1R3CA

The structure of p38alpha c162s mutant
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
349
structure length
349
Chain Sequence
ERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDSELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Mitogen-activated protein kinase 14
publication title Lattice stabilization and enhanced diffraction in human p38 alpha crystals by protein engineering.
pubmed doi rcsb
source organism Homo sapiens
total genus 108
structure length 349
sequence length 349
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2003-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1r3cA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1r3cA01
1ZMWA 4TTHB 3NW6A 4BCJA 5C1QB 3F7WA 3KVXA 5DFPA 2P0CA 4BWPA 4ORKA 4QO9A 2NNWB 1VJYA 2HCKA 4XS2A 5TE0A 4A9UA 2E9UA 4FSZA 3UOLA 3V8WA 2R3HA 4JNWA 4LRKA 5EKOA 3ZFMA 4C4JA 1APME 3O96A 3Q52A 3VBYA 2C5VA 1AD5A 1ZYDA 5FTGA 1QCFA 2WU7A 4CKRA 2G2IA 3TUBA 5AFVA 2ZV2A 2WQBA 4KRDA 4DT8A 3Q53A 3TUDA 3UODA 3Q5IA 4RFZA 4RC2A 5I9XA 4U5JA 5C27A 4H36A 3FZPA 5HBEA 3DJ6A 1DM2A 1YDSE 3I0QA 1JNKA 3OWKA 4JDJA 2QOLA 4C57A 4ZLOA 3OD6X 2YDIA 1OKYA 2XKCA 4AW0A 3ENMA 3ANQA 2XCKA 4LI5A 5FDXA 1M7NA 4BKZA 5J1WA 3P9JA 1OKVA 2OFUA 2QVSE 2VTMA 2GFCA 3AC2A 3IOKA 4H1MA 4WO5A 3Q9WA 5HHWA 3RAWA 3VN9A 4BB4A 4ZMFA 2OZAB 5FXRA 1RW8A 3E88A 4IX6A 4BDFA 3BBWA 2Z8CA 4ANNA 3OY1A 2PUIA 2BILB 3EN5A 3D2KA 1G3NA 2Y6OA 3E7OA 2XJ2A 3KN6A 4JG7A 5D12A 3DAJA 1PYEA 1WBVA 1YI6A 2BALA 2F49A 3RNYA 4O7NA 4NCTC 3W2QA 3NW5A 2DS1A 3FKNA 1Z5MA 4XCUA 4CFUA 4KIQA 4RGJA 3LFCA 2JKQA 4YU2A 3BWJA 2IJMA 2QOFA 2XMYA 3PYYA 5BVDA 1Q99A 4OLIA 5LVMA 4FEWA 3QU0A 4ZJIA 4XV1A 3LCTA 4B8LA 4PL5A 4GT5A 3FXZA 3TIZA 3M2WA 4C3FA 4IACA 4RIYA 3I7CA 2QG7A 5CU2A 4C3RA 2IWIA 3KXXA 3LLTA 3VHKA 5IQGA 3DXNA 2ZYBA 3MA3A 2HAKA 