4X6QC

An isoform-specific myristylation switch targets riib pka holoenzymes to membranes
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
337
structure length
334
Chain Sequence
b'SVKEFLAKAKEDFLKKWETPSQNTAQLDQFDRIKTLGTGSFGRVMLVKHKESGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVAGGEMFSHLRRIGRFEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFTEF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cAMP-dependent protein kinase type II-beta regulatory subuni
publication title An Isoform-Specific Myristylation Switch Targets Type II PKA Holoenzymes to Membranes.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 103
structure length 334
sequence length 337
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2014-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4x6qC01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4x6qC02
4A4OA 5LVMA 3DGKA 2GNJA 4XBRA 5BVOA 2ONLC 1LEZA 3LXKA 5HG8A 4ANNA 2BFXA 4A9SA 4B4LA 4BDGA 3UOKA 3N4UA 4EOLA 4RC2A 4FTJA 3V51A 1LEWA 2O0UA 4FEQA 2FSLX 2ZV9A 4FT5A 4YJPA 5J5TA 5LWNA 3UIBA 3TKHA 4CD0A 3R7YA 2IPXA 4D4RA 4EHVA 2VTRA 2QU5A 3GOPA 3V8TA 4BDKA 2F2UA 2YIXA 2CGVA 5L2TA 1W82A 4BL1A 2UW3A 2HWPA 4J52A 3DJ6A 3W2RA 3V5JA 5CLPA 1OZ1A 4P90A 5A3XA 4FSQA 1IEPA 4BTJA 4L3LA 3H0ZA 5K3YA 4CKRA 5B0XA 1ZY4A 3LLAA 5LVNA 4IX4A 3JYAA 5GJFA 5DGZA 4NTTA 1LPUA 1OKWA 3QTRA 4AXAA 2IW8A 3W33A 5FRIA 5HIEA 1XBCA 2GTNA 3QCQA 3QD2B 1UU3A 2I1MA 4L44A 3VRZA 1H4LA 2IVUA 3R22A 3VNTA 4DEBA 1PKDA 3CKXA 4EH4A 4RLKA 4BZDA 2W5AA 1PRYA 3UZRA 5C4LA 1VYWA 2I6LA 3PPZA 5CEOA 1Q3DA 3LMIA 4ZS4A 2BAJA 5KNJA 3OHTA 4EH5A 4AZTA 3HA8A 5CALA 3HV7A 1Q24A 2WTIA 3KRRA 4BZOA 5BVEA 4PNKA 1NY3A 2XF0A 1ZOEA 4G3GA 4UEUA 5CU3A 5B2MA 1A48A 5HG9A 4YHFA 3Q96A 4FKQA 2CSNA 3SOAA 2WHBA 4O0YA 3RAIA 4C36A 3HVCA 5HGIA 3FJQE 4P5ZA 3BI6A 5B2KA 2UZOA 3D7ZA 3NUNA 3TJCA 2VTTA 3AG9A 5CENA 1OBGA 5IPJA 3M42A 4FI1A 3FKNA 2CJMA 5CY3A 3OCGA 3DNDA 5KMNA 2I7QA 4FKGA 3VS5A 4RFMA 2PZRA 3KCFA 1XH4A 1PMUA 3L8PA 3RMFA 4CT2A 4ZZNA 3ZXTA 4CSVA 5IA4A 2ZV2A 3I5ZA 3IS5A 2HIWA 2X39A 5HU9A 2GQRA 3DS6A 2VTJA 3R1SA 3TCPA 4J97A 3IK3A 3PIZA 2B53A 4IMYA 3VBVA 2PVFA 2ZAZA 4YGAA 3U4WA 2AUHA 4C8BA 3ET7A 4F9AA 3PY0A 4UB7A 1OGUA 4KS8A 3DXPA 4FV3A 4QTBA 2JAVA 2E2BA 4PL4A 2UVXA 5A54A 2B0QA 3QQHA 4GYGA 3GGFA 3A4PA 2OH0E 2XYNA 3TUBA 2Y6MA 2CKOA 2WMAA 4I41A 2W9ZB 3BCEA 1QPDA 2EXMA 5AP4A 5FXRA 5KO1A 3EOCA 3ZUVA 4DITA 2J0KA 4S31A 2VWUA 4EC9A 1P14A 4L7SA 5A4EA 3FLSA 5AMNA 1KV1A 3MVLA 4RVMA 4EOMA 1YWRA 3GXLA 3LFSA 2VD5A 3KGAA 4CNHA 3MFTA 2EB3A 4IVCA 3ZHPC 4A9YA 2I0YA 1IASA 4AG8A 3RHXA 4R3CA 2OJGA 4YZNA 3NNUA 5JZJA 2H6DA 5LVOA 1YDRE 3C4XA 1OECA 1YKRA 2FUMA 2GNFA 2WOUA 5EM7A 4CVAA 2WB8A 2E9NA 2HW6A 2P4IA 3BLRA 4MF0A 4TWOA 1K2PA 3EZRA 5DT0A 4AN9A 4B7TA 3DLSA 4E4MA 5D9HA 4O7TA 4TYJA 4WSQA 4FZDB 4X2NA 3UQFA 3Q60A 2IVTA 4EH6A 3ZBFA 2JIIA 5AA9A 2XRWA 5BUEA 4HZRA 1O6LA 3GNIB 1XKKA 1YI3A 4GK3A 3NUSA 2W5HA 5M09A 3C4FA 2QHMA 4FIHA 4JOAA 2VNWA 1UU7A 4RBLA 4QTAA 3SXFA 1WBNA 3I7BA 3KXNA 2ESMA 3MY5A 4AE6A 4RWIA 5EK7A 4XG3A 5KMOA 4S33A 2UZDA 2BILB 2WU7A 3FHIA 3TG1A 3U6HA 4NK9A 4QMNA 2YZLA 3QGWA 1STCE 4BZNA 5M51A 3QAME 4RZVA 4EK3A 4BBMA 4XBUA 3ZDUA 4KBAA 4B99A 4UY9A 1DAYA 1GNGA 4BIEA 2C6OA 4K6ZA 4AX8A 2UVYA 2V62A 4DBNA 3G51A 3FKLA 1CKPA 3LCDA 3WZKA 3V01A 4CYIA 3P0MA 4RIYA 4R5SA 2C5OA 4YTHA 3D94A 5HD7A 4YJOA 3R9HA 4DC2A 3I7CA 4M0YA 5I9UA 5C8NA 4FTQA 1YI4A 3C4WA 2R0UA 4MBIA 4GJ2A 2UW4A 3O7LB 5CAUA 3CXWA 2B7AA 2C47A 3EHAA 1T46A 4R3PA 4CG8A 2R9SA 4O91A 2J4ZA 2WMBA 3MS9A 4D4YA 5ICPA 2EXCX 3R04A 2Y9QA 1Y6AA 1IRKA 1BKXA 3VS1A 5BVFA 4ACCA 4MXZA 5AA8A 3KRXA 4JNWA 3LKMA 3R8ZA 3WF7A 3GC7A 2JDTA 4IM2A 4O0TA 4O2ZA 3UVQA 3VO3A 3W16A 5CAVA 5HLNA 4AW1A 3DCVA 3NIZA 5CSHA 4ZOGA 1JKLA 4FV5A 4I6HA 3EN5A 4KWPA 3VULA 1ZARA 4BI2A 4F9YA 4M97A 2VX1A 2NRYA 3P86A 4A06A 4D2PA 3M1SA 3TKUA 1J91A 3ENMA 3ZFMA 3FLWA 3QRJA 4ZLOA 2IJMA 2QKRA 5DOSA 3ZONA 3N9XA 4ASEA 5BMSA 3VJNA 2Z7SA 3C5IA 4F1MA 2YLEA 4Z3VA 4QNAA 3QF9A 3MIYA 3P9JA 4TKSA 1JKTA 4PMMA 4FIJA 2X2KA 3DLZA 4OTIA 1S9IA 1JQHA 2OIDA 3EQIA 5KX8A 4YLLA 2C68A 1H1PA 4GFMA 4BDJA 5IQFA 4CFVA 4R1YA 4FG9A 5DIAA 3QD3A 4CFFA 2R3OA 4YHJA 5TF9A 4U5JA 1V0BA 2J5EA 2HY0A 4Y95A 3OOMA 4XS2A 4FOCA 2PVLA 5L8JA 4HVDA 3KXXA 2V22A 3SXSA 2Z60A 4KKEA 4IVAA 2W06A 4MQ2A 5L6OA 5J1VA 2ITXA 1BMKA 3P4KA 4I0RA 4RG0A 3ZUUA 4I23A 5HEZA 4PMPA 4PPBA 5H8EA 2YIYA 4H39A 5G6VA 3SLSA 2J9MA 4RIWB 2BAQA 5EHOA 5FM3A 3NYXA 1JSTA 3KXMA 4DFBA 3S4QA 4IADA 4K33A 4AQCA 3UPZA 4L67A 2E9VA 2IN6A 2ZM4A 3PPKA 3DK7A 3FY2A 5FTQA 4EEVA 3AT3A 2F57A 4IHPA 3V3VA 4WG3A 5M4UA 4G3FA 4R77A 4FZFB 1ZY5A 4ASXA 3TM0A 3TNIA 5IA2A 1IA9A 1OL5A 4JLCA 3NDMA 3PJ8A 3TNPC 5E8VA 5KKRB 3ORMA 3VF8A 4YC8A 1M14A 1K3AA 2XNOA 2X7FA 2XEZA 3B8QA 5ETAA 3MESA 1MRUA 3DT1A 1RQQA 2O65A 2R5TA 4H05A 3DK3A 4QPSA 2ITQA 5EHYA 3GCUA 4K1BA 3NNXA 4ASZA 3GU5A 4EZ7A 2B54A 3TKIA 4O7YA 4AGWA 3PLAE 2WNTA 1GIHA 4R5YA 4YBKA 3BELA 2R7IA 3QU0A 3BBTB 4HGEA 4WBOA 2VAGA 3PXZA 4H58A 2Y7JA 2X7OA 2C6DA 2GS7A 4RA4A 4QMPA 2E9PA 3VN9A 2ZOQA 4RVTA 1YXSA 4G9RA 3DJ7A 3RM6A 4DLJA 4G3EA 5M53A 3D9VA 2BRBA 1WCCA 4RVKA 5EM6A 2G2HA 4ZIMA 