3FL5A

Protein kinase ck2 in complex with the inhibitor quinalizarin
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
325
structure length
324
Chain Sequence
SKARVYADVNVLRPKEYWDYEALTVQWGEQDDYEVVRKVGRGKYSEVFEGINVNNNEKCIIKILKPVKKKKIKREIKILQNLGGPNIVKLLDIVRDQHSKTPSLIFEYVNNTDFKVLYPTLTDYDIRYYIYELLKALDYCHSQGIMHRDVKPHNVMIDHELRKLRLIDWGLAEFYHPGKEYNVRVASRYFKGPELLVDLQDYDYSLDMWSLGCMFAGMIFRKEPFFYGHDNHDQLVKIAKVLGTDGLNVYLNKYRIELDPQLEALVGRHSRKPWLKFMNADNQHLVSPEAIDFLDKLLRYDHQERLTALEAMTHPYFQQVRAAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Casein kinase II subunit alpha
publication title Quinalizarin as a potent, selective and cell-permeable inhibitor of protein kinase CK2
pubmed doi rcsb
source organism Zea mays
molecule tags Transferase
total genus 105
structure length 324
sequence length 325
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2008-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3fl5A01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3fl5A02
2X6DA 2XKFA 5AP0A 2JDSA 4ONAA 3VWAA 3DBDA 3Q6WA 4FZAB 4E73A 4I41A 4LUDA 2YM3A 1UWJA 4YJUA 5HLNA 4EHVA 2JGZA 3MSSA 5HGIA 3TN8A 4X0MA 2RGPA 3BU3A 3NUNA 4CGAA 5DT3A 4YNOA 4QMOA 3S95A 1HCLA 4DA5A 4USFA 3F3TA 1ZOGA 3UQGA 5DEWA 5EM5A 3NNVA 1KWPA 5DR2A 3TUCA 3E8DA 1OKWA 2ZDTA 3KGAA 2ZV7A 2UZUE 3MH3A 5F1ZA 4CFXA 4EH2A 4ZLZA 4EC8A 2R0IA 4DHFA 5HLWA 5DA3A 3L8VA 3RK5A 4PDOA 2I7QA 4UWBA 3SAYA 2VNWA 4ANLA 3QTZA 3GC7A 5CF5A 3A7IA 4FK6A 2OG8A 4PL5A 4ZZMA 4ALVA 1XH5A 2YFXA 4AQCA 4CCBA 2YWPA 4JNWA 4FZDB 3U8WA 3FKNA 4V01A 4XP0A 2PVRA 3FSKA 3GU4A 3NUXA 4O0TA 3LFDA 1ZY4A 3LFQA 4HCVA 3FPQA 4DEHA 4B7TA 4K1BA 3E64A 4N4SA 4HOKA 5AUVA 4EHEA 4MX9A 2O0UA 1YOJA 4F70A 1FGKA 2WQNA 2C0OA 3OWPA 5EYMA 2NRUA 3PUPA 3O0GA 3HRBA 5A4TA 4R7IA 4O21A 4TRLA 1H1QA 1YKRA 2VD5A 4A07A 3HMOA 1TQPA 4ANQA 4O7WA 5IQCA 3F3VA 4H36A 2YDIA 3FLWA 4OBOA 4J99A 3P78A 3EMGA 3AT2A 4M14A 2R3GA 2A2AA 4LQMA 1Q97A 4KSQA 3DQXA 3LHJA 3VIDA 4FSUA 4XUFA 3C4WA 3ZM4A 2X1NA 4ANSA 1M17A 2F49A 5HBJA 3C4ZA 3NCGA 4IVDA 5CENA 5B7VA 1B39A 2IVSA 3U6IA 4IB5A 3EQRA 4O2PA 4TYHA 5AR4A 3TDVA 3A60A 1VYWA 3OVVA 1CM8A 2VTTA 4B9DA 4LUEA 5BVOA 5FG8A 2B0QA 4HYIA 4GFOA 2R3QA 4L7FA 3EFJA 4PF4A 5TE0A 4DH3A 5KZIA 4BR3A 3Q6UA 3W32A 3EN6A 3RWPA 1W7HA 1K3AA 3EN9A 1APME 1CMKE 4I4FA 3VBYA 4O0WA 3TNIA 4FK3A 5CEIA 3WF8A 4ACHA 5I9VA 4N6YA 4UEUA 4LGGA 3GB2A 4FEUA 1SMHA 4PL4A 1E9HA 2HW7A 3FXZA 1PXLA 2XNBA 4QP6A 3UBDA 4G3CA 3VUKA 4S31A 1LEZA 2VWZA 5CF4A 4UYNA 4BDDA 5K5NA 2QOHA 4O2ZA 1KOAA 3TI1A 2G2HA 5IG1A 3ZXZA 1V0BA 3ID6C 3O2MA 4XHKB 2E9OA 5F95A 5CEPA 1YRPA 5HIDA 2C3KA 1YXSA 2JKMA 4M0YA 4OTWA 3P4KA 3FQHA 4M97A 1I44A 4EUUA 3NUAA 1P4FA 3QQHA 1Y8YA 2XEZA 2O2UA 3O71A 2A19B 2CJMA 5C1QB 5HBHA 3A2CA 3PSBA 5LOHA 3NNXA 4JG7A 3D5VA 3KL8A 4JDHA 2J0IA 3E8CA 3EQFA 1GOLA 4DLIA 3HGKA 5CX9A 4CFWA 1JKTA 3PJCA 2AUHA 4IQ6A 4RSSA 5FP5A 5J95A 3A8WA 3REPA 4E5BA 2Y9QA 5IH5A 4DH5A 3GT8A 4GMYA 4YZCA 2OK1A 3EQHA 4G16A 1PRYA 4WSYA 2BAQA 1H28A 2ZM3A 3BCEA 3EZVA 2WMTA 2G15A 1CKIA 4IZ7A 4C4FA 4J98A 4IC8A 3KULA 4F9WA 2FSOX 5HLPA 5AUXA 4PQNA 4I23A 2FSTX 1GY3A 4FGBA 4QTEA 4USDA 3BU6A 4ZSEA 3WF7A 5CF8A 1AD5A 4J97A 4RFYA 3UTOA 4CNHA 2E9VA 1XO2B 4S34A 5AIKA 4AGUA 4D0WA 5EK7A 4EK5A 3V3VA 3R02A 1ATPE 2J51A 4FSZA 3TJCA 3W2CA 2PZYA 3AMYA 4MAOA 3GCVA 1FMKA 3FWQA 3EKNA 3UG1A 4OAUC 1YHVA 2PWLA 1PKDA 3SX9A 2EB3A 2IVUA 1OMWA 4YZBA 2B9JA 4AN2A 4EWHA 1ZYSA 5JGBA 1MRYA 3FL5A 4JRNA 3DBEA 3FY2A 4RWLA 3I7CA 5TR6A 4F1OA 3FMNA 2XRUA 3LCOA 3QZGA 4YHTA 3TACA 3VBWA 4A7CA 4AT4A 1QPJA 3PJ3A 2ESMA 5DG5A 4PL3A 4QTAA 3ZSGA 2Z8CA 3NCZA 1WBOA 3KXNA 3T9TA 5HZNA 2H6DA 3KULB 4HGSA 2HOGA 4WG3A 2HENA 3CKWA 3MA6A 4MBJA 5KZ0A 4CFFA 2V5QA 3RAWA 3ZC5A 2C5NA 2JDRA 4FTAA 2CMWA 4TYEA 3BYSA 3CJFA 3ZSIA 2UZWE 3UVRA 3Q4TA 3OF0A 3RPOA 5BPYA 3FMKA 2Y6MA 1JSVA 2BZHB 3NAYA 4FTJA 4IEBA 5TOZA 3W33A 4IADA 1OL6A 4MEDA 2B9HA 2UW0A 4D9UA 5AJQA 5IZFA 4E5AX 5ETCA 1ZARA 4FOBA 3BEGA 2F9GA 2X81A 4DGMA 3C13A 3TG1A 2J6MA 4L45A 1OPJA 2OI4X 1JVPP 4YJQA 3ACKA 1PXKA 4F99A 3FAAA 5JRQA 3W8QA 2CGVA 4FV3A 3I7BA 3R7GA 3EB0A 5J9LA 3UZTA 3RTPA 1YQJA 3IW7A 3QHWA 4F9AA 5BVFA 4IAIA 4UMQA 3ORNA 4PV0A 5E8ZA 4PWNA 3JR1A 3TUDA 5EQEA 1SNXA 5L8KA 2XCHA 3F6XA 4AW0A 4AZFA 3CD8A 5A54A 3Q4ZA 1GZKA 5BX0A 5M56A 4O1PA 5JQ8A 1OUKA 3LFAA 3U6JA 4ZSLA 4BHNA 2A27A 2BZIB 3COHA 1O6KA 3R1SA 5AMNA 1G5SA 3PE1A 5FUTA 3LJ2A 1URCA 4R3CA 1PXNA 3PY1A 4FIFA 3QCQA 2VN9A 3TT0A 4EZ5A 4FTKA 4OGRA 5KKRB 2WQBA 4U7ZA 4FIIA 4FUYA 5HCYA 3QC4A 5CASA 4FKWA 1XHAA 3OEZA 5HOAA 3R9OA 4O7YA 5IDPA 5DOSA 2QONA 2YN8A 2OJFE 4LMUA 4XG2A 5AP6A 4AZVA 4XV1A 2XRWA 2VU3A 4FKVA 5EKNA 5HVKA 3KREA 3VBQA 3WIKA 4QMNA 4FTMA 3MY1A 3IQ7A 4H1JA 2CNVA 3QTUA 2IO6A 3GGFA 3I60A 4G31A 2IZTA 2VTQA 5AUYA 2YITA 4C37A 3T8OA 4NWMA 5F20A 4G2FA 4F63A 5HG8A 2C6IA 4ACDA 4BCIA 1OM1A 4KA3A 1P5EA 4K18A 2C6EA 1WVWA 5HIEA 2C1AA 4NM3A 4L67A 4TYGA 3H0ZA 5EM7A 4TY1A 3NRMA 3HAVA 4GKIA 2QC6A 2GS2A 2YCSA 3U9CA 4F64A 3PIXA 3QAME 3HA6A 4OTGA 4FV5A 3TNQB 3NVMB 5ACKA 1M2QA 5FP6A 2BDWA 2GFCA 2QLUA 3FQSA 3VO3A 3NAXA 3WBLA 3CS9A 1LEWA 2PMOX 3DGKA 4TN6A 1IG1A 3FHIA 2YCQA 3BLQA 5E8XA 5JH6A 4Z7GA 5KHWA 2C47A 3A7HA 4NKSA 1XBCA 