2BKKA 3KF4A 3QQKA 1IAJA 2GNFA 5M44A 2W5BA 2YZAA 1ZOEA 4EBWA 2OXXA 3D9VA 3VS0A 3S2PA 3U6IA 2GPHA 5HG7A 4O0YA 4E73A 4Z55A 3S0OA 4DH1A 3OXIA 3C7QA 3QQFA 4AT4A 3OT8A 4CTCA 4DTAA 2X9FA 4TYJA 2RG6A 4HVHA 4O7YA 4EYJA 3RAKA 2ONLA 2OIBA 4CKIA 2W1HA 2EWAA 4AZFA 5KCVA 3R22A 4XG4A 4G6NA 4JOAA 4Z3VA 4XP0A 5JSMA 2X7OA 2ETKA 5B2KA 1PY5A 2XBJA 1YWRA 2XNOA 5TOZA 3JVSA 3FMKA 3E8DA 3SOCA 4IX4A 3DOGA 2C5NA 3BZ3A 4GSBA 4FOCA 2QOKA 2ERKA 2O64A 4IFGA 4N57A 4OTHA 1U5RA 4X3JA 5J9ZA 3ORZA 1GOLA 1UWHA 3CQUA 3NUYA 2Q0BA 4S31A 4WIHA 2ZVAA 3GBZA 1OUKA 4Z16A 3FMHA 4EBVA 5EOBA 4ONAA 3VRZA 4ZTNA 3G0FA 5JH6A 4ANLA 1V1KA 4CZYB 2OF2A 2IW6A 5KHXA 2AC5A 4QYFA 4FGBA 3ZYAA 4FUYA 5M55A 1Q62A 2PHKA 3KMUA 2FSLX 4GW8A 3IKAA 4S2ZA 4LV8A 4U79A 3TKIA 4BF2A 4F9CA 3EFWA 3EN6A 3MVJA 5CTPA 5CU4A 2RFEA 4L43A 4HPUE 3RM6A 5JFWA 4UX9A 5C8MA 3C4EA 5ANGA 4KS7A 2PUNA 3HMNA 3SRVB 2FB8A 4E4LA 3VWAA 1K9AA 1FGIA 2BTRA 4PQNA 4FTCA 5EQPA 4ASXA 2ZAZA 4BCQA 1KOBA 3MJ2A 4OTFA 3JY0A 4MAOA 4CFWA 1OPJA 1CDKA 3F5UA 3WE8A 4C3PA 5BNJA 4CRSA 2CKOA 3WZEA 1H1PA 1WFCA 3DZQA 2CKQA 2JAMA 1ERKA 2BDJA 2J6MA 4C35A 2IVSA 5GIPE 2XIXA 4YP8A 2R3IA 2VNYA 1H28A 2A1AB 4K2RA 4LOQA 5B0XA 2CCIA 4IM0A 5C8KA 4FC0A 1IEPA 3QCQA 4D4YA 2VAGA 2PWLA 4CG8A 1H00A 4ZTHA 2HWOA 3GXLA 4YLLA 2C1AA 2XNMA 4TXCA 2H96A 4RIWB 4IDVA 5JEBA 1H27A 2JC6A 3ET7A 3TV7A 1P14A 4O0XA 4TRLA 2JBOA 3FV8A 4I20A 4IAFA 3MY0A 1WBNA 2ITQA 3PXRA 3G15A 3P23A 3ID6C 3OCSA 4MNEA 2W1IA 3WBLA 3BHHA 5HG5A 5CEMA 4OT6A 4XP3A 1Q8ZA 3OCGA 3PUPA 4CD0A 2VTQA 3HRBA 5BPYA 3TWJA 4W9XA 2R0UA 3PDTA 2OIDA 1U4DA 5HBHA 3FEGA 2YCQA 3KA0A 5GNKA 3VRYA 2WMTA 1NVQA 3DB8A 3FLYA 4FV5A 4GS6A 3NGAA 3VJOA 3E3BX 3C4CA 4TYIA 5KBRA 2R5TA 5TO8A 3W32A 4ZAUA 5E4HA 1OIUA 3R8ZA 4YBKA 2XZSA 4BIDA 3EFKA 2PE1A 3GFWA 3C5IA 4IW0A 4QPAA 3UO4A 4K33A 4FEXA 4R77A 4JG6A 3EYGA 