3FL5A

Protein kinase ck2 in complex with the inhibitor quinalizarin
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
325
structure length
324
Chain Sequence
SKARVYADVNVLRPKEYWDYEALTVQWGEQDDYEVVRKVGRGKYSEVFEGINVNNNEKCIIKILKPVKKKKIKREIKILQNLGGPNIVKLLDIVRDQHSKTPSLIFEYVNNTDFKVLYPTLTDYDIRYYIYELLKALDYCHSQGIMHRDVKPHNVMIDHELRKLRLIDWGLAEFYHPGKEYNVRVASRYFKGPELLVDLQDYDYSLDMWSLGCMFAGMIFRKEPFFYGHDNHDQLVKIAKVLGTDGLNVYLNKYRIELDPQLEALVGRHSRKPWLKFMNADNQHLVSPEAIDFLDKLLRYDHQERLTALEAMTHPYFQQVRAAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Casein kinase II subunit alpha
publication title Quinalizarin as a potent, selective and cell-permeable inhibitor of protein kinase CK2
pubmed doi rcsb
source organism Zea mays
total genus 105
structure length 324
sequence length 325
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2008-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3fl5A01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3fl5A02
2VRXA 1U54A 3DKCA 2WMXA 4FKJA 5ETAA 3TACA 4GYGA 4EH6A 2J0LA 3P1AA 5J9LA 5T6KA 5AP7A 5FUTA 4RJ6A 4GKHA 2C3IB 3F2NA 4HVSA 3P79A 4JJRA 4E4LA 2Z8CA 3VWAA 3ZSGA 2G2FA 1AGWA 3TIYA 3R9HA 2C6LA 3QRKA 3LQ8A 3Q32A 3BYVA 4WO5A 2WTKB 1Q8WA 3I81A 4O91A 5AJQA 4QQTA 5M07A 4CG8A 5AR2A 4HPUE 4JX7A 4FSQA 4QRCA 3HMMA 1VEBA 1WBWA 4QMNA 3BU3A 2UVXA 2PE1A 1ZMWA 2YAAA 3KXXA 3Q6UA 4PDOA 2W4OA 1Q8TA 3GXLA 4ZSGA 3UQCA 4XG9A 4QMYA 4RWJA 2Y0AA 3QALE 4MXZA 4FV3A 3VS5A 2QOKA 3I60A 5I5ZA 4JDJA 5LMKA 4LGDA 5IQGA 3UVPA 5H2UA 1JSVA 1J7IA 3GOKA 4S2ZA 1L3RE 2EUFB 5LVOA 3GU6A 2W1FA 4XNEA 2WMSA 4FC0A 1QCFA 5CU6A 2XIKA 4RX7A 4GYIA 4PQNA 5AR8A 4UMUA 5EH0A 3ANRA 3TNQB 2Y8OA 2QR7A 2XK4A 1H0WA 2VTTA 4O7WA 5E91A 4IBMA 4UXQA 4IDVA 5AAGA 5L6PA 5FLFA 2XNPA 4K18A 1WVXA 4ENYA 4ANSA 2R3MA 1ZZLA 3HZTA 4OGRA 3EJ1A 1OVEA 3DTWA 4ZLZA 4RIYB 3HRBA 3AC8A 5D41A 5ETCA 2AYPA 1WBVA 2V55A 4D9TA 2JFMA 2GQRA 4LYNA 3FLNC 3OOGA 2W96B 4HGEA 5T68A 4O7RA 3ZZEA 5A6NA 2VUWA 1GZKA 1YVJA 2W1HA 3R30A 2QR8A 4FG9A 4FTJA 4ZTSA 3R7EA 2EXCX 1URCA 4EUUA 1A48A 2FA2A 4V05A 5GINE 3A2CA 5HVJA 3F3ZA 3BYUA 4CFXA 3OROA 3Q5ZA 3L1SA 2R64A 3FL4A 4GUEA 1P14A 5FDPA 2B0QA 3D5VA 3VQHA 4EEVA 4XYFA 3OBJA 1WBNA 2ZB1A 4YJUA 3SHEA 5IQIA 2XP2A 1OL2A 4G5JA 4JDIA 3GU7A 5HG9A 3OF0A 4L00A 3KXHA 5M51A 4GRBA 1PXJA 4BTJA 3RALA 1PXIA 2YJRA 1OIYA 4H1JA 2HIWA 4CZUA 3TV4A 4FKOA 5LVMA 4RIXB 4ZY6A 4P2KA 5GJGA 2VNYA 3KCKA 4BWPA 4I21A 3G33A 3HNGA 2VD5A 2YDKA 5GJFA 4CQGA 1H26A 5E8YA 1MQ4A 3G0EA 3SX9A 4PL4A 3NW5A 3OY1A 3PIYA 3T3VA 4GEOA 3GUBA 4JXFA 2CKEA 2JDOA 3DU8A 3D14A 3P5KA 3N51A 2QOBA 2F49A 4Y5HA 3OHTA 5BNJA 3G9NA 3QYZA 3F2RA 1QMZA 2CJMA 5HG8A 4GIIA 1QPJA 4K33A 4TN6A 4ZS4A 4N0SA 3QTUA 5DR6A 5CZHA 4M97A 5AUZA 4DT8A 4FEVA 4I3ZA 1NT2A 3ATTA 4AACA 3C50A 4C35A 3OEFX 4XH6A 1H01A 2OJ9A 4FODA 4LV5A 5CENA 4CYIA 3BV3A 3L9LA 2XA4A 4V0GB 3R7OA 4U5JA 5L6OA 1Q8YA 1TQPA 3IG7A 3AMAA 4IXPA 2VO3A 4BCGA 4FKRA 3MVJA 3PJ2A 3TJCA 4HGTA 1T46A 4E5WA 4E7WA 3MPAA 3CJFA 3B8RA 4QP8A 5HE1A 4USDA 3RNYA 4FSMA 4J1RA 1MRVA 4E1ZA 4AXAA 2YABA 5HLWA 5AWMA 3KRJA 1XHAA 3R8MA 2X7OA 1B6CB 4U0IA 3NIEA 3BBWA 4OTRA 2C6IA 2A4LA 3RM7A 3CR0A 3IPHA 3LFAA 4M0YA 3WF6A 5ICPA 1O6KA 4YSMA 3R1NA 3EQDA 3TTIA 2ZV7A 2E2BA 5L8JA 2WIPA 3FMNA 5I9XA 4TYHB 3LQ3A 2YHVA 3FHIA 3GQIA 4FKGA 1KE6A 3FMJA 4G9CA 4C61A 3FI3A 3KFAA 3QQKA 2BAQA 4DEAA 4XV2A 2QONA 2R3NA 3LFDA 3Q4ZA 4N57A 1F3MC 3LM0A 3AOXA 2I0HA 3R1YA 2H96A 4ZZMA 2OGVA 4FEQA 2VX3A 4O22A 2C3JA 4RSSA 5IEVA 3ERKA 3O17A 5IUIA 2YM6A 4FKIA 5E8SA 4ANOA 2ETKA 4NJ3A 4YO4A 2GNFA 2CGWA 3ZFMA 5C4LA 5HO6A 5TE0A 5EQEA 1UWHA 2YWPA 3Q4CA 3SOCA 3HAMA 2JBOA 4U7ZA 4KS8A 4FTMA 3C0HA 3QWKA 3IGGA 4RGJA 4O81A 3NNXA 1FVRA 3GEQA 5A4CA 4BHZA 1ZMVA 3BKBA 3GVUA 5GJDA 3I1AA 4IX4A 4I6QA 2WFYA 3VHKA 1PXOA 3O50A 4HVDA 5AP6A 1OL7A 1DS5A 1P5EA 3LVPA 4FNWA 5E8UA 5LARA 5CEOA 5LCJA 2QOQA 2P2HA 2WQOA 1SVEA 4RQVA 1G5SA 5FGKA 3ZZWA 2IJMA 4FSYA 1URWA 5DEYA 3RI1A 4YPDA 3WF7A 2WXVA 1BX6A 4M7IA 1MUOA 4IFGA 4MF0A 4O2ZA 4FT9A 5EOLA 5J87A 5GIOE 2WELA 5H8BA 2R4BA 4CCUA 3PG1A 1PXPA 3TDWA 3QTSA 2CPKE 3R00A 4FGBA 3WE8A 4ASZA 4G6LA 4Z55A 5J7HA 2ZYBA 5DT4A 5KNJA 3ZU7A 3AD6A 2AUHA 4WOVA 4OBQA 3LJ1A 4KBAA 4QTEA 3Q3BA 4E6DA 5CNNA 4EC9A 5J79A 2Y4IB 3IW8A 2NO3A 4FF8A 4J97A 4NCTA 3RWPA 2XNOA 3QTZA 5E1EA 4MH7A 4LL5A 5IQCA 4BKYA 3DXNA 4IW0A 2RGPA 2WNTA 2XJ1A 2WQEA 1CKPA 2X7FA 3DFAA 5CI7A 3V5LA 3ZDIA 2R2PA 2GHLA 2VTHA 3Q4UA 4CT1A 2PUPA 1PXNA 5AV1A 4F0IA 5LWNA 3WZEA 3UP2A 4ACHA 4EL9A 5IEYA 4XV9A 5EDPA 5GZ9A 5HU9A 2XKCA 4R78A 3Q4TA 4HYUA 2QG5A 3R9RA 3KRLA 4KRDA 3P78A 3PVGA 3PSBA 3AMYA 2PE2A 4AA0A 2QVSE 3W2SA 5CI6A 3ROYA 4WBOA 2XKFA 3GC9A 4DF3A 1KE9A 5CEQA 5DT3A 1PXMA 2VO0A 3DBDA 3GI3A 3R8VA 3UOLA 4BCKA 3UG2A 5K9IA 3RK7A 1OPLA 3QTRA 4FA2A 4V04A 4IWDA 5L2TA 3OXIA 4BI0A 3QUEA 4DGOA 4GS6A 1V1KA 4XOYA 2V7AA 1Y91A 1J1CA 2Y6OA 3II5A 4FGRA 1R3CA 1WCCA 3E5AA 3PIZA 4PDSA 3ULZA 5IQEA 3CEKA 1ZOHA 4FTAA 4BDKA 4O1PA 3D7ZA 3FKOA 2F7EE 2W1IA 3DQWA 2RG6A 4E6CA 2YZLA 2O64A 3F5UA 3T3UA 4BY9E 4JQ7A 4ZTMA 3HMIA 3E7VA 3SA0A 1G8SA 4W8EA 4O6LA 1OKYA 3UZTA 3DDQA 4CRLA 4F99A 1PXKA 4FG7A 2W1EA 2XNGA 3C4CA 2GMXA 3SXFA 3ZEWA 4D4RA 5JZJA 3VF8A 4EH8A 