2O2UA 4ACGA 2BRGA 2PUNA 2O8YA 4APPA 2RKUA 2PVMA 3LCOA 5C9CA 5M56A 2PMLX 1JNKA 5ANJA 4GK2A 4MWIA 5EG3A 4DH5A 4HYHA 3ZLSA 4QMYA 3UOJA 4TRLA 4GSBA 3E8CA 2YCRA 5HBEA 4PPCA 4Y5QA 2QQ7A 2QHNA 3E8EA 4X3FB 1TKIA 4JDIA 5CQWA 4DGMA 3IG7A 4J8NA 4Q9SA 4FVPA 3D5VA 4QQJA 1OIQA 1QMZA 5HG5A 3TV4A 5KHXA 3GP0A 5E7RA 3MFRA 3BQCA 3DU8A 3ZM9A 4YZDA 5IMEA 2YCFA 4ORKA 4KIQA 2ITYA 2OW3A 5IEYA 2BHHA 4NT4A 1RW8A 2FSTX 2IZSA 3LM0A 3UYTA 4EHZA 2UZVA 3OTUA 5CVFA 4MD9E 5TT7A 4RJ4A 3MH0A 2VWBA 3FLYA 3RI1A 1YQJA 4U7ZA 3KULB 3TN8A 4E26A 4QMOA 5E91A 1RE8A 2PSQA 4YSMA 5T68A 3CJGA 3R7UA 3RM7A 3E93A 3RAWA 4AN3A 4OBPA 3A99A 2A1AB 4BDEA 4CFNA 3GFWA 3LM5A 4F0FA 1PJKA 5A14A 2B52A 3D2IA 4FKJA 3UVPA 4YZ9A 3NW5A 4XG4A 4DEEA 5I3RA 4Y83A 3PSCA 4ZMEA 3ZTXA 4EQMA 2W17A 3ZEPA 3GT8A 4GVAA 3FXXA 2IZRA 3VVHA 2VUWA 4F09A 4JDHA 4YR8A 3FMLA 4CFUA 4IWQA 4O84A 3DFAA 2IG7A 3TDWA 4KIOA 1Q62A 3O71A 2OJJA 4AZFA 2C0IA 4R7HA 2VO0A 4TWNA 3PVBA 3EQPA 4U3ZA 4O82A 1WBWA 4FSUA 4IH8A 2CMWA 2WXVA 2XMYA 3ORLA 5EW8A 5HHWA 1OIYA 1U46A 4K2RA 3PXRA 5AV1A 4MEDA 2XNBA 3ZC5A 3SXRA 4XG9A 3CQUA 5TO8A 4BDFA 4HVHA 2WQNA 5IG1A 3R7OA 3P08A 3QRKA 5HNGA 4WNPA 2YABA 3QALE 5C03A 1XJDA 3UDBA 4ANSA 4EKLA 4F1TA 3GQIA 2G1TA 5AUXA 4NUSA 1DS5A 1URCA 3W2QA 5HLWA 2BRNA 3JY9A 5EI2A 2YITA 4WUNA 1AQ1A 2ITWA 1Z9XA 4DGGA 5HI2A 2P3GX 5HE2A 2QOOA 1KV2A 5K4JA 2GMXA 2ZB1A 5F94A 3D15A 2XRUA 2GU8A 4NCTC 4ACMA 3R7VA 4FT0A 3KMUA 4PMTA 1KSWA 1OKYA 1CSNA 4JT3A 4ZMFA 1T45A 3LVPA 3A4OX 3FZOA 5F9EA 2PUUA 4YUQA 4BBFA 2WIHA 3LLTA 4ZZOA 3S00A 3VS3A 4PRJA 3HP5A 2QG5A 5EDQA 2JIUA 3BHVA 4JQEA 3VUMA 1L3RE 4XRLA 2XEYA 4IC7A 3FXZA 1BLXA 3EN6A 4QYYA 4ZP5A 4FZ7A 4FOBA 3OCSA 4MBLA 3MH2A 3EWHA 4L8MA 5HCXA 4I22A 3VRYA 4ZLZA 5CSVA 1OPLA 4OTQA 4D28A 2X4ZA 1W0XC 2ZJWA 2B4SB 2J2IB 2OBJA 4FNYA 4H1JA 3PP1A 4U0IA 4BICA 5HCZA 4WNOA 4Q5HA 4E7WA 5JQ5A 3BGQA 4O7ZA 2I0EA 4EQUA 2J51A 4PP9A 4C34A 3IO7A 3KA0A 5FD2A 5BYYA 4DTAA 3SG9A 4S34A 3PVWA 5FBNC 1P5EA 4F7NA 1M7QA 3DKFA 1OMWA 5CF4A 3MA3A 3OZ6A 1MQBA 4OGRA 4EQCA 3NRMA 4I3ZA 4NW6A 2C6LA 4BCGA 3S1HA 2V7OA 1JSVA 3O51A 3ID6C 2CCHA 4A9RA 3E7OA 3NGAA 3VQHA 2JDSA 4WSYA 2G15A 1YHWA 2UZBA 3C5UA 2B9IA 3RCDA 5AP1A 4LG4A 4L45A 5EQPA 2P0CA 3QZFA 3R8UA 3VBYA 5IQHA 3PPJA 4YC3A 4I6BA 4Y8DA 2GFSA 4RWKA 4P5QA 3PUPA 2OG8A 3G33A 3QQJA 2JBPA 3ZMMA 5CAPA 1KE6A 1O6KA 2BTSA 3SDJA 4IDTA 2OGVA 1PHKA 3HV5A 3QXOA 4MX9A 1NA7A 3R7EA 5DEYA 3UVRA 4GT5A 4GKHA 4NM7A 2A4LA 2W05A 2Y6OA 3E63A 3E62A 5FGKA 1UNGA 1YHSA 3FMKA 4O21A 3IONA 4WD5A 4GV1A 4QO9A 3F2RA 5CAQA 4U40A 3QFVA 3ZZWA 4EK4A 2PWLA 4ITHA 5KBRA 3TUCA 2YFXA 2RFEA 1PXPA 3QL8A 1Q41A 1ZXEA 3FLQA 5A4QA 5J5SA 4HZSA 2X2LA 3DKCA 3KXHA 4EOSA 3Q4ZA 4ZTMA 2FA2A 3QYZA 4PX6A 3BWFA 2XCKA 4CT1A 4YTCA 4CRSA 5FEDA 2P33A 2R64A 3F5XA 1CKIA 4FTCA 2C5XA 4GG7A 4LYNA 2V5QA 4I20A 3MPTA 4XRJA 5K0XA 2YIWA 3CEKA 4DTKA 4XP2A 1I09A 4EBVA 3UNZA 4DFZE 2B9JA 3OP5A 3CPBA 1H27A 5FTOA 2QOQA 5JGDA 2HY81 5ANOA 4I94A 3MY0A 3ZO1A 5H8BA 4EOPA 4UN0C 2BROA 5HTBA 4FKLA 2BZJA 2GHLA 1OVEA 4XOZA 4F7LA 3JR1A 1UNHA 4L46A 3IQ7A 2AC3A 3FKOA 4HNIA 2FH9A 2VWVA 3VUIA 3Q4UA 3O96A 4BKYA 3LFFA 4NM0A 1ZMWA 1EH4A 3JUHA 4JBVA 3QZIA 2XNEA 4OTDA 3OEFX 2UUEA 2WQOA 3KXZA 4FV6A 3SGCA 3LJ0A 4FTOA 3CY2A 1KE5A 2R7BA 2BZKB 3RBWA 3R9NA 2GNLA 5IQDA 3KU2A 4C2WA 5J9LA 1WBVA 4CRLA 2ZVAA 3HX4A 2YAAA 1IG1A 3QRIA 4FIIA 3HUCA 3TI1A 1SYKA 3ROCA 4BWPA 1PXMA 5KMLA 2A19B 2QG7A 4PL5A 2X8EA 3BKBA 3V8SA 4JJRA 5LARA 4E4LA 3FUPA 5EYKA 1XH9A 3FI2A 2XA4A 4XV2A 5FDXA 3V5LA 2PVNA 2ERKA 4OTWA 5FLFA 1OUKA 3FMJA 4IAZA 4G6LA 5CEIA 4C3PA 3LIJA 3QKLA 4IWOA 4F0GA 3UE4A 3LQ3A 2ITPA 3CY3A 3CBLA 4MQ1A 3LFAA 3RPRA 4QP1A 4BCHA 1J7UA 5DYJA 4I24A 1J3HA 4K11A 1W98A 3EFJA 4MXXA 3T8OA 4I5MA 4FKSA 5EI6A 2F49A 1OL2A 5HCYA 4EC8A 1FVVA 1GZKA 2JKMA 3ODYX 3M2WA 4LGHA 3E3PA 3BYUA 3WILA 3OWJA 3TWJA 4GKIA 2OWBA 4E73A 2OJ9A 4JIAA 3V6RA 5EFQA 2ZDUA 2BZHB 3SW4A 1H1QA 4O0VA 3UIXA 4KAOA 4EOJA 3KL8A 3LAUA 1X8BA 2WTDA 4AZSA 1Q5KA 4O2PA 2HOGA 5AJQA 2BVAA 5L8LA 4DGLC 3PE2A 3FBVA 3I60A 2RFDA 4XEYA 1YI6A 5DFPA 3C4EA 5IU2A 1QCFA 2H96A 3QQUA 4LRKA 4YJVA 3JVRA 3ZRKA 4GIHA 4PDPA 5JN2A 3M11A 2YN8A 4IWDA 3HRBA 4FIEA 2VWZA 4O0SA 5CTPA 4OAVB 2WMTA 5AM7A 2JKKA 3HDNA 4TT7A 3V5WA 4BVUA 3ZO4A 4IVBA 3R8LA 4J7BA 2VTPA 2RG6A 2PVYA 5IZFA 5L2SA 4EH3A 5M55A 5KE0A 4XP3A 2AYPA 3L8XA 4EH9A 5M06A 3BZ3A 2JITA 4P7EA 4WBBB 5BVKA 2YA9A 4B8MA 3C9WA 3KMMA 4IZYA 4WA9A 3VBTA 2XKDA 2W4KA 3QTSA 4DINA 3BE2A 1M2PA 4FTUA 2OKRA 3GENA 3HMPA 3LMGA 4EYJA 5DR2A 4LQMA 4QP3A 3UIUA 4O7SA 4PUZA 3RTPA 3HV3A 1U54B 5IH5A 2YAKA 3Q2MA 5GZ9A 3D5WA 3VBXA 4C58A 3OS3A 4FV1A 3HKOA 2ZMDA 4DCAA 2ACXA 3DY7A 3R02A 2PTKA 4DFUA 2JDOA 4FSYA 3RINA 3AD4A 3PRFA 3Q32A 4BHZA 4IB0A 4ONAA 4BN1A 5AAFA 4S30A 4KKGA 1H0WA 4YTFA 2X81A 5E8WA 3GOKA 3NUXA 4FK6A 3NWWA 4RMZA 3P7AA 3TZMA 4F9WA 3OY1A 4WOVA 4B6LA 3R00A 3UMXA 3RAKA 4HGLA 3RNIA 4FICA 5DLSA 5AWMA 4EK6A 5AUVA 2C5NA 4LGDA 1BYGA 1DM2A 2XJ1A 4L43A 2HAKA 3ORTA 3WIKA 3G9LX 3BU6A 2HZ4A 2EWAA 2XK3A 2ZMCA 3BHHA 4RJ3A 3K5VA 4KA3A 4IFCA 4RIOA 4UALA 3G15A 2QOCA 4NKSA 4F65A 3O7LD 2XZSA 4L53A 3ZSGA 2BR1A 3CE3A 4KIPA 2QR8A 3MBLA 4Z7GA 2HXLA 1XBBA 2VTOA 4CKIA 4ZK5A 3FL5A 4M15A 3HRCA 4ERKA 