2ZM3A 4JT3A 1KV2A 5CZHA 4BTKA 4FKJA 1YWVA 4QQCA 4RLKA 4FICA 4NUSA 4OBQA 4RA4A 3RPOA 4BKYA 2QI8A 3QRJA 3OOGA 4TKSA 5M06A 2XJ1A 2WTKB 4JIAA 4LFIA 5BYZA 2RKUA 2LAVA 4YGAA 3FZOA 5ANEA 4FL2A 4IJPA 4C33A 3LKMA 3FMDA 3QRKA 4QPMA 4EEVA 4AS0A 2NP8A 3FPQA 4I6QA 4ZJVA 2WMVA 2RG5A 5FLFA 1UNGA 5A4EA 2C5OA 3JVRA 5ANKA 1WBPA 2YA9A 3VS5A 4CZTA 3R30A 4E6AA 3QQUA 3KB7A 4DFYA 3C50A 5AA8A 5TKDA 2BFYA 3PP1A 4LMUA 2C6DA 4GU6A 4FKVA 4Y46A 5FM3A 2YAAA 3UGCA 3OWLA 4O38A 4AUAA 3RK5A 2YCRA 3MY1A 1PJKA 2BAQA 2WIHA 3R1NA 4FSNA 4UEUA 3ZO1A 3TUCA 3NPCA 3OUKA 4F7LA 4OBPA 3PSBA 1PXPA 2XK6A 1F5QA 3K5UA 3UMWA 5CT0A 3MBLA 3H4JA 4CYJA 5HE0A 5A3XA 4ZY4A 2I0YA 4FK6A 4UXLA 2YHVA 4D9TA 4FG7A 3BV3A 2OZAA 4UXQA 4DFLA 5CANA 4C8BA 3RAIA 3CJFA 1H01A 4J97A 5IA2A 5JRSA 3QRUA 2WPAA 2YIRA 1FVRA 1VYWA 3MFRA 5CWZA 3IDPA 4AACA 4AWIA 3RALA 3HX4A 3ZONA 3LCOA 4OAVB 1XJDA 2V62A 3MH1A 4XG7A 3ZZWA 2QLQA 4J8MA 2B9FA 2WMUA 1J1CA 2X8IA 4QYHA 3VUDA 4QP8A 2PVJA 4BTMA 2BZJA 4AOTA 2IZUA 2Z7RA 4FSMA 1QPEA 2W17A 4RX9A 3THBA 4QTAA 4WBOA 4QMMA 2CNUA 2QONA 3RCJA 4F9AA 5EDRA 3MIYA 4NKAA 5EI8A 4D1SA 4XLVA 3JS2A 1JSUA 1XH7A 5CT7A 2YIXA 5J7BA 4QQTA 2QOCA 4CV8A 1Q3DA 4O7WA 3CTJA 3VUGA 3HNGA 2Y9QA 3ZDUA 4DGMA 3A7JA 3BHVA 4RVTA 4FV7A 1TVOA 5JRQA 4H3QA 3MESA 1SMHA 2YM8A 5AR3A 2G2HA 1KE5A 4EK6A 4X7QA 3ZC6A 3IS5A 2XNPA 4GYIA 5IUIA 5J5TA 5E8WA 2JKOA 3VBXA 1PMUA 3AT4A 2QLUA 4IVDA 1OM1A 3BV2A 4O21A 3LQ3A 3UQGA 4AT5A 1MP8A 1PXMA 1WAKA 4XG2A 5HLPA 3DFAA 2XYUA 2ACXA 3P5KA 1KE7A 3HRFA 3QAME 2XKEA 3HLLA 2QHMA 4D1XA 1LPUA 3FI8A 3QQJA 4FSRA 3NUXA 4II5A 1PXLA 3UZPA 3PXKA 2R3JA 4FKSA 3EHAA 4KBAA 4WNKA 2IG7A 3E8EA 2W1DA 4DF3A 1DS5A 3FQHA 5H8BA 4A9SA 5IISA 3MYGA 4FEUA 1M17A 1A9UA 3ZDIA 4I5MA 3QQHA 4QYEA 4DGGA 4JRNA 2OXDA 2GQSA 3R9RA 3F6XA 3FJQE 3KRLA 3P0MA 3VHEA 2P3GX 4BL1A 4FYNA 4FT9A 5FTOA 4USEA 