2VGPA 1FMOE 2W99B 4FV5A 4C57A 4D5HA 3UNKA 2GNJA 3IK3A 4ZSLA 3UMXA 1TKIA 5BYYA 4FIIA 2R3JA 5EI2A 3C4FA 4QNYA 4RIYA 3DB6A 1PYEA 4MBIA 2W4JA 3SW7A 2FH9A 5DWRA 4ALWA 3VS0A 3VUDA 3QC4A 4U3ZA 3BYOA 4LFIA 4XG3A 4CXAA 1NVQA 3WBLA 4BCOA 1PXLA 4NUSA 2VWBA 2IVUA 3E63A 2ITPA 4YBJA 4AF3A 3KVXA 3P7BA 1YHWA 1CTPE 4FNZA 2UW9A 4CFFA 3TG1A 3JYAA 2ONLA 3FAAA 1CMKE 4AE6A 4O0WA 1UV5A 3FQSA 4I23A 4L3JA 4MD7E 3QD2B 1OL6A 2W5HA 4EOPA 5J9ZA 4S34A 2PTKA 2WGJA 3FSFA 4FIFA 4IE9A 5ANIA 3ZTXA 4F0FA 5K0KA 4PNKA 2R3GA 4IM0A 1PMVA 4RIXA 4KB8A 2XJ0A 2YZAA 4LQMA 2HWPA 3UPZA 2ZM4A 4M67A 2QG7A 4AZEA 2BZIB 4OBOA 5E9EA 5KUPA 3R1QA 3R28A 3ZEPA 3ALOA 1F0QA 1ZY5A 3BE2A 4YJQA 5J5SA 1WBTA 2C5VA 3PPZA 1BLXA 3DAJA 4E3CA 4FIGA 4BDCA 5I9YA 1FPUA 2WB8A 3RHKA 4M0ZA 3S1HA 4QMLA 2CNVA 1Q8ZA 2VTNA 3HGKA 3AC2A 4N6ZA 4AOIA 3LFCA 2VTQA 5TT7A 3ZH8A 2OO8X 4RJ3A 2CLQA 3NUNA 1OIRA 2BTRA 3CXWA 4GU6A 5FG8A 4EHEA 2V7OA 3EYGA 3H9RA 4RX8A 3IW5A 4GT3A 4HJOA 4I1ZA 3V8WA 3P0MA 1U54B 4ZY4A 4ANLA 5F1ZA 3G90X 4C3RA 4GFGA 3M1SA 4V0GA 2WPAA 5KZ0A 3FZ1A 3SV0A 4RVMA 3IW4A 5B7VA 5CANA 2CDZA 2OXXA 4FZ7A 3F88A 3BCEA 4MXOA 2VZ6A 4AZFA 2PZYA 2Z60A 2OH4A 4C59A 4FZAB 4BDIA 2IZTA 3AXWA 3UOKA 3G5DA 3U87A 4BBEA 4LOOA 2YERA 4EH5A 4ANNA 4YJRA 1XH5A 4TNDA 2OJGA 4IAKA 4C37A 5AP1A 3W8QA 4O7VA 1Y6AA 3BU6A 2GTNA 4NKSA 4O27B 4L68A 3WF5A 4CNHA 2CKQA 2RFEA 2C47A 5KZIA 2QNJA 3FMKA 3UDBA 4IZ5A 5KKRB 4FTRA 4A9RA 4AT4A 1XH7A 2C68A 1IEPA 1QPEA 3AC4A 3OUKA 4YZCA 4D1SA 4TYHA 4K0YA 3D5UA 5CAQA 3FMHA 2O63A 3MVHA 3Q60A 5GNKA 5EHLA 5L4QA 2JIVA 4QP2A 4BZDA 5IH4A 4DA5A 3DJ7A 2YIWA 2WTKC 3M11A 4KD1A 4I20A 3R73A 5HE3A 3TV6A 1YOMA 3UO4A 3TUDA 1H28A 5AUYA 1YHSA 4X21A 3WZJA 3R1SA 3FZRA 4XG2A 2XBAA 4HVIA 1SMHA 1NXKA 2G9XA 2WMWA 4RFZA 4WUAA 2IZSA 1H1PA 3Q9YA 4R8QA 4U81A 4DEIA 5HO7A 1KOAA 4F7NA 3C1XA 3EMGA 4F7LA 3N4VA 3BWJA 4J8MA 1J91A 2J50A 3ZONA 4N4SA 4BIEA 1XJDA 4BKJA 3TM0A 4C4GA 4XP0A 5HLPA 5K3YA 2CN5A 2CHLA 1RQQA 3N9XA 5GIPE 5K0XA 5AV3A 2BR1A 3C4WA 3FWQA 4GT5A 4WSQA 2REIA 5CF5A 1TQIA 4OTHA 3EWHA 2IWIA 3OWKA 4H3BA 4O0UA 2BROA 3EKNA 4IWQA 1IG1A 3FSKA 5ANGA 3NVMB 3QGWA 2UW3A 3NGAA 3SXSA 5B2MA 1AQ1A 4DEEA 2WU7A 5AEPA 5AA9A 3PXFA 2CCHA 3NAYA 4EWQA 2VTOA 3VS2A 4BIBA 4FVPA 2OLCA 3EQBA 5BMSA 3QCSA 3E92A 4XHKB 4EYJA 4PP7A 4XLVA 5EKNA 2QODA 3QHRA 4KBCA 2BDJA 5FRIA 4GK4A 2CGXA 3EFJA 5DEWA 2V0DA 5HCXA 5HIEA 5KMMA 3LCKA 1HCKA 2VN9A 4CZYB 2ZDUA 2J0KA 3QQHA 4MXAA 4AW2A 5I9VA 2W9FB 2W1ZA 5TKDA 2GNIA 4AE9A 2J0IA 2Y7JA 4FSWA 1BL7A 5EM8A 3F69A 3GQLA 2GDOA 3JVSA 3V5TA 3LXKA 4TWNA 3VQUA 4IAFA 3A7IA 4LV8A 2X2KA 4KIOA 5A9UA 4E93A 3TXOA 4CKIA 3C51A 3HKOA 5CU2A 4QMUA 4NZWB 5CX9A 4KUJA 4NM3A 3C5IA 5AUUA 2BRNA 5KO1A 3LFEA 4BDBA 5EM6A 2HZ4A 3A60A 2CSNA 5AP2A 4FICA 2C0OA 1Z57A 4L3LA 1ZXEA 3OEZA 5L2SA 3NCGA 1O6LA 2C6TA 3Q52A 4IC7A 4PX6A 3MH3A 5E92A 3AGMA 3LOKA 3SC1A 4DH5A 4EK3A 2RSVA 5JN2A 4HGSA 5JT2A 2Y4PA 4Q2AA 1IAJA 4ZSJA 3U51A 3E8NA 1G8AA 3PXKA 3SQQA 1PF8A 2VTSA 4FV9A 3UIXA 1Y57A 3ITZA 5TR6A 4ZTHA 3WE4A 4FKLA 3NDMA 2B7AA 3AD4A 1K3AA 4BCJA 2XB7A 1GIIA 2GNLA 5J9YA 3A4PA 4UYAA 3W32A 4LM5A 4GVAA 3EIDA 4ALVA 4FKVA 2PVJA 4IWOA 4QYEA 4FV8A 5IH5A 3PRIA 3DLSA 5L8KA 2X39A 4EH7A 4O7ZA 2X6DA 4ZEGA 4BR3A 3K5UA 3Q6WA 5LXMA 4C62A 4H1MA 4JIKA 3ULIA 4ZLYA 3T8OA 3OC1A 3BHHA 1MQBA 3QX2A 5IMEA 4QYFA 4E4XA 1JOWB 4YBKA 1H1SA 5E7RA 4O7LA 4Q9SA 1UNHA 4EONA 4DH7A 2W1CA 3EL7A 2XKEA 2Z2WA 5DIAA 3QA0A 4MWHA 5C03A 3LZBA 5L2WA 3MH0A 4BL1A 3QC9A 4D2VA 3IGOA 3FLSA 3E8DA 5FM2A 4QPAA 2J0MB 5AUVA 1JKTA 2UW7A 4O7SA 3FLWA 1KWPA 4LRKA 3KN5A 3O96A 4AFJA 4L01A 1H08A 4YTHA 3B8QA 2P4IA 4PPBA 3MB7A 4D58A 2GNHA 2ETMA 3VUKA 5LOHA 4H39A 4MF1A 4Z7GA 3VBYA 2XK7A 3FMEA 4DC2A 2W1DA 4KKHA 3VUIA 4R7IA 1R0PA 5DOSA 3NS9A 3ZO4A 5F95A 2ITXA 4O96A 4O82A 4YP8A 3DBQA 4C34A 3PSDA 3MBLA 2X4FA 2WHBA 4F9CA 3LW0A 3ORTA 5KCVA 4YO6A 3KA0A 4CRSA 3COHA 3KMWA 2F57A 5D7VA 4NKAA 5J5TA 3ZDUA 3BLQA 2UZDA 2X8DA 2V5QA 3TDVA 1KOBA 4FKSA 2H6DA 4L3PA 1XH6A 2JDTA 4FE2A 3OBGA 2BKZA 1XH8A 4Q5EA 4NWMA 4QP4A 4WA9A 4YURA 2X8IA 5A3XA 2FSLX 2VTJA 3RK9A 4Z9LA 2XIXA 3KRWA 4LRMA 5BVNA 1PMEA 4UEUA 4XG6A 5HOAA 5IG1A 2ZDTA 3D83A 5JGBA 4OW8A 4FT7A 3V3VA 2BZJA 4XP2A 4ZTNA 4I4FA 1WVYA 5AV2A 1LEZA 4OR5A 4D4YA 2GS6A 2P33A 3ZRMA 3PE1A 1OPKA 1UNGA 3CC6A 2UZLA 4OTPA 4CV9A 4FL2A 3FKNA 4M84A 3BGZA 3PVBA 2WZJA 2YDIA 1H24A 3GOPA 2BUJA 3T9TA 3V04A 1WFCA 2R3PA 4K1BA 2WTCA 1K2PA 4RVKA 3AC5A 3NEWA 5H8GA 1W0XC 3F5GA 2YACA 3QD0A 3FQEA 4NFMA 4RA5A 1V0PA 1PY5A 1A06A 4H3QA 4OTDA 3M2WA 1OIUA 3U4WA 4LUEA 1BI7A 2XMYA 1GIHA 1XH4A 3MTLA 3CP9A 4FSUA 4MNFA 2QOFA 4MYGA 5DFPA 2JC6A 2HZIA 2BMCA 5FEDA 4L52A 3TNIA 5EW3A 4QP1A 2AC3A 2Y4IC 2QHNA 2UW8A 3HP5A 3OCGA 5FXQA 3QCQA 4EWHA 3WZUA 1OKZA 3S2PA 3JR1A 5HVKA 5J7BA 4EOJA 3V5WA 5JFVA 4F1TA 2HW6A 1Q3WA 4O0TA 4F63A 5KHWA 3VIDA 3MB6A 3A61A 4XRLA 5HBEA 2YAKA 3UOHA 1LR4A 2WQMA 5CEMA 3U6HA 2GU8A 4BDDA 2JAVA 3LLAA 3LPBA 5CYIA 2OFUA 2W4KA 4MK0A 2BPMA 2ZVAA 4YC3A 2IW9A 4B9DA 4EHZA 5IF1A 1BUHA 1XBBA 5DPVA 5I4NA 2XS0A 4O2PA 4QMMA 5IQHA 4MBLA 3LFSA 4GKIA 3MJ2A 1LUFA 2BIKB 3Q5IA 4EOLA 4F1OA 3ZC5A 4U80A 4BCFA 5CAOA 4MBJA 4CTCA 2BILB 4CFUA 4RC4A 2C6KA 2OIBA 1Q3DA 4M14A 3S00A 3MDYA 2C6OA 1ZAOA 3LCDA 