1OM1A 4HCTA 4O7NA 3BYVA 4GFGA 4CCBA 1PXIA 1KE9A 5ITAA 3U55A 2Z7RA 2R4BA 4LOQA 4UYAA 2R3NA 4XV3A 4TTHB 4I6FA 3P7BA 4GU9A 4MK0A 2WTJA 1H28A 3QZHA 3UO5A 3KVWA 4U9AA 4E1ZA 3TIZA 4II5A 3GVUA 1XH6A 2C6KA 1TVOA 2JAMA 3KXGA 2HCKA 5AM6A 3EFKA 4ZSLA 4FEVA 4PP7A 2E9UA 1A06A 3H10A 4C61A 4ZTSA 3A7GA 2IW6A 4GEOA 2OFUA 2WTCA 3FC2A 2PZIA 4C35A 1H25A 4LFIA 4TNBA 3BQRA 3FMEA 5IISA 3A60A 3GC0A 2ZV8A 4PTEA 2HWOA 3PVUA 4NYEA 2VWWA 4M84A 4ANBA 2O63A 3QKMA 3VS7A 1PF8A 4DH1A 4YURA 1Q8UA 3F69A 3V8WA 4P2KA 2QO2A 2X1NA 4MD7E 2IWIA 3UZPA 2VV9A 3EFWA 4FEXA 1PMEA 3VW6A 5AUWA 5EM5A 5AADA 2FSOX 4WIHA 2W1HA 4CQEA 4UMTA 4DF3A 5JRQA 4FTLA 3DQWA 3QTIA 2FO0A 4HCVA 4ERWA 3O2MA 4LV5A 5HLPA 4IAKA 4RIWA 4HPTE 3WZUA 5JFXA 3FI3A 2BAKA 3OROA 4O38A 3Q9YA 3QD4A 4IAFA 1MRYA 5F95A 3VBWA 5A4CA 2VU3A 5K5NA 1WMKA 5AUZA 1R3CA 1V1KA 3PXKA 4G6OA 3SQQA 2E9OA 4G5JA 2J50A 2VTQA 5CWZA 3RWPA 2OZAA 3WI6A 3DBDA 2WTVA 3WZDA 1VYZA 5DPVA 1GZOA 4GMYA 3FI8A 3GC8A 3N51A 4N6YA 4D1XA 3ELJA 1GAGA 2PK9A 3PZEA 3Q4TA 2RFNA 3CGFA 5J9YA 3NVMB 4A4XA 4BCQA 3NR9A 5TOZA 3CCNA 5CI6A 3LXPA 4EH8A 5ETFA 3F7WA 4FV7A 4A7CA 4MF1A 2GCDA 4XG2A 3NCZA 5GJDA 5H3QA 3VWAA 3ZDIA 3A8WA 5BYZA 1L8TA 4XH6A 3LFQA 4IQ6A 5DWRA 4AZEA 3HMMA 3I0QA 3MN3A 3T3UA 3H9RA 3HGKA 3I81A 1KE8A 4ARKA 1SZMA 5LVPA 4IM3A 2Z7QA 2C0OA 1ZOGA 3H9OA 4YO6A 2ITTA 3CJFA 4FBXA 2Z2WA 4J98A 3C4CA 2EXEA 1PYXA 2R3MA 3QQFA 5HD4A 4EZ5A 3TNQB 4I21A 3OW4A 2CKPA 3IGGA 5A6NA 3IDPA 4O1PA 5EW9A 1YW2A 1ZYJA 2J0IA 3MTFA 4AT4A 3CD8A 4YHTA 1J7IA 1O6YA 3VUTA 3GCPA 5J95A 2JIVA 2WMXA 4YJQA 4CLJA 5CSXA 1YDTE 4M69A 4FK3A 1PXNA 4JG7A 3U6IA 1JVPP 5I5ZA 2W1EA 4CV9A 4L00A 3DBCA 4EONA 5FUTA 4O83A 2F7XE 4GFOA 4Y5HA 4FSWA 4G6NA 1W8CA 4N6ZA 4BBEA 3AMAA 3MSSA 5T3QA 4D5KA 5I9XA 3FEGA 2PY3A 3QCYA 4L3PA 2XM8A 3PFQA 5F20A 4BRXA 4DEHA 1YXTA 3HZTA 3BLQA 3OBJA 4X3FA 5FQDC 3W10A 4C3RA 4GUBA 5I9WA 3NMUF 4X6QC 3TDVA 2XKEA 4HVSA 4BY9E 2XIKA 4A9UA 4ITJA 4BFMA 4AA5A 4BCKA 4DG2E 3ORNA 4JVGA 4EUUA 2C3IB 5AIRA 5DG5A 1YWVA 4NJ3A 4XUFA 4XLVA 5TE0A 3TT0A 3PWDA 3TZ7A 4O6EA 3QZGA 4YLKA 5EOBA 4EYMA 2I0HA 2YWVA 1ZYDA 3U9CA 4NW5A 3KULA 1DI8A 2GPHA 2VZ6A 2ETKA 2XK8A 1WVWA 2Y4PA 3DKGA 4MAOA 2W4JA 4CTBA 5LMKC 4DHFA 2GS2A 2GNGA 2GQGA 3Q2JA 4KRCA 3R73A 4X7QA 4YJRA 4FX3A 4W8EA 2G2IA 5IH6A 1LR4A 3K5UA 4ZXTA 5CEQA 3F3UA 4R6VA 4YTIA 5BMMA 3ZM4A 2ETRA 4IJPA 4ZTLA 2ITOA 3SAYA 4EK8A 2J0LA 1H1RA 4ZSGA 3FZ1A 3NS9A 3ZXZA 5C8KA 3G0EA 2C0TA 4MD8E 3EN9A 5J7HA 4DG0E 5AR4A 3JXWA 4G9CA 3E8DA 3UMWA 4BYJA 3ACKA 4D9TA 4U6RA 4W8DA 3SX9A 4E20A 4EOIA 4ZSAA 5A4LA 2V0DA 4IX6A 3OT8A 4Q5EA 1Q99A 5DR9A 1TQMA 2HENA 3ODZX 5B7VA 3AC8A 3WYYA 4LMUA 3GEQA 3EFLA 5J7BA 3CC6A 3K2LA 3L9PA 2OK1A 2W5BA 5AR5A 3MFSA 2JKQA 4E6CA 4RT7A 2QVSE 4ENXA 5IH4A 4MCVA 3I6UA 3HV6A 3NUUA 4JRNA 3LFBA 4LI5A 4IB3A 5IMXA 4OUCA 3CTHA 1NVQA 1XH7A 4BWXA 1FVTA 2BRMA 4DGNA 4JG8A 4QD6A 3BBWA 3NPCA 2CPKE 2OZAB 3E7VA 4IAAA 4AF3A 3PA4A 3LFCA 3TNWA 5HTCA 4YU2A 2XIYA 3HEGA 3E87A 4FSRA 5JGAA 3RVGA 4NTSA 5E92A 3CIKA 1F3MC 3LQ8A 3D83A 3KFAA 2XJ0A 3QKKA 4IZAA 3N4VA 3QQLA 4QP9A 4JRVA 5I9ZA 4YZMA 3H0YA 4C4FA 3ZO3A 5K5XA 1U5QA 4TXCA 1WZYA 4DH7A 4UMQA 2O64A 3CTQA 2G01A 3FSKA 4N0SA 3TZ8A 3MA6A 4GG5A 3N4TA 5DVRA 3V04A 2C3KA 1V0OA 4HGTA 2IO6A 5DI1A 4U45A 2GNHA 3FZSA 4S32A 4MH7A 2WMRA 1M52A 2WQBA 2OICA 2WMSA 3Q53A 1OBDA 1IR3A 3BHTA 2YDKA 4EWQA 3IPHA 1P4OA 5L2QA 4HW7A 4AGCA 4U8ZA 2GNIA 5CSWA 1SVEA 1H08A 1WVYA 2W1IA 5ANDA 4AT5A 4FTAA 3RHKA 4M69B 1Q8YA 3QWJA 2R3GA 2YACA 4GK4A 1Y8YA 2OXDA 4X2FA 4E5AX 2X4FA 4YZBA 4ZLYA 2W7XA 5HVYA 4D2VA 3EQRA 3R30A 4RX5A 1BL7A 3F7ZA 4TY1A 4O81A 2UZNA 4DT8A 2PZ5A 2ITZA 3VBQA 3O0GA 5L4QA 2ERZE 2PVRA 3B8RA 2YCQA 3OBGA 5JRSA 3SHEA 3UGCA 1BX6A 2Z8CA 1FMOE 2F2CB 4LOOA 5D7VA 3UC4A 3PJ3A 3PYYA 4J71A 4MXYA 3R1YA 4CMUA 1B38A 4X0MA 4DFLA 3DNEA 2Q83A 4MNEB 2VO7A 5L2IA 1GJOA 1MRVA 2Y4IC 4MXOA 4EOOA 4D2RA 5LCKA 1GIJA 4YNEA 2VO6A 3SG8A 3EYGA 3RZBA 3BYOA 4AS0A 3FAAA 4OBOA 3O8PA 3I6WA 1ZRZA 4RA5A 3HUBA 3WE8A 3ORIA 2C6IA 5C4KA 4D2SA 3TXOA 4BGQA 4EK5A 2O5KA 2UV2A 5HBJA 3H9FA 2XNGA 2C6MA 5FXSA 3KN6A 2JGZA 4PV0A 4Y46A 4NM3A 3KB7A 5M4CA 2WTWA 4FTNA 2J7TA 3ZSIA 3R7GA 1QL6A 2BIKB 3UIMA 3PG1A 2X7GA 1J1BA 1UKHA 4JR7A 3ZCLA 4BGHA 3K3JA 5I9VA 1F5QA 3CP9A 4D1SA 3CPCA 5A46A 2RGPA 4ZTHA 2X8IA 4O7WA 4GVJA 4NSTA 4I93A 3Q9WA 5HQ0A 3HAVA 4IX5A 4KUJA 3LCKA 3IW8A 5GJGA 4CLIA 4O0UA 4AUAA 2DUVA 2XVDA 2QI8A 3KK9A 1WAKA 5BUJA 3VS4A 4R1VA 3AMBA 3MJ2A 4U97A 4B8LA 4UMUA 2W1FA 3DQXA 3P1AA 4X21A 3RK7A 4F7JA 1WBTA 3R1NA 4CXAA 4X3JA 3G5DA 2W1CA 4FV8A 4LUEA 4ACDA 2ONLA 3CD3A 3F2NA 3MB7A 1Q3WA 5AP2A 2AC5A 2WD1A 2QR7A 3HMIA 2PUIA 4KD1A 4U43A 4KKHA 4ZJJA 5KUPA 3R8PA 3LZBA 5AX9A 3WIGA 3LXLA 5I0BA 4J53A 3QX4A 3KF7A 2YEXA 2LAVA 4K18A 2YJRA 3P78A 4E6AA 3QC4A 3F5PA 4RVLA 4XX9A 3HDMA 5EQYA 3O23A 3UZTA 2QOFA 4C62A 5D11A 1HOWA 2RFSA 3QXPA 5GZAA 4XG6A 4C4IA 2HZ0A 3MGYA 3KN5A 3IDBA 4FKOA 4KBCA 4APCA 1OUYA 5CU6A 3R7IA 3QBNA 4FMQA 3GU7A 2C5VA 5E1EA 4FEUA 4FSTA 4JL9A 3CTJA 3PIXA 2DQ7X 3H4JA 3OTVA 4JX7A 2YIRA 1JKSA 4U42A 5AAEA 5L6PA 3FQHA 5E8SA 4LMNA 3C0HA 3BX5A 4DBXA 1FGKA 3PRIA 2OF4A 3KRWA 4ZS0A 4F6UA 1UU9A 5LMAA 5D7AA 5TKDA 5HVJA 4BDBA 3UBDA 4FSNA 4M0ZA 2R2PA 