3PA 3G5DA 4P5ZA 3VWAA 4QP3A 4WUNA 4YU2A 2DQ7X 4LV5A 3T3UA 4O7NA 3BU6A 4G17A 4I6QA 2J0JA 5D12A 2GSFA 4XH6A 5EQEA 4DDGA 4CYIA 5DNRA 3V5QA 2WU7A 4YBJA 4GVJA 2QCSA 2ERKA 3HGKA 3DCVA 4MXOA 4BHNA 1MUOA 2IO6A 3R02A 3E8DA 1JWHA 2IZTA 4IEBA 1PYXA 2PHKA 3KN5A 2AEGA 1YXXA 3PJ8A 3HP2A 4MNEA 4O7YA 4FKJA 3NFFB 5LVLA 4FSRA 4AA0A 5HIBA 5M09A 2ITTA 1BMKA 1VYWA 4QTCA 3FSFA 2J9MA 2X4ZA 3CIKA 3MVMA 1R0EA 3PJCA 1YXVA 3ZC5A 4IWDA 1NVRA 2X8IA 4U5JA 4TYHB 3R9OA 2VO6A 4RWJA 4GV1A 5IDPA 1W8CA 4AN2A 5LWMA 3PPZA 4YJPA 4MUQA 3PZHA 3QGYA 4WO5A 2XJ1A 4AA4A 4ANQA 4F9BA 4UALA 2EXEA 3AT3A 3ID6C 4AZVA 5M51A 4DFLA 5KKRC 2QODA 5B0XA 3FMNA 4IFCA 4M8TA 5HLNA 2PZPA 3P08A 3CGFA 3GQLA 1ZYDA 3R1YA 4I21A 3UC3A 5KUPA 4DFXE 5CZHA 3TACA 5IQAA 4FTNA 3AT4A 4O4EA 1JOWB 4XG2A 1J7LA 5AWMA 4G6OA 2W1FA 4U8ZA 4C2WA 5LMKC 5LVNA 1E1XA 4DGLC 1GIJA 5IA0A 1Z5MA 5C8KA 4FV7A 3I7CA 1RW8A 3NPCA 3HRFA 2CKEA 2W5BA 2X0GA 3R9HA 4ZTLA 2UW0A 1PXPA 3OBJA 5CZIA 3DLSA 3W0RA 2QC6A 3ZBXA 2W1IA 4X2JA 2XBAA 4ANLA 4FL3A 4G9CA 4DA5A 1FGKA 2ZV9A 2XK8A 4QTDA 1YI6A 5CNOA 3VBQA 4C4IA 4C35A 1XH4A 2C6LA 3CP9A 3G6GA 4JVGA 3F3TA 4PX6A 3UGCA 1H28A 5FP5A 2CKOA 3VRYA 4AG8A 3LFNA 5GIPE 4XHKB 3ZLWA 5AV2A 3HA6A 3PVBA 4FIHA 5A4TA 1ZAOA 5AUTA 4FF8A 4RPVA 2ERZE 3ATSA 3CBLA 4J52A 3AC1A 3SV0A 4C4JA 4FV8A 5HO7A 1O6LA 3PE1A 1OECA 3UP2A 2XNMA 1Q8TA 4FZDB 4QDEA 4LL5A 3ZU7A 1IASA 3D15A 3KFAA 3C4CA 4L7SA 4IZ5A 4MXZA 4NWMA 4JIAA 3CQEA 3FPMA 4YZDA 2OICA 3DB6A 5T6KA 3DJ5A 1MRUA 4I20A 5FGKA 2C3IB 1U59A 2JDSA 4K9YA 5GZ9A 3RWQA 4G16A 4B9DA 1E9HA 4CG8A 3P4KA 4ACGA 2ZB0A 3K5UA 3TZ8A 4AGDA 4O1PA 5HNIX 2J2IB 4AGCA 5IA2A 4OBPA 4IX6A 2C5VA 1ZY4A 3QFVA 2OWBA 4GIIA 4C57A 2IF8A 5AV0A 4JG7A 