4BYJA 5BVNA 2ZB1A 3EN4A 2WQMA 3KXHA 4FTLA 3LQ8A 2R3PA 1WBOA 5JGDA 3VBVA 3QHRA 2J0MB 4LRJA 1URCA 1CM8A 4U45A 2XUUA 5I3OA 4LUDA 4F1OA 4L45A 3BWFA 1DI8A 2E9VA 5HU9A 5KKRB 2HYYA 3OG7A 4CFMA 4QNAA 2BAKA 3BU3A 4RQKA 5HE1A 5A6NA 3G51A 3NDMA 4FIFA 4ZSEA 5BQ0A 5EHYA 4CZUA 5DR9A 4FSYA 1LUFA 5A4LA 1JKKA 5M4FA 1Q8YA 4IAZA 5ETCA 2YFXA 1H1SA 4FKRA 3PY1A 4K8AA 5AUTA 3ZM9A 4IANA 1W0XC 2QOQA 4E26A 1QPJA 4FG9A 4C02A 4EI4A 3SXRA 4ZMEA 5DEYA 2F9GA 3NIEA 3PPKA 4C61A 3CGOA 3GOPA 4BCMA 5IEVA 4GL9A 5AP3A 5AEPA 1G5SA 3QTIA 3D4QA 4KIKB 4C34A 5CEQA 4EH2A 2W5AA 3O23A 4F1MA 4YTCA 3C13A 2ITOA 3Q2MA 2I0EA 4IQ6A 2J5EA 2OG8A 4RIWA 3OMVA 3CKWA 4WA9A 5T68A 4WRSA 1YI4A 2YCFA 3QUPA 3RMFA 4FTUA 3VS7A 3TNQB 2AYPA 5EFQA 2YM4A 3HA6A 2QURA 2H34A 3HP5A 4HNFA 5E8SA 3BU6A 4E20A 1JKLA 4EH5A 4FNZA 4B4LA 4DH8A 5BVOA 2YN8A 2YITA 4IWDA 4IM2A 1OIQA 3KU2A 4RVMA 5IZFA 2XM9A 3GU6A 1QL6A 4FYOA 4KA3A 4QP3A 3NAYA 5C26A 3UQFA 4DYMA 3R2YA 4QMQA 4AU8A 2PVRA 2PK9A 4BIBA 4H3PA 5CAPA 3NNXA 3U4UA 2QOOA 3BPRA 4I3ZA 3RPVA 1OL2A 3H0ZA 4R5YA 3C0HA 3NMUF 4AN3A 2JEDA 2X4FA 3ODZX 4LGHA 4BHZA 4BRXA 1UU9A 2WMAA 2HY81 4X2GA 4FTKA 4FV4A 1YDTE 5IEYA 3PRIA 4RA5A 3P79A 4D5KA 1XBCA 2R3LA 2W05A 3TZ8A 1MQBA 1SZMA 3KXNA 3ZS5A 1IA8A 2EB3A 4JI9A 4ZIMA 4F9BA 3SXFA 3G2FA 3KXGA 4WSYA 5J7HA 4FKGA 2QU6A 5EI2A 3KL8A 4JQEA 4XRLA 3WZDA 5K4JA 1GAGA 4JAJA 2PZIA 4XBUA 3QWJA 4MVFA 2W99B 3EMGA 4D28A 5LWMA 4EC8A 5JN2A 3R8PA 2HW6A 3CXWA 3W2RA 3R8UA 4YPSA 3LJ1A 4Y85A 3PVBA 4OR5A 5L6WL 3WF8A 2R3KA 5AX3A 2C6OA 2VTRA 3UO5A 4DBXA 2F4JA 3L1SA 3FDNA 4BGHA 3EIDA 5I9WA 5HTBA 5AP4A 2Y6MA 1E9HA 3BLHA 4JLCA 3R8VA 2WTWA 1S9JA 5HICA 1ZRZA 2GHGA 1W8CA 1NA7A 2PPQA 3QWKA 4YMJA 3ROCA 4XG9A 5IQHA 4EH9A 3NNUA 3BYMA 3WIKA 3AD6A 4N6YA 5F9EA 4PX6A 4FI1A 5E91A 1M2QA 4GK2A 3NYOA 5FP6A 3AC8A 3IOPA 4RPVA 3OROA 4DFNA 5IH6A 1P4OA 