4M66A 3QD2B 5DLSA 3HYHA 3RMFA 3OXZA 2BRHA 3RK7A 2HZ0A 4O82A 4FG7A 1H0WA 5KE0A 1ZZLA 1Z5MA 1BKXA 2BR1A 3JY0A 5DRBA 4A06A 4F7NA 4ZJVA 4D55A 3R30A 3G0EA 3R7OA 3RJCA 5AR2A 3V5TA 3LCDA 3AC8A 4EL9A 4ZY5A 1R78A 2PSQA 2BHEA 4FKLA 2WTKC 4N70A 4Y85A 2QHNA 4QMUA 4JR7A 4QP8A 3RZFA 2YM8A 3ZU7A 2PVMA 4IDVA 1K2PA 4KIKA 4F1TA 5KMKA 4LM5A 4WNOA 1R3CA 1GIIA 4MNEB 2BHHA 4QPSA 4I6QA 4RWIA 1WBNA 5CU4A 5HEZA 5C03A 4KIPA 4ZJJA 2JEDA 3UNJA 1U59A 2BPMA 2GU8A 4FTNA 1ZAOA 3G6GA 4ZLYA 4FKUA 3R01A 5IF1A 3GP0A 4FTCA 3UVQA 2QODA 3BBTB 3SQQA 3GQIA 3B8RA 3TV7A 4G3DA 2YM5A 4NL0A 4O0YA 3ORLA 4RIOA 4FTIA 3UC3A 3FLZA 4FT0A 1UV5A 1W8CA 2HY81 4HVGA 5EI8A 3ZO1A 1R1WA 5EQYA 4O0RA 5DH3A 3FC2A 1YWNA 4FKPA 4U9AA 2XK8A 2HELA 3ORMA 4HVSA 3CTHA 5DT0A 5GIOE 5HVJA 2W4OA 3NIEA 4BCKA 4EOLA 4F7LA 2P3GX 2ITYA 2IVVA 2PYWA 4CLJA 3D2IA 2FSLX 1QCFA 4R5SA 4EJNA 2BUJA 3A4OX 3BPRA 4MBLA 4U45A 3P9JA 3ZO3A 3JUHA 1JKKA 3JVSA 3R1YA 5E8TA 5IQGA 2O8YA 2PHKA 4OTDA 1Q5KA 3G9LX 3D2KA 4G17A 3RWQA 3UZPA 1QPDA 2I6LA 3DKOA 4II5A 4HYHA 2GQRA 3I5NA 5DVRA 2W1CA 3DJ5A 3KXZA 3KCFA 3ZEWA 3TKUA 1R0PA 4FEWA 4AZWA 5BVNA 3VJOA 5DRDA 5EHYA 3ET7A 5J9YA 5E8UA 4U3ZA 4A9YA 4N57A 1XH7A 1OKYA 4DITA 2XIXA 5DIAA 4TTHB 1PXMA 2IVTA 4RIYB 2O5KA 1AQ1A 3QZHA 4S30A 4X2JA 3OD6X 4B8MA 4C4EA 3DXPA 4CEGA 4H3PA 1J7LA 5KX8A 1L3RE 3KXGA 4KKEA 3ZFYA 4HNFA 4F9CA 2UZTA 4KAOA 3EIDA 4L00A 4CMUA 4DYMA 1YI6A 2F7ZE 2HZIA 3LXLA 3OWJA 1M2PA 5ANOA 3ZO2A 4AW1A 4O91A 4EYJA 4TYIA 1DM2A 1LPUA 1M7NA 4RRVA 3GU8A 5BYYA 3GUBA 4UXLA 2GCDA 2IJMA 5AP3A 1U5QA 1XH4A 1U46A 4NTTA 3DKCA 4EK6A 1DI9A 2PUUA 4P5QA 5A9UA 3U6HA 4P5ZA 1PYEA 4AGDA 3PY3A 1IR3A 4L53A 1YWRA 5HCXA 4DEIA 2VNYA 3ELJA 3MJ1A 5GJGA 5M06A 4UALA 4RQVA 3K5VA 4G3GA 3ZCLA 1SVGA 4UN0C 1F0QA 4YJTA 5E8SA 2PE2A 3CPBA 4JXFA 3OMVA 2J0LA 2VWWA 3AQVA 3POOA 1V0OA 3P79A 2OGVA 5CT0A 4FNZA 1Y6AA 3QA0A 4ZTLA 5CVHA 4EK4A 3HVCA 4KABA 2X6EA 3OCBA 2XA4A 4CMOA 2BDFA 5FD2A 5I0BA 2I40A 4PX6A 3UIXA 4DH8A 4NJ3A 3MVHA 3OCSA 3HUBA 3TNHA 3FXXA 3OROA 1CKJA 3HMNA 2YJSA 4XG8A 3ZRMA 4KINA 4GYGA 4NK9A 2V7AA 4LI5A 5M09A 2XBAA 2A1AB 4CLIA 3W2SA 4UBAA 4F7JA 2BAKA 1JKLA 4BKYA 2B4SB 1PF8A 3ZDUA 4NEUA 2B9FA 4QMMA 3AG9A 2BRGA 2XP2A 2QO9A 2W96B 5H8BA 3D0EA 1H1WA 3L9LA 2UV2A 4AZSA 2WMAA 2JKQA 2XJ1A 3FPMA 3HA8A 4G5PA 2C3JA 3BELA 3KRLA 4ZSAA 4YGAA 2R3LA 4AN9A 1YHSA 5E8WA 3PVWA 4FV6A 3UG2A 3Q9ZA 3KRWA 4RVTA 4LMNA 2Z7SA 3C4EA 1PMNA 4BCNA 5IEVA 3PVBA 5FBNC 1PHKA 2ZV8A 2BFYA 3LFBA 2ZDUA 4KSPA 1FOTA 1JSTA 3WF5A 3FI4A 4IAYA 5D7VA 3U54A 1BI7A 2X8DA 4H3QA 2RFDA 4CRSA 5EKOA 1ND4A 4ZIMA 5L2QA 3KEXA 2R3OA 4BDKA 2REIA 5CEOA 3QUEA 4FTRA 2FVDA 4IJ9A 3KFAA 4D1ZA 3WI6A 2C6MA 4DINA 4EJ7A 3FLYA 4XV2A 4R5YA 3PE2A 5AV3A 4EZ7A 4XV9A 2IZSA 5C8NA 3R22A 4FVRA 4EQMA 4DGNA 2YHVA 4R77A 4I5PA 3UVPA 3DZOA 4HVIA 2NO3A 4PMTA 1DS5A 4X2FA 4YNEA 5L6PA 3LLAA 3ITZA 3OT3A 4QMPA 2CN8A 2W4KA 3S4QA 2VGOA 4GSBA 5C27A 3VS4A 4DFYA 4DAWA 4BC6A 1FQ1B 3MB6A 3W2OA 1RJBA 2Q83A 2QKWB 1H1SA 4OTIA 2HK5A 4ANMA 5L2TA 2PUPA 5AAEA 4ERWA 3TNPC 5ETFA 4IZYA 4V0GA 5IEYA 2RG5A 4F6SA 2BZJA 1DAYA 4NTSA 4XRJA 5GJDA 5CZIA 1MP8A 4FG9A 4C2WA 4BHZA 3R21A 4D9TA 3IG7A 4EOPA 4MBIA 5EDPA 4Q9SA 2PVFA 2W05A 3ANQA 4OTQA 4BCFA 3O51A 3PLAE 3MH1A 2P2IA 1P14A 4CYIA 4CKIA 4FA2A 2J4ZA 4QP4A 1IAHA 1H25A 3POZA 2VWUA 3D4QA 2DYLA 2EUFB 2GTMA 4DT8A 4GUEA 4ZMFA 3QRUA 3U9NA 3EQIA 4GRBA 5CU3A 4EK3A 4FKSA 4BFMA 5BMMA 3VUGA 4JS8A 3FXWA 5LVOA 2YLEA 5JT2A 2OKRA 2W9FB 1VR2A 4YSMA 2DWBA 4GVAA 3L9NA 4PTCA 4HYSA 5AX3A 4GG5A 2E2BA 4E3CA 2UZVA 2VGPA 4BYIA 2BIYA 5CS6A 2RKUA 2P2HA 4NT4A 1S9IA 2QO2A 3KXXA 4QPAA 3Q9YA 4LV5A 3ORPA 4XBRA 4YP8A 4F0GA 2PZRA 3MFUA 4QMYA 3E93A 4CRLA 4ZAUA 4IWOA 2HYYA 2YM4A 4EH9A 4EEVA 5AR3A 4LYNA 2QOIA 4ENXA 3G15A 5HNBA 1ZMWA 1Q8UA 2BDJA 3QQJA 3RZBA 2PZ5A 3C50A 4B4LA 1F3MC 5L2WA 3GC0A 2EB2A 3G33A 4K11A 4DC2A 2VTHA 3F82A 3BBWA 4BCPA 5BYZA 4O0UA 3WOWA 5AA9A 5EW9A 3CSVA 3MI9A 4ITJA 3OHTA 4O96A 4BCGA 4U42A 4RVKA 3VS7A 3F61A 2PVHA 4G9RA 1YWVA 3BRBA 5A14A 3HV3A 2WOUA 1DAWA 4AACA 4IWDA 4C58A 4DCEA 2X2MA 4C7TA 4HVDA 3CEKA 4J1RA 4E26A 5IMEA 4D0XA 3FSFA 4J96A 4WIHA 3TWJA 2WZJA 3ZHPC 4QP2A 3FL4A 3UOHA 2FGIA 4S33A 4HW7A 1JNKA 3P5KA 1NVRA 3ENHA 5FRIA 1ZMUA 2VX1A 1ZYLA 3AC4A 4IMYA 4Y8DA 2UZLA 4OTPA 1PJKA 3QCSA 3VQUA 4DE4A 3DLZA 5ETIA 3VRYA 2VTLA 2W1GA 2YA9A 4EH4A 4JT3A 5LVNA 4UMUA 4BB4A 2SRCA 3R28A 4GU9A 3ORIA 3E8NA 3SVVA 3RAHA 4WD5A 5EDRA 3N9XA 4CZUA 5ANIA 3TCPA 4K2RA 3BGZA 3QU0A 4G1WA 4O0VA 3V5WA 4XP3A 2IPXA 3KB7A 2QNJA 4FR4A 4C59A 3DB6A 4IZ5A 5EM8A 4PPCA 3LAUA 4ZTSA 3ERKA 3HMIA 4CTCA 5KNJA 3OCGA 4JJRA 2UVYA 3MPTA 4WBOA 3W10A 5J5TA 1ZLTA 2R9SA 5T68A 5I9ZA 4FL1A 1NA7A 2KTYA 3Q96A 4D2VA 4DH7A 1PXPA 3QXPA 5HNIX 4M15A 4I4EA 4OTFA 3MFSA 3CTJA 4RC2A 4YSJA 2W4JA 1PW2A 1YW2A 3C4CA 4JIKA 5KCVA 4F1MA 5HO7A 5BQ0A 3OC1A 3BEAA 2O63A 4QYEA 4AF3A 2NP8A 4U0IA 3ALNA 2W7XA 3OT8A 4IHPA 3I81A 2GPHA 4ANNA 3H9FA 3TIZA 1LP4A 3UIMA 3HP2A 2OXYA 5IPJA 2KULA 5KO1A 4R7HA 3MB7A 3RPSA 3P86A 1EH4A 2VUWA 2WXVA 4DEEA 2CNUA 5AAFA 3QTQA 1OL2A 2OSCA 2YM6A 4JI9A 2PZIA 3F3ZA 4MYGA 4RMZA 3VC4A 4BDGA 2HZNA 5JZJA 4IWPA 4PDPA 3GOPA 5D11A 2VO7A 5HNGA 4WUAA 4Z3VA 3TKHA 5C4LA 1ZZ2A 3CXWA 2ZAZA 3KKVA 4AU8A 1FVTA 