4IM3A 4UZHA 5LQFA 3ZO3A 5LWMA 2R3RA 4WKQA 2RFSA 4A4OA 5AFVA 2GSFA 4EJNA 5GZAA 3FUPA 3HDMA 4YTFA 4G5PA 5HESA 3QD4A 5EHYA 3LXNA 2VX0A 4XEYA 3FI8A 3OWPA 4WG5A 2EB2A 5A54A 1VYZA 1FGKA 2QD9A 3NNUA 3PXYA 1G3NA 3NUYA 4RQKA 3WYXA 5IQDA 3MA3A 3EN4A 4Y72A 5A46A 4YMJA 1M7QA 2J6MA 3EN6A 4ONAA 1U59A 4AG8A 4EKLA 5AM7A 5EDRA 3W2CA 5AP5A 3C5UA 3I5ZA 3R02A 4OBPA 4B6LA 1SZMA 3I6WA 3COKA 5DMZA 1LP4A 2XF0A 3WZDA 3UVQA 4BCNA 5C26A 3I7BA 3PVWA 4LGHA 2WO6A 2HW7A 1CM8A 3GC8A 4FTKA 4R5SA 1J7LA 4K11A 4NIFA 4I41A 4YHFA 5HG7A 3U9NA 4A9YA 3UJGA 2WTIA 4ASXA 4I92A 3PPKA 4C58A 3NYNA 2ITQA 3F3VA 1ZOGA 4AZSA 2XRWA 1R78A 3BU5A 2EXMA 3ZOSA 3QKMA 4EQUA 4HYSA 3UTOA 5JRSA 3NW6A 4X3JA 3REPA 5FBOA 3GT8A 3F9NA 3NPCA 4PMSA 4C02A 3RPOA 2GQSA 5FD2A 2VV9A 3ZXZA 3RAIA 3CKWA 1R39A 5CSPA 1YXVA 2XNMA 4TZRA 4G3EA 4GK3A 1U5QA 5FEQA 3IQ7A 2Z7QA 3W18A 2WTVA 4ZAUA 4JQ8A 5AR5A 4AN3A 1M52A 4I0TA 5HICA 3QZGA 4DG0E 4HYIA 4O0VA 3HLLA 3Q9WA 5J1WA 1LPUA 3KU2A 5HD4A 4L8MA 2OSCA 2QHMA 4I5MA 3E87A 3HRFA 3GCUA 3R8LA 4ALUA 4C36A 2J51A 3JVRA 3QX4A 3VO3A 4D2WA 4F08A 4QT1A 3HV7A 3O8PA 4GFMA 1FMKA 2XK8A 4V01A 4UB7A 3U54A 1TVOA 2CGVA 2O3PA 4L46A 5CF8A 1T45A 4QTAA 2IVTA 4WG4A 1KE8A 3KB7A 3O2MA 5BUJA 3KXMA 3FXZA 4I24A 2XH5A 4BGHA 4WIHA 4BZOA 4DH3A 3ZMMA 2BRMA 5I0BA 2PL0A 3VW8A 4ZMEA 4JOAA 4HVGA 3DFCB 2QKRA 4OAUC 4DBXA 3FY0A 1S9JA 2QOOA 4FMQA 4W9XA 3I0QA 4KKEA 3V01A 3PXZA 4G6NA 5HU3A 5IZFA 4MXYA 4PMMA 4ZJJA 4IB1A 2IZUA 3RINA 2JKOA 4TWOA 3VUTA 1DI8A 1SYKA 4JAJA 3BI6A 2C5XA 4JDKA 3CS9A 3Q04A 5L8LA 3A8XA 4L44A 2X6EA 4I6BA 4D1ZA 3D7TA 3TZ8A 1YI6A 3LMIA 4WRGA 3O71A 4GUBA 4PPCA 4RJ7A 3WF8A 5EYCA 4QMVA 4X2KA 4EOQA 3AC3A 5LJJA 3PA3A 2A2AA 4OTIA 4PNIA 4I4EA 2A1AB 5GHVA 2HY0A 3MFTA 2OI4X 3VBVA 2WQNA 4RG0A 4DFXE 3OVVA 2OBJA 4NW5A 4AGDA 3MY1A 3MIAA 3C4XA 5CQWA 3ZM4A 4G31A 5AR4A 5E8TA 2PMNX 4LMNA 3DJ5A 1YHVA 5CU4A 1E9HA 4F70A 1B39A 5KKRC 4Q9ZA 3AG9A 4OT5A 2YLFA 2UV2A 5ITAA 2PUNA 2OKRA 2BFYA 4W4XA 3L8VA 3DA6A 4GL9A 3QYWA 2RF9A 4DFZE 3PLSA 3DQXA 1YDTE 2C5NA 2R3LA 3RMFA 2ZMDA 4ZTLA 3QKLA 3FMDA 4RFMA 2YM8A 5H9BA 2X2LA 5HI2A 5HLNA 3LFQA 3L9MA 2Q83A 2YM4A 3HVCA 5BYLA 2F4JA 2J2IB 3SRVA 3JPVA 3VHEA 3BBTB 4KA3A 2X1NA 5KMJA 2R7IA 1RE8A 3P08A 2H34A 4NTTA 2FYSA 4P4CA 5IDPA 3R7IA 2WMTA 3PTGA 4L7FA 4UMRA 2UZUE 3MWUA 3ZUUA 3ZO2A 4ACCA 4C4HA 1JSUA 4CFNA 4CKRA 2W7XA 5E1SA 4YJVA 3F5XA 4C4EA 2W9ZB 1M2QA 2YN8A 4B8LA 4JL9A 3EYHA 2RL5A 4G3GA 4YZBA 5K5XA 4XS2A 5M08A 2XBJA 4FSZA 4ZSAA 4YNOA 3EQPA 5CAPA 2C5YA 3N4UA 3DLZA 4FTCA 4IAIA 5M56A 5B2KA 1FOTA 4EH9A 2ITWA 4NM0A 1UU7A 4D9UA 4N6YA 1GZOA 2OWBA 4TWCA 4U3YA 5JEBA 2IW8A 2G2IA 3A7GA 3HMOA 5M09A 3I0OA 4I6FA 2B4SB 3AQVA 4KINA 3PLAE 5IA4A 4EHGA 3IDPA 3PWDA 3U8WA 4JNWA 3G15A 4IB5A 1JKLA 1XBCA 2YIYA 3SOAA 4RRVA 4RWKA 4YNEA 3QWJA 2CMWA 3QTWA 3PDTA 1HOWA 3EQCA 2O5KA 4FZFB 3UC4A 2BKKA 1OKWA 2GNGA 1ZMUA 2KTYA 3C9WA 4L67A 3FKLA 1W84A 2XM8A 5A4TA 2WMVA 3RCJA 3PP1A 1NA7A 5AMNA 4EQCA 1OB3A 4CMTA 4Y73A 4JG6A 4DFUA 4HNFA 4UY9A 4ZTQA 3KRXA 1MRYA 2JLDA 5ANOA 5J8IA 5HD7A 1YDSE 3FXXA 5EM5A 3SAYA 3VNTA 5D12A 2IN6A 4EH4A 3MTFA 2W5BA 1H1QA 4U97A 4UMPA 1JPAA 2WAJA 3I6UA 1E1XA 2UZTA 3OZ6A 4RZVA 3F6XA 3C7QA 3ZUTA 4TY1A 5HVYA 4M66A 2BZKB 4F64A 5HTCA 3PJ8A 2JGZA 5DGZA 4DE4A 2XK6A 4XV1A 2HXQA 2RG5A 2DYLA 4U43A 3FI4A 5CXHA 4AWIA 5AM6A 5E8VA 2UW4A 4FSTA 4O7TA 4YLKA 5JFSA 3BIZA 4QMTA 4AW0A 4LGGA 4ZK5A 1YXSA 5BUIA 3DBCA 2PUUA 5CS6A 4F9BA 2RKUA 2PVKA 5AUWA 4YUQA 2KULA 4O0YA 4ZTRA 3DNDA 4O6EA 3CTHA 2JDVA 2C0IA 4RPVA 3SKCA 4BCHA 4C4IA 4YGAA 1ZYDA 2QOCA 4PTGA 4FYOA 3OTVA 4OTWA 4IFCA 4D55A 4HGLA 4DTBA 1RW8A 2OICA 2VWWA 2VX1A 4FTUA 1PMNA 3DY7A 2CCIA 3RK5A 3ZYAA 4BDFA 3S0OA 2ACXA 4IVAA 3QCYA 3DBEA 4NSTA 4WBBB 4KIPA 4QD6A 3PZEA 2QQ7A 4LI5A 4PY1A 4A9SA 2JFLA 4R7HA 4BBFA 5FTGA 2UVZA 3ORPA 4BWKA 5AP0A 4NJDA 3NUSA 2WMQA 4PTCA 3IOKA 3LXPA 3GNIB 3POOA 3ALNA 1GIJA 4I5PA 4I93A 2Q0BA 2CLXA 5KBRA 2BALA 3QUPA 4S32A 4U6RA 4EK4A 1W98A 5LMBA 3TTJA 4D0WA 4MKCA 4EJ7A 2PE0A 3GC7A 2UZWE 3DB8A 4U40A 2XIZA 4GT4A 5AV0A 3IKAA 1IA8A 4QYHA 3GP0A 4YU2A 2YJSA 3TIZA 1WVWA 3LFBA 3C0IA 3QRIA 3H0ZA 5CSVA 5CEIA 2A0CX 2J7TA 3TNHA 4HZSA 5KX8A 2NRYA 4DFLA 2IVSA 4JRNA 3LE6A 1OL1A 2OIDA 2A19B 4G3FA 2WU6A 4IC8A 4U41A 4ASEA 5DRDA 3LCOA 3ZBXA 4JVGA 4CMUA 1M7NA 4RIWB 4ENXA 1WMKA 2QLUA 3D2KA 4FEXA 3KK9A 3QF9A 4IJPA 4A4LA 4BDAA 1YI3A 5CT0A 5HIDA 4S30A 4FX3A 4ORKA 3ZRKA 3CTJA 3BGQA 5ACKA 3W8LA 4TT7A 2C6MA 2Y9QA 3GCVA 4I0SA 4KNBA 4QMOA 5BVFA 2VU3A 2X9FA 3NWWA 2RFNA 2YM7A 2PY3A 2PVHA 3FEGA 4FV1A 1NVRA 3UQFA 4IH8A 2YISA 5CAVA 4ANQA 5CAUA 3Q2MA 3EFLA 4AT3A 3I4BA 4P90A 5CXZA 3C13A 4FSRA 4D1XA 4UWCA 1Q99A 4IZ7A 3VJNA 4UZDA 4D28A 4QP7A 4F9YA 1YW2A 2GS2A 3D0EA 3HX4A 1RJBA 5AR7A 2PMOX 3V5PA 4GW8A 2OJJA 4G2FA 3QQGA 3OW3A 5HCYA 3F5PA 2JD5A 4XLIA 4IVBA 3KVWA 5JSMA 5IUGA 5AA8A 2VTPA 3ODYX 4CV8A 3FXWA 4EQMA 3RZBA 3D5WA 4O86A 2E9OA 3GU4A 4U42A 2J90A 4FEWA 3GCQA 4AAAA 2OXYA 4FV4A 4GJ2A 4M8TA 3UMWA 2P2IA 4F6WA 5I9WA 5IA1A 5JFWA 1QPCA 3R8PA 4QPSA 3RPVA 4FL1A 4RVTA 3VS1A 4PRJA 1OKVA 2DUVA 4L9IA 4QMQA 3IDBA 3V51A 5DHJA 3LJ0A 5G6VA 3D4QA 4XJ0A 2Z7SA 5E8XA 1CDKA 5CY3A 5ETIA 2QI8A 2PSQA 4D4SA 4XX9A 1JVPP 4QP6A 4BZNA 5L2QA 2VTMA 4ZP5A 4FUXA 