2HOGA 2J7TA 2PMOX 4MHAA 3DKOA 3OW3A 4U80A 3H10A 5HGIA 3L8PA 1MRYA 3LCSA 4F63A 3U4WA 3SLSA 4KABA 5EK7A 4RIYB 4FE2A 3NYXA 3CY3A 2XK3A 5ANDA 5B2MA 3EOCA 2ZOQA 1LP4A 4M66A 5KMKA 1PRYA 1UV5A 4QP9A 3K3JA 3EN7A 3S95A 4G3DA 3L9MA 4A9TA 3O0GA 3NNWA 2GCDA 4IZYA 4QMSA 2CPKE 4H58A 1FINA 5KMOA 3ZH8A 1YDRE 4ANQA 2A19B 3I6UA 1BYGA 2OFVA 2IZSA 2BRHA 4KSPA 4CMUA 2J0JA 4U9AA 5FRIA 3EYHA 1T46A 5AR4A 4NFMA 5IH4A 3IQ7A 2UW6A 2VTNA 3RNIA 3WZJA 3I5NA 2I1MA 1LR4A 3ZO2A 4ACGA 3RVGA 1YQJA 2NO3A 4PWNA 3A4OX 5E8ZA 4HZRA 2IW8A 3NSZA 2B9IA 4BGGA 3FC1X 4BN1A 3N51A 4IVBA 2CGWA 2JGZA 4R3PA 4QOXA 1IASA 3UOHA 4BCNA 4X0MA 2Q83A 5E1EA 2C1BA 5HNIX 4YJQA 4R8QA 4IAKA 5DR6A 5M57A 3UZTA 3EN9A 1H26A 4YHJA 2OW3A 1OL6A 4Q5EA 5HORA 2X6EA 1JLUE 3DQWA 5I9YA 1FPUA 2R3MA 4Y83A 2C6IA 3A61A 3P7AA 4FT5A 3UBDA 1BL7A 2FSMX 4C2WA 1ZYLA 2E9PA 2QO2A 2B52A 3C5UA 4D2VA 4EOLA 3OWPA 3ZFXA 4AGDA 2OJGA 2WTDA 3QD0A 4GK3A 1M7QA 4L3PA 1U46A 4KB8A 3GCSA 2C6MA 5HE3A 4IVAA 4AF3A 1UNHA 5FEDA 3E64A 3GQIA 4S30A 5CSXA 4EJ7A 4PL3A 3BQRA 4JR3A 5KMNA 3U6HA 5KMLA 3QX2A 2VN9A 3DBDA 3ORNA 2IO6A 4GCJA 1CKJA 5D7AA 3RZBA 4C4FA 3CEKA 1GZOA 3ZRMA 3HV5A 3MH3A 4ALVA 2CGVA 2GHMA 2PMNX 5KZ0A 5EW9A 5E90A 3RM7A 2RGPA 1Y57A 4FV3A 4N0SA 4FV9A 4GFGA 4GMYA 4QYYA 4TT7A 3CY2A 3OT3A 4J53A 4EOJA 3PXQA 5EYMA 2QU5A 4AN9A 3VC4A 2XK4A 4LGDA 3UIXA 3DK6A 2C5XA 2PULA 4ANSA 2P4IA 3QGWA 2LGCA 3H9OA 3IDCA 4KBCA 5AV0A 2XP2A 2F2UA 2HENA 3PVGA 3QUEA 4PDPA 4WNPA 3KN5A 1Y6BA 5CEPA 5FDPA 4KNBA 2BROA 3TJCA 2BMCA 4U6RA 3RCDA 1SVGA 5CXZA 1XQZA 2VTSA 3VQUA 2YACA 5JFSA 3DY7A 3ATSA 4O0VA 4HVIA 1UWJA 2BDFA 3PSCA 2HXLA 5D10A 4MNEB 1NXKA 3OBGA 4G31A 3C0GA 5DPVA 5CI7A 4GJ3A 3TG1A 4EQMA 4L7FA 3ZC5A 2JIIA 3HMMA 1LEZA 3IW7A 4MEDA 2R64A 2PMIA 4EOPA 1FQ1B 3OP5A 4MXZA 4O1PA 3LIJA 4I4EA 3PG1A 5CVFA 2UVZA 4IIRA 4D2RA 3PJ8A 4Y73A 