4G17A 5CT7A 3WZJA 3UG1A 4RJ5A 4FG8A 2WMWA 5AFVA 2NRUA 2JFMA 4YP8A 1R0EA 4M7IA 5CX9A 4IANA 3GI3A 5BUIA 1OITA 3DBFA 3GU4A 4FV4A 5HX6A 4QYFA 2V7AA 5M08A 5HESA 3AC4A 2PE2A 1YOJA 5D12A 4DFXE 3R9RA 1FGIA 5F1ZA 4YMJA 2PVJA 3HLLA 3ENHA 1QPJA 3JVSA 2QOKA 2UW8A 2NP8A 4CKJA 1V0PA 3CSVA 4QTDA 2P2IA 4L9IA 4RGJA 2B55A 2F4JA 4H36A 4OT6A 5HU3A 2XB7A 4IZ7A 4MYGA 4BCOA 3TUDA 3WARA 4TZRA 4YJTA 4D4VA 2R3RA 4D1ZA 3ORXA 1OB3A 5KMJA 3POZA 4OR5A 4O0WA 2OF2A 3Q9ZA 4N70A 4LM5A 5G1XA 3EQCA 4EORA 2BPMA 1PMVA 1YHVA 1U54A 4QP7A 3H3CA 4X2JA 4XCUA 3GCQA 3DAKA 3QC9A 4F9BA 3NZ0A 4UMRA 3OXZA 2XK6A 4PL3A 2XKFA 3S3IA 4Y73A 1DAWA 4CQGA 2YISA 3CQEA 4E4NA 1VR2A 4I92A 2XIRA 3UOHA 5IQGA 2QO7A 5AR2A 4CCUA 1GIIA 4EHGA 3F6XA 5H8GA 2JKOA 2YJSA 2BALA 3BEGA 1ZZ2A 2QC6A 4RQKA 4RRVA 3COKA 5ETCA 5IUGA 2IZUA 3F66A 4WKQA 4USEA 4LRMA 5DN3A 3ALNA 2CDZA 1IA8A 1PW2A 2F7EE 2XIZA 2XYUA 3ZBXA 4BC6A 1VEBA 4D2TA 4RC4A 4O96A 5EHLA 4PDSA 3OEZA 1GOLA 1YDSE 3OY3A 2ITVA 3ALOA 3CS9A 2B9HA 3BHUA 3D7TB 3NEWA 2FGIA 4O27B 2XK9A 3C1XA 3COMA 5HOAA 1F0QA 1Z57A 5C8MA 3T3VA 3TV6A 4BCPA 4O0XA 4YO4A 2NNWB 3KREA 4CZTA 2XP2A 2R3PA 3EQGA 3FE3A 3SKCA 3TTJA 3ZRLA 4CMOA 3FC1X 1WFCA 3FZRA 1JSUA 3MFUA 4I4EA 3I5NA 4TYHB 4BYIA 3MB6A 5ACKA 3RPVA 1SVHA 4GIIA 2BDWA 2Y8OA 3EZVA 3F3ZA 4G1WA 4IM0A 5ANGA 3LXNA 3OW3A 1NW1A 5CXZA 4I6QA 2WQMA 4A4LA 5IA3A 3DDQA 3O8UA 3ZLYA 5CVHA 2PYWA 3A62A 5IF1A 4C0TA 4EH2A 2W96B 4FGRA 3AC5A 3NLBA 4QMXA 2VTHA 1TQIA 2VTNA 2XBJA 4IW0A 4UWYA 3VF9A 2PMOX 2YIQA 3Q5IA 4FL2A 4NFMA 5BYLA 4Q9ZA 4UYNA 5CZHA 5FDPA 1SM2A 5HE1A 2H34A 4UWCA 3PY1A 5HNBA 4FF8A 4RX8A 2NO3A 2UZLA 3C7QA 2VWIA 3G9NA 3FSFA 2PUPA 4DEAA 4ZJVA 2DS1A 3IW6A 2X9FA 3HA6A 2CNUA 2WMQA 2VNYA 3LMHA 5JZNA 3RPSA 5LWMA 1G5SA 1W83A 2JEDA 2BKZA 4FKIA 4BF2A 5HNIX 2FB8A 3EQBA 5AP3A 3ZUTA 3LJ1A 4ID7A 5TR6A 4BCIA 1JWHA 3QLGA 3OWPA 3ZH8A 2CNQA 4UV0A 5FBOA 3B2WA 4KS7A 1Z5MA 2UW7A 5J87A 5C1QB 3PXFA 3I79A 3PZHA 4EUTA 2QNJA 4JBPA 4G34A 3TEIA 4DN5A 4MXCA 4HYIA 2B1PA 5HO6A 3ZEWA 2ITNA 4LRJA 3VS2A 4M13A 1KE7A 3L9LA 4D0WA 2W1GA 2ITUA 2ZM3A 5DE2A 5D1JA 4JG6A 4ITIA 3WZEA 2PZYA 3COHA 2QURA 5A4TA 1YOMA 4MNFA 4H3BA 4BDDA 4B0GA 3BU3A 5J1WA 2JLDA 3BIZA 3RAHA 4O0RA 1OKVA 4EKKA 5IEXA 5JFVA 2C69A 3SA0A 4YLJA 2PULA 3BU5A 4WUAA 4TYEA 3SVVA 1J1CA 3IW7A 3NUYA 4AE9A 2YDJA 4L6QA 5CYIA 3VIDA 4QTEA 1BL6A 3UP7A 3QUEA 4WNMA 2QO9A 3BGZA 2XH5A 5E90A 4LL5A 4OTHA 5KBQA 4AACA 5IKWA 4I1ZA 4EJNA 5CSPA 1XH8A 4M14A 3KEXA 2R3IA 3EJ1A 2H8HA 2BDFA 4RLLA 2Z7LA 4AGDA 2G9XA 3G6GA 2JD5A 3Q6WA 4LOPA 4QPAA 5KMKA 3A2CA 2GDOA 4FR4A 4PDYA 3G2FA 3FYKX 5FEQA 4E5BA 1DI9A 3AQVA 2WTKC 4FNZA 3QUDA 2UVZA 5GZ8A 2WPAA 1VZOA 5LXMA 3E8NA 4BDAA 3R9OA 3Q4CA 1NT2A 3KRLA 3OG7A 4V0GA 5HKMA 3NUPA 5AV4A 5HO7A 2WFYA 1HCLA 3E88A 3MH3A 5IA5A 3ZOSA 4DYMA 4EHEA 4W9WA 4CFWA 4QP2A 2BMCA 4QMZA 4UBAA 4C4EA 3W18A 3R1QA 4EI4A 2JBOA 3VUDA 3DBQA 1KOBA 3ZLWA 4YSJA 2Z02A 4TL0A 1ZYLA 3SC1A 3CKWA 4FKVA 3TACA 3UNJA 5J9ZA 1M7NA 4MKCA 4L42A 4FODA 5CS6A 3L9MA 4U3YA 3DA6A 3DTCA 4C2VA 4BDCA 2CKEA 3SV0A 4QQCA 5KZ0A 4M3QA 1XHAA 4QYGA 2XNMA 4W4XA 2QOHA 4ZEGA 1A9UA 2GHMA 3I0OA 3QQKA 1FPUA 4FTRA 4MHAA 2RIOA 5D41A 5HZNA 4D4SA 3FMNA 1OL6A 4XJ0A 1QPEA 4FIFA 2PPQA 4U44A 2YM4A 5ETIA 2I0VA 5HVKA 3F5UA 4ZSJA 3VAPA 5EOLA 4FEWA 1R39A 2XCHA 4XMOA 3UPXA 1Q8WA 4MTAA 3KF4A 4FV9A 5BVWA 4DEGA 3ETAA 3R71A 4FVQA 3PA5A 4D0XA 3ITZA 4LV8A 4ENYA 4GRBA 4DLIA 4O7RA 4FSZA 3ZFXA 3LW0A 4WRSA 3FMHA 5HE0A 3QA0A 3Q9XA 4PMSA 1OI9A 1P2AA 4R3RA 4UZHA 4YJNA 4V04A 3ROYA 2YZAA 3QWKA 4JR3A 5E8XA 3G0FA 3NW6A 5GHVA 4QT1A 4TNDA 2WOTA 4GCJA 3DAJA 2CGXA 5AUUA 4U79A 1OL7A 4ZY5A 1FBNA 4DE4A 4OBQA 4BI0A 5DHJA 4WRGA 5HX8A 1CDKA 3MTLA 3NYOA 4F6WA 2OXYA 2V55A 2QOLA 3FLNC 1OIRA 4FKPA 5L3AA 4TPTA 3LFNA 5CU4A 2OH4A 1H0VA 4K0YA 4FGBA 3OC1A 4RJ7A 5HIBA 5CF5A 2BDJA 3AD6A 3D5UA 4P4CA 3SOCA 3KCKA 3G90X 1CM8A 2YERA 5KMMA 4C37A 3RPYA 3L1SA 2BHEA 4X6RA 3TZ9A 2P2HA 4NM5A 4NEUA 4H3PA 2C1AA 4JAJA 4YNOA 4R7BA 3KQ7A 4DEDA 4QMUA 4F9CA 4FV0A 4AA4A 4OTPA 4QYHA 3MVJA 1H00A 3R63A 1ZYSA 2UW5A 3O50A 4L3JA 5AR3A 5GIPE 1KUTA 4O86A 1FMKA 4NKAA 5IQIA 3LE6A 4CZUA 2F9GA 5H9BA 3AC3A 4A9TA 3AT2A 5EYCA 4I5HA 4IX3A 2PE1A 2UZTA 4RFZA 4E4XA 3GCSA 4FG7A 5CT0A 2X9EA 3R28A 4MBJA 4M66A 2QOIA 2IW9A 4BCMA 4OTRA 4HVGA 1K9AA 2R0IA 2YDIA 4JDKA 5EKNA 4YPSA 5BNJA 2JC6A 2PVHA 3F3VA 4OTGA 3JY0A 4RWLA 3GB2A 3BRBA 3DXNA 3QD0A 4IAIA 4AU8A 3MVHA 4IFGA 5DT3A 4OTFA 3RP9A 5J8IA 1Y91A 2VGOA 3BE9A 2JFLA 3FMMA 2OZOA 3QTUA 4K8AA 4BIDA 3HMOA 4FTKA 4D5HA 1PMNA 2YM8A 3A7FA 1FVRA 2C3JA 2VN9A 4KABA 3L9NA 3A7IA 1XBAA 3NX8A 4G16A 4V0GB 4C3FA 3DJ5A 4IWPA 5JSMA 2YM3A 2P55A 3IKAA 4NCTA 4W4YA 3MY1A 2VTIA 4WG5A 5EW3A 4X2GA 3V6SA 3WF6A 5IA0A 2OLCA 2PL0A 3DBEA 4NFNA 1ZMUA 4RIXB 3PA3A 5E8YA 3R8VA 2VRXA 5CANA 5M4FA 4QP8A 4FTIA 4USDA 5JMSA 3NIEA 2C30A 2RSVA 2C1BA 4YBJA 4J95A 4TN6A 5E8UA 5K0KA 3RZFA 4U80A 4ALUA 5EQEA 2PMNX 4ZTNA 3QTZA 2ZDTA 1ZYCA 3FPQA 4BKZA 5EH0A 3NNWA 3ANQA 3W8QA 2UZEA 2RL5A 4M8TA 4NU1A 4F64A 1Y6BA 3KK8A 4QMVA 3GUBA 3MWUA 5FP5A 4CEGA 1URWA 4XLIA 3VHKA 4IZ5A 2ZV7A 3BYMA 3FQEA 3R01A 3R2BA 4QRCA 5C01A 3RWQA 5A9UA 3LCSA 5ANKA 1R0PA 4JS8A 4UXQA 4AWIA 4EOQA 1WVXA 2QONA 4MNEA 4QMQA 5E4HA 