2B7AA 3ZMMA 3ZSHA 4RIWB 3AC5A 2WQMA 3BE9A 3KK9A 4C61A 2VWIA 2WEVA 4QNYA 1J3HA 3GCUA 5FQDC 3V5LA 2GNGA 4L3LA 4NYEA 4Y46A 4GVJA 3RHXA 3KMMA 2C6OA 4HGLA 4F09A 3UZRA 4XLVA 4YC6A 5J87A 2OZOA 2DQ7X 5CVFA 4QQ5A 2YAKA 1W82A 3FLQA 5C4KA 1Q61A 3UOKA 4UXQA 4YTIA 3QQKA 3PY0A 4BVUA 4EZ3A 2HXLA 5H8GA 4APPA 4ID7A 4F6UA 2XIZA 4GH2A 5J1WA 2QI8A 2F2CB 4NIFA 4RJ3A 4GUBA 5BVEA 4A4XA 4J53A 4BWPA 2ZYBA 4JRVA 4FF8A 4IXPA 4FKTA 3DK6A 4QYFA 4ZMEA 3ZUUA 5GIPE 1TKIA 5EM6A 5EI6A 2C6TA 5CAPA 4ZS0A 2OIBA 2W1EA 2V55A 3FQEA 3NYXA 4G6OA 3V51A 1XH9A 3VAPA 1IEPA 2J7TA 2G2FA 2B1PA 2OIQA 4BI2A 2YCRA 3MVLA 4FV9A 4D1XA 2XK7A 1UU3A 3PA5A 4G9CA 5KUPA 2ITWA 4S2ZA 3Q32A 2BALA 4I5HA 4QTCA 2XNPA 3JY9A 3VBXA 5JZNA 4GT3A 3SRVA 4TPTA 4WUNA 4KBAA 3A99A 3Q4UA 4OBQA 5CSXA 3U4WA 4O84A 3PPKA 2C5OA 3TKIA 2JAMA 4D2PA 1R39A 3UYTA 4EQCA 2WTJA 5HQ0A 4QMZA 2C1BA 4JOAA 3EL7A 4Z7HA 4ZTMA 3UOJA 4MD7E 4DGOA 4YUQA 1OPLA 4Q5EA 3ZDIA 1TQIA 1KE5A 5ANDA 4FEVA 3RAIA 3V5QA 5ANGA 4RWKA 3R8UA 5GZ8A 4ORKA 3K5UA 4JG6A 3TZ9A 4AOIA 5E9EA 4L42A 5GZ9A 4KRCA 3BV3A 3RVGA 4L3JA 4Z55A 3ZZWA 4RG0A 4JX3A 2BRMA 2R3RA 2VV9A 3OOMA 2CKOA 2C3IB 5T6KA 2GDOA 3CR0A 1XWSA 3AT4A 1YXUA 3O8UA 3BU5A 1BYGA 5DEYA 5B0XA 2YZLA 4CV8A 3OY3A 5K4IA 2Y0AA 4ACMA 3C51A 4X7QA 2G9XA 3D7TA 3RNYA 4TYHB 5I9YA 4WNKA 3WF9A 4QMTA 1MRVA 3NW6A 3QZIA 2R5TA 3R00A 4G34A 4RGJA 5HESA 3MIAA 4B6LA 2WPAA 3A4PA 2ITVA 3LXNA 3MPMA 4LG4A 5DT4A 3MA3A 5HX6A 4U80A 5JGAA 4R7BA 1NY3A 4IX3A 2XK3A 4U5JA 5FDXA 2GNLA 4QYGA 4CFVA 3PXYA 4MWIA 3LFFA 1PXJA 3DCVA 2UW8A 5H2UA 2ITUA 2ZM1A 3LQ5A 1VJYA 2XKEA 4XCUA 4AA4A 5IU2A 1V1KA 3C1XA 5JSMA 3ATSA 1QPEA 1ZXEA 4IAAA 3RGFA 4L46A 3BHYA 3ZBFA 2HY0A 1CSNA 4JG8A 3V6SA 4M84A 3O17A 5HU9A 5DI1A 3WZKA 4FUXA 1ZOHA 3HX4A 2CLQA 4IX4A 5IUGA 4AX8A 5TKDA 5HD4A 2JDOA 3R04A 2CCHA 3QA8A 3ZRKA 1OIYA 3ZTXA 3VS3A 3OTUA 2VTPA 2J9MA 3SOCA 4WNMA 4JAIA 2GHLA 3Q4CA 2YM7A 3VS2A 1DI8A 4M69A 5J7BA 5LMBA 5A4QA 3D94A 1SZMA 3OWKA 5IKWA 4FT3A 4OBPA 4RC3A 4EH5A 3KMWA 3KU2A 4QNAA 4R3PA 4C3RA 3HMPA 4HVHA 5AUUA 4I0RA 2X4ZA 3VQHA 1RDQE 3FZOA 2QOBA 5CY3A 4YC8A 3RBWA 3L8SA 3IOPA 2J5EA 4PRJA 2XNEA 4ALUA 4AOJA 5J1VA 4DG0E 3UMWA 4RLLA 4FT5A 2Z2WA 4QMQA 3CGFA 4FKJA 2R7IA 1XQZA 4YHJA 3D14A 1Q8WA 3PVUA 4C57A 4J8MA 4CTBA 2ERKA 3II5A 2GSFA 3P7AA 3MIYA 2WMQA 2B55A 4FV2A 5M53A 4YO4A 5LMAA 2BILB 3FMHA 4HCUA 3EN5A 1B6CB 3QYZA 2AC5A 4XNEA 4E6CA 2WMVA 5HU3A 4PPAA 4CFUA 1TQMA 3LM0A 4IE9A 1H01A 3SXRA 4UV0A 4ITHA 3TTJA 2PUIA 3ZC6A 1XR1A 3QD0A 2HWPA 3VUIA 4YTFA 2EXEA 2V62A 3COIA 3L1SA 3ENMA 4FL2A 2OO8X 2WQEA 3V04A 4BZDA 4H3BA 1JKSA 2G1TA 3HMMA 3UO5A 3F69A 1PKGA 4IM0A 1B38A 1U54A 4FX3A 4FKOA 5CAUA 4DEDA 4MXXA 3LFNA 4ZTRA 3UODA 4D2TA 4AZTA 4FBXA 4TL0A 4IIRA 3I79A 2XS0A 1KE9A 3EL8A 3GU6A 4DCAA 4NW6A 1GZOA 2VO0A 2XYNA 3LIJA 5G6VA 4BBFA 4E7WA 4B8LA 4FOCA 4RIXA 2A4LA 2R3NA 3HLLA 5IUIA 4BKZA 4BI1A 3Q9XA 4HCTA 3VULA 3DFAA 4BKJA 4IB0A 1PXIA 3DS6A 1WBTA 3W16A 3DT1A 5I4NA 4CQEA 2BCJA 3QRTA 3BGQA 5HVYA 2X2LA 4BN1A 4XEYA 2Y4IC 4EH3A 5IQEA 1SVHA 4BDBA 3C4FA 3E88A 4MKCA 2GNHA 3R8MA 3P1AA 5ANJA 3BV2A 1HCKA 1F5QA 1GZNA 2FSMX 3DBQA 4W4XA 3GC8A 4BICA 4EOOA 5CSPA 5IA1A 1NT2A 3LQ3A 4W9WA 1UKIA 4IM2A 3ZLWA 3D7ZA 3FI2A 3ZEPA 4FTTA 3C7QA 4OUCA 4QTDA 5CYIA 4O83A 1IA8A 2ZV2A 4FIEA 4C4JA 4C62A 5I9WA 3FEGA 4GT5A 3NYOA 2JIUA 4M12A 4YMJA 1E1VA 5A46A 5HTCA 3RKBA 5J8IA 1H27A 5AX9A 2VRXA 4FVQA 2HAKA 3OFMA 4CMTA 3EH9A 4HPTE 4Q9ZA 4JQEA 2OH0E 1WCCA 3GEQA 3VRZA 2UZOA 4MXYA 1OKVA 2WB8A 4QP3A 3R7EA 4CT2A 5FTGA 4ZZNA 3GCPA 3OXTA 3TZMA 3HV6A 3BIZA 3NDMA 5CZHA 4U44A 2UW6A 4AN3A 3JVRA 3HP5A 4BZNA 2J2IB 3W18A 2YAAA 3OY1A 3QZFA 4DTKA 4ZTHA 4X3FC 4EHZA 4OTHA 5IQAA 5CU6A 5C8KA 3V8TA 2JITA 2X2KA 4GFGA 2VX0A 3RNIA 4ANBA 4BCOA 2PVLA 1JQHA 4YZ9A 2WMBA 4YO6A 3KMUA 3ZZEA 5K0XA 2UVZA 4K6ZA 5E8YA 3ZONA 3W55A 3NSZA 4TWPA 3VS6A 3EFKA 2WMXA 1IASA 3B2TA 4XG6A 5CEKA 3MW1A 1ZYJA 3IGOA 4LL5A 4ZSJA 3C0IA 1KV2A 4QYHA 1REKA 4ZZOA 4FEXA 1WAKA 4GJ2A 1OZ1A 5EDQA 3TIYA 4XS2A 2W1IA 2OIDA 1QPCA 3ODYX 3AD6A 4W4YA 1OIRA 1M7QA 2C5VA 3O96A 3VHKA 3AGLA 4FT9A 4RT7A 4WRSA 3UIUA 4PDYA 4JAJA 4EOQA 4YLLA 5TF9A 4YJOA 3IOKA 5HG5A 3OWLA 5C8MA 3CCNA 2CGWA 5M51A 3C0HA 4IAKA 4BIDA 3FUPA 3P08A 3SDJA 5J7HA 3MY0A 2BRNA 4NFNA 3FKOA 4O6LA 5C9CA 2GNIA 2J90A 2OZAA 5HORA 5CF6A 5KBQA 5M4IA 4FNYA 1BL6A 4MXAA 2GHMA 3MWUA 3W1FA 3ZBXA 5J9ZA 3FI8A 3IDPA 3MFRA 3M1SA 3FKLA 2WKMA 4DG2E 3OZ6A 5DFPA 4XV3A 1UKHA 3R8ZA 4GCJA 4NM5A 2ZOQA 4RWJA 2QHMA 4E4LA 5E7RA 4BTFA 4E6QA 2Y6OA 3BHVA 4X2KA 3F7WA 1BL7A 3HDNA 5HI2A 4BDCA 4O7SA 1K9AA 2V7OA 3GCQA 3OP5A 3PRIA 3UQFA 2QR8A 2QOFA 3E92A 2XNMA 3D15A 3PPJA 4M0ZA 4WHZA 5LXMA 5DYJA 3FZTA 4XMOA 3IW8A 2WTKB 4YJNA 5ETAA 2B52A 4AA5A 3QQUA 1Y57A 2JDTA 3O7LB 4U6RA 1PY5A 2EXMA 5DBXA 4RFZA 3PFQA 3KVWA 4OT5A 1H08A 4I20A 3ZYAA 4C3FA 4O7TA 3LXPA 1LR4A 4J7BA 4KIKB 5FEEA 2CKPA 2BMCA 4CT1A 2HZ4A 2JD5A 2WELA 5EW8A 3AGMA 4TWNA 2XCKA 2PPQA 5C26A 2OH4A 4TNBA 2OBJA 3N4TA 3OUNB 1UNHA 3LCTA 1YDRE 4PTEA 4AOTA 3BI6A 3F7ZA 4KBKA 5F4NA 4O7ZA 4DBNA 3EYHA 3U55A 2E9NA 3EOCA 3FYKX 3QQGA 4TW9A 5M57A 4CKJA 4YZMA 3ULIA 3QTRA 5BUEA 3NX8A 2R3JA 3SD0A 1P4OA 3CIKA 1SYKA 3KRJA 4IANA 3QCXA 3ROYA 2I1MA 5L6WL 4XG7A 4UMPA 3GFEA 3CJGA 3FMMA 