3VBQA 4RFYA 3ROCA 3HP2A 4J95A 1OECA 4TTHB 3UNZA 2PVNA 3G9LX 3OS3A 1REJA 4IAYA 4OTGA 4BCQA 4FZDB 3P4KA 4TL0A 1F5QA 4IVCA 1NW1A 4MXXA 3DS6A 2X8EA 5DBXA 2E9NA 4FKUA 1KV2A 3WIGA 5HE0A 3MS9A 3O23A 5CTPA 5CALA 2I7QA 4QYGA 1JLUE 2HCKA 2ERZE 3TJDA 5HO8A 4G6OA 3CD3A 4FYNA 4AX8A 5C01A 3KN6A 2YM3A 5C8MA 4GG5A 3UODA 5FP5A 3R01A 4BHNA 2B9HA 2XIYA 4RA4A 3ZS5A 3TN8A 4O7YA 3NVKI 1ZYCA 2XYNA 4X0MA 4BF2A 1JQHA 2VTRA 3QTIA 4IADA 2YCRA 4UWBA 3K2LA 4FT0A 2LAVA 2OU7A 4B7TA 4K9YA 3L8SA 4DN5A 4TYGA 4FVRA 4GJ3A 4AW5A 3PVUA 3PXRA 5HORA 2NNWB 3ACJA 5CSHA 3NR9A 5DA3A 4LOQA 3IECA 4G34A 5CASA 2PZPA 2J5FA 3VS6A 3F66A 3P7CA 3H0YA 3UO6A 3KRRA 3QZIA 5HNGA 4AS0A 3H9OA 1BYGA 3QRTA 4YTCA 4NIFB 1V0BA 3A7JA 4JBQA 4EK6A 3TV7A 1Q41A 3E64A 3VUMA 3PJCA 2J5EA 4II5A 3RJCA 5HG5A 4WNKA 1OUYA 3R0TA 3EQHA 2I6LA 3UQGA 4DYMA 4F7SA 1PKGA 3A4OX 4BDJA 3W55A 2DQ7X 4DLJA 5FM3A 1JBPE 4HNIA 2BFXA 3NYVA 3FYKX 3W1FA 4IWPA 4DINA 3OMVA 3WIKA 4IACA 4J53A 3L8XA 3ZLYA 2C1BA 5BVKA 3NMUF 3MSSA 4YC6A 2OF4A 4TKSA 3TKUA 4AA5A 3E3PA 4WNOA 4YZMA 1Q24A 3ORZA 2EVAA 3ENMA 3ORXA 3RKBA 1XH9A 4AZVA 1IAHA 5ACBC 2XYUA 2CKOA 4DCEA 2RIOA 2FO0A 2QOLA 2Z7RA 2NRUA 5AX3A 3L8PA 3LCSA 3ENHA 3V5QA 2GTMA 2QOHA 2C1AA 5M4UA 4BN1A 4QQCA 2SRCA 5DN3A 5JKGA 4MXCA 3QQFA 3DAKA 3A7FA 2CGUA 4I5HA 4FSNA 3A62A 3RWQA 3FQHA 3Q2JA 4YR8A 2W05A 3FYJX 3PG3A 5EM7A 3C0GA 1GAGA 4G17A 4X2GA 2CNQA 5CLPA 4MAOA 3QXPA 4C3FA 3KQ7A 4RX9A 3DOGA 5F4NA 5IA5A 3LLTA 1PKDA 5TOZA 3FL5A 1STCE 3FI2A 4GSBA 5JZNA 2B52A 3JUHA 2W1GA 4FV2A 3UOJA 4MD8E 3MJ1A 2OK1A 5HNBA 3AGLA 3FJQE 3QA8A 4QMXA 2WTDA 4M69B 4UWYA 4CQEA 4FTTA 4E4NA 5DYJA 3E7OA 3WI6A 3MV5A 3QKKA 2X4ZA 3AMBA 4USEA 4J71A 4DFYA 3NYOA 1ZLTA 3D7TB 1YXUA 1JKKA 1GNGA 4UMTA 3UIUA 3PA4A 4FOBA 4ZIMA 4NL0A 3WZKA 5DNRA 4DFBA 2BDWA 4N70A 2BVAA 5IMXA 1ZYJA 4U44A 3HRCA 4MTAA 1SNXA 1YOLA 3H10A 2J9MA 2XEYA 2WEVA 4FNXA 4FV0A 1MRUA 4AN9A 3E8EA 3O51A 4Z7HA 3SGCA 2F2UA 3HV4A 3LCTA 5FXRA 4YPSA 3PPJA 3PP0A 5AAEA 3QUDA 3TCPA 1XKKA 3FZSA 2R9SA 3FE3A 4J99A 1WBSA 1H07A 4M13A 3MFSA 3CQUA 1PW2A 3CPCA 3RPSA 5A4EA 4YHJA 3HV3A 4AT5A 2VWUA 3KF4A 4FL3A 3K54A 4ASDA 5GZ8A 4J98A 2UZVA 3MI9A 4IIRA 2YEXA 2C0TA 4HCTA 1JKSA 4TW9A 5CEKA 3VW6A 3CBLA 1S9IA 4EORA 4YZNA 5F20A 3HUBA 3SRVB 3FZTA 3UE4A 4HOKA 4RBLA 2WOUA 3VUHA 1ZYLA 4C4JA 2CNUA 3A8WA 4ITIA 3RNIA 1REKA 1OBDA 2WMRA 2WTWA 4IANA 3VF9A 1SVGA 4BWXA 4OLIA 3QQUA 5CSXA 3LMHA 3FDNA 3IONA 2UW5A 3ETAA 3GENA 4P5QA 4ZMFA 4YLLA 3DZQA 2UVYA 4EOOA 3AD5A 2HZNA 1H4LA 5DR2A 2OF2A 2JIUA 5HEZA 4RIWA 4M12A 1P4FA 2PWLA 4IAZA 2V22A 5EYDA 3CSVA 4WD5A 1Q62A 5KE0A 3U55A 3NX8A 3ZBFA 3PA5A 1MP8A 4XV3A 4W8DA 1JWHA 2FUMA 1WBPA 2B54A 4PDPA 4EH3A 1H27A 4UALA 2C30A 4AUAA 4XG7A 3QZFA 2VAGA 2PMIA 3PXQA 3W2OA 2XCKA 3DV3A 3Q9XA 3R21A 2GS7A 5EG3A 2RFDA 2OZAB 4DGGA 3KMUA 3CQWA 2J0JA 3EQGA 5LVNA 2ITVA 3JXWA 4UXLA 2YA9A 2C3KA 5D1JA 2B9FA 1YOJA 5C4KA 3DXPA 2R0UA 3O7LB 5KHXA 2UW0A 4QMWA 4PL3A 2XVDA 4EBVA 3UZPA 3BEAA 4M3QA 5JQ8A 4MD9E 4PP9A 4ZLOA 3R6XA 5A4LA 4O0XA 3V8TA 4U79A 4YZ9A 3HMPA 4NH1A 3M42A 3QRJA 2P3GX 4RLKA 3E88A 4X3FB 4PPAA 4X2NA 4PMTA 4QOXA 4EYMA 3QGYA 4ZY5A 4NYEA 2BHEA 2Y6MA 2YIRA 4FIEA 2PZ5A 3MPTA 1CKJA 4OUCA 4FG8A 4FK6A 4KSPA 3R9OA 4BCIA 5KBQA 4CSVA 2YITA 3CKXA 3MN3A 2VGOA 1YXTA 3NLBA 2PVLA 4I22A 3ZXTA 4F65A 4DCAA 4J8NA 5AR3A 4ZJVA 3ZO1A 1A9UA 2IG7A 3NUPA 3TZ7A 3R7VA 2B9JA 5CVGA 5AUXA 4EI4A 4ANMA 1YWRA 5CVHA 5HBHA 4Y8DA 1ZY4A 2BIYA 5E8ZA 4HVHA 4A9UA 4CCBA 4L42A 1PJKA 4AOTA 3D15A 3FPQA 4X6RA 2PULA 2VWVA 2QKWB 4JG7A 3W33A 2X2MA 3PZHA 5L3AA 3LJ2A 4CT2A 5I3OA 4DT9A 5FP6A 3UNJA 3DAEA 4IEBA 4XG4A 4KIKB 3TNWA 3CJGA 3T9IA 2QU6A 3LMGA 2QCSA 1ZRZA 4JX3A 4MX9A 4FKTA 3NSZA 2G2HA 4HCUA 2WMAA 4KS7A 3OW4A 1XWSA 3KY2A 4Y46A 1JSTA 3CY2A 2ITYA 2WMBA 2PVRA 5HTBA 3JS2A 5EYMA 3UPXA 4F9AA 3HMNA 4FI1A 2BRGA 2I0YA 4XG8A 3AT4A 3ORKA 4CYJA 4GMYA 3JY9A 4XBRA 4C2WA 1OITA 3R7UA 4YSJA 4DGLC 2YM5A 2IVVA 2WEIA 3OFMA 4FT5A 1M2PA 5DT0A 4B4LA 4ZXTA 2X81A 4CTBA 3BRBA 4LG4A 3LIJA 3QL8A 4W4WA 3QQLA 3QZHA 2ERKA 2O8YA 4O0SA 2YDJA 2BAJA 2OFVA 4AGCA 1H1WA 1YDRE 4EOIA 4Y95A 3OXTA 4AU8A 3UO5A 3ET7A 2QU5A 2A27A 3E8CA 3KCFA 4NTSA 3RPYA 5BVDA 5AIKA 4DLIA 5JFXA 3FY2A 2F7XE 2UUEA 2W06A 4LRJA 2BCJA 5H8EA 1I09A 1UU9A 3R04A 3MH1A 4FT3A 4AP7A 3JY0A 4CFMA 4CLIA 1DI9A 4R5YA 4G16A 2EB3A 3RGFA 4E5AX 4LUDA 4O38A 4LOPA 2IW6A 2OG8A 3R2BA 3VBTA 1UKIA 1UKHA 1H1RA 3VC4A 4CLJA 3WYYA 2I0VA 1W83A 4QTBA 3TZ9A 4BYJA 4C4FA 5EQYA 4BYIA 4RJ8A 3EZVA 2PVFA 2OW3A 1YXXA 4RT7A 3EFKA 5I3RA 1ATPE 3FMMA 3QTQA 4BKZA 3TI1A 4D2SA 3OWLA 4MHAA 4UYNA 3C4EA 3QXOA 2QLQA 5EFQA 2CKPA 4WNPA 4NM7A 3QFVA 1OM1A 3NNWA 5CQUA 3LXLA 1UWJA 5FDXA 5AIRA 3MIYA 4DG3E 2QURA 3MGYA 4FV7A 2QO7A 3F82A 4FK3A 5D10A 3PJ1A 4F7JA 4GIHA 3CE3A 2QC6A 3AT2A 4C8BA 2ZB0A 2E9UA 3UIMA 2R3IA 2B9IA 4GV1A 4ACDA 4R7BA 3QLGA 1ZWSA 2YCFA 3ZLSA 3DK3A 2X0GA 4IX6A 5HX6A 3SG8A 5D9HA 3GGFA 2OH0E 2YFXA 3VBWA 4F6SA 5JMSA 4DAWA 4APCA 1FVTA 2ITUA 2R3FA 3EN5A 3DGKA 2FSOX 3VS7A 5HNIX 4BI1A 3OWJA 4ZS0A 3QTXA 4H3PA 4R3PA 4DH8A 2ZV2A 3KULB 2QO9A 4CFVA 2ZM1A 4OTQA 4ZZNA 3PWYA 4FEUA 4JDHA 3CIKA 2C4GA 4K2RA 4QTDA 5BVEA 4G1WA 4YJTA 2XZSA 5EYKA 3DBFA 3H4JA 1H8FA 5AP3A 3V6RA 4U8ZA 4YC8A 3LQ5A 3R63A 