3WOWA 4M12A 4L7FA 3K3IA 2XK4A 5AR7A 5AP7A 1ZOHA 2A0CX 1YXVA 3AD5A 3D5XA 4GS6A 5EDRA 2YM7A 2A27A 3P5KA 4MXAA 3GC9A 3DZOA 4YJUA 2ETMA 3O17A 4I5CA 3GFEA 3HRFA 3W32A 3BYSA 1VJYA 4C7TA 4HPUE 4DFNA 1SMHA 5CZIA 5L2WA 2YHVA 3MYGA 2BFYA 3ORZA 3U4UA 3HAMA 4RWJA 2UZUE 4K9YA 3UOLA 3OD6X 4BR3A 4GYIA 4QQTA 3FZTA 5EYDA 2W4OA 3ULZA 4PTGA 4PDOA 3EMGA 2REIA 1YWNA 2EB2A 1PXKA 4IAYA 4FNWA 2EUFB 1PXLA 2ZM1A 3U8WA 3LQ5A 3W2SA 4BHNA 4DCEA 4FIGA 4NL0A 3RK9A 4IC8A 3QHRA 4AFEA 2Y4IB 1UV5A 1IAJA 3MPMA 5BPYA 2Y0AA 4MVFA 1YVJA 5LMBA 4JQ7A 1NVSA 4BI1A 5M07A 1FQ1B 3QRUA 3FY0A 1WBPA 3ACJA 3CQWA 4TWPA 4L52A 4EZ3A 5FP6A 3EH9A 5AAGA 3FZPA 3MVMA 4TWCA 2OXXA 2YLFA 3WE4A 5JEBA 3ZFYA 3FYJX 3GCVA 4FT9A 4C02A 3S0OA 1JOWB 3T9IA 2XBAA 5AP6A 3DKOA 1JPAA 4JX3A 3KC3A 4ZZMA 4GL9A 4F70A 4FUXA 3IECA 4IE9A 4AA0A 2XIXA 4PPAA 3OCTA 5EM8A 3WYXA 3ZLXA 5M4IA 1MQ4A 3MH1A 2BKKA 3EKKA 5FG8A 1G8SA 2PZPA 3BPRA 3A7HA 4IJ9A 2J5FA 4HYUA 3FPMA 5EDPA 5AR8A 3TIYA 4ANQA 4FE2A 1H24A 4OW8A 4UWBA 4CZYB 4OAUC 5D10A 3OXTA 4BCNA 4F63A 1REKA 2XM9A 1B39A 2PU8A 4BCFA 5LCJA 3QA8A 4Q2AA 4QQ5A 4V05A 4A07A 1BI7A 1H01A 4KBKA 2PVKA 3ZRMA 3PY3A 4AW5A 4U41A 4AW0A 4KIKA 5AV3A 4AZWA 4LGGA 5A6OA 5LOHA 4M67A 5HTIA 3QGYA 5DMZA 5DBXA 3F88A 4C59A 4WG4A 2WEIA 5CU0A 4CMTA 5IEVA 4PF4A 2W1ZA 3BHYA 2KTYA 4KNBA 1XO2B 4ZY6A 5LVLA 1H26A 4QP6A 2GTMA 4G3DA 5T6KA 1J7LA 4DGOA 3QRTA 3CLYA 2ZB0A 2HZNA 3EIDA 4GT4A 4Z9LA 4ZSEA 5CEKA 4RQVA 1GZ8A 2R3QA 5I9YA 2CGUA 3SD0A 4NIFA 3ZC6A 4GT3A 4AOJA 1W84A 1W7HA 3MJ1A 5CNOA 1WBSA 3FLZA 4UZDA 4IXPA 3TV7A 2FSMX 2BIYA 1NXKA 1QPCA 2W1DA 3B2TA 4XG8A 5DRDA 5GIOE 4RX9A 4PY1A 3IOPA 4FTTA 4DTBA 4USFA 4XG7A 4J8MA 4DEIA 3MIAA 4FYNA 5EKOA 1KOAA 4XV9A 3QCSA 3PP0A 1PYEA 4H3QA 5AV0A 2ZYBA 3ZS5A 1MUOA 2JDRA 3VUKA 5JQ8A 3QUPA 4CFXA 2QODA 2LGCA 4QMMA 2J0MB 4XYFA 3W8LA 1ZMVA 5IQBA 1M2RA 1PKGA 3V5PA 2WU6A 3QTWA 3ZO2A 4OT5A 5AP5A 2WQEA 4B9DA 5M44A 2C5YA 2FYSA 3FMDA 4RIYB 3ULIA 2R3HA 2X8DA 3GU8A 4HOKA 5HG7A 3DXQA 5DR6A 3EL8A 4XP0A 3W55A 4RX7A 4PTCA 1YRPA 3W2PA 2BRHA 2VTAA 1S9JA 2WELA 2NPQA 3JPVA 1JBPE 4BB4A 4O7VA 2WMUA 3R9DA 3R8MA 4ZTRA 1KWPA 2VX3A 4C4HA 4CGAA 1ZLTA 2BCJA 4IIRA 4J99A 4W4VA 3FI4A 2UZWE 3I4BA 5E8TA 1U5RA 2XKCA 3MV5A 4GJ3A 1RJBA 3NNVA 3H30A 4O6LA 2XK7A 4HNFA 5E8ZA 3E64A 3IGOA 2PE0A 5GNKA 1OPKA 1APME 1Q97A 1SNUA 4AW2A 3DTWA 5CU2A 1WBOA 4Z7HA 1U59A 1UNLA 1ZAOA 5DEWA 1TQPA 2VO3A 3DDPA 4FKTA 5EI8A 3LOKA 3ZZEA 3L8SA 3EKNA 4C4JA 3RGFA 2B9FA 3QLFA 5JT2A 3UQGA 4Y72A 1ZWSA 1H07A 2EVAA 4Z16A 1H1WA 2WIPA 3IOKA 1LP4A 2GFCA 3AT4A 2J6MA 4J96A 4R78A 4XNEA 2WZJA 3VW8A 4DAWA 1MP8A 2HXQA 5CEMA 5LQFA 1AGWA 2OJIA 2VTSA 5LMKA 4CG9A 3HYHA 2YM5A 3AC1A 4RPVA 3A8XA 3FL4A 4PQNA 4U81A 2CLQA 3C0IA 3D7TA 3G6HA 3HL7A 4QMTA 4ZJIA 5DRBA 3LCTA 4RC3A 3GQLA 4RFYA 2BUJA 4FT7A 2CKQA 3BEAA 2CNVA 3HMNA 4FKWA 4F6SA 4R7IA 5IDPA 1PXJA 4BWKA 5CI7A 2WKMA 4TYHA 3EQHA 2QOBA 3Q52A 3OXIA 1UWJA 2XNPA 3GBZA 4IDVA 3RALA 3IDCA 3QX2A 2DYLA 4CTCA 4TYIA 3U87A 4F7SA 3C50A 2X6DA 5KKRC 2QCSA 4BDIA 4OLIA 3U54A 5HIDA 5ACBC 3SW7A 3U9NA 3QYWA 2RG5A 4Z55A 2WEVA 5BVNA 2G2FA 3R83A 4ANOA 1ATPE 4QYEA 1IAHA 2OSCA 3OWLA 4KIKB 3UO4A 5BQ0A 5CQUA 2CHLA 3R0TA 3C13A 4YJSA 1FOTA 3DPKA 3PLSA 4D55A 5HICA 3U51A 2HK5A 3IW5A 4AFJA 1R1WA 5DT4A 4F08A 2PMIA 4UX9A 4F1OA 3V5TA 3PJCA 3SRVA 5CF8A 5AEPA 3PG3A 3W2CA 3MI9A 3BGPA 4KB8A 4NZWB 3Q04A 2W0JA 4CYJA 4DG3E 5HORA 5LJJA 4ANLA 3UTOA 4AOIA 1U4DA 3W2OA 4NIFB 4D58A 2XNNA 4FKUA 5AIKA 1ERKA 2H9VA 2GS6A 5IUHA 3OT3A 2VWXA 5AX3A 3D14A 4FVRA 2OFVA 3PSBA 4RJ6A 4J1RA 5JK3A 2F7ZE 4QTCA 4V01A 4AN2A 3VUGA 4D9UA 1Q4LA 4GUEA 3P23A 3ATTA 3EL7A 2HELA 1XQZA 4QNYA 3V5QA 1Q8TA 5H2UA 3KKVA 4X3FC 3TL8A 2J0JA 4EH7A 5AV2A 4BIBA 1UA2A 2WO6A 3AOXA 3AGLA 2WMVA 3EB0A 3R6XA 4CV8A 1M2QA 4IB1A 5C26A 4ZTQA 2X2MA 1JAMA 3NAXA 4G5PA 5KZIA 5L6WL 3VS6A 2YWPA 3QQGA 3QTXA 2R3LA 4KINA 2XJ2A 2OJFE 4FZAB 5B2LA 3VJOA 3UJGA 3C4ZA 3ORKA 3UQCA 3D2KA 3DAEA 3OUKA 3QHWA 4W4WA 3UG2A 1OL1A 2W9FB 3C51A 3QCXA 4JIKA 5CVGA 3REPA 3RK5A 5JKGA 5K4IA 5E9EA 1GY3A 4XOYA 3T9TA 3PWYA 3LPBA 3LHJA 4LL0A 4QMSA 4I4FA 4JQ8A 2R3KA 4E8AA 3OUNB 2R3JA 3EN4A 3RCJA 1ND4A 1Q61A 3UC3A 3F3WA 5KCVA 3CR0A 1YOLA 4FT3A 3R2YA 2HW7A 3BLHA 3KRJA 1CKJA 4FKRA 3A7JA 1JKKA 4EOKA 2OO8X 3DK6A 5I3OA 2CLXA 4PWNA 4KRDA 4W9XA 3F9NA 3AGMA 4FNXA 4QMWA 5F4NA 4M68A 5FWKK 4QP4A 1BI8A 3K54A 2QLQA 2VTMA 2VX0A 3NUAA 1I44A 3DOGA 3II5A 3F3TA 1CTPE 4F99A 3CGOA 4JI9A 4CFMA 2HZIA 1Y57A 4ALWA 5M57A 4DT9A 1JLUE 4FL1A 3NAYA 3DFCB 3UP2A 4GW8A 4E6DA 5E1SA 4EBWA 2HYYA 3UYSA 2VWYA 4PNIA 5DH3A 3FXWA 4H1MA 5FM2A 3VC4A 5HBHA 2QU6A 5DA3A 2OU7A 3Q3BA 3U6JA 3EYHA 4F4PA 4NWMA 4JAIA 2DWBA 2CCIA 4L01A 5K9IA 2VTLA 3AMYA 4WHZA 3L8VA 3THBA 4K77A 2RF9A 5I4NA 3BV3A 3OWKA 4LUDA 3EQDA 1UWHA 3F61A 4QPMA 5HO8A 1SNXA 2Q0NA 1CMKE 3POOA 4DFYA 1UVRA 4UXLA 4E93A 1M17A 4EJ7A 2QKWB 2Q0BA 3PIYA 3BWJA 4BCJA 3OMVA 3NCGA 3ORPA 3Q5ZA 5CF6A 3RNYA 4ZY4A 2XUUA 5EYMA 4I0SA 5DNRA 4BGGA 2C3LA 4N4SA 3P7CA 2WAJA 4WNKA 3E5AA 4XV1A 2PHKA 3UO6A 1G3NA 4EWHA 1OKZA 3TJDA 4O7LA 2WTKB 4RZWA 4FZ6A 1AD5A 3E3BX 2YCSA 4ASDA 2WGJA 2A2AA 3DV3A 2GSFA 3ATSA 2I40A 3KY2A 5IQEA 2YM6A 5HE3A 4O22A 3A61A 5GINE 3OF0A 5CXHA 3AXWA 4AGUA 1XWSA 