3C0GA 3PA4A 5L8LA 1PYXA 2E9UA 2X0GA 2RIOA 3EN4A 3AMBA 4IC7A 4O0XA 5JMSA 4DBXA 2FYSA 3KC3A 3LJ1A 3FZPA 4FSMA 4V04A 5H9BA 4G3EA 1GAGA 3SHEA 4BDFA 2Y4PA 3H30A 1CKPA 5CI7A 4ASXA 5IH6A 5FTOA 3CBLA 3QALE 4QRCA 3RPYA 4CV9A 1H00A 5LCJA 2XIKA 3TZ7A 4DF3A 1UNLA 3G5DA 4IFGA 4EOSA 2YWVA 4PDSA 4C36A 4L01A 3U51A 3ZFMA 1OIQA 3ORKA 5A4CA 4D4RA 4PMSA 3TZ8A 3K2LA 4P4CA 2GHGA 4AUAA 4FGRA 5DNRA 3ETAA 5D10A 3BHTA 4FI1A 5CEQA 3MY5A 4FV7A 4GK2A 4UZDA 4BTKA 2AYPA 2WMUA 2ZJWA 4BBEA 5J5SA 1ZYCA 1G8SA 2BKKA 3FZRA 3NW7A 2YLFA 2C69A 4R6VA 2VTMA 5HO6A 3VNTA 4ACCA 1CDKA 4BZOA 4DH1A 3VN9A 3WZUA 5CNNA 5IA3A 1Q62A 4ZOGA 1UWHA 4X6QC 4M68A 4QP7A 5AUTA 5A6NA 2G2IA 4ZEGA 1Q8ZA 5IA5A 4MNFA 1H8FA 3F2NA 1IRKA 1H4LA 4I5CA 4PP9A 3VF8A 4EK8A 4EH7A 1WFCA 5CEMA 2CHLA 1KE8A 5BUJA 1OL1A 1PMUA 4WG4A 2JFLA 5CSHA 3S00A 4A4LA 4QOXA 1OPKA 2XVDA 3PPZA 3LKMA 4APCA 1FVRA 3ZFXA 5J79A 4QMSA 4QT1A 2CGXA 4C0TA 4E4XA 5EOLA 4M7IA 4WRGA 1ZY5A 2QLQA 5HKMA 1MUOA 3ZS5A 3PSCA 5A3XA 2XM8A 3FMJA 3Q53A 3VVHA 4IVBA 4XJ0A 2H96A 2XZSA 5HG9A 3W2RA 1FBNA 5AV4A 4JL9A 3RP9A 3AC3A 4QMLA 4ASEA 4XLIA 3F2RA 2X7FA 2YIRA 3LE6A 4Z16A 4I0SA 1Q8TA 2BROA 3BYUA 4ZLOA 3V5JA 4R1YA 1WZYA 4O86A 3T9IA 5JEBA 2OXXA 4FKIA 2BZKB 3OBJA 3BYMA 3R9DA 2F57A 4BDEA 2X4FA 2PVYA 1Q24A 2X7OA 4FZ6A 4QPMA 5BMSA 2E9PA 4PUZA 3QKLA 3SV0A 5AUZA 1L8TA 3FMEA 4JBOA 4ZY6A 3EQCA 2XNOA 4FICA 4LGDA 1YI3A 3JXWA 2YIQA 2NPQA 3F88A 4YHFA 3SXFA 5DMZA 3DFCB 3PJ8A 4M8TA 3TM0A 4BCJA 3UJGA 3DLSA 5LWNA 2UZNA 1J1CA 2R3MA 4U79A 3DK3A 3V01A 5FEQA 4IACA 3Q3BA 5A6OA 3FLNC 2OJJA 4O7LA 5IA0A 2B54A 2XIRA 4MWHA 3QLGA 4H1MA 4HNIA 1MQBA 3V8WA 2I0YA 2QD9A 4CFNA 4EKLA 2GMXA 5JN2A 4CFMA 3LM5A 4K77A 3HV4A 5B2MA 5BYLA 5CSWA 4NH1A 1YDSE 4O81A 3F2AA 5JRSA 4U81A 4AFEA 4AZEA 3F9NA 4D2SA 3ORXA 4ALWA 2YIWA 2PE0A 4TZRA 2JC6A 2QO7A 2YJRA 2XJ0A 1R0EA 3QX2A 3DBFA 5EH0A 2GFSA 2VX3A 3C4XA 3MH2A 3KN5A 3R9HA 4BYJA 4E8AA 4MF1A 4FIJA 4I1ZA 4BTJA 4RVLA 5CAOA 5EHLA 4YLKA 3LMIA 4USEA 3AC2A 3PXZA 4J71A 4ZXTA 3HUCA 2Y7JA 1FINA 2P4IA 4NM7A 4GFMA 3FBVA 1AGWA 3PA3A 2QOQA 2BVAA 4FNWA 4UYAA 3WZJA 4NM0A 1KUTA 2XB7A 4D2RA 5ICPA 5CANA 3BQRA 4V05A 4RBLA 2ITOA 4DGGA 5A4EA 3PXFA 2YABA 2ZV9A 4EC9A 3F5UA 4M13A 1Y8GA 2X8IA 2IZUA 3C5UA 4O0SA 1HOWA 4IX6A 3Q2JA 3I4BA 4A9UA 2HWOA 5AA8A 1W98A 3ZUVA 4L6QA 2XBJA 1SVEA 1Y91A 2GS6A 5AR8A 2ZMDA 3TEIA 4OR5A 2WU7A 4W4VA 4Y73A 3UGCA 4AT3A 5CLPA 5L8JA 2CPKE 3IW6A 4RJ5A 2EU9A 2J50A 3MJ2A 1YVJA 4HGEA 4KIOA 2G01A 4V0GB 3VS0A 4FODA 3A7JA 4I6BA 3MDYA 5AP1A 1KSWA 4BY9E 3RALA 2F7XE 4AA0A 5AM6A 3UIBA 1UNGA 3I6WA 2QOCA 2ITXA 2IW6A 2P0CA 2X7GA 4GEOA 4GYIA 3K54A 5CXZA 2RL5A 3PXKA 5HE0A 3R0TA 4UMRA 2C6DA 3D5UA 1XBBA 4NW5A 4HJOA 3PYYA 5E8VA 4GS6A 3M42A 1VEBA 4KUJA 3BHHA 3R63A 2IW9A 3Q52A 4QQCA 3DZQA 3H10A 4MTAA 3RCJA 4C4IA 4EONA 3DKGA 4RC4A 4TKSA 2W06A 4X2NA 4XP2A 4O7RA 3OXIA 4GW8A 3NUUA 5E1SA 2FA2A 2GNJA 3VF9A 2CLXA 3O23A 3F3UA 2UW7A 4U43A 3ZLYA 1YXVA 5AP7A 2C5XA 4AP7A 3I6UA 5L4QA 4TYJA 2ETRA 4E6DA 5IUHA 3RM7A 1M52A 5KMLA 2UW3A 2W1ZA 4G6LA 5D7AA 2ETMA 3S3IA 4I93A 3DAJA 4FNXA 4JQ8A 5KMJA 4J52A 3MN3A 4IWQA 5AIRA 4X3JA 4FEQA 3KVXA 2YIYA 3NIZA 4UY9A 5KMIA 1H1RA 5JQ5A 1ZOEA 4KD1A 2OJ9A 5AWMA 5AV1A 1IA9A 4LOQA 4RX9A 3VUMA 4X6RA 4I92A 1JWHA 5AP5A 4MD8E 2UW9A 3VS1A 3NNUA 1JSUA 2VO6A 5ACBC 1NW1A 5D12A 4I22A 1T46A 1Q99A 4W8DA 3DBCA 3G6HA 2ITTA 4DLJA 1ZYDA 2PUNA 4NZWB 4KKHA 1XH8A 2WAJA 5JK3A 3WARA 1H1PA 4O38A 4L3PA 5FDPA 4EOJA 5TT7A 3QKMA 2ITPA 5FEDA 5FWKK 2W5AA 5AFVA 3UYSA 4EUTA 2PVNA 4ACGA 4TNDA 5IDNA 4FKQA 5LVLA 3PIYA 2PL0A 2WD1A 4WBBB 3V5PA 4C4GA 1PXOA 1Q8YA 3F5GA 3QTIA 1Z57A 3NYNA 4E1ZA 1G8AA 3HRFA 5IH4A 2R64A 4F65A 2XNGA 2OJGA 3SG8A 4DFBA 3FZ1A 3KF7A 5GHVA 3PDTA 2Z60A 4YLJA 2FB8A 4DEGA 2BFXA 4AFJA 4DFXE 5AM7A 2GTNA 4X21A 2BAJA 1J7IA 1XJDA 2BKZA 4F6WA 4PMPA 3N4UA 4U41A 3CKXA 4JIAA 2OWBA 4DFUA 4MVFA 3R2BA 2PVKA 3LMHA 4GG7A 3E87A 3DJ7A 3H9RA 4MHAA 4UB7A 2P55A 4JX7A 4D58A 4MXCA 4GKHA 3WZEA 2C68A 5CU0A 5HBEA 3PIZA 3R71A 2WQOA 5AADA 3HDMA 4ENYA 4JBPA 3RCDA 4GK4A 5KHXA 5K0KA 3TDWA 2R3HA 3ORZA 4QTBA 4RVMA 3HNGA 2QR7A 2LGCA 3DJ6A 3IECA 4W4WA 4EKKA 4FT7A 4KWPA 1A48A 5FGKA 3PP0A 2XF0A 4LV8A 4Y5QA 4C4HA 1H26A 4K0YA 3GI3A 5T3QA 5L2IA 1OBDA 3M2WA 2QG5A 4OLIA 4FYNA 2DUVA 2ZM4A 4CKRA 5IA2A 3LFCA 4RZWA 4B99A 1Q41A 1OL5A 4WOVA 1J91A 3GU5A 3SKCA 4AG8A 3QGYA 3F3WA 4QMVA 5D9HA 5DWRA 2JAVA 3DDQA 3CLYA 5F9EA 4K33A 5M4CA 4CG8A 1FPUA 4I5MA 4UZHA 4I6HA 1ZWSA 2EWAA 4F9YA 5LVMA 2CNQA 2BRBA 4A9TA 4G3FA 2VTAA 2UW5A 4AT5A 1RQQA 1O9UA 2B53A 1SNUA 2Q0NA 2HW6A 3AMAA 4EOMA 5CAQA 4PMMA 2WMWA 3RINA 3DAKA 3SXSA 4Q5HA 4RJ7A 4Y83A 4FKGA 3T3UA 3JYAA 3O50A 2YIXA 3CQEA 1P2AA 1JOWB 3BYOA 3A7GA 4NKAA 5CWZA 5M44A 3IW4A 4RJ8A 4DN5A 3DXQA 1FMOE 3NLBA 4NIFB 5EQPA 3DTCA 4ITIA 3AC1A 4CZTA 4C38A 5CQUA 4C34A 4U97A 3DA6A 4XG9A 5E91A 3T3VA 3PWDA 4PNKA 3B2WA 2C3LA 3I1AA 4L9IA 3R8LA 4N0SA 3DY7A 4CSVA 3DNDA 3MV5A 2QU5A 3R9RA 4HZRA 3R8VA 2WIHA 5M07A 5BVDA 4RX7A 3QQLA 2XUUA 3ACJA 5EOBA 3FHRA 4RX8A 4EQUA 4YURA 4OTRA 5EYCA 4Y95A 2C0TA 2VAGA 4P7EA 3KF4A 3KY2A 2X9FA 1X8BA 3CY2A 3QD3A 2I0VA 3SRVB 3IDCA 2JKKA 5M08A 3QQFA 2X39A 3ZH8A 3GENA 3E3PA 3ZRLA 4RX5A 4FG8A 2RFEA 4IAFA 3V6RA 4IH8A 4O1OA 4QP9A 1VYZA 