2Y0AA 4JQ8A 4OTHA 5DGZA 3GC8A 4BCNA 4GMYA 3NAXA 3OTUA 3LCTA 2GS6A 4YLKA 1OGYA 4CMUA 4EHVA 2YWVA 4ZTNA 3W10A 5CEMA 5CS6A 4D4YA 1UWHA 3ALNA 3KEXA 3GU8A 4OTWA 4I94A 3RHXA 2G1TA 4UMRA 4U0IA 4FEUA 5AADA 2UW4A 2OF2A 5FRIA 3NYOA 2JGZA 2CGUA 3UJGA 4W4VA 2NPQA 3DQXA 2RG5A 1V0OA 1Q99A 4TWOA 2XK7A 4PUZA 3BRBA 2HIWA 4IX3A 2XEYA 3QZGA 5AMNA 3VHEA 4DFZE 3BE9A 3C4ZA 5JK3A 4BTFA 3FE3A 3COMA 4CKIA 3A60A 1Q8YA 2BAJA 4Q9ZA 3NAYA 3Q9YA 4R77A 3D7TA 2WIPA 3QTRA 5CU4A 5K0KA 4KIPA 4O7SA 3PLSA 3HL7A 4YTCA 4OUCA 1GAGA 3GXLA 3N4VA 3P0MA 3R28A 4IHPA 3QZIA 4G6LA 4BDGA 3QBNA 4EK4A 5EQPA 3FYJX 2ONLA 2YEXA 2QR8A 4Y83A 3UVQA 3ZFMA 2WMVA 2XNPA 3C1XA 3MDYA 1RJBA 2C0IA 2ITUA 3DNEA 4X3FA 4EWHA 4QYYA 4D5HA 3RK9A 2W9FB 4CV8A 5ANJA 3FLQA 4A4LA 3KA0A 4FMQA 3ODZX 5CXZA 5HQ0A 1F5QA 5L4QA 2IVVA 3E7VA 4R1YA 4WOVA 4RX8A 1ZRZA 1WVXA 2HZNA 1BI8A 3MY5A 4HOKA 3FYKX 2P55A 5AFVA 4OAUC 4KKGA 3KMMA 5EI8A 2C6EA 4BGHA 3V8SA 3Q2MA 2PUPA 5JZNA 3ORNA 4FTAA 3GU7A 1PXMA 2OI4X 4F1OA 3PVWA 1LPUA 4Q2AA 4YC6A 2PSQA 4GT4A 5BX0A 4FEVA 1Q8WA 4EOLA 4RRVA 5JFSA 4EC8A 5HESA 1AQ1A 3LM5A 4I5HA 4IC7A 3GCSA 5F4NA 3OCBA 2Y9QA 4J71A 3QU0A 2JC6A 3VRZA 5HBJA 3OCTA 5CF6A 4W9WA 2AC5A 2YCQA 3OD6X 4IX4A 4TYJA 4E6QA 3I7BA 3IG7A 4G2FA 3UNZA 2X6DA 1PKDA 3W8LA 4QP2A 3L1SA 4EQCA 1PMUA 4PMPA 5A4EA 2QG7A 2XARA 4QDVA 5AP7A 3DS6A 3ZSGA 1O9UA 4TYGA 3BGZA 4B99A 2HAKA 2W96B 1Y8YA 3OS3A 4Z55A 2B9JA 3OWPA 2XM8A 3QRTA 3FZTA 3ANQA 3QD3A 2R3JA 4WD5A 3IDCA 5I9YA 4I1ZA 3VO3A 2ZB1A 3W33A 3F3VA 3H9OA 3ZUVA 3LPBA 4CQGA 4USFA 4YO4A 4B4LA 5AM6A 2EB3A 3CJFA 3QLFA 4YJOA 3OHTA 4AW5A 4NM5A 3AKKA 4QQ5A 3ZCLA 2GHMA 3SX9A 3R9DA 3FZSA 3R73A 3D5WA 3DGKA 2YN8A 5CALA 3F82A 5EKNA 4CLJA