3EQFA 3F5GA 1RDQE 3BV2A 3D4QA 5CNNA 2UW9A 1UU8A 5ANEA 3WF8A 3P79A 5C27A 4X2KA 2C6TA 2FVDA 4C33A 5CEPA 4R8QA 4ACHA 4I5PA 3UNKA 5AUYA 2CGWA 4IACA 3PXQA 5FEEA 4FL3A 3KVXA 4FC0A 3EN7A 4ZAUA 3MPAA 5JFSA 4BTMA 3PDTA 3R21A 1H1SA 3WBLA 4DA5A 1YXXA 3PVGA 4QOXA 2GQSA 3PSDA 4G31A 3SRVB 3ERKA 2GHGA 4JBOA 5CAOA 5KMIA 3HP2A 4ANMA 4DH8A 1G8AA 5IQAA 4Y85A 4FA2A 5AP0A 3OVVA 1O9UA 3OFMA 3UODA 3PE1A 2CN8A 1OIUA 3HNGA 3KMWA 3NVKI 5JGBA 3RPOA 1E1XA 4RJ8A 4ALVA 3PXYA 4IVDA 1H8FA 2OI4X 1E1VA 4WO5A 4JDJA 1B6CB 2X0GA 4HJOA 4YC6A 4DH3A 5AUTA 3W1FA 4AP7A 2O3PA 3FWQA 1FINA 4C4GA 2XS0A 1XR1A 3LFDA 4HCUA 1GZNA 4G2FA 2VGPA 3I1AA 4C57A 3FDNA 4HVIA 4O1OA 5KHWA 4WT6A 2C4GA 3ZYAA 2X6EA 3MW1A 4BDHA 2J90A 1SVGA 3D0EA 4AOTA 2JDVA 3FQSA 2KULA 2W99B 4EL9A 4UMPA 2SRCA 3VS0A 4AT3A 1Y8GA 4S2ZA 5IUIA 4KSQA 4RSSA 1PXOA 4HYSA 3VHEA 3ZU7A 2IZTA 4NH1A 3E92A 2BTRA 3GU6A 4GH2A 4C38A 3HECA 4G3CA 3OOGA 4IEBA 4D2WA 3DB8A 3VQUA 1R78A 4BTKA 3NW7A 4BTFA 1UKIA 4FV2A 5FTGA 5IQCA 4MWHA 1OPJA 2CN5A 4GU6A 1BUHA 5ANIA 5JH6A 4N57A 5FXQA 1REJA 1ZZLA 3JS2A 1HCKA 3NYNA 5L8KA 3Q6UA 5IA1A 4IBMA 4F0IA 3TTIA 3HV4A 3PJ2A 1YXUA 3IW4A 3PTGA 2UW6A 4QMLA 4TW9A 3S95A 4YPDA 4TYGA 4E3CA 3NYVA 4FYOA 5IDNA 1PY5A 3F2AA 3FV8A 3DZQA 3OCBA 4L68A 3TNHA 3DB6A 3WF5A 4XHKB 1Q8ZA 4FTMA 3FHRA 3RJCA 4JXFA 2C6EA 4FUYA 4YZCA 4FSMA 4I0TA 3S2PA 4E5WA 5BVDA 3PJ1A 1XH5A 4JBQA 3AC2A 4HGSA 4KSPA 3RKBA 1P4FA 2EU9A 5CASA 3C0GA 2IVVA 3MDYA 2BZIB 3COIA 4AAAA 4AZVA 1E9HA 2OIQA 3LFEA 4E6QA 5J79A 2UW0A 4NJDA 3NSZA 2QD9A 3VUHA 3WF9A 4IB5A 2OIBA 1LUFA 3ANRA 1NVRA 3O8TA 5BX0A 3ZSHA 2QLUA 2R3FA 3QTQA 4RIXA 2IVSA 3LJ2A 3F82A 5JFWA 4BKJA
chains in the Genus database with same CATH superfamily
4A4OA 5LVMA 3DGKA 2GNJA 4XBRA 5BVOA 2ONLC 1LEZA 3LXKA 5HG8A 4ANNA 2BFXA 4A9SA 4B4LA 4BDGA 3UOKA 3N4UA 3W0QA 4EOLA 4RC2A 4FTJA 3V51A 1LEWA 2O0UA 4FEQA 2FSLX 2ZV9A 4FT5A 4YJPA 5J5TA 5LWNA 3UIBA 3TKHA 4CD0A 3R7YA 2IPXA 4D4RA 4EHVA 2VTRA 2QU5A 3GOPA 3V8TA 4BDKA 2F2UA 2YIXA 2X0QA 2CGVA 5L2TA 1W82A 4BL1A 2UW3A 2HWPA 4J52A 3DJ6A 3W2RA 3V5JA 5CLPA 1OZ1A 4P90A 5A3XA 4FSQA 1IEPA 4BTJA 4L3LA 3H0ZA 5K3YA 4CKRA 5B0XA 1ZY4A 3LLAA 5LVNA 4IX4A 3JYAA 5GJFA 4AXCA 5DGZA 4NTTA 1LPUA 1OKWA 3QTRA 4AXAA 2IW8A 3W33A 5FRIA 5HIEA 1XBCA 2GTNA 3QCQA 3QD2B 1UU3A 2I1MA 4L44A 3VRZA 1H4LA 2IVUA 3R22A 3VNTA 4DEBA 1PKDA 3CKXA 4EH4A 4RLKA 4BZDA 2W5AA 1PRYA 3UZRA 5C4LA 1VYWA 2I6LA 3PPZA 5CEOA 1Q3DA 3LMIA 4ZS4A 2BAJA 5KNJA 3OHTA 4EH5A 4AZTA 3HA8A 5CALA 3HV7A 1Q24A 2WTIA 3KRRA 4BZOA 5BVEA 4PNKA 1NY3A 2XF0A 1ZOEA 4G3GA 4UEUA 5CU3A 5B2MA 1A48A 5HG9A 4YHFA 3Q96A 4FKQA 2CSNA 3SOAA 2WHBA 4O0YA 3RAIA 4C36A 3HVCA 5HGIA 3FJQE 4P5ZA 3BI6A 5B2KA 2UZOA 3D7ZA 3NUNA 3TJCA 2VTTA 3AG9A 5CENA 1OBGA 5IPJA 3M42A 4FI1A 3FKNA 2CJMA 5CY3A 3OCGA 3DNDA 5KMNA 2I7QA 4FKGA 3VS5A 4RFMA 2PZRA 3KCFA 1XH4A 1PMUA 3L8PA 3RMFA 4CT2A 4ZZNA 3ZXTA 4CSVA 5IA4A 2ZV2A 3I5ZA 3IS5A 2HIWA 2X39A 5HU9A 2GQRA 3DS6A 2VTJA 3R1SA 3TCPA 4J97A 3IK3A 3PIZA 2B53A 4IMYA 3VBVA 2PVFA 2ZAZA 4YGAA 3U4WA 2AUHA 4C8BA 3ET7A 4F9AA 3PY0A 4UB7A 1OGUA 4KS8A 3DXPA 4FV3A 4QTBA 2JAVA 2E2BA 4PL4A 2UVXA 5A54A 2B0QA 3QQHA 4GYGA 1TFFA 3GGFA 3A4PA 2OH0E 2XYNA 3TUBA 2Y6MA 2CKOA 2WMAA 4I41A 2W9ZB 3BCEA 1QPDA 2EXMA 5AP4A 5FXRA 5KO1A 3EOCA 3ZUVA 4DITA 2J0KA 4S31A 2VWUA 4EC9A 1P14A 4L7SA 5A4EA 3FLSA 5AMNA 1KV1A 3MVLA 4RVMA 4EOMA 1YWRA 3GXLA 3LFSA 2VD5A 3KGAA 4CNHA 3MFTA 2EB3A 4IVCA 3ZHPC 4A9YA 2I0YA 1IASA 4AG8A 3RHXA 4R3CA 2OJGA 4YZNA 3NNUA 5JZJA 2H6DA 5LVOA 1YDRE 3C4XA 1OECA 1YKRA 2FUMA 2GNFA 2WOUA 5EM7A 4CVAA 2WB8A 2E9NA 2HW6A 2P4IA 3BLRA 4MF0A 4TWOA 1K2PA 3EZRA 5DT0A 4AN9A 4B7TA 3DLSA 4E4MA 5D9HA 4O7TA 4TYJA 4WSQA 4FZDB 4X2NA 3UQFA 3Q60A 2IVTA 4EH6A 3ZBFA 2JIIA 5AA9A 2XRWA 5BUEA 4HZRA 1O6LA 3GNIB 1XKKA 1YI3A 4GK3A 3NUSA 2W5HA 5M09A 3C4FA 2QHMA 4FIHA 4JOAA 2VNWA 1UU7A 4RBLA 4QTAA 3SXFA 1WBNA 3I7BA 3KXNA 2ESMA 3MY5A 4AE6A 4RWIA 5EK7A 4XG3A 5KMOA 4S33A 2UZDA 3NFFB 2BILB 2WU7A 3FHIA 3TG1A 3U6HA 4NK9A 4QMNA 2YZLA 3QGWA 1STCE 4BZNA 5M51A 3NFGB 3QAME 4RZVA 4EK3A 4BBMA 4XBUA 3ZDUA 4KBAA 4B99A 4UY9A 1DAYA 1GNGA 4BIEA 2C6OA 4K6ZA 4AX8A 2UVYA 2V62A 4DBNA 3G51A 3FKLA 1CKPA 3LCDA 3WZKA 3V01A 4CYIA 3P0MA 4RIYA 4R5SA 2C5OA 4YTHA 3D94A 5HD7A 4YJOA 3R9HA 4DC2A 3I7CA 4M0YA 5I9UA 5C8NA 4FTQA 1YI4A 3C4WA 2R0UA 4MBIA 4GJ2A 2UW4A 3O7LB 5CAUA 3CXWA 2B7AA 2C47A 3EHAA 1T46A 4R3PA 4CG8A 2R9SA 4O91A 2J4ZA 2WMBA 3MS9A 4D4YA 5ICPA 2EXCX 3R04A 2Y9QA 1Y6AA 1IRKA 1BKXA 3VS1A 5BVFA 4ACCA 4MXZA 5AA8A 3KRXA 4JNWA 3LKMA 3R8ZA 3WF7A 3GC7A 2JDTA 4IM2A 4O0TA 4O2ZA 3UVQA 3VO3A 3W16A 5CAVA 5HLNA 4AW1A 3DCVA 3NIZA 5CSHA 4ZOGA 1JKLA 4FV5A 4I6HA 3EN5A 4KWPA 3VULA 1ZARA 4BI2A 4F9YA 4M97A 2VX1A 2NRYA 3P86A 4A06A 4D2PA 3M1SA 3TKUA 1J91A 3ENMA 3ZFMA 3FLWA 3QRJA 4ZLOA 2IJMA 2QKRA 5DOSA 3ZONA 3N9XA 4ASEA 5BMSA 3VJNA 2Z7SA 3C5IA 4F1MA 2YLEA 4Z3VA 4I6LA 4QNAA 3QF9A 3MIYA 3P9JA 4TKSA 1JKTA 4PMMA 4FIJA 2X2KA 3DLZA 4OTIA 1S9IA 1JQHA 2OIDA 3EQIA 5KX8A 4YLLA 2C68A 1H1PA 4GFMA 4BDJA 5IQFA 4CFVA 4R1YA 4FG9A 5DIAA 3QD3A 4CFFA 2R3OA 4YHJA 5TF9A 4U5JA 1V0BA 2J5EA 2HY0A 4Y95A 3OOMA 4XS2A 4FOCA 2PVLA 5L8JA 4HVDA 3KXXA 2V22A 3SXSA 2Z60A 4KKEA 4IVAA 2W06A 4MQ2A 