4L8MA 1UU8A 2UZEA 4MQ2A 4U40A 3CQUA 3OBGA 4DGLC 3RHKA 5I9XA 4GIIA 3E62A 4FYOA 2H8HA 2I0EA 4KNBA 4GK3A 2GNFA 4YJSA 3NS9A 3QYWA 2VWBA 3CQWA 3NUSA 5IA4A 1PMVA 4RA5A 4AXAA 1GJOA 2C0IA 3CP9A 4XG4A 2BIKB 2F4JA 3O8TA 3R8PA 4MD9E 4BIBA 3JS2A 4IAZA 3R1QA 3ULZA 3EQDA 3D7TB 3LMGA 3GFWA 3KRXA 5D1JA 4D4YA 4FTLA 4FMQA 4D2WA 3A61A 2Z7RA 5DR9A 1UU7A 5EYDA 4XOZA 2PMLX 4PNIA 4QMWA 2W99B 5DGZA 3Q9WA 4M3QA 1H24A 3LCKA 4MXZA 4U8ZA 4FVPA 4O6EA 5K5XA 3KK8A 3ODZX 1YOMA 2VWVA 4FSQA 4JBQA 5FXQA 3DOGA 3E7OA 4GU6A 4FSRA 2IZRA 4YTHA 3K3IA 4BTMA 3FJQE 5H8EA 3CTQA 5LQFA 4LGHA 5AR7A 5JFVA 4Y72A 3LCSA 2J0KA 2JKOA 2RF9A 2CGUA 2EVAA 5CNOA 3OUKA 2B9IA 4JVGA 4OW8A 2WIPA 4QMXA 4AWIA 2WEIA 4C3PA 4TWOA 4CXAA 4MXOA 3DNEA 3DKFA 4KBCA 3FMLA 3UPXA 4FSYA 1OL7A 3CY3A 5HE3A 3QTWA 2PMNX 2JLDA 4M69B 3Q5ZA 3UNZA 1QL6A 3VW8A 3NWWA 1Q4LA 4IZAA 5I3OA 5GINE 2W17A 5CVGA 5E1EA 5GNKA 5HHWA 1YI4A 4LOOA 5KBRA 5HTBA 4P2KA 1H07A 5IQDA 5IQIA 4D5HA 1OIUA 3N4VA 5HE1A 1FVVA 4YBJA 5A4LA 2Q0BA 3QLFA 3W2QA 2W1DA 3LXKA 3KN6A 3NZ0A 4YJPA 5JKGA 4Q2AA 5KMNA 3CGOA 4F7SA 4PPBA 3GNIB 3KRRA 2UW4A 4I21A 4ERKA 2XYUA 3PVGA 4AE9A 2FH9A 3D83A 4I24A 1WVXA 1T45A 1NVSA 4ZTNA 5CALA 5CU2A 5EFQA 5FXSA 4BGQA 4ZP5A 1OKZA 4OT6A 1WBWA 3MTLA 2O65A 5KKRC 3NUPA 2VO3A 2W1HA 3E7VA 4IB1A 2UVXA 3PZHA 4EORA 2CKEA 3E3BX 1TVOA 3FC1X 3M11A 1BLXA 5AEPA 4FSNA 3NYVA 1U54B 4L68A 3THBA 2WTIA 3F5XA 4E4NA 4O7VA 1O6YA 1UU9A 5CSVA 4ZSGA 4CCUA 3OG7A 4RPVA 3EQBA 2WNTA 1ERKA 2JBOA 4BGHA 5CT7A 3HEGA 3FZSA 3UO4A 4GT4A 5HD7A 1YHWA 3PTGA 4TWCA 1YDTE 3D9VA 4RIXB 2OFUA 2PK9A 4ASDA 4QQJA 2IN6A 2UUEA 2Y4IB 1ZRZA 3EQGA 4X3FA 4XH6A 3DDPA 5L2SA 3LFSA 3KQ7A 3VUHA 5B2LA 3UP7A 3RPVA 5BNJA 2VTIA 4KS8A 5CXHA 3IO7A 4WKQA 3RAKA 2V0DA 3HV5A 1H0VA 3VUDA 4RFMA 3NGAA 3DU8A 2PVJA 2UZDA 4FTUA 4O27B 3QTXA 4DTBA 4MF0A 1XH6A 2OF4A 5BUIA 3KXHA 3R2YA 4OAVB 5AAGA 4I6FA 3R73A 2QOLA 1SM2A 5M4UA 3PG1A 2O64A 5E92A 1Q3DA 3VHEA 3Q5IA 3FI3A 3IS5A 3NR9A 3PLSA 4JDIA 4ZS4A 3F5PA 1XKKA 2OFVA 3PP1A 3OS3A 2QU6A 4R1VA 4AAAA 3RK9A 4EH6A 3EYGA 2XEYA 3UO6A 4IX5A 3TV4A 3LZBA 5LCKA 4FTOA 4C2VA 2WFYA 4I3ZA 4Y5HA 3UMXA 4IB3A 4UWCA 5AV0A 4YTCA 1YXTA 2OLCA 3PG3A 2J5FA 3QKKA 4PY1A 3D5WA 1GNGA 4LOPA 3MPAA 2RG6A 4X3FB 3OW3A 3UDBA 4FTQA 3UQCA 2PE1A 4MNEA 2YISA 3VUTA 2R3KA 2UZBA 3ZLXA 5IQBA 1BX6A 4AGWA 4CQGA 3PXQA 3GCSA 2ETKA 4YPSA 4EH8A 3ZLSA 4X2GA 4ZTQA 4XOYA 4WO5A 2J0MB 3DPKA 3BYVA 2OJIA 4R8QA 3FY0A 2F2UA 4JDKA 2JBPA 3DAEA 5DN3A 4YR8A 2R0UA 5JFWA 4L44A 2Z7LA 5K4JA 4QD6A 2XKCA 2WMSA 4FV0A 3SW4A 3L8PA 4D28A 3S0OA 2PZPA 3C9WA 3BX5A 3O8PA 4IJPA 5GZAA 3A7FA 4BCMA 3ALOA 3OOGA 2ONLA 2P33A 3QGWA 3NUYA 4RJ4A 4DG3E 2VWXA 1XBAA 3R83A 1W84A 3NVKI 2XH5A 4I94A 4HPUE 5DE2A 2ONLC 2ACXA 4L52A 2IW8A 3RPRA 4AW2A 3G0FA 2A0CX 3COMA 3W8LA 2QQ7A 4BRXA 1NXKA 4H05A 4CG9A 1WMKA 3R1NA 3FDNA 4FV4A 4RA4A 4KIQA 2YEXA 5TO8A 2CSNA 2BTRA 2HIWA 3NMUF 2VTNA 1V0PA 2C5YA 3QBNA 3BLHA 4RLKA 4NJDA 2W0JA 3FYJX 3QWKA 1W0XC 4IDTA 3DTWA 4TT7A 2OZAB 5HX8A 4JQ7A 4R3RA 1WBPA 2VTRA 4ARKA 3GOKA 3FV8A 3QRKA 4J95A 1M14A 4KKGA 5DPVA 3TL8A 3HAMA 4RIYA 4GL9A 4HGTA 4BCHA 5JGDA 1WVYA 4E93A 5H3QA 4MQ1A 4LRKA 4N6ZA 1REJA 4KB8A 4BDAA 1GIHA 3DV3A 3H9OA 1U4DA 3ZO4A 5IQHA 4QYYA 2XMYA 5F94A 5LJJA 1JBPE 4ZJIA 3R7IA 5L6OA 3H3CA 1OUYA 3E63A 3GVUA 1OGUA 3FMDA 3TXOA 3ZUTA 3L9PA 1Y6BA 3KA0A 1OVEA 4WA9A 2RFNA 2C6KA 1OITA 3IK3A 3P7BA 5BVKA 1S9JA 1A9UA 3BWJA 4KS7A 2WMRA 4AE6A 4C33A 2C4GA 5E4HA 4BL1A 3PRFA 2OW3A 5EG3A 5DR6A 4CZYB 4F0IA 3KCKA 5AR5A 4HYUA 1BMKA 3UC4A 4E6AA 3SC1A 3VS5A 2CDZA 3UOLA 1J1BA 1I09A 2WTDA 4NCTA 4WSQA 3FE3A 3K3JA 3R7VA 2ITZA 4R78A 2XNNA 2ZB0A 3E5AA 5KMOA 2DS1A 2H34A 4NCTC 1ZMVA 2OU7A 5HCZA 4K9YA 3UNKA 4PP7A 4J8NA 5FBOA 2ERZE 2QOKA 3QUPA 3UE4A 3U87A 4KRDA 3R7YA 5ITAA 3G2FA 2YACA 3ROCA 3EFWA 4FZ7A 5G1XA 3BZ3A 3VBTA 2W9ZB 4C02A 5HICA 4JDJA 5HG7A 1OECA 2JIVA 1JAMA 2O3PA 3HL7A 3LW0A 2H9VA 3OCTA 2PY3A 3QFVA 3G90X 4EBVA 3L8XA 4IVAA 3A62A 2WTCA 4RZVA 4D1SA 2XIYA 5M55A 2CKQA 2PULA 2ITNA 4UMTA 4C35A 5EHOA 4B0GA 3RM6A 2R4BA 3EJ1A 3NEWA 2FUMA 3WILA 3AXWA 2OXDA 1Z9XA 3R6XA 4O7NA 1WBVA 2I0HA 2C30A 3HRCA 2PTKA 3LVPA 3W2PA 3QC9A 4D4SA 3EQPA 4CD0A 3KXMA 5DHJA 4XG3A 4O22A 4QQTA 2RSVA 5D41A 4BWXA 1J7UA 4WG5A 4PTGA 3WE4A 5JFSA 2EXCX 2NRYA 3OEFX 3WF6A 4JR3A 1G3NA 1OI9A 3ATTA 3BKBA 3Q04A 4XRLA 3PWYA 4LFIA 4EI4A 3I5ZA 2V22A 2GS7A 4H58A 4BI0A 2Z7QA 4YJVA 4S32A 1A06A 3EZRA 4FSWA 4A4OA 1OB3A 2LAVA 3L9MA 2QURA 4IBMA 4D4VA 5JFXA 2GQGA 3QWJA 3QRIA 3ZXTA 1UVRA 2XK9A 1E1XA 4GV1A 2W5BA 4L43A 3OTVA 1KOBA 1RE8A 3LQ8A 5K3YA 2VTOA 4BDIA 2VZ6A 4IW0A 3MESA 2J0JA 2AC3A 5LMKA 3P0MA 2R2PA 3MS9A 5ANEA 4EHGA 3WZDA 4GIHA 4RQKA 3S1HA 5BVWA 5LMKC 1NVQA 1IAJA 3DB8A 5HE2A 4LRMA 2JDVA 3WYXA 4E5WA 4DT9A 2VTSA 2WO6A 3JPVA 2YERA 3PZEA 4BF2A 5IISA 5C01A 2Y8OA 2R3IA 4EYMA 3MFTA 2W1FA 4A9RA 3TTIA 4YU2A 3SW7A 3MGYA 4FV1A 4CYJA 4UX9A 5KMMA 2CN5A 1LUFA 2QCSA 2WGJA 3MTFA 3QD4A 2JFMA 3QL8A 4BWKA 4DEBA 3LFEA 4WNPA 3CPCA 2OF2A 3EHAA 5LARA 5M4FA 3FLSA 1CTPE 3ORTA 3Q60A 5FTQA 4DTAA 1YXXA 4QP1A 2WTVA 4YPDA 3WYYA 1URWA 3GBZA 3VJNA 3F66A 4H39A 4LRJA 3EKKA 3VW6A 5LVPA 2HXQA 4P90A 1RW8A 4MH7A 3TV6A 4BDJA 3QXOA 4FC0A 5ANKA 3V8SA 3E8EA 3PJ2A 5I5ZA 3COKA 2RFSA 