3R21A 5GJDA 2JDVA 5AR8A 4B8MA 4DG0E 4L42A 5GZAA 2CGXA 2CNQA 4FTJA 4NWMA 5ACBC 5IMXA 4N6ZA 1YHVA 4QTDA 5LMKA 4ENYA 4UY9A 5BMSA 3IGGA 4CRLA 1OECA 5AP0A 2WGJA 4RFYA 3P1AA 3FMJA 4OT5A 3VNTA 1KWPA 3Q96A 4JDKA 4F6UA 3E5AA 2OI4X 3QD4A 5AMNA 3KMWA 1I44A 3TKHA 2JDOA 4NM0A 4D1ZA 4F0GA 3DLZA 2IVUA 3SKCA 4EOMA 5BVEA 4X3FB 2WTJA 4FKWA 5CAUA 4I21A 2Y4IB 3QHWA 4AGWA 4E6DA 4M8TA 1UKHA 5IUGA 4EH3A 2B9HA 2Z7SA 4HCTA 4IEBA 4RWJA 4ZZOA 5HE2A 3UE4A 4J98A 4XRJA 5M08A 2YM5A 3LFSA 1JAMA 3A62A 3KEXA 4QMYA 1H1WA 4FR4A 3H3CA 2B9JA 2O3PA 2V5QA 5EW8A 3GC9A 1NVRA 1OBDA 4O7RA 4PMMA 3DLSA 3HV4A 3Q2JA 5EHLA 3EZRA 4QQ5A 3ORPA 2W1GA 5H8EA 3SW7A 2VGOA 4IADA 3QZIA 5DR2A 3SQQA 2GDOA 3ZLSA 3E93A 4YC8A 2HXQA 3IW5A 2IN6A 1ZYJA 4ASZA 4FGRA 2Q0NA 2QC6A 3UOKA 3ZBFA 3HAVA 2C0TA 5EYDA 2QHNA 3ORMA 2Y0AA 4L6QA 4MX9A 1VYZA 4WG5A 2UW0A 4GV1A 1Q97A 2BZHB 3Q4UA 4RX8A 5IG1A 3TEIA 3U8WA 4EK4A 5C4LA 1SNXA 3ULIA 2RFNA 3ZTXA 2DYLA 3QX4A 2G01A 3HAMA 3BYSA 4G6LA 2X2LA 1J91A 3F82A 4EQUA 2JFMA 4IDTA 1FMKA 1STCE 2Z2WA 4L68A 3TKUA 4GFMA 3LE6A 1W82A 3RK9A 5I9ZA 3NVMB 4EK5A 5ETAA 3KULA 4A4LA 4TY1A 5AP7A 4EH8A 4FSQA 5D9HA 4EZ5A 5FM2A 1KV1A 1YOMA 4ZZMA 4FT3A 3RWQA 4K77A 4MBIA 3OOMA 3QZGA 4L00A 2WMWA 2H9VA 2OJJA 3VIDA 5IUHA 5KHWA 4ZSLA 4MD9E 5HD4A 5HU3A 3G9LX 2XIYA 1W84A 1WVXA 3TN8A 1YOJA 3HL7A 4ZK5A 4D2TA 3EQHA 4RWKA 2C5YA 3OBJA 1REJA 2QR7A 5E1SA 4TL0A 5CSWA 5K9IA 5HVYA 2BHHA 5KMMA 3PLAE 3R7EA 4CCBA 3UZRA 3E3PA 3F5XA 3OS3A 3PE1A 2C0IA 2R7BA 4AZSA 4RC3A 5IH5A 3UP7A 4JG8A 4FSWA 5DI1A 3R7OA 2Y4PA 3NX8A 1CKIA 4MXAA 4U40A 3FMLA 4XHKB 1H0WA 3MGYA 4G34A 4PPBA 3TCPA 1PYXA 2C69A 3IONA 4YZ9A 3NLBA 4NIFA 4FTNA 4TW9A 3D7ZA 4WT6A 3ZEPA 3DKGA 4QTCA 2XCHA 2CDZA 4GIHA 2RFSA 5DOSA 2BIYA 1M14A 4FL1A 3RKBA 4NCTA 4F1TA 4G16A 4FZFB 4FX3A 1CTPE 4R3CA 1KE6A 3MFTA 4AW2A 5C8NA 2ITZA 3DKCA 4QMWA 