5L6OA 5J1VA 2ITXA 1BMKA 3P4KA 4I0RA 4RG0A 3ZUUA 4I23A 5HEZA 4PMPA 4PPBA 5H8EA 2YIYA 4H39A 5G6VA 3SLSA 2J9MA 4RIWB 2BAQA 5EHOA 5FM3A 3NYXA 1JSTA 3KXMA 4DFBA 3S4QA 4IADA 4K33A 4AQCA 3UPZA 4L67A 2E9VA 2IN6A 2ZM4A 3PPKA 3DK7A 3FY2A 5FTQA 4EEVA 3AT3A 2F57A 4IHPA 3V3VA 4WG3A 5M4UA 4G3FA 4R77A 4FZFB 1ZY5A 4ASXA 3TM0A 3TNIA 5IA2A 4BJJB 1IA9A 1OL5A 4JLCA 3NDMA 3PJ8A 3TNPC 5E8VA 4USEA 3ORMA 5KKRB 3VF8A 4YC8A 1M14A 1K3AA 2XNOA 2X7FA 2XEZA 3B8QA 5ETAA 3MESA 1MRUA 3DT1A 1RQQA 2O65A 2R5TA 4H05A 3DK3A 4QPSA 2ITQA 5EHYA 3GCUA 4K1BA 3NNXA 4O4DA 4ASZA 3GU5A 4EZ7A 2B54A 3TKIA 4O7YA 4AGWA 3PLAE 2WNTA 1GIHA 4R5YA 4YBKA 3BELA 2R7IA 3QU0A 3BBTB 4HGEA 4WBOA 2VAGA 3PXZA 4H58A 2Y7JA 2X7OA 2C6DA 2GS7A 4RA4A 4QMPA 2E9PA 3VN9A 2ZOQA 4RVTA 1YXSA 4G9RA 3DJ7A 3RM6A 4DLJA 4G3EA 5M53A 3D9VA 2BRBA 1WCCA 4RVKA 5EM6A 2G2HA 4ZIMA 2O2UA 4ACGA 2BRGA 2PUNA 2O8YA 4APPA 2RKUA 2PVMA 3LCOA 5C9CA 5M56A 2PMLX 1JNKA 5ANJA 4GK2A 4MWIA 5EG3A 4DH5A 4HYHA 3ZLSA 4QMYA 3UOJA 4TRLA 4GSBA 3E8CA 2YCRA 5HBEA 4PPCA 4Y5QA 2QQ7A 2QHNA 3E8EA 4X3FB 1TKIA 4JDIA 5CQWA 4DGMA 3IG7A 4J8NA 4Q9SA 4FVPA 3D5VA 4QQJA 1OIQA 1QMZA 5HG5A 3TV4A 5KHXA 3GP0A 5E7RA 3MFRA 3BQCA 3DU8A 3ZM9A 4YZDA 5IMEA 2YCFA 4ORKA 4KIQA 2ITYA 2OW3A 5IEYA 2BHHA 4NT4A 1RW8A 2FSTX 2IZSA 3LM0A 3UYTA 4EHZA 1G8KA 2UZVA 3OTUA 5CVFA 4MD9E 5TT7A 4RJ4A 1VLRA 3MH0A 2VWBA 3FLYA 3RI1A 1YQJA 4O4FA 3KULB 4U7ZA 3TN8A 4QMOA 4E26A 5E91A 1RE8A 2PSQA 4YSMA 5T68A 3CJGA 3R7UA 3RM7A 3E93A 3RAWA 4AN3A 4OBPA 3A99A 2A1AB 4BDEA 4CFNA 3GFWA 3LM5A 4F78A 2XALA 4F0FA 1PJKA 5A14A 2B52A 3D2IA 4FKJA 3UVPA 4YZ9A 3NW5A 4XG4A 4DEEA 5I3RA 4Y83A 3PSCA 4ZMEA 3ZTXA 4EQMA 2W17A 3ZEPA 3GT8A 4GVAA 3FXXA 2IZRA 3VVHA 2VUWA 4F09A 4JDHA 4YR8A 3FMLA 4CFUA 4IWQA 4O84A 3DFAA 2IG7A 3TDWA 4KIOA 1Q62A 3O71A 2OJJA 2X0OA 2C0IA 4AZFA 4R7HA 2VO0A 4TWNA 3PVBA 3EQPA 4U3ZA 4O82A 1WBWA 4FSUA 4IH8A 2CMWA 2WXVA 2XMYA 3ORLA 5EW8A 5HHWA 1OIYA 1U46A 4K2RA 3PXRA 5AV1A 4MEDA 2XNBA 3ZC5A 3SXRA 4XG9A 3BLAA 3CQUA 5TO8A 4BDFA 4HVHA 2WQNA 5IG1A 3R7OA 3P08A 3QRKA 5HNGA 4WNPA 2YABA 3QALE 5C03A 1XJDA 3UDBA 4ANSA 4EKLA 4F1TA 3GQIA 2G1TA 5AUXA 4NUSA 1DS5A 1URCA 3W2QA 5HLWA 2BRNA 3JY9A 5EI2A 2YITA 4WUNA 1AQ1A 2ITWA 1Z9XA 4DGGA 5HI2A 2P3GX 5HE2A 2QOOA 1KV2A 5K4JA 2GMXA 2ZB1A 5F94A 3D15A 2XRUA 2GU8A 4NCTC 4ACMA 3R7VA 4FT0A 3KMUA 4PMTA 1KSWA 1OKYA 1CSNA 4JT3A 4ZMFA 1T45A 3LVPA 3A4OX 3FZOA 5F9EA 2PUUA 4YUQA 4BBFA 2WIHA 3LLTA 4ZZOA 3S00A 3VS3A 4PRJA 3HP5A 2QG5A 5EDQA 2JIUA 3BHVA 4JQEA 3VUMA 1L3RE 4XRLA 2XEYA 4IC7A 3FXZA 1BLXA 3EN6A 4QYYA 2XARA 4ZP5A 4FZ7A 4FOBA 3OCSA 4MBLA 3MH2A 3EWHA 4L8MA 5HCXA 4I22A 3VRYA 4ZLZA 5CSVA 1OPLA 4OTQA 4D28A 2X4ZA 1W0XC 2ZJWA 2B4SB 2J2IB 2OBJA 4FNYA 4H1JA 3PP1A 4U0IA 4BICA 5HCZA 4WNOA 4Q5HA 4E7WA 5JQ5A 3BGQA 3PFYA 4O7ZA 2I0EA 4EQUA 2J51A 4PP9A 4C34A 3IO7A 3KA0A 5FD2A 5BYYA 4DTAA 3SG9A 4S34A 3PVWA 5FBNC 1P5EA 4F7NA 1M7QA 3DKFA 1OMWA 5CF4A 3MA3A 3OZ6A 1MQBA 4OGRA 4EQCA 3NRMA 4QDEA 4I3ZA 4NW6A 2C6LA 4BCGA 3S1HA 2V7OA 1JSVA 3O51A 3ID6C 2CCHA 4A9RA 3E7OA 3NGAA 3VQHA 2JDSA 4WSYA 2G15A 1YHWA 2UZBA 3C5UA 2B9IA 3RCDA 5AP1A 4LG4A 4L45A 5EQPA 2P0CA 3QZFA 2XANA 3R8UA 3VBYA 5IQHA 3PPJA 4YC3A 4I6BA 4Y8DA 2GFSA 4RWKA 4P5QA 3PUPA 2OG8A 3G33A 3QQJA 2JBPA 3ZMMA 5CAPA 1KE6A 1O6KA 2BTSA 3SDJA 4IDTA 2OGVA 1PHKA 3HV5A 3QXOA 4MX9A 1NA7A 3R7EA 5DEYA 3UVRA 4GT5A 4GKHA 4NM7A 2A4LA 2W05A 2Y6OA 3E63A 3E62A 5FGKA 1UNGA 1YHSA 3FMKA 4O21A 3IONA 4WD5A 4GV1A 4QO9A 3F2RA 5CAQA 4U40A 3QFVA 3ZZWA 4EK4A 2PWLA 4ITHA 5KBRA 3TUCA 2YFXA 2RFEA 1PXPA 3QL8A 1Q41A 1ZXEA 3FLQA 5A4QA 5J5SA 4HZSA 2X2LA 3DKCA 3KXHA 4EOSA 3Q4ZA 4ZTMA 2FA2A 3QYZA 4PX6A 3BWFA 2XCKA 4CT1A 4YTCA 4CRSA 5FEDA 2P33A 2R64A 3F5XA 1CKIA 4FTCA 2C5XA 4GG7A 4LYNA 2V5QA 4I20A 3MPTA 4XRJA 5K0XA 2YIWA 3CEKA 4DTKA 4XP2A 1I09A 4EBVA 3UNZA 4DFZE 2B9JA 3OP5A 3CPBA 1H27A 5FTOA 2QOQA 5JGDA 2HY81 5ANOA 4I94A 3MY0A 3ZO1A 5H8BA 4EOPA 4UN0C 2BROA 5HTBA 4FKLA 2BZJA 2GHLA 1OVEA 4XOZA 4F7LA 3JR1A 1UNHA 4L46A 3IQ7A 2AC3A 3FKOA 4HNIA 2FH9A 2VWVA 3VUIA 3Q4UA 3O96A 4BKYA 3LFFA 4NM0A 1ZMWA 1EH4A 3JUHA 4JBVA 3QZIA 2XNEA 4OTDA 3OEFX 3UDTA 2UUEA 2WQOA 3KXZA 4FV6A 3SGCA 3LJ0A 4FTOA 3CY2A 1KE5A 2R7BA 2BZKB 3RBWA 3R9NA 2GNLA 5IQDA 3KU2A 4C2WA 5J9LA 1WBVA 4CRLA 2ZVAA 3HX4A 2YAAA 1IG1A 3QRIA 4FIIA 3HUCA 3TI1A 1SYKA 3ROCA 4BWPA 1PXMA 5KMLA 2A19B 2QG7A 2NYAA 4PL5A 2X8EA 3BKBA 3V8SA 4JJRA 5LARA 4E4LA 3FUPA 5EYKA 1XH9A 3FI2A 2XA4A 4XV2A 5FDXA 3V5LA 2PVNA 2ERKA 4OTWA 5FLFA 4LDTA 1OUKA 3FMJA 4IAZA 4G6LA 5CEIA 4C3PA 3LIJA 3QKLA 4IWOA 4F0GA 3UE4A 3LQ3A 2ITPA 3CY3A 3CBLA 4MQ1A 3LFAA 3RPRA 4QP1A 4BCHA 1J7UA 5DYJA 4I24A 1J3HA 4K11A 1W98A 3EFJA 4MXXA 3T8OA 4I5MA 4FKSA 5EI6A 2F49A 1OL2A 5HCYA 4EC8A 1FVVA 1GZKA 2JKMA 3ODYX 3M2WA 4LGHA 3E3PA 3BYUA 3WILA 3OWJA 3TWJA 4GKIA 2OWBA 4E73A 2OJ9A 4JIAA 3V6RA 5EFQA 2ZDUA 2BZHB 3SW4A 1H1QA 4O0VA 3UIXA 4KAOA 4EOJA 3KL8A 3LAUA 1X8BA 2WTDA 4AZSA 1Q5KA 4O2PA 2HOGA 5AJQA 2BVAA 5L8LA 4DGLC 3PE2A 3FBVA 3I60A 2RFDA 4XEYA 1YI6A 5DFPA 3C4EA 5IU2A 1QCFA 2H96A 3QQUA 4LRKA 4YJVA 3JVRA 3ZRKA 4GIHA 4PDPA 5JN2A 3M11A 2YN8A 4IWDA 3HRBA 4FIEA 2VWZA 4O0SA 5CTPA 4OAVB 2WMTA 5AM7A 2JKKA 3HDNA 4TT7A 3V5WA 4BVUA 3ZO4A 