4I0TA 2R3PA 3D5XA 4FV8A 4XBUA 3Q2MA 2WU6A 1STCE 5I9UA 3R7UA 4A9SA 4F4PA 3WIGA 3IGGA 5I3RA 3WE8A 4ANOA 3BLRA 4DFZE 3AD4A 1KV1A 2R7BA 3BE2A 4XYFA 2ZVAA 2QOOA 2ZB1A 4F08A 4IVCA 4IM3A 2JIIA 4XX9A 3QTSA 4FSTA 1OBGA 2C6LA 5CTPA 4YC3A 3B8QA 4BCQA 2XK4A 3CE3A 2NNWB 3NW5A 5AP4A 2PU8A 2ITQA 2XJ2A 4C8BA 3U4UA 4GJ3A 3MH0A 1GIJA 4G5JA 4M67A 4ASZA 1BI8A 1MRUA 4W8EA 5IMXA 3BQCA 1U5RA 4JBVA 2CCIA 4YBKA 3H0YA 3H4JA 2PMIA 3EFLA 4TXCA 2BTSA 3P23A 1YOLA 4D5KA 3I0OA 1GZ8A 3MYGA 2IWIA 3HKOA 3NNWA 4LL0A 5EW3A 4CVAA 4JLCA 3ZOSA 3TUBA 2F7EE 4DFNA 3EN7A 4FZFB 3ZM9A 5HO8A 3ANRA 3C5IA 2ZMCA 3I0QA 3HECA 3AOXA 3GXLA 3LJ0A 2Z02A 5EI2A 4MK0A 4AS0A 3GC9A 5IEXA 3A8XA 2FO0A 3BGPA 4EWQA 1MQ4A 3SA0A 3QCYA 2XK6A 4UWYA 4Z9LA 5FM2A 4F9BA 4FIGA 3GU7A 5FXRA 4W9XA 4E20A 2XM9A 5GJFA 5B2KA 4NUSA 3GQLA 2QKRA 1BUHA 3SGCA 3IPHA 4E4MA 4QO9A 2X9EA 2YCFA 4AGCA 1UA2A 1WBSA 5CAVA 3RI1A 4FE2A 4BGGA 1JLUE 3HZTA 2GQSA 3UP2A 3PJ1A 5FM3A 3R9NA 5K9IA 4FIHA 2W5HA 3LOKA 3G51A 3VBVA 5LWMA 4FL3A 3LPBA 4NU1A 4U3YA 4BDHA 2YZAA 4DFLA 4BBMA 3MVMA 3UPZA 4MCVA 4NSTA 3AD5A 1QMZA 4AW5A 5AV2A 3DK7A 3QF9A 4G6NA 3IKAA 3QHRA 4ZY4A 3EWHA 5L3AA 3TJDA 2YDKA 4WT6A 2X8EA 2WOTA 4IFCA 4L7SA 3QX4A 4EOKA 2XKDA 4DEAA 4F0FA 1KE7A 4FKRA 3BHUA 3MBLA 3IONA 5IQFA 3O7LD 5HTIA 3OW4A 4BIEA 5EYKA 3IDBA 2QG7A 3LLTA 3TNWA 2QVSE 3HV7A 3BWFA 5AP2A 5HIBA 1W83A 3P7CA 4NFMA 3S2PA 2OICA 5AUWA 4YZDA 3SOAA 1M2RA 4HZSA 1VZOA 2VTJA 2VWYA 3PSDA 2WHBA 4ZK5A 4EOIA 3G9NA 2R3FA 3NPCA 3CC6A 1FGIA 3DQWA 5CI6A 4YJRA 1JPAA 1PMEA 3AT3A 4K8AA 4RJ6A 4EBWA 5FLFA 2YDJA 2WTWA 2HCKA 3SG9A 3SLSA 2IG7A 5CQWA 3IW5A 1O6LA 3DXNA 3MVJA 3QUDA 3CD3A 3N51A 4YZNA 1Q3WA 5E90A 3PXRA 1KE6A 3QRJA 4RIWA
chains in the Genus database with same CATH superfamily
2X6DA 2XKFA 5AP0A 2JDSA 4ONAA 3VWAA 3DBDA 3Q6WA 4FZAB 4E73A 4I41A 4LUDA 2YM3A 1UWJA 4YJUA 5HLNA 4EHVA 2JGZA 3MSSA 5HGIA 3TN8A 4X0MA 2RGPA 3BU3A 3NUNA 4CGAA 5DT3A 4YNOA 4QMOA 3S95A 1HCLA 4DA5A 4USFA 3F3TA 1ZOGA 3UQGA 5DEWA 5EM5A 3NNVA 1KWPA 5DR2A 3TUCA 3E8DA 3W0PA 1OKWA 2ZDTA 3KGAA 2ZV7A 2UZUE 3MH3A 5F1ZA 4CFXA 4EH2A 4ZLZA 4EC8A 2R0IA 4DHFA 5HLWA 5DA3A 3L8VA 3RK5A 4PDOA 2I7QA 4UWBA 3SAYA 2VNWA 4ANLA 3QTZA 3GC7A 5CF5A 3A7IA 4FK6A 2OG8A 4PL5A 4ZZMA 4ALVA 1XH5A 2YFXA 4AQCA 4CCBA 2YWPA 4JNWA 4FZDB 3U8WA 3FKNA 4V01A 4XP0A 2PVRA 3FSKA 3GU4A 3NUXA 4O0TA 3LFDA 1ZY4A 3LFQA 4HCVA 3FPQA 4DEHA 4B7TA 4K1BA 3E64A 4N4SA 4HOKA 5AUVA 4EHEA 4MX9A 2O0UA 1YOJA 4F70A 1FGKA 2WQNA 2C0OA 3OWPA 5EYMA 2NRUA 3PUPA 3O0GA 3HRBA 5A4TA 4R7IA 4O21A 4TRLA 1H1QA 1YKRA 2VD5A 4A07A 3HMOA 1TQPA 4ANQA 4O7WA 5IQCA 3F3VA 4H36A 2YDIA 3FLWA 4OBOA 4J99A 3P78A 3EMGA 3AT2A 4M14A 2R3GA 2A2AA 4LQMA 1Q97A 4KSQA 3DQXA 3LHJA 3VIDA 4FSUA 4XUFA 3C4WA 3ZM4A 2X1NA 4ANSA 1M17A 2F49A 5HBJA 3C4ZA 3NCGA 4IVDA 5CENA 5B7VA 1B39A 2IVSA 3U6IA 4IB5A 3EQRA 4O2PA 4TYHA 5AR4A 3TDVA 3A60A 4AXEA 1VYWA 3OVVA 1CM8A 2VTTA 4B9DA 4LUEA 5BVOA 5FG8A 2B0QA 4HYIA 4GFOA 2R3QA 4L7FA 3EFJA 4PF4A 5TE0A 4DH3A 5KZIA 4BR3A 3Q6UA 3W32A 3EN6A 3RWPA 1W7HA 1K3AA 3EN9A 1APME 1CMKE 4I4FA 3VBYA 2ZFYA 4O0WA 3TNIA 4FK3A 5CEIA 3WF8A 4ACHA 5I9VA 4N6YA 4UEUA 4LGGA 3GB2A 4FEUA 1SMHA 4PL4A 1E9HA 2HW7A 3FXZA 1PXLA 1XMLA 2XNBA 4QP6A 3UBDA 4G3CA 3VUKA 4S31A 1LEZA 2VWZA 5CF4A 4UYNA 4BDDA 5K5NA 2QOHA 4O2ZA 1KOAA 3TI1A 2G2HA 5IG1A 3ZXZA 1V0BA 3ID6C 3O2MA 4XHKB 2E9OA 5F95A 5CEPA 1YRPA 5HIDA 2C3KA 1YXSA 2JKMA 4M0YA 4OTWA 3P4KA 3FQHA 4M97A 1I44A 4EUUA 3NUAA 1P4FA 3QQHA 1Y8YA 2XEZA 2O2UA 3O71A 2A19B 2CJMA 5C1QB 5HBHA 3A2CA 3PSBA 5LOHA 3NNXA 4JG7A 3D5VA 3KL8A 4JDHA 2J0IA 3E8CA 3EQFA 1GOLA 4DLIA 3HGKA 5CX9A 4CFWA 1JKTA 3PJCA 2AUHA 4IQ6A 4RSSA 5FP5A 5J95A 3A8WA 3REPA 4E5BA 2Y9QA 5IH5A 4DH5A 3GT8A 4GMYA 4YZCA 2OK1A 3EQHA 4G16A 1PRYA 4WSYA 2BAQA 1H28A 2ZM3A 3BCEA 3EZVA 2WMTA 2G15A 1CKIA 4IZ7A 4C4FA 4J98A 4IC8A 3KULA 4F9WA 2FSOX 5HLPA 5AUXA 4PQNA 4I23A 2FSTX 1GY3A 4FGBA 4QTEA 4USDA 3BU6A 4ZSEA 3WF7A 5CF8A 1AD5A 4J97A 4RFYA 3UTOA 4CNHA 2E9VA 1XO2B 4S34A 5AIKA 4AGUA 4D0WA 5EK7A 4EK5A 3V3VA 3R02A 1ATPE 2J51A 4FSZA 3TJCA 3W2CA 2PZYA 3AMYA 4MAOA 3GCVA 1FMKA 3FWQA 3EKNA 3UG1A 4OAUC 1YHVA 2PWLA 1PKDA 3SX9A 2EB3A 2IVUA 1OMWA 4YZBA 2B9JA 4AN2A 4EWHA 1ZYSA 5JGBA 1MRYA 3FL5A 4JRNA 3DBEA 3FY2A 4QEBA 4RWLA 3I7CA 5TR6A 4F1OA 3FMNA 2XRUA 3LCOA 3QZGA 4YHTA 3TACA 3VBWA 4A7CA 4AT4A 1QPJA 3PJ3A 2ESMA 5DG5A 4PL3A 4QTAA 3ZSGA 2Z8CA 3NCZA 1WBOA 3KXNA 3T9TA 5HZNA 2H6DA 3KULB 4HGSA 2HOGA 4WG3A 2HENA 3CKWA 3MA6A 4MBJA 5KZ0A 4CFFA 2V5QA 3RAWA 3ZC5A 3NFGB 2C5NA 2JDRA 4FTAA 2CMWA 4TYEA 3BYSA 3CJFA 3ZSIA 2UZWE 3UVRA 3Q4TA 3OF0A 3RPOA 5BPYA 3FMKA 2Y6MA 1JSVA 2BZHB 3NAYA 4FTJA 4IEBA 5TOZA 3W33A 4IADA 1OL6A 4MEDA 2B9HA 2UW0A 4D9UA 5AJQA 5IZFA 4E5AX 4AAYA 5ETCA 1ZARA 4FOBA 3BEGA 2F9GA 2X81A 4DGMA 3C13A 3TG1A 2J6MA 4L45A 1OPJA 2OI4X 1JVPP 4YJQA 3ACKA 1PXKA 4F99A 3FAAA 5JRQA 3W8QA 2CGVA 4FV3A 3I7BA 3R7GA 3EB0A 5J9LA 3UZTA 3RTPA 1YQJA 3IW7A 3QHWA 4F9AA 5BVFA 4IAIA 4UMQA 3ORNA 4PV0A 5E8ZA 4PWNA 3JR1A 3TUDA 5EQEA 1SNXA 5L8KA 2XCHA 3F6XA 4AW0A 4AZFA 3CD8A 5A54A 3Q4ZA 1W2CA 4I6LA 1GZKA 5BX0A 5M56A 4O1PA 5JQ8A 1OUKA 3LFAA 3U6JA 4ZSLA 4BHNA 2A27A 2BZIB 3COHA 1O6KA 3R1SA 5AMNA 1G5SA 3PE1A 5FUTA 3LJ2A 1URCA 4R3CA 1PXNA 