3C9WA 4FNYA 4ANOA 4CQGA 2F2CB 4DTKA 3R1QA 2A4LA 5FD2A 2OH4A 2GFSA 3DGKA 3BGZA 2YIQA 3BI6A 2C6KA 5LWNA 3MW1A 5K0XA 2WQEA 4U8ZA 4FEVA 2XB7A 2YM6A 4KBKA 2IW9A 3ZSGA 3FLQA 2QNJA 3VS6A 4EH7A 4X2JA 1PXKA 3RWPA 2C47A 4XLIA 2XK8A 3QBNA 5CNNA 5CU0A 3ZXTA 3D14A 4UMPA 5D41A 1W7HA 5HCYA 5KE0A 5EM5A 4D0WA 4RX5A 5IA1A 2HZ4A 3KC3A 4DGNA 4KS8A 3QLGA 5HOAA 1PXOA 3CKXA 2GU8A 2UW4A 3KKVA 4GVJA 5CSHA 3PWYA 4X21A 4NEUA 3NUNA 3FI4A 3HUBA 2R4BA 2PZRA 2XF0A 3R02A 4FSTA 4NTTA 3SDJA 4FKUA 4TWCA 4PMPA 4DH7A 3WF5A 4UWYA 3Q4TA 4XP2A 5I3RA 3VW6A 1G8SA 2GMXA 1IAHA 3SOAA 4IWPA 5ANIA 4S34A 3QC9A 2Z7QA 2BDWA 4YC6A 2PL0A 2UW8A 4B0GA 2W96B 4UV0A 2J50A 1NVSA 4DG3E 3OTVA 2X0GA 3PP0A 3V3VA 3Q04A 3ZOSA 4NJDA 4MXOA 4U81A 1JVPP 4I93A 4XV9A 4YJUA 4YO6A 3CR0A 4P7EA 2EXEA 4PTCA 3O17A 5AAEA 3AGMA 4AZWA 4C36A 1YXXA 2CLXA 4YR8A 4C62A 4A07A 4BY9E 5IQDA 3G9NA 2B54A 4C0TA 4JDHA 4BKJA 2XKDA 3PJ3A 4BWKA 1JWHA 5CEIA 3O8UA 2QG5A 5AP2A 3HP2A 4O7LA 3WF9A 4DTBA 2GNJA 3NVKI 3PA3A 4FSUA 1Q61A 4GT3A 2A2AA 4ZSGA 5CYIA 3FL4A 4AOJA 3CD3A 2OICA 1U54A 1F0QA 1XH4A 3RJCA 2VTIA 2VTTA 2VO3A 5HESA 2YEXA 2VTLA 2VX3A 4JAIA 4AP7A 1SM2A 4S33A 2ITTA 2CMWA 3Q3BA 1R1WA 2BAJA 2XNGA 4NSTA 5HCXA 5C01A 4ZSJA 3POZA 3GNIB 5M51A 2I0HA 2P2HA 4MXXA 1XBAA 2QOBA 1ZMUA 2VX1A 4FIHA 2EXCX 4HGEA 2HZ0A 3CP9A 3M11A 1TQIA 2OGVA 3O8PA 4L01A 5FEQA 3TIYA 5J95A 3SA0A 2X39A 4UZHA 4WD5A 5HZNA 4NW6A 3LXNA 4DAWA 5EHOA 3EB0A 1OKWA 5J9YA 2PYWA 3MVMA 4J1RA 4BCKA 4G3CA 2VZ6A 4EHZA 2VX0A 3GC0A 1SVEA 3U9NA 4UMRA 4GFOA 4JBPA 2VWZA 4X3FA 1GIHA 3UDBA 2PVKA 5CS6A 5CENA 5FGKA 5BYYA 3HDNA 4JDIA 3A8WA 4U44A 1ZOGA 3A7HA 3F3TA 3COKA 2WOUA 2UZUE 4FTOA 1F3MC 4XG6A 3UYSA 2XK9A 3EL7A 4IHPA 2GTMA 2UW5A 4RJ4A 5DNRA 5E8UA 3RPSA 5EM6A 5L3AA 3ULZA 2XEZA 3RPYA 1WVWA 4ZZNA 1HCKA 1OITA 3E8NA 1W83A 2X8DA 2KULA 3ALOA 2PZYA 2YCSA 4MK0A 