4IVBA 3R8LA 4J7BA 2VTPA 2RG6A 2PVYA 5IZFA 5L2SA 4EH3A 5M55A 5KE0A 4XP3A 2AYPA 3L8XA 4EH9A 5M06A 3BZ3A 2JITA 4P7EA 4WBBB 5BVKA 2YA9A 4B8MA 3C9WA 3KMMA 4IZYA 4WA9A 3VBTA 2XKDA 2W4KA 3QTSA 4DINA 3BE2A 1M2PA 4FTUA 2OKRA 3GENA 3HMPA 3LMGA 4EYJA 5DR2A 4LQMA 4QP3A 3UIUA 4O7SA 4PUZA 3RTPA 3HV3A 1U54B 5IH5A 2YAKA 3Q2MA 5GZ9A 3D5WA 3VBXA 4C58A 3OS3A 4FV1A 3HKOA 2ZMDA 4AXDA 4DCAA 2ACXA 3DY7A 3R02A 2PTKA 4DFUA 2JDOA 4FSYA 3RINA 3AD4A 3PRFA 3Q32A 4BHZA 4IB0A 4ONAA 4BN1A 5AAFA 4S30A 4KKGA 1H0WA 4YTFA 2X81A 5E8WA 3GOKA 3NUXA 4FK6A 3W0RA 3NWWA 4RMZA 3P7AA 3TZMA 4F9WA 3OY1A 4WOVA 4B6LA 3R00A 3UMXA 3RAKA 4HGLA 3RNIA 4FICA 5DLSA 5AWMA 4EK6A 5AUVA 2C5NA 4LGDA 1BYGA 1DM2A 2XJ1A 4L43A 2HAKA 3ORTA 3WIKA 3G9LX 3BU6A 2HZ4A 2EWAA 2XK3A 2ZMCA 3BHHA 4RJ3A 3K5VA 4KA3A 4IFCA 4RIOA 4UALA 3G15A 2QOCA 4NKSA 4F65A 3O7LD 2XZSA 4L53A 3ZSGA 2BR1A 3CE3A 4KIPA 2QR8A 3MBLA 4Z7GA 2HXLA 1XBBA 2VTOA 4CKIA 4ZK5A 3FL5A 4M15A 3HRCA 4ERKA 1OM1A 4HCTA 4O7NA 3BYVA 4GFGA 4CCBA 1PXIA 1KE9A 5ITAA 3U55A 2Z7RA 2R4BA 4LOQA 4UYAA 2R3NA 4XV3A 4TTHB 4I6FA 3P7BA 4GU9A 4MK0A 2WTJA 1H28A 3QZHA 3UO5A 3KVWA 4U9AA 4E1ZA 3TIZA 4II5A 3GVUA 1XH6A 2C6KA 1TVOA 2JAMA 3KXGA 2HCKA 5AM6A 3EFKA 4ZSLA 4FEVA 4PP7A 2E9UA 1A06A 3H10A 4C61A 4ZTSA 3A7GA 2IW6A 4GEOA 2OFUA 2WTCA 3FC2A 2PZIA 4C35A 1H25A 4LFIA 4TNBA 3BQRA 3FMEA 5IISA 3A60A 3GC0A 2ZV8A 4PTEA 2HWOA 3PVUA 4NYEA 2VWWA 4M84A 4ANBA 2O63A 3QKMA 3VS7A 1PF8A 4DH1A 4YURA 1Q8UA 3F69A 3V8WA 4P2KA 2QO2A 2X1NA 1TZDA 4MD7E 2IWIA 2IEWA 1XMLA 3UZPA 2VV9A 3EFWA 4FEXA 1PMEA 3VW6A 5AUWA 5EM5A 5AADA 2FSOX 4WIHA 2W1HA 4CQEA 4UMTA 4DF3A 5JRQA 4FTLA 3DQWA 3QTIA 2FO0A 4HCVA 4ERWA 3O2MA 4LV5A 5HLPA 4IAKA 4DHIB 4RIWA 4HPTE 3WZUA 5JFXA 3FI3A 2BAKA 4AXEA 3OROA 4O38A 3Q9YA 3QD4A 3W0SA 4IAFA 1MRYA 5F95A 3VBWA 5A4CA 2VU3A 5K5NA 1WMKA 5AUZA 1R3CA 1V1KA 3PXKA 4G6OA 3SQQA 2E9OA 4G5JA 2J50A 2VTQA 5CWZA 3RWPA 2OZAA 3WI6A 3DBDA 2WTVA 3WZDA 2ZFYA 3AKLA 1VYZA 5DPVA 1GZOA 4GMYA 3FI8A 3GC8A 3N51A 4N6YA 4D1XA 3ELJA 4BJJA 1GAGA 2PK9A 3PZEA 3Q4TA 2RFNA 3CGFA 5J9YA 3NVMB 4A4XA 4BCQA 3NR9A 5TOZA 3CCNA 5CI6A 3LXPA 4EH8A 5ETFA 3F7WA 4FV7A 4A7CA 4MF1A 2GCDA 4XG2A 3NCZA 5GJDA 5H3QA 3VWAA 3ZDIA 3A8WA 5BYZA 1L8TA 4XH6A 3LFQA 4IQ6A 5DWRA 4AZEA 3HMMA 3I0QA 3MN3A 3T3UA 3H9RA 3HGKA 3I81A 1KE8A 4ARKA 1SZMA 5LVPA 4IM3A 2Z7QA 2C0OA 1ZOGA 3H9OA 4YO6A 2ITTA 3CJFA 4FBXA 2Z2WA 4J98A 3C4CA 2EXEA 1PYXA 2R3MA 3QQFA 5HD4A 4EZ5A 3TNQB 4I21A 3OW4A 2CKPA 3IGGA 5A6NA 3IDPA 4O1PA 5EW9A 1YW2A 1ZYJA 2J0IA 3MTFA 4AT4A 3CD8A 4YHTA 1J7IA 1O6YA 3VUTA 3GCPA 5J95A 2JIVA 2WMXA 4YJQA 4CLJA 5CSXA 1YDTE 4M69A 4FK3A 1PXNA 4JG7A 3U6IA 1JVPP 5I5ZA 2W1EA 4CV9A 4L00A 3DBCA 4EONA 5FUTA 4O83A 2F7XE 4GFOA 4Y5HA 4FSWA 4G6NA 1W8CA 4N6ZA 4BBEA 3AMAA 3MSSA 5T3QA 4D5KA 5I9XA 3FEGA 2PY3A 3QCYA 4L3PA 2XM8A 3PFQA 5F20A 4BRXA 4DEHA 1YXTA 3HZTA 3BLQA 3OBJA 4X3FA 5FQDC 3W10A 4C3RA 4GUBA 5I9WA 3NMUF 4X6QC 3TDVA 2XKEA 4HVSA 4BY9E 2XIKA 4A9UA 4ITJA 4BFMA 4AA5A 4BCKA 4DG2E 3ORNA 3AKJA 4JVGA 4EUUA 2C3IB 5AIRA 5DG5A 1YWVA 4NJ3A 4XUFA 4XLVA 5TE0A 3TT0A 3PWDA 3TZ7A 4O6EA 3QZGA 4YLKA 5EOBA 4EYMA 2I0HA 2YWVA 1ZYDA 3U9CA 4NW5A 3KULA 1DI8A 2GPHA 1W2FA 2VZ6A 2ETKA 2XK8A 1WVWA 2Y4PA 3DKGA 4MAOA 2W4JA 4CTBA 5LMKC 4DHFA 2GS2A 3AKKA 2GNGA 2GQGA 3Q2JA 4KRCA 3R73A 4X7QA 4YJRA 2X0PA 4FX3A 4W8EA 2G2IA 5IH6A 1LR4A 3K5UA 4ZXTA 5CEQA 3F3UA 4R6VA 4YTIA 5BMMA 3ZM4A 2ETRA 4IJPA 4ZTLA 2ITOA 3SAYA 4EK8A 2J0LA 1H1RA 4ZSGA 3FZ1A 3NS9A 3ZXZA 5C8KA 3G0EA 2C0TA 4MD8E 3EN9A 5J7HA 4DG0E 5AR4A 3JXWA 4G9CA 3E8DA 3UMWA 4BYJA 3ACKA 4D9TA 4U6RA 4W8DA 3SX9A 4E20A 4EOIA 4ZSAA 5A4LA 2V0DA 4IX6A 3OT8A 4Q5EA 1Q99A 5DR9A 1TQMA 2HENA 3ODZX 4JMQA 5B7VA 3AC8A 3WYYA 4LMUA 3GEQA 3EFLA 5J7BA 3CC6A 3K2LA 3L9PA 2OK1A 2W5BA 5AR5A 3MFSA 2JKQA 4E6CA 4RT7A 2QVSE 4ENXA 5IH4A 4MCVA 3I6UA 3HV6A 3NUUA 4JRNA 3LFBA 4LI5A 4IB3A 5IMXA 4OUCA 3CTHA 1NVQA 1XH7A 4BWXA 1FVTA 2BRMA 4DGNA 4JG8A 4QD6A 3BBWA 3NPCA 2CPKE 2OZAB 3E7VA 4IAAA 4AF3A 3PA4A 3LFCA 3TNWA 5HTCA 4YU2A 2XIYA 3HEGA 3E87A 4FSRA 5JGAA 3RVGA 4NTSA 5E92A 3CIKA 1F3MC 3LQ8A 3D83A 3KFAA 2XJ0A 3QKKA 4IZAA 3N4VA 3QQLA 4QP9A 4JRVA 5I9ZA 4YZMA 3H0YA 4C4FA 3ZO3A 5K5XA 1U5QA 4TXCA 1WZYA 4DH7A 4UMQA 2O64A 3CTQA 2G01A 3FSKA 3BL7A 4N0SA 3TZ8A 3MA6A 4GG5A 3N4TA 5DVRA 3V04A 2C3KA 1V0OA 4HGTA 2IO6A 5DI1A 4U45A 2GNHA 3FZSA 4S32A 4MH7A 2WMRA 1M52A 2WQBA 2OICA 2WMSA 3Q53A 5BV3A 1OBDA 1IR3A 3BHTA 2YDKA 4EWQA 3IPHA 1P4OA 5L2QA 4HW7A 4AGCA 4U8ZA 2GNIA 5CSWA 1SVEA 1H08A 1WVYA 2W1IA 5ANDA 4AT5A 4FTAA 3RHKA 4M69B 1Q8YA 3QWJA 2R3GA 2YACA 4GK4A 1Y8YA 2OXDA 4X2FA 4E5AX 2X4FA 4YZBA 4ZLYA 2W7XA 5HVYA 4D2VA 3EQRA 3R30A 4RX5A 1BL7A 3F7ZA 4TY1A 4O81A 2UZNA 4DT8A 2PZ5A 2ITZA 3VBQA 3O0GA 5L4QA 2ERZE 2PVRA 3B8RA 2YCQA 3OBGA 5JRSA 3SHEA 3UGCA 1BX6A 2Z8CA 1FMOE 2F2CB 4LOOA 5D7VA 3UC4A 3PJ3A 3PYYA 4J71A 4MXYA 3R1YA 4CMUA 1B38A 4X0MA 4DFLA 3DNEA 2Q83A 4MNEB 2VO7A 5L2IA 1GJOA 1MRVA 2Y4IC 4MXOA 4EOOA 4D2RA 5LCKA 1GIJA 4YNEA 2VO6A 3SG8A 3EYGA 3RZBA 3BYOA 4AS0A 3FAAA 4OBOA 3O8PA 3I6WA 1ZRZA 4RA5A 3HUBA 3WE8A 3ORIA 2C6IA 5C4KA 4D2SA 3TXOA 4BGQA 4EK5A 2O5KA 2UV2A 5HBJA 3H9FA 2XNGA 2C6MA 5FXSA 3KN6A 2JGZA 4PV0A 4Y46A 4NM3A 3KB7A 5M4CA