3PY1A 4FIFA 3QCQA 2VN9A 3TT0A 3TYKA 4EZ5A 4FTKA 4OGRA 5KKRB 2WQBA 4AQKA 4U7ZA 4FIIA 4FUYA 5HCYA 3QC4A 5CASA 4FKWA 1XHAA 3OEZA 5HOAA 3R9OA 4O7YA 5IDPA 5DOSA 2QONA 2YN8A 2OJFE 4LMUA 4XG2A 5AP6A 4AZVA 4XV1A 2XRWA 2VU3A 4FKVA 5EKNA 5HVKA 3KREA 3VBQA 3WIKA 4QMNA 4FTMA 3MY1A 3IQ7A 4H1JA 2CNVA 3QTUA 2IO6A 3GGFA 3I60A 4G31A 2IZTA 2VTQA 5AUYA 2YITA 4C37A 3T8OA 4NWMA 5F20A 4G2FA 4F63A 5HG8A 2C6IA 4ACDA 4BCIA 1OM1A 4KA3A 1P5EA 4K18A 2C6EA 1WVWA 5HIEA 2C1AA 4NM3A 4L67A 4TYGA 3H0ZA 5EM7A 4TY1A 3NRMA 3HAVA 4GKIA 2IF8A 2QC6A 2GS2A 2YCSA 3U9CA 4F64A 3PIXA 3QAME 3HA6A 4OTGA 4FV5A 3TNQB 3NVMB 5ACKA 1M2QA 5FP6A 2BDWA 2GFCA 2QLUA 3FQSA 3VO3A 3NAXA 3WBLA 3CS9A 1LEWA 2PMOX 3DGKA 4TN6A 1IG1A 3FHIA 2YCQA 3BLQA 5E8XA 5JH6A 4Z7GA 5KHWA 2C47A 3A7HA 4NKSA 1XBCA 4M66A 3QD2B 5DLSA 3HYHA 3RMFA 3OXZA 2BRHA 3RK7A 2HZ0A 4O82A 4FG7A 1H0WA 5KE0A 1ZZLA 1Z5MA 1BKXA 2BR1A 3JY0A 5DRBA 4A06A 4F7NA 4ZJVA 4D55A 4QDEA 3R30A 3G0EA 3R7OA 3RJCA 5AR2A 3V5TA 3LCDA 3AC8A 4EL9A 4ZY5A 1R78A 2PSQA 2BHEA 4FKLA 2WTKC 4N70A 4Y85A 2QHNA 4QMUA 4JR7A 4QP8A 4DHJA 3RZFA 2YM8A 3ZU7A 2PVMA 4IDVA 1K2PA 4KIKA 4F1TA 5KMKA 4AXDA 4LM5A 4WNOA 1R3CA 1GIIA 4MNEB 2BHHA 4QPSA 4I6QA 4RWIA 1WBNA 5CU4A 5HEZA 5C03A 4KIPA 4ZJJA 2JEDA 3UNJA 1U59A 2BPMA 2GU8A 4FTNA 1ZAOA 3G6GA 4ZLYA 4FKUA 3R01A 5IF1A 3GP0A 4FTCA 3UVQA 2QODA 3BBTB 3SQQA 3GQIA 3B8RA 3TV7A 4G3DA 2YM5A 1G8KA 4NL0A 4O0YA 3ORLA 4RIOA 4FTIA 3UC3A 3FLZA 4FT0A 1UV5A 1W8CA 2HY81 4HVGA 5EI8A 3ZO1A 1R1WA 5EQYA 4O0RA 5DH3A 3FC2A 1YWNA 4FKPA 4U9AA 2XK8A 2HELA 3ORMA 4HVSA 3CTHA 5DT0A 5GIOE 5HVJA 2W4OA 3NIEA 4BCKA 4EOLA 4F7LA 2P3GX 2ITYA 2IVVA 2PYWA 4CLJA 3D2IA 2FSLX 1QCFA 4R5SA 4EJNA 2BUJA 3A4OX 3BPRA 4MBLA 4U45A 3P9JA 3ZO3A 3JUHA 1JKKA 3JVSA 3R1YA 5E8TA 5IQGA 2O8YA 2PHKA 4OTDA 1Q5KA 3G9LX 3D2KA 4G17A 3RWQA 3UZPA 1QPDA 2I6LA 3DKOA 4II5A 4HYHA 2GQRA 3I5NA 5DVRA 2W1CA 3DJ5A 3KXZA 3KCFA 3ZEWA 3TKUA 1R0PA 4FEWA 4AZWA 5BVNA 3VJOA 5DRDA 5EHYA 3ET7A 5J9YA 5E8UA 4U3ZA 4A9YA 4N57A 1XH7A 1OKYA 4DITA 2XIXA 5DIAA 4TTHB 1PXMA 2IVTA 4RIYB 2O5KA 1AQ1A 3QZHA 4S30A 4X2JA 3OD6X 4B8MA 4C4EA 3DXPA 4CEGA 4H3PA 1J7LA 5KX8A 1L3RE 3KXGA 4KKEA 3ZFYA 4HNFA 4F9CA 2UZTA 4KAOA 3EIDA 4L00A 4CMUA 4DYMA 1YI6A 2F7ZE 2HZIA 3LXLA 3OWJA 1M2PA 5ANOA 3ZO2A 4AW1A 4O91A 4EYJA 4TYIA 1DM2A 1LPUA 1M7NA 4RRVA 3GU8A 5BYYA 3GUBA 4UXLA 2GCDA 2IJMA 5AP3A 1U5QA 1XH4A 1U46A 4NTTA 3DKCA 4EK6A 1DI9A 2PUUA 4P5QA 5A9UA 3U6HA 4P5ZA 1PYEA 4AGDA 3PY3A 1IR3A 4L53A 1YWRA 5HCXA 4DEIA 2VNYA 3ELJA 3MJ1A 5GJGA 5M06A 4UALA 4RQVA 3K5VA 4G3GA 3ZCLA 1SVGA 4UN0C 1F0QA 4YJTA 5E8SA 2PE2A 3CPBA 4JXFA 2NYAA 3OMVA 2J0LA 2VWWA 3AQVA 3POOA 1V0OA 3P79A 2OGVA 5CT0A 4FNZA 1Y6AA 3QA0A 4ZTLA 5CVHA 4EK4A 3HVCA 4KABA 2X6EA 3OCBA 2XA4A 4CMOA 2BDFA 5FD2A 5I0BA 2I40A 4PX6A 3UIXA 4DH8A 4AXFA 4NJ3A 3MVHA 3OCSA 3HUBA 3TNHA 3FXXA 3OROA 1CKJA 3HMNA 2YJSA 4XG8A 3ZRMA 4KINA 4GYGA 4NK9A 2V7AA 4LI5A 4O4FA 5M09A 2XBAA 2A1AB 4CLIA 3W2SA 4UBAA 4F7JA 2BAKA 1JKLA 4BKYA 2B4SB 1PF8A 3ZDUA 4NEUA 2B9FA 4QMMA 3AG9A 2BRGA 2XP2A 2QO9A 2W96B 5H8BA 3D0EA 1H1WA 3L9LA 2UV2A 4AZSA 2WMAA 2JKQA 2XJ1A 3FPMA 3HA8A 4G5PA 2C3JA 3BELA 3KRLA 4ZSAA 4YGAA 2R3LA 4AN9A 1YHSA 5E8WA 3PVWA 4FV6A 3UG2A 3Q9ZA 3KRWA 4RVTA 4LMNA 2Z7SA 3C4EA 1PMNA 4BCNA 5IEVA 3PVBA 5FBNC 1PHKA 2ZV8A 2BFYA 3LFBA 2ZDUA 4KSPA 1FOTA 1JSTA 3WF5A 3FI4A 4IAYA 5D7VA 3U54A 1BI7A 2X8DA 4H3QA 2RFDA 4CRSA 5EKOA 1ND4A 4ZIMA 5L2QA 3KEXA 2R3OA 4BDKA 2REIA 5CEOA 3QUEA 4FTRA 2FVDA 4IJ9A 3KFAA 4D1ZA 3WI6A 2C6MA 4DINA 4EJ7A 3FLYA 4XV2A 4R5YA 3PE2A 5AV3A 4EZ7A 4XV9A 2IZSA 5C8NA 3R22A 4FVRA 4EQMA 4DGNA 2YHVA 4R77A 4I5PA 3UVPA 3DZOA 4HVIA 2NO3A 4PMTA 1DS5A 4X2FA 4YNEA 5L6PA 3LLAA 3ITZA 3OT3A 4QMPA 2CN8A 2W4KA 3S4QA 2VGOA 4GSBA 5C27A 3VS4A 4DFYA 4DAWA 4BC6A 1FQ1B 3MB6A 3W2OA 1RJBA 2Q83A 2QKWB 1H1SA 4OTIA 2HK5A 4ANMA 5L2TA 2PUPA 5AAEA 4ERWA 3TNPC 5ETFA 4IZYA 4V0GA 5IEYA 2RG5A 4F6SA 2BZJA 1DAYA 4NTSA 4XRJA 5GJDA 5CZIA 1MP8A 4FG9A 4C2WA 4BHZA 3R21A 4D9TA 3IG7A 4EOPA 4MBIA 5EDPA 4Q9SA 2PVFA 2W05A 3ANQA 4OTQA 4BCFA 4AXCA 3O51A 3PLAE 3MH1A 2P2IA 1P14A 4CYIA 4CKIA 4FA2A 2J4ZA 4QP4A 1IAHA 1H25A 3POZA 2VWUA 3D4QA 2DYLA 2EUFB 2GTMA 4DT8A 4GUEA 4ZMFA 3QRUA 3U9NA 3EQIA 4GRBA 5CU3A 4EK3A 4FKSA 4BFMA 5BMMA 3VUGA 4JS8A 3FXWA 5LVOA 2YLEA 5JT2A 2OKRA 2W9FB 1VR2A 4YSMA 2DWBA 4GVAA 3L9NA 4PTCA 4HYSA 5AX3A 4GG5A 2E2BA 4E3CA 2UZVA 2VGPA 4DHZA 4BYIA 2BIYA 5CS6A 5BV3A 2RKUA 2P2HA 4NT4A 1S9IA 2QO2A 3KXXA 4QPAA 3Q9YA 4LV5A 3ORPA 4XBRA 4YP8A 4F0GA 2PZRA 3MFUA 4QMYA 3E93A 4CRLA 4ZAUA 4IWOA 2HYYA 2YM4A 4EH9A 4EEVA 5AR3A 4LYNA 2QOIA 4ENXA 3G15A 5HNBA 1ZMWA 1Q8UA 2BDJA 3QQJA 3RZBA 2PZ5A 3C50A 4B4LA 1F3MC 5L2WA 3GC0A 2EB2A 3G33A 4K11A 4DC2A 2VTHA 3F82A 3BBWA 4BCPA 5BYZA 4O0UA 3WOWA 5AA9A 5EW9A 3CSVA 3MI9A 4ITJA 3OHTA 4O96A 4BCGA 4U42A 4RVKA 3VS7A 3F61A 2PVHA 4G9RA 1YWVA 3BRBA 5A14A 3HV3A 2WOUA 1DAWA 4AACA 4IWDA 4C58A 4DCEA 2X2MA 4C7TA 4HVDA 3CEKA 4J1RA 4E26A 5IMEA 4D0XA 3FSFA 4J96A 4WIHA 3TWJA 2WZJA 3ZHPC 4QP2A 3FL4A 3UOHA 2FGIA 4S33A 4HW7A 1JNKA 3P5KA 1NVRA 3ENHA 5FRIA 1ZMUA 2VX1A 3UDZA 1ZYLA 3AC4A 4IMYA 4O4EA 4Y8DA 2UZLA 4OTPA 1PJKA 3QCSA 3VQUA 4DE4A 3DLZA 5ETIA 3VRYA 2VTLA 2W1GA 2YA9A 4EH4A 4JT3A 