4AA4A 3TUBA 3EB0A 4IX3A 2F7ZE 4M69A 3UYTA 3KKVA 5IISA 1YWNA 3LAUA 3POZA 4FTLA 2JKKA 3U9CA 3BYMA 4GCJA 2VTLA 4MQ2A 2O2UA 4EC8A 4JAIA 5ANEA 2WMUA 3EZRA 3HV5A 3NW7A 2OZOA 4JBVA 1GOLA 3DDPA 3FLZA 2GQGA 1XQZA 4K8AA 5TO8A 5CF4A 4D5KA 3BLRA 3G6HA 2R5TA 3RM6A 2PZRA 4IB3A 1Z9XA 4IJ9A 4NFNA 4A4XA 5HE2A 2V62A 4FTOA 1WZYA 3HYHA 3QCXA 4IX5A 3AT3A 4FTIA 1SNUA 2IO6A 1J7UA 2JKMA 4H05A 5EHOA 4PTEA 3DNEA 4RJ5A 4F09A 3GC0A 3HUCA 5CU0A 4ZSEA 1PRYA 2G01A 1H0VA 3KEXA 4OAVB 1FINA 2BDFA 2BHHA 2E9VA 2EU9A 5K4IA 4DHFA 4FKPA 2E9PA 3K3IA 2JBPA 3TWJA 4FVQA 3R7YA 5IPJA 2ITOA 3GB2A 3W2PA 4G9RA 1Q4LA 4BRXA 1XO2B 3P9JA 3ZHPC 4G3CA 4D2PA 3FMLA 4YZDA 2FSTX 2UZOA 1ZARA 3RPRA 3F3UA 4JLCA 5LVLA 5C8NA 5BMMA 5HBJA 4DITA 2FGIA 3GFEA 4TPTA 5LMKC 4XOZA 5CWZA 3O8UA 4IB0A 4H36A 4EOSA 1M2RA 2ITZA 2X9EA 3THBA 4ARKA 4D0XA 2BRBA 2R0IA 3IS5A 3KREA 2XRUA 3LM5A 1IR3A 4TYEA 3EQIA 4WNMA 5K5NA 3QRUA 4AGUA 2BAKA 2PMLX 4O21A 5AADA 5IQAA 4XCUA 3EN9A 4PF4A 5HX8A 3N4TA 3EQRA 2FSMX 5FXSA 4JIAA 3V6SA 2QO2A 3DKOA 2WTJA 1YWVA 4BTMA 2OZAA 4O7NA 1SVHA 3BYSA 3ZSHA 2XEZA 4KABA 3SD0A 3GBZA 2ESMA 5C27A 4Y85A 4FV6A 3IDCA 3BZ3A 4IDTA 3OCBA 4HW7A 4E5BA 4M15A 3TL8A 1SM2A 2WOTA 3UP7A 4E6AA 2VWZA 4DH1A 2BRHA 3OUNB 2JKQA 4UX9A 3BWFA 3U6JA 3TNPC 1JAMA 5CNOA 2HXLA 2PHKA 1VYWA 1OIQA 1YRPA 2C69A 3CQEA 4S31A 2VNWA 3CCNA 4X3FA 4XUFA 1NVSA 1KUTA 2PUIA 5IQBA 5M4IA 3BQRA 3MFUA 1AD5A 4JR7A 3F3TA 2ZOQA 2F9GA 3MPMA 4EOKA 3DJ6A 3COMA 1OGUA 3F2AA 4FTNA 2VTAA 3RVGA 1OI9A 1OBGA 3ZLWA 4CVAA 2IPXA 4BFMA 1XBAA 5T3QA 4IHPA 3PYYA 3ZFYA 2JDSA 4GVJA 3SDJA 2XNNA 5HZNA 3QHWA 4H58A 5ETFA 4AN2A 3SXRA 5E8WA 4BTFA 3ORMA 1X8BA 3MY0A 5C8KA 4I5CA 2JEDA 4AZWA 4E20A 4NK9A 4PDYA 5I9UA 3RP9A 3TEIA 2CN8A 3B2TA 3UZRA 1PYXA 2FVDA 3RCDA 2XKDA 5AAFA 5ANDA 1UNLA 4GK2A 4JR3A 3MESA 3G6GA 4C3PA 3NRMA 3WARA 3ORNA 3PIXA 4Z3VA 4BICA 4EHVA 2X7GA 1GZ8A 3IOPA 4KIKA 4W4VA 4BGGA 4ID7A 4DFNA 5HCZA 2PZIA 4RLLA 3FPMA 1YKRA 5HHWA 2YCSA 3PY0A 2R7BA 2GFSA 3C4ZA 5CEPA 4DG2E 2VO6A 2HAKA 4A07A 4O83A 3HDNA 3V8SA 2ITNA 4U45A 3QAME 4MQ1A 5DRBA 5EOBA 4BC6A 1Y8GA 3BHTA 4IMYA 5FWKK 2XM9A 1UU3A 3GCSA 3R9NA 1Y8YA 4C2VA 1IA9A 4M68A 3UG1A 4RC3A 2PU8A 3HA6A 3O8TA 2GFCA 3RAHA 3LHJA 4R6VA 3PY3A 3DK7A 3OT8A 2WKMA 1Q5KA 1XR1A 2PK9A 3O0GA 2OJFE 3O7LD 4XMOA 4YJSA 5IEXA 1ZOEA 5J95A 3VULA 3NNVA 3H3CA 4AGWA 4RWIA 3COIA 4BBMA 4X6QC 3UGCA 1BMKA 5IQFA 2W5AA 1APME 5BUEA 4JS8A 4WRSA 3ANQA 3MFRA 2VO7A 4WSYA 4PUZA 3EH9A 1PHKA 3W16A 5C1QB 4I94A 5CT7A 1IRKA 2IZRA 4TYIA 4EOMA 1HCLA 5D7AA 4QQ5A 3BELA 3R71A 1CKIA 2ZMCA 3KXZA 4QMZA 4FR4A 5CF6A 2FB8A 1I44A 2G1TA 4PV0A 4RWLA 4BI2A 5AUTA 4AW1A 5TF9A 4XRJA 3GCPA 4QP3A 5EK7A 3OOMA 5H3QA 4F4PA 1ZYSA 3UBDA 2YIQA 1Q61A 3OCTA 4D2TA 5IA3A 4A7CA 4NU1A 2B53A 3ZLXA 1DAWA 1J1BA 4A06A 2YWVA 5M06A 4EK5A 3UIBA 4ITJA 2XCHA 3BGPA 3MYGA 3BX5A 3HL7A 3QU0A 3SLSA 5JQ5A 1NY3A 2C6DA 5IU2A 4O84A 4MVFA 3NUUA 1RDQE 3W10A 5FEEA 4S33A 4JG8A 4JBOA 5EDQA 3ZUVA 3NZ0A 4R3CA 4EK8A 1U46A 4AZTA 4BCPA 3D2IA 3EN7A 1UU8A 4RZWA 4DEBA 4F0GA 1EH4A 2PVYA 4F9WA 4DEDA 5KMOA 3FHRA 3KXNA 4FZ6A 4IZYA 5EKOA 3UVRA 3D94A 3PUPA 4MNEB 4KAOA 4B99A 2VWXA 4DGNA 3CD8A 3MH2A 2NPQA 3OP5A 3R7GA 2WIHA 5I9ZA 2HOGA 3ZRLA 3TZMA 3P86A 1UA2A 3KK8A 4K6ZA 1GY3A 4U9AA 5M4FA 3FLYA 4ERWA 5M57A 3ZSIA 3S95A 3IO7A 4GH2A 4HYHA 3CGOA 3G0FA 1Q8UA 3ODZX 5AX9A 1BL6A 3KULA 5DE2A 4C7TA 3R2YA 4J96A 4Z16A 5EQPA 1E1VA 4I0RA 2R3QA 3FLQA 3DKGA 2ZAZA 2J4ZA 3BPRA 3Q9ZA 4JRVA 4L53A 1JNKA 3OTUA 4YHTA 4D2RA 4ZZOA 5M44A 2C3LA 5AV4A 3EL8A 4QNAA 3QBNA 3ZC6A 4QMPA 5BYZA 4EZ3A 4QMSA 3RAWA 4X3FC 3HV6A 2VWIA 4J52A 4MCVA 4BCMA 4ACMA 4CGAA 3BHVA 3ORLA 1P2AA 2I0EA 3OT3A 2JAMA 4Y83A 5CU3A 2W17A 3MVLA 1FVVA 3KC3A 2QOIA 4RX5A 4NCTC 3NIZA 2F2CB 5JGAA 5F94A 4YJPA 4IZAA 5DVRA 3SG9A 5KMNA 3BE9A 3DZOA 1R0EA 1WAKA 5DG5A 5HKMA 1U4DA 2LGCA 4WT6A 1O9UA 3IW6A 4LMUA 1R1WA 5M55A 1BKXA 1KSWA 3MA6A 5EW9A 3F7WA 3UC3A 1K9AA 5EI6A 1OMWA 2XK3A 3R22A 5FTQA 2EWAA 5D11A 5IA2A 2R3HA 2B55A 4USFA 3BV2A 1Z5MA 4FTQA 3VS3A 5E4HA 3P23A 3BQCA 5HIBA 4O0RA 2YCQA 4MWIA 4B8MA 3LFNA 3OG7A 3A7HA 3CY3A 4IQ6A 3AC1A 5CVFA 4FKWA 4AFEA 5BQ0A 5KMIA 5FBNC 3G51A 2ITTA 2Z7LA 5BVOA 2HWOA 5LMAA 4LL0A 3PRFA 2DWBA 1P4OA 4CEGA 3HAVA 3ELJA 3HECA 4W4YA 2PVMA 3ORIA 4RIOA 4K77A 3L9PA 5A14A 5E90A 3KF7A 2HELA 3CPBA 3LFFA 4ZJIA 3DK6A 1VR2A 5BX0A 2XK9A 1GJOA 4UV0A 2ZM3A 4BIDA 2C6EA 2GHMA 4B0GA 3K5VA 2JITA 1DM2A 4FKQA 1Y6BA 3E62A 3PE2A 3CTQA 2B1PA 2P0CA 4EZ7A 2AC5A 3VVHA 5BPYA 3A99A 4FBXA 4DBNA 2H9VA 2ETRA 4DTAA 2PYWA 1KE5A 4RMZA 4E73A 1CSNA 4L43A 3HA8A 3I79A 5IDNA 1ND4A 2G15A 3U6IA 1FQ1B 5AP4A 5DLSA 4APPA 3KL8A 1KE7A 4QTCA 3B2WA 5IH6A 4R1VA 4EBWA 5M53A 1UVRA 4L6QA 3FV8A 5B0XA 4QYYA 2ONLC 3GU5A 2VWYA 4P5ZA 4KBKA 5KMLA 3DXQA 4TYJA 4W9WA 1ZZ2A 4X2JA 4DEHA 4BDGA 5HQ0A 4TNBA 2XIRA 3WF9A 3D9VA 3OY3A 4KKGA 1OUKA 2H8HA 4JBPA 4ITHA 4QO9A 5A4QA 3KXGA 4X7QA 3DKFA 5HTIA 3RTPA 4NT4A 5C9CA 4WUNA 1H00A 2JIIA 3OD6X 4MEDA 5DR9A 3TT0A 4G3DA 4J7BA 4E26A 4FIJA 3VRZA 3NCZA 5IKWA 3R8ZA 1O6YA 3EFWA 4HZRA 4CFWA 1FBNA 5F9EA 3EKKA 1QL6A 4WHZA 3LKMA 3SW4A 4BVUA 2I40A 3QQJA 5A6OA 2ZJWA 3UYSA 4A9TA 4BGQA 3OCSA 4C38A 1W8CA 3QD3A 3OXZA 3WILA 1M14A 1H25A 3WOWA 2O65A 3Q96A 4FNYA 4GU9A 3R8UA 5K4JA 2HZ0A 1QPDA 3GFWA 4IVDA 4ZOGA 4OT6A 3VRYA 4BDHA 1W7HA 3VBXA 2JDRA 4NEUA 5FQDC 1WBOA 2O0UA 3HEGA 4Q5HA 3PJ3A 4PL5A 3U4UA 4PWNA 4HPTE 4OTFA 3EOCA 4GG7A 5FTOA 3W2QA 4FIHA 3EQFA 3E3BX 4YLJA 4JQEA 2OJIA 2XNBA 3FC1X 3DTCA 5EW8A 3VAPA 3ZM9A 4ACGA 1DAYA 4P7EA 2P55A 5B2LA 1KV1A 5JK3A 1U5RA 2R3OA 5M4CA 3FZPA 4KIQA 1OPJA 5CZIA 5LVPA 4E4MA 3RAKA 2BTSA 2XNEA 2YIXA 3RHXA 3RZFA 4BB4A 5JRQA 4UBAA 2GHGA 4YTIA 3GU8A 3NYXA 4C33A 3F3WA 4DTKA 3FBVA 3MW1A 3NAXA 4DEGA 3EHAA 4CMOA 4GFOA 2HENA 1W82A 4IAAA 3H9FA 1VZOA 3Q53A 4R1YA 5DH3A 4E6QA 1OZ1A 4R77A 2UW6A 5BVWA 1ERKA 4YJNA 1M17A 4RJ4A 4UMQA 4PMPA 4XBUA 2HY81 4UN0C 3ID6C 2HYYA 4F6UA 3S4QA 3V5JA 3PSCA 1B38A 4JI9A 1IASA 3KMMA 2WD1A 4C0TA 4HCVA 5KMKA 4BTKA 3CGFA 4IM2A 4KWPA 3DPKA 4X2FA 2OIQA 5ANJA 5IUHA 3NUAA 5L2IA 3MY5A 5G1XA 3BHUA 3FZOA 4TXCA 1BI8A 4RVLA 1V0OA 4QP9A 4CG9A 1TQMA 4YJOA 4CKJA 2XUUA 2DS1A 2Z02A 3ATSA 3R83A 1Q97A 2C5OA 2I1MA 4ANBA 2HK5A 1GZNA 5JH6A 3S3IA 3D5XA 3VN9A 2PPQA 4R3RA 3BHYA 4L45A 2ZV8A 3BEGA 4BDEA 3F61A 3BLHA 4EKKA 1OL5A 4O1OA 4TWPA 5EI8A 3L9NA 4AQCA 1J3HA 1LEWA 2WQBA 1VJYA 2XJ2A 2Q0NA 4FUYA 4KSQA 5JGDA 3VS4A 1FGIA 4CZTA 3IW7A 5IA0A 4QQJA 4RC2A 3KGAA 2R3KA 3DCVA 2NP8A 3MVMA 4NM5A 5LCKA 1PMUA 4DGMA 3PFQA 4I6HA 5DI1A 4EH2A 5CSWA 4MNEA 3SVVA 3FC2A 4E8AA 3H30A 4D4VA 3I5NA 1YQJA 3E93A 4EUTA 3PY1A 2GPHA 3TKHA 3W2RA 3QLFA 4EZ5A 3TKIA 3DT1A 3F7ZA 1L8TA 4XP3A 3ZCLA 3P7AA 3ACKA 4L7SA 3R9DA 5HGIA 2OXDA 4AOJA 2UZBA 4KRCA 3I7CA 2GCDA 4JT3A 5J1VA 1YI4A 2EXEA 4TRLA 3K3JA 4QPMA 3VJOA 3NUXA 3ZFXA 2YLEA 4F1MA 2ZV9A 2W0JA 5ANKA 3G2FA 4CD0A 2VTIA 4Y5QA 5L6WL 4ERKA 3CLYA 3RBWA 2BZHB 4FOCA 4WG3A 3VUGA 4NW6A 2UZEA 2UZNA 3TUCA
chains in the Genus database with same CATH superfamily
2VRXA 1U54A 3DKCA 2WMXA 4FKJA 5ETAA 3TACA 4GYGA 4EH6A 2J0LA 3P1AA 5J9LA 5T6KA 5AP7A 5FUTA 4RJ6A 4GKHA 2C3IB 3F2NA 4HVSA 3P79A 4JJRA 4E4LA 2Z8CA 3VWAA 3ZSGA 2G2FA 1AGWA 3TIYA 3R9HA 2C6LA 3QRKA 3LQ8A 3Q32A 3BYVA 4WO5A 2WTKB 1Q8WA 3I81A 4O91A 5AJQA 4QQTA 5M07A 4CG8A 5AR2A 4HPUE 4JX7A 4FSQA 4QRCA 3HMMA 1VEBA 1WBWA 4QMNA 3BU3A 2UVXA 2PE1A 1ZMWA 2YAAA 3KXXA 3Q6UA 4PDOA 2W4OA 1Q8TA 3GXLA 4ZSGA 3UQCA 4XG9A 4QMYA 4RWJA 2Y0AA 3QALE 4MXZA 4FV3A 3VS5A 2QOKA 3I60A 5I5ZA 4JDJA 5LMKA 4LGDA 5IQGA 3UVPA 5H2UA 1JSVA 1J7IA 3GOKA 4S2ZA 1L3RE 2EUFB 5LVOA 3GU6A 2W1FA 4XNEA 2WMSA 4FC0A 1QCFA 5CU6A 2XIKA 4RX7A 4GYIA 4PQNA 5AR8A 4UMUA 5EH0A 3ANRA 3TNQB 2Y8OA 2QR7A 2XK4A 1H0WA 2VTTA 4O7WA 5E91A 4IBMA 4UXQA 4IDVA 5AAGA 5L6PA 5FLFA 2XNPA 4K18A 1WVXA 4ENYA 4ANSA 2R3MA 1ZZLA 3HZTA 4OGRA 3EJ1A 1OVEA 3DTWA 4ZLZA 4RIYB 3HRBA 3AC8A 5D41A 5ETCA 2AYPA 1WBVA 2V55A 4FRFA 2JFMA 4D9TA 2GQRA 4LYNA 3FLNC 3OOGA 2W96B 4HGEA 5T68A 4O7RA 3ZZEA 5A6NA 2VUWA 1GZKA 1YVJA 2W1HA 3R30A 2QR8A 4FG9A 4FTJA 4ZTSA 3R7EA 2EXCX 1URCA 4EUUA 1A48A 2FA2A 4V05A 5GINE 3A2CA 5HVJA 3F3ZA 3BYUA 4CFXA 3OROA 3Q5ZA 3L1SA 2R64A 3FL4A 4GUEA 1P14A 5FDPA 2B0QA 3D5VA 3VQHA 4EEVA 4XYFA 3OBJA 1WBNA 2ZB1A 4YJUA 3SHEA 5IQIA 2XP2A 1OL2A 4G5JA 4JDIA 3GU7A 5HG9A 3OF0A 4L00A 3KXHA 5M51A 4GRBA 1PXJA 4BTJA 3RALA 1PXIA 2YJRA 1OIYA 4H1JA 2HIWA 4CZUA 3TV4A 4FKOA 5LVMA 4RIXB 4ZY6A 4P2KA 5GJGA 2VNYA 3KCKA 4BWPA 4I21A 3G33A 3HNGA 2VD5A 2YDKA 5GJFA 4CQGA 1H26A 5E8YA 1MQ4A 3G0EA 3SX9A 4PL4A 3NW5A 3OY1A 3PIYA 3T3VA 4GEOA 3GUBA 4JXFA 2CKEA 2JDOA 3DU8A 3D14A 2IEWA 3P5KA 3N51A 2QOBA 3O5AA 2F49A 4Y5HA 3OHTA 5BNJA 3G9NA 3QYZA 3F2RA 1QMZA 2CJMA 5HG8A 4GIIA 1QPJA 4K33A 4TN6A 4ZS4A 4N0SA 3QTUA 5DR6A 5CZHA 4M97A 5AUZA 4DT8A 4FEVA 4I3ZA 1NT2A 3ATTA 4AACA 3C50A 4C35A 3OEFX 4XH6A 1H01A 2OJ9A 4FODA 4LV5A 5CENA 4CYIA 3BV3A 3L9LA 2XA4A 4V0GB 3R7OA 4U5JA 5L6OA 1Q8YA 1TQPA 3IG7A 3AMAA 4IXPA 2VO3A 4BCGA 4FKRA 3MVJA 3PJ2A 3TJCA 4HGTA 1T46A 4E5WA 4E7WA 3MPAA 3CJFA 3B8RA 4QP8A 5HE1A 4USDA 3RNYA 4FSMA 4J1RA 1MRVA 4E1ZA 4AXAA 2YABA 5HLWA 5AWMA 3KRJA 1XHAA 3R8MA 2X7OA 1B6CB 4U0IA 3NIEA 3BBWA 4OTRA 2C6IA 2A4LA 3RM7A 3CR0A 3IPHA 3LFAA 4M0YA 3WF6A 5ICPA 1O6KA 4YSMA 3R1NA 3EQDA 2XALA 3TTIA 2ZV7A 2E2BA 5L8JA 2WIPA 3FMNA 5I9XA 4TYHB 3LQ3A 2YHVA 3FHIA 3GQIA 4FKGA 1KE6A 3FMJA 4G9CA 4C61A 3FI3A 3KFAA 3QQKA 2BAQA 4DEAA 2XAOA 3AKKA 4XV2A 2QONA 2R3NA 3LFDA 3Q4ZA 4N57A 1F3MC 3LM0A 3AOXA 2I0HA 3R1YA 2H96A 4ZZMA 2OGVA 4FEQA 2VX3A 4O22A 2C3JA 4RSSA 5IEVA 3ERKA 3O17A 5IUIA 2YM6A 4FKIA 5E8SA 4ANOA 2ETKA 4NJ3A 4YO4A 2GNFA 2CGWA 3ZFMA 5C4LA 5HO6A 5TE0A 5EQEA 1UWHA 2YWPA 3Q4CA 3SOCA 3HAMA 2JBOA 4U7ZA 4KS8A 4FTMA 3C0HA 3QWKA 3IGGA 4RGJA 4O81A 3NNXA 1FVRA 3GEQA 5A4CA 4BHZA 1ZMVA 3BKBA 3GVUA 5GJDA 3I1AA 4IX4A 4I6QA 1TFFA 2WFYA 3VHKA 1PXOA 3O50A 4HVDA 5AP6A 1OL7A 1DS5A 1P5EA 3LVPA 4FNWA 5E8UA 5LARA 5CEOA 5LCJA 2QOQA 2P2HA 2WQOA 1SVEA 4RQVA 1G5SA 5FGKA 3ZZWA 2IJMA 4FSYA 1URWA 5DEYA 3RI1A 4YPDA 3WF7A 2WXVA 1BX6A 4M7IA 1MUOA 4IFGA 4MF0A 4O2ZA 4FT9A 5EOLA 5J87A 5GIOE 2WELA 5H8BA 2R4BA 4CCUA 3PG1A 1PXPA 4QDVA 3TDWA 3QTSA 2CPKE 3R00A 4FGBA 3WE8A 4ASZA 4G6LA 4Z55A 5J7HA 2ZYBA 5DT4A 5KNJA 3ZU7A 3AD6A 2AUHA 4WOVA 4OBQA 3LJ1A 4KBAA 4QTEA 3Q3BA 4E6DA 5CNNA 1TZDA 4EC9A 5J79A 2Y4IB 3IW8A 2NO3A 4FF8A 4J97A 4NCTA 3RWPA 2XNOA 3QTZA 5E1EA 4MH7A 4LL5A 5IQCA 4BKYA 3DXNA 4IW0A 2RGPA 2WNTA 2XJ1A 2WQEA 1CKPA 2X7FA 3DFAA 5CI7A 