5LVNA 4UMUA 4BB4A 2SRCA 3R28A 4GU9A 3ORIA 3E8NA 3SVVA 3RAHA 4WD5A 5EDRA 3N9XA 4CZUA 5ANIA 3TCPA 4K2RA 3BGZA 3QU0A 4G1WA 4O0VA 3V5WA 4XP3A 2IPXA 3KB7A 2QNJA 4FR4A 4C59A 3DB6A 4IZ5A 5EM8A 4PPCA 3LAUA 4ZTSA 3ERKA 3HMIA 4CTCA 5KNJA 3OCGA 4JJRA 2UVYA 3MPTA 4WBOA 3W10A 5J5TA 1ZLTA 2R9SA 5T68A 5I9ZA 4FL1A 1NA7A 2KTYA 3Q96A 4D2VA 4DH7A 1PXPA 3QXPA 5HNIX 4M15A 4I4EA 4OTFA 3MFSA 3CTJA 4RC2A 4YSJA 2W4JA 1PW2A 1YW2A 3C4CA 4JIKA 5KCVA 4F1MA 5HO7A 5BQ0A 3OC1A 3BEAA 2O63A 4QYEA 4AF3A 2NP8A 4U0IA 3ALNA 2W7XA 3OT8A 4IHPA 3I81A 2GPHA 4ANNA 3H9FA 3TIZA 1LP4A 3UIMA 3HP2A 2OXYA 5IPJA 2KULA 5KO1A 4R7HA 3MB7A 3RPSA 3P86A 1EH4A 2VUWA 2WXVA 4DEEA 2CNUA 5AAFA 3QTQA 1OL2A 2OSCA 2YM6A 4JI9A 2PZIA 3F3ZA 4MYGA 4RMZA 3VC4A 4BDGA 2HZNA 5JZJA 4IWPA 4PDPA 3GOPA 1W2DA 2VO7A 5D11A 4WUAA 5HNGA 4Z3VA 3TKHA 5C4LA 1ZZ2A 3CXWA 2ZAZA 3KKVA 4AU8A 1FVTA 2B7AA 3ZMMA 3ZSHA 4RIWB 3AC5A 2WQMA 3BE9A 3KK9A 4C61A 2VWIA 2WEVA 4QNYA 1J3HA 3GCUA 5FQDC 3V5LA 2GNGA 4L3LA 4NYEA 4Y46A 4GVJA 3RHXA 3KMMA 2C6OA 4HGLA 4F09A 3UZRA 4XLVA 4YC6A 5J87A 2OZOA 2DQ7X 5CVFA 4QQ5A 1TZDA 2YAKA 1W82A 3FLQA 5C4KA 1Q61A 3UOKA 4UXQA 4YTIA 3QQKA 3PY0A 4BVUA 4EZ3A 2HXLA 5H8GA 4APPA 4ID7A 4F6UA 2XIZA 4GH2A 5J1WA 2QI8A 2F2CB 4NIFA 4RJ3A 4GUBA 5BVEA 4A4XA 4J53A 4BWPA 2ZYBA 4JRVA 4FF8A 4IXPA 4FKTA 4O4BB 3DK6A 4QYFA 4ZMEA 3ZUUA 5GIPE 1TKIA 5EM6A 2XALA 5EI6A 2C6TA 5CAPA 4ZS0A 2OIBA 2W1EA 2V55A 3FQEA 3NYXA 4G6OA 3V51A 1XH9A 3VAPA 1IEPA 2J7TA 2G2FA 2B1PA 2OIQA 4BI2A 2YCRA 3MVLA 4FV9A 4D1XA 2XK7A 1UU3A 3PA5A 4G9CA 5KUPA 2ITWA 4S2ZA 3Q32A 2BALA 4I5HA 4QTCA 2XNPA 3JY9A 3VBXA 5JZNA 4GT3A 3SRVA 4TPTA 4WUNA 4KBAA 3A99A 3Q4UA 4OBQA 5CSXA 3U4WA 4O84A 3PPKA 2C5OA 3TKIA 2JAMA 4D2PA 1R39A 3UYTA 4EQCA 2WTJA 5HQ0A 4QMZA 2C1BA 3W0QA 4JOAA 3EL7A 4Z7HA 4ZTMA 3UOJA 4MD7E 4DGOA 4YUQA 1OPLA 4Q5EA 3ZDIA 1TQIA 1KE5A 5ANDA 4FEVA 3RAIA 3V5QA 5ANGA 4RWKA 3R8UA 5GZ8A 4ORKA 3K5UA 4JG6A 3TZ9A 4AOIA 5E9EA 4L42A 5GZ9A 4KRCA 3BV3A 3RVGA 4L3JA 4Z55A 3ZZWA 4RG0A 4JX3A 2BRMA 2R3RA 2VV9A 3OOMA 2CKOA 2C3IB 5T6KA 2GDOA 3CR0A 1XWSA 3AT4A 1YXUA 3O8UA 3BU5A 1BYGA 5DEYA 5B0XA 2YZLA 4CV8A 3OY3A 5K4IA 2Y0AA 4ACMA 3C51A 4X7QA 2G9XA 3D7TA 3RNYA 4TYHB 5I9YA 4WNKA 3WF9A 4QMTA 4LV7A 1MRVA 3NW6A 3QZIA 2R5TA 3R00A 4G34A 4RGJA 5HESA 3MIAA 4B6LA 2WPAA 3A4PA 2ITVA 3LXNA 3MPMA 4LG4A 5DT4A 3MA3A 5HX6A 4U80A 5JGAA 4R7BA 1NY3A 4IX3A 2XK3A 4U5JA 5FDXA 2GNLA 4QYGA 4CFVA 3PXYA 4MWIA 3LFFA 1PXJA 3NFFB 3DCVA 2X0QA 2UW8A 5H2UA 1ST4A 2ITUA 2ZM1A 3LQ5A 1VJYA 2XKEA 4XCUA 4AA4A 5IU2A 1V1KA 3C1XA 5JSMA 3ATSA 1QPEA 1ZXEA 4IAAA 3RGFA 4L46A 3BHYA 3ZBFA 2HY0A 1CSNA 4JG8A 3V6SA 4M84A 3O17A 5HU9A 5DI1A 3WZKA 4FUXA 1ZOHA 3HX4A 2CLQA 4IX4A 5IUGA 4AX8A 5TKDA 5HD4A 2JDOA 3R04A 2CCHA 3QA8A 3ZRKA 1OIYA 3ZTXA 3VS3A 3OTUA 2VTPA 2J9MA 3SOCA 4WNMA 4JAIA 2GHLA 3Q4CA 2YM7A 3VS2A 1DI8A 4M69A 5J7BA 5LMBA 5A4QA 3D94A 1SZMA 3OWKA 5IKWA 4FT3A 4OBPA 4RC3A 4EH5A 1XMMA 3KMWA 3KU2A 4QNAA 4R3PA 4C3RA 3HMPA 4HVHA 5AUUA 4I0RA 2X4ZA 3VQHA 1RDQE 3FZOA 2QOBA 5CY3A 4YC8A 3RBWA 3L8SA 3IOPA 2J5EA 4PRJA 2XNEA 4ALUA 4AOJA 5J1VA 4DG0E 3UMWA 4RLLA 4FT5A 2Z2WA 4QMQA 3CGFA 4FKJA 2R7IA 1XQZA 4YHJA 3D14A 1Q8WA 3PVUA 4C57A 4J8MA 4CTBA 2ERKA 3II5A 2GSFA 3P7AA 3MIYA 2WMQA 2B55A 4FV2A 5M53A 4YO4A 5LMAA 2BILB 3FMHA 4HCUA 3EN5A 1B6CB 3QYZA 2AC5A 4XNEA 4E6CA 2WMVA 5HU3A 4PPAA 4CFUA 1TQMA 3LM0A 4IE9A 1H01A 3SXRA 4UV0A 4ITHA 3TTJA 2PUIA 3ZC6A 1XR1A 3QD0A 2HWPA 3VUIA 4YTFA 2EXEA 2V62A 3COIA 3L1SA 3ENMA 4FL2A 2OO8X 2WQEA 3V04A 4BZDA 4H3BA 1JKSA 2G1TA 3HMMA 3UO5A 3F69A 3AKKA 1PKGA 4IM0A 1B38A 1U54A 4FX3A 4FKOA 5CAUA 4DEDA 4MXXA 3LFNA 4ZTRA 3UODA 4D2TA 4AZTA 4FBXA 4TL0A 4IIRA 3I79A 2XS0A 1KE9A 3EL8A 3GU6A 4DCAA 4NW6A 1GZOA 2VO0A 2XYNA 3LIJA 5G6VA 4BBFA 4E7WA 4B8LA 4FOCA 4RIXA 2A4LA 2R3NA 3HLLA 5IUIA 4BKZA 4BI1A 3Q9XA 4HCTA 3VULA 3DFAA 4BKJA 4IB0A 1PXIA 3DS6A 1WBTA 3W16A 3DT1A 5I4NA 4CQEA 2BCJA 3QRTA 3BGQA 5HVYA 2X2LA 4BN1A 4XEYA 2Y4IC 4EH3A 5IQEA 1SVHA 4BDBA 3C4FA 3E88A 4MKCA 2GNHA 3R8MA 3P1AA 5ANJA 3BV2A 1HCKA 1F5QA 1GZNA 2FSMX 3DBQA 4W4XA 3GC8A 4BICA 4EOOA 5CSPA 5IA1A 1NT2A 3LQ3A 4W9WA 1UKIA 4IM2A 3ZLWA 3D7ZA 3FI2A 4MUQA 3ZEPA 4FTTA 3C7QA 4OUCA 4QTDA 5CYIA 4O83A 1IA8A 2ZV2A 4FIEA 4C4JA 4C62A 5I9WA 3FEGA 4GT5A 3NYOA 2JIUA 4M12A 4YMJA 1E1VA 5A46A 5HTCA 3RKBA 5J8IA 1H27A 5AX9A 2VRXA 4FVQA 4F78A 2HAKA 3OFMA 4CMTA 3EH9A 4HPTE 4Q9ZA 4JQEA 2OH0E 1WCCA 3GEQA 3VRZA 2UZOA 4MXYA 1OKVA 2WB8A 4QP3A 3R7EA 4CT2A 5FTGA 4ZZNA 3GCPA 3OXTA 3TZMA 3HV6A 3BIZA 3NDMA 5CZHA 4U44A 2UW6A 4AN3A 3JVRA 3HP5A 4BZNA 2J2IB 3W18A 2YAAA 3OY1A 3QZFA 4DTKA 4ZTHA 4X3FC 4EHZA 4OTHA 5IQAA 5CU6A 5C8KA 3V8TA 2JITA 2X2KA 4GFGA 2VX0A 3RNIA 4ANBA 4BCOA 2PVLA 1JQHA 4YZ9A 2WMBA 4YO6A 3KMUA 3ZZEA 5K0XA 2UVZA 4K6ZA 5E8YA 3ZONA 3W55A 3NSZA 4TWPA 3VS6A 3EFKA 2WMXA 1IASA 3B2TA 4XG6A 5CEKA 3MW1A 1ZYJA 3IGOA 4LL5A 3TMOA 4ZSJA 3W0OA 3C0IA 1KV2A 4QYHA 1REKA 4ZZOA 4FEXA 1WAKA 4GJ2A 1OZ1A 5EDQA 3TIYA 4XS2A 2W1IA 2OIDA 1QPCA 3ODYX 3AD6A 4W4YA 1OIRA 1M7QA 2C5VA 3O96A 3VHKA 3AGLA 4FT9A 4RT7A 4WRSA 3UIUA 4PDYA 4JAJA 4EOQA 4YLLA 5TF9A 4YJOA 3W0RA 3IOKA 5HG5A 3OWLA 5C8MA 3CCNA 2CGWA 5M51A 3C0HA 4IAKA 4BIDA 3FUPA 3P08A 3SDJA 5J7HA 3MY0A 2BRNA 4NFNA