3V5LA 3ZDIA 2R2PA 2GHLA 2VTHA 3Q4UA 4CT1A 2PUPA 1PXNA 5AV1A 4F0IA 5LWNA 3WZEA 3UP2A 4ACHA 4EL9A 5IEYA 4XV9A 5EDPA 5GZ9A 5HU9A 2XKCA 4R78A 3Q4TA 4HYUA 2QG5A 3R9RA 3KRLA 4KRDA 3P78A 3PVGA 3PSBA 3AMYA 2PE2A 4AA0A 2QVSE 3W2SA 5CI6A 3ROYA 4WBOA 2XKFA 3GC9A 4DF3A 1KE9A 5CEQA 5DT3A 1PXMA 2VO0A 3DBDA 3GI3A 3R8VA 3UOLA 4BCKA 3UG2A 5K9IA 3RK7A 1OPLA 3QTRA 4FA2A 4V04A 4IWDA 5L2TA 3OXIA 4BI0A 3QUEA 4DGOA 4GS6A 1V1KA 4XOYA 2V7AA 1Y91A 1J1CA 2Y6OA 3II5A 4FGRA 1R3CA 1WCCA 3E5AA 3PIZA 4PDSA 3ULZA 5IQEA 3CEKA 1ZOHA 4FTAA 4BDKA 4O1PA 3D7ZA 3FKOA 2F7EE 2W1IA 3DQWA 2RG6A 4E6CA 2YZLA 2O64A 3F5UA 3T3UA 4BY9E 4JQ7A 4ZTMA 3HMIA 3E7VA 3SA0A 1G8SA 4W8EA 4O6LA 1OKYA 3UZTA 3DDQA 4CRLA 4F99A 1PXKA 4FG7A 2W1EA 2XNGA 3C4CA 2GMXA 3SXFA 3ZEWA 4D4RA 5JZJA 3VF8A 4EH8A 2VGPA 1FMOE 2W99B 4FV5A 4C57A 4D5HA 3UNKA 2GNJA 3IK3A 4ZSLA 3UMXA 1TKIA 5BYYA 4FIIA 2R3JA 5EI2A 3C4FA 4QNYA 4RIYA 3DB6A 1PYEA 4MBIA 2W4JA 3SW7A 2FH9A 5DWRA 4ALWA 3VS0A 3VUDA 3QC4A 4U3ZA 3BYOA 4LFIA 4XG3A 4CXAA 1NVQA 3WBLA 4BCOA 1W2DA 1PXLA 4NUSA 2VWBA 2IVUA 3E63A 2ITPA 4YBJA 4AF3A 3KVXA 3P7BA 1YHWA 1CTPE 4FNZA 3W0PA 2UW9A 4CFFA 3TG1A 3JYAA 2ONLA 3FAAA 1CMKE 4AE6A 4O0WA 1UV5A 3FQSA 4I23A 4L3JA 4MD7E 3QD2B 1OL6A 2W5HA 4EOPA 5J9ZA 4S34A 2PTKA 2WGJA 3FSFA 4FIFA 4IE9A 5ANIA 3ZTXA 4F0FA 5K0KA 4PNKA 2R3GA 4IM0A 1PMVA 4RIXA 4KB8A 2XJ0A 2YZAA 4LQMA 2HWPA 3UPZA 2ZM4A 4M67A 2QG7A 4AZEA 1XMLA 2BZIB 4OBOA 5E9EA 5KUPA 4DHIB 3R1QA 3R28A 3ZEPA 3ALOA 1F0QA 4AXEA 1ZY5A 3BE2A 4YJQA 5J5SA 1WBTA 2C5VA 3PPZA 1BLXA 3DAJA 4E3CA 4FIGA 4BDCA 5I9YA 1FPUA 2WB8A 3RHKA 4M0ZA 3S1HA 4QMLA 2CNVA 1Q8ZA 2VTNA 3HGKA 3AC2A 4N6ZA 4AOIA 3LFCA 2VTQA 5TT7A 3ZH8A 2OO8X 4RJ3A 2CLQA 3NUNA 1OIRA 2BTRA 3CXWA 4GU6A 5FG8A 4EHEA 3AKLA 2V7OA 3EYGA 3H9RA 4RX8A 3IW5A 4GT3A 4HJOA 4I1ZA 3V8WA 3P0MA 4AXCA 1U54B 4ZY4A 4ANLA 5F1ZA 3G90X 4C3RA 4GFGA 3M1SA 4V0GA 2WPAA 5KZ0A 3FZ1A 3SV0A 4RVMA 3IW4A 5B7VA 5CANA 2CDZA 2OXXA 4FZ7A 3F88A 3BCEA 4MXOA 2VZ6A 4AZFA 2PZYA 2Z60A 2OH4A 4C59A 4FZAB 4BDIA 2IZTA 3AXWA 3UOKA 3G5DA 3U87A 4BBEA 4LOOA 2YERA 4EH5A 4ANNA 4YJRA 1XH5A 4TNDA 2OJGA 4IAKA 4C37A 5AP1A 3W8QA 4O7VA 1Y6AA 3BU6A 2GTNA 4NKSA 4O27B 4L68A 3WF5A 4CNHA 2CKQA 2RFEA 2C47A 5KZIA 2QNJA 3FMKA 3UDBA 4IZ5A 5KKRB 3PFYA 4FTRA 4A9RA 4AT4A 1XH7A 2C68A 1IEPA 1QPEA 3AC4A 3OUKA 4YZCA 4D1SA 4TYHA 4K0YA 3D5UA 5CAQA 3FMHA 2O63A 3MVHA 3Q60A 5GNKA 5EHLA 5L4QA 2JIVA 4QP2A 4BZDA 5IH4A 4DA5A 3DJ7A 2YIWA 2WTKC 3M11A 4KD1A 4I20A 3R73A 5HE3A 3TV6A 1YOMA 3UO4A 3TUDA 1H28A 5AUYA 1YHSA 4X21A 3WZJA 3R1SA 3FZRA 4XG2A 2XBAA 4HVIA 1SMHA 1NXKA 2G9XA 2WMWA 4RFZA 4WUAA 2IZSA 1H1PA 3Q9YA 4R8QA 4U81A 4DEIA 5HO7A 1KOAA 4F7NA 4F78A 3C1XA 3EMGA 4F7LA 3N4VA 3BWJA 4J8MA 1J91A 2J50A 3ZONA 4N4SA 4BIEA 1XJDA 4BKJA 3TM0A 4C4GA 4XP0A 5HLPA 5K3YA 2CN5A 2CHLA 1RQQA 3N9XA 5GIPE 5K0XA 5AV3A 2BR1A 3C4WA 3FWQA 4GT5A 4WSQA 2REIA 5CF5A 1TQIA 4OTHA 3EWHA 2IWIA 3OWKA 4H3BA 4O0UA 2BROA 3EKNA 4IWQA 1IG1A 3FSKA 5ANGA 3NVMB 3QGWA 2UW3A 3NGAA 3SXSA 5B2MA 1AQ1A 4DEEA 2WU7A 5AEPA 5AA9A 3PXFA 2CCHA 3NAYA 4EWQA 2VTOA 3VS2A 4BIBA 4FVPA 2OLCA 3EQBA 5BMSA 3QCSA 3E92A 4XHKB 4EYJA 4PP7A 4XLVA 5EKNA 2QODA 3QHRA 4KBCA 2BDJA 5FRIA 4GK4A 2CGXA 3EFJA 5DEWA 2V0DA 5HCXA 5HIEA 5KMMA 3LCKA 1HCKA 4AAYA 2VN9A 4CZYB 2ZDUA 2J0KA 3QQHA 4MXAA 4AW2A 5I9VA 2W9FB 2W1ZA 5TKDA 2GNIA 4AE9A 2J0IA 2Y7JA 4FSWA 1BL7A 5EM8A 3F69A 3GQLA 2GDOA 3JVSA 3V5TA 3LXKA 4TWNA 3VQUA 4IAFA 3A7IA 4LV8A 2X2KA 4KIOA 5A9UA 4E93A 3TXOA 4CKIA 3C51A 3HKOA 5CU2A 4QMUA 4NZWB 5CX9A 2AQXA 4KUJA 4NM3A 3C5IA 5AUUA 2BRNA 5KO1A 3LFEA 4BDBA 5EM6A 2HZ4A 3A60A 2CSNA 5AP2A 4FICA 2C0OA 1Z57A 4L3LA 4O4BB 1ZXEA 3OEZA 5L2SA 3NCGA 1O6LA 2C6TA 3Q52A 4IC7A 4PX6A 3MH3A 5E92A 3AGMA 3LOKA 3SC1A 4DH5A 4EK3A 2RSVA 5JN2A 4HGSA 5JT2A 2Y4PA 4Q2AA 1IAJA 4ZSJA 3U51A 3E8NA 1G8AA 3PXKA 3SQQA 1PF8A 2VTSA 4FV9A 3UIXA 1Y57A 3ITZA 5TR6A 4ZTHA 3WE4A 4FKLA 3NDMA 2B7AA 3AD4A 1K3AA 4BCJA 2XB7A 1GIIA 2GNLA 5J9YA 3A4PA 4UYAA 3W32A 4LM5A 4GVAA 3EIDA 4QDEA 4ALVA 4FKVA 2PVJA 4IWOA 4QYEA 4FV8A 5IH5A 3PRIA 3DLSA 5L8KA 2X39A 4EH7A 4O7ZA 2X6DA 4ZEGA 4BR3A 3K5UA 3Q6WA 5LXMA 4C62A 1ST0A 4H1MA 4JIKA 3ULIA 4ZLYA 3T8OA 3OC1A 3BHHA 1MQBA 3QX2A 5IMEA 4QYFA 4E4XA 1JOWB 4YBKA 1H1SA 5E7RA 4O7LA 4Q9SA 1UNHA 4EONA 4DH7A 2W1CA 2XAMA 3EL7A 2XKEA 2Z2WA 5DIAA 3QA0A 4MWHA 5C03A 3LZBA 5L2WA 3MH0A 4BL1A 3QC9A 4D2VA 3IGOA 3FLSA 3BL7A 3E8DA 5FM2A 4QPAA 2J0MB 5AUVA 1JKTA 2UW7A 4O7SA 3FLWA 1KWPA 4LRKA 3KN5A 3O96A 4AFJA 4L01A 1H08A 4YTHA 3B8QA 2P4IA 4PPBA 3MB7A 4D58A 2GNHA 2ETMA 3VUKA 5LOHA 4H39A 4MF1A 4Z7GA 3VBYA 4AQKA 2XK7A 3FMEA 4DC2A 2W1DA 4KKHA 3VUIA 4R7IA 1R0PA 5DOSA 3ML1A 3NS9A 3ZO4A 5F95A 2ITXA 4O96A 4O82A 4YP8A 3DBQA 4C34A 3PSDA 3MBLA 2X4FA 2WHBA 4F9CA 3LW0A 3ORTA 5KCVA 4YO6A 3KA0A 4CRSA 3COHA 3KMWA 2F57A 5D7VA 4LDTA 4NKAA 5J5TA 3ZDUA 3BLQA 2UZDA 2X8DA 2V5QA 3TDVA 1KOBA 4FKSA 2H6DA 4L3PA 1XH6A 2JDTA 4FE2A 3OBGA 2BKZA 1XH8A 4Q5EA 4NWMA 4QP4A 4WA9A 4YURA 2X8IA 5A3XA 2FSLX 2VTJA 3RK9A 4Z9LA 2XIXA 3KRWA 4LRMA 5BVNA 1PMEA 4UEUA 4XG6A 5HOAA 5IG1A 2ZDTA 3D83A 5JGBA 4OW8A 4FT7A 3V3VA 2BZJA 4XP2A 4ZTNA 4I4FA 1WVYA 5AV2A 1LEZA 4OR5A 4D4YA 2GS6A 2P33A 3ZRMA 3PE1A 3P5JC 1OPKA 1UNGA 3CC6A 2UZLA 4OTPA 4CV9A 4FL2A 3FKNA 4M84A 3BGZA 3PVBA 2WZJA 2YDIA 1H24A 3GOPA 2BUJA 3T9TA 3V04A 1WFCA 2R3PA 4K1BA 2WTCA 1K2PA 4RVKA 3AC5A 3NEWA 5H8GA 1W0XC 3F5GA 2YACA 3QD0A 3FQEA 4NFMA 4RA5A 1V0PA 1PY5A 1A06A 4H3QA 4OTDA 3M2WA 1OIUA 3U4WA 4LUEA 1BI7A 2XMYA 1GIHA 1XH4A 3MTLA 3CP9A 4FSUA 4MNFA 2QOFA 4MYGA 5DFPA 2JC6A 2HZIA 2BMCA 5FEDA 4L52A 3TNIA 5EW3A 4QP1A 2AC3A 2Y4IC 2QHNA 2UW8A 3HP5A 3OCGA 5FXQA 3QCQA 4EWHA 3WZUA 1OKZA 3S2PA 3JR1A 5HVKA 5J7BA 4EOJA 3V5WA 5JFVA 4F1TA 2HW6A 1Q3WA 4O0TA 4F63A 5KHWA 3VIDA 1G8JA 3MB6A 3A61A 4XRLA 5HBEA 2YAKA 3UOHA 1LR4A 2WQMA 5CEMA 3U6HA 2GU8A 4BDDA 2JAVA 3LLAA 3LPBA 5CYIA 2OFUA 2W4KA 4MK0A 2BPMA 2ZVAA 4YC3A 2IW9A 4B9DA 4EHZA 5IF1A 1BUHA 1XBBA 5DPVA 5I4NA 2XS0A 4O2PA 4QMMA 5IQHA 4MBLA 3LFSA 4GKIA 3MJ2A 1LUFA 2BIKB 3Q5IA 4EOLA 4F1OA 3ZC5A 4U80A 4BCFA 5CAOA 4MBJA 4CTCA 2BILB 4CFUA 4RC4A 2C6KA 2OIBA 1Q3DA 4M14A 3S00A 3MDYA 2C6OA 1ZAOA 3LCDA 4IM3A 4UZHA 5LQFA 3ZO3A 5LWMA 2R3RA 4WKQA 2RFSA 4A4OA 5AFVA 2GSFA 4EJNA 5GZAA 3FUPA 3HDMA 4YTFA 4FJVA 4G5PA 5HESA 3QD4A 5EHYA 3LXNA 2VX0A 4XEYA 3FI8A 3OWPA 4WG5A 2EB2A 5A54A 1VYZA 1FGKA 2QD9A 3NNUA 3PXYA 1G3NA 3NUYA 4RQKA 3WYXA 5IQDA 3MA3A 3EN4A 4Y72A 5A46A 4YMJA 1M7QA 2J6MA 3EN6A 4ONAA 1U59A 4AG8A 4EKLA 5AM7A 5EDRA 3W2CA 5AP5A 3C5UA 3I5ZA 3R02A 4OBPA 4B6LA 1SZMA 3I6WA 3COKA 5DMZA 1LP4A 2XF0A 3WZDA 3UVQA 4BCNA 5C26A 3I7BA 3PVWA 4LGHA 2WO6A 2HW7A 1CM8A 3GC8A 4FTKA 4R5SA 1J7LA 4K11A 4NIFA 4I41A 4YHFA 5HG7A 3U9NA 4A9YA 3UJGA 2WTIA 4ASXA 4I92A 3PPKA 4C58A 3NYNA 2ITQA 3F3VA 1ZOGA 4AZSA 2XRWA 1R78A 3BU5A 2EXMA 3ZOSA 3QKMA 4EQUA 4HYSA 3UTOA 5JRSA 3NW6A 4X3JA 3REPA 5FBOA 3GT8A 3F9NA 3NPCA 4PMSA 4C02A 3RPOA 2GQSA 5FD2A 2VV9A 3ZXZA 3RAIA 3CKWA 1R39A 5CSPA 1YXVA 2XNMA 4TZRA 4G3EA 4GK3A 1U5QA 5FEQA 3IQ7A 2Z7QA 3W18A 2WTVA 4ZAUA 4JQ8A 5AR5A 4AN3A 1M52A 4I0TA 5HICA 3QZGA 4DG0E 4HYIA 4O0VA 3HLLA 3Q9WA 5J1WA 1LPUA 3KU2A 5HD4A 4L8MA 2OSCA 2QHMA 4I5MA 3E87A 3HRFA 3GCUA 3R8LA 4ALUA 4C36A 2J51A 3JVRA 3QX4A 3VO3A 4D2WA 4F08A 4QT1A 3HV7A 3O8PA 4GFMA 1FMKA 2XK8A 4V01A 4UB7A 3U54A 1TVOA 2CGVA 2O3PA 4L46A 5CF8A 1T45A 4QTAA 2IVTA 4WG4A 1KE8A 3KB7A 3O2MA 5BUJA 3KXMA 3FXZA 4I24A 2XH5A 4BGHA 4WIHA 4BZOA 4DH3A 3ZMMA 2BRMA 5I0BA 2PL0A 3VW8A 4ZMEA 4JOAA 4HVGA 3DFCB 2QKRA 4OAUC 4DBXA 3FY0A 1S9JA 2QOOA 4FMQA 4W9XA 3I0QA 4KKEA 3V01A 3PXZA 3TYKA 4G6NA 5HU3A 5IZFA 4MXYA 4PMMA 4ZJJA 4IB1A 2IZUA 3RINA 2JKOA 4TWOA 3VUTA 1DI8A 1SYKA 4JAJA 3BI6A 2C5XA 4JDKA 3CS9A 3Q04A 5L8LA 3A8XA 4L44A 2X6EA 4I6BA 4D1ZA 3D7TA 3TZ8A 1YI6A 3LMIA 4WRGA 3O71A 4GUBA 4PPCA 4RJ7A 3WF8A 5EYCA 4QMVA 4X2KA 3AKJA 4EOQA 3AC3A 5LJJA 3PA3A 2A2AA 4OTIA 4PNIA 4I4EA 2A1AB 5GHVA 4DHJA 2HY0A 3MFTA 2OI4X 3VBVA 2WQNA 4RG0A 4DFXE 3OVVA 2OBJA 4NW5A 4AGDA 3MY1A 3MIAA 3C4XA 5CQWA 3ZM4A 4G31A 5AR4A 5E8TA 2PMNX 4LMNA 3DJ5A 1YHVA 5CU4A 1E9HA 4F70A 1B39A 5KKRC 4Q9ZA 3AG9A 4OT5A 2YLFA 2UV2A 5ITAA 2PUNA 2OKRA 2BFYA 4W4XA 3L8VA 3DA6A 4GL9A 3QYWA 2RF9A 4DFZE 3PLSA 3DQXA 1YDTE 2C5NA 2R3LA 3RMFA 2ZMDA 4ZTLA 3QKLA 3FMDA 4RFMA 2YM8A 5H9BA 2X2LA 5HI2A 5HLNA 3LFQA 4LV7A 3L9MA 2Q83A 2YM4A 3HVCA 5BYLA 2F4JA 2J2IB 3SRVA 3JPVA 3VHEA 3BBTB 4KA3A 2X1NA 5KMJA 2R7IA 1RE8A 3P08A 2H34A 4NTTA 2FYSA 4P4CA 5IDPA 3R7IA 2WMTA 3PTGA 4L7FA 4UMRA 2UZUE 3MWUA 3ZUUA 3ZO2A 4ACCA 4C4HA 1JSUA 4CFNA 4CKRA 2W7XA 5E1SA 4YJVA 3F5XA 4C4EA 2W9ZB 1M2QA 2YN8A 4B8LA 4JL9A 3EYHA 2RL5A 4G3GA 4YZBA 5K5XA 4XS2A 5M08A 2XBJA 4FSZA 4ZSAA 4YNOA 3EQPA 5CAPA 2C5YA 3N4UA 3DLZA 4FTCA 4IAIA 5M56A 5B2KA 1FOTA 4EH9A 2ITWA 4NM0A 1UU7A 4D9UA 4N6YA 1GZOA 2OWBA 4TWCA 4U3YA 5JEBA 2IW8A 2G2IA 3A7GA 3HMOA 5M09A 3I0OA 4I6FA 2B4SB 3AQVA 4KINA 3PLAE 5IA4A 4EHGA 3IDPA 3PWDA 3U8WA 4JNWA 3G15A 4IB5A 1JKLA 1XBCA 2YIYA 3SOAA 4RRVA 4RWKA 4YNEA 3QWJA 2CMWA 3QTWA 3PDTA 1HOWA 3EQCA 2O5KA 4FZFB 3UC4A 2BKKA 1OKWA 2GNGA 1ZMUA 2KTYA 3C9WA 4L67A 3FKLA 1W84A 2XM8A 5A4TA 2WMVA 3W0OA 3RCJA 3PP1A 1NA7A 5AMNA 4EQCA 1OB3A 4CMTA 4Y73A 4JG6A 4DFUA 4HNFA 4UY9A 4ZTQA 3KRXA 1MRYA 2JLDA 5ANOA 5J8IA 5HD7A 1YDSE 3FXXA 5EM5A 3SAYA 3VNTA 5D12A 2IN6A 4EH4A 3MTFA 2W5BA 1H1QA 4U97A 4UMPA 4DHZA 1JPAA 2WAJA 3I6UA 1E1XA 2UZTA 3OZ6A 4RZVA 3F6XA 3C7QA 3ZUTA 4TY1A 5HVYA 4M66A 2BZKB 4F64A 5HTCA 3PJ8A 2JGZA 5DGZA 4DE4A 2XK6A 4XV1A 2HXQA 2RG5A 2DYLA 4U43A 3FI4A 5CXHA 3W0MA 2NYAA 4AWIA 5AM6A 5E8VA 2UW4A 4FSTA 4O7TA 4YLKA 5JFSA 3BIZA 4QMTA 4AW0A 4LGGA 4ZK5A 1YXSA 5BUIA 3DBCA 2PUUA 5CS6A 4F9BA 2RKUA 2PVKA 5AUWA 4YUQA 2KULA 4O0YA 4ZTRA 3DNDA 4O6EA 3CTHA 2JDVA 2C0IA 4RPVA 3SKCA 4BCHA 4C4IA 4YGAA 1ZYDA 2QOCA 4PTGA 4FYOA 3OTVA 4OTWA 4IFCA 4D55A 4HGLA 4DTBA 1RW8A 2OICA 2VWWA 2VX1A 4FTUA 1PMNA 3DY7A 2CCIA 3RK5A 3ZYAA 4BDFA 3S0OA 2ACXA 4IVAA 3QCYA 3DBEA 4NSTA 4WBBB 4KIPA 4QD6A 3PZEA 2QQ7A 4LI5A 4PY1A 4A9SA 2JFLA 4R7HA 4BBFA 5FTGA 2UVZA 3ORPA 4BWKA 4O4FA 5AP0A 4NJDA 3NUSA 5BV3A 2WMQA 4PTCA 3IOKA 3LXPA 3GNIB 3POOA 3ALNA 1GIJA 4I5PA 4I93A 2Q0BA 2CLXA 5KBRA 2BALA 3QUPA 4S32A 4U6RA 4EK4A 1W98A 5LMBA 3TTJA 4D0WA 4MKCA 4EJ7A 2PE0A 3GC7A 2UZWE 3DB8A 4U40A 2XIZA 4GT4A 5AV0A 3IKAA 1IA8A 4QYHA 3GP0A 4YU2A 2YJSA 3TIZA 1WVWA 3LFBA 3C0IA 3QRIA 3H0ZA 5CSVA 5CEIA 2A0CX 2J7TA 3TNHA 4HZSA 5KX8A 2NRYA 4DFLA 2IVSA 4JRNA 3LE6A 1OL1A 2OIDA 2A19B