2ITVA 3ZO3A 4DT9A 5K0KA 5L6OA 5CVHA 4JXFA 4BZOA 5BUJA 3DZOA 5BYLA 4X2KA 3BE9A 3FYJX 1WBWA 3MWUA 3U87A 3CTHA 4HYIA 4PL4A 2VTJA 4O2PA 2YZLA 2JKKA 3EH9A 3RTPA 3NIZA 1X8BA 3DQXA 4FKIA 3BGPA 4DEIA 2J90A 4C59A 1YRPA 3NUSA 2BCJA 4WG4A 5AM7A 5AUWA 5HO7A 3EQFA 4W4WA 3SXSA 3UJGA 3KK9A 4I6FA 1RJBA 3FHIA 2BZKB 4W4XA 2ZM4A 5KO1A 5GIOE 5HO6A 5I9UA 1DI9A 1O6LA 1YHSA 1OI9A 5KX8A 4Q9SA 2BZIB 3TNIA 4NFNA 4MBJA 4I22A 4GVAA 3AT2A 4QMOA 3HMOA 4ZTLA 2IZRA 5DRDA 1ZARA 4IB0A 5CZIA 4C4GA 3EQBA 4OGRA 5H8GA 1BL6A 5JZJA 3R01A 3PA5A 4ITIA 4LGGA 3ZUUA 5AV4A 2ZJWA 3FWQA 3QRTA 3D2IA 4MXCA 5AWMA 3GQLA 5ETIA 4CCUA 5HLWA 4PTEA 3W18A 3HEGA 3TXOA 3MJ1A 4FNXA 3TTJA 2NPQA 1PF8A 2ITYA 2YERA 1H4LA 4LOPA 1Q8TA 5M4CA 5J9LA 2WO6A 4G5JA 5IA4A 3G90X 3O7LB 2XRWA 4BYIA 5J8IA 4YUQA 5BUIA 3C4XA 2Z7LA 3F3VA 4AG8A 3CS9A 4YO4A 4FK3A 3BRBA 4E4MA 2J9MA 3LPBA 2C4GA 1H1RA 3TI1A 4UWBA 1Z9XA 2WTCA 3VS4A 3PTGA 4B99A 3MA6A 3OCTA 4HCUA 3GEQA 4HVSA 2Y8OA 5CF6A 4IM3A 4CLJA 2YM7A 3R6XA 4NU1A 2YDJA 3R1SA 4CG9A 3GU4A 5E8VA 3FI3A 3ZMMA 4AT3A 4FF8A 1GZ8A 4D58A 5EQYA 2V7AA 4MBLA 1HOWA 3NUAA 4XOYA 5AIRA 4TN6A 3W55A 4E5WA 1UVRA 1QPDA 3A60A 4RX7A 1ND4A 1YVJA 4AN2A 4P90A 5DT3A 2G9XA 2HELA 3FUPA 5E7RA 5FBOA 4D5HA 3BLRA 5LVLA 2EUFB 4MWHA 5GJGA 4PUZA 4O7SA 3DDQA 4JJRA 4DEHA 4YLJA 3LZBA 4RJ6A 4JX7A 4FBXA 3FL5A 3LXKA 4EJNA 4FZ7A 3CGFA 4XBRA 4AAAA 1KE9A 3RP9A 3NYNA 4M0YA 4AW5A 1HCLA 3QC4A 3PSDA 5DT4A 4GG7A 4BI2A 3GU8A 2BFXA 1XO2B 2UUEA 3IK3A 3B8QA 4YZCA 4ZLZA 3L9NA 2X7FA 2CLQA 3UNZA 4F0IA 5TT7A 2XBAA 4AZEA 2DUVA 2G2FA 3GU5A 3PRFA 3LFBA 4N70A 5G6VA 3LJ0A 3KXMA 2RL5A 3OW4A 5CASA 2VD5A 4KSQA 4O0WA 2YIWA 4EHEA 1PMVA 5CLPA 3QA0A 4V05A 3C1XA 4WUAA 4AA5A 1OMWA 3D94A 3L8VA 3MV5A 3R63A 3NNVA 5LQFA 5LMBA 1T45A 4FV0A 3PJCA 4XX9A 4O7TA 4HYSA 4C4IA 2UW7A 3AQVA 2W0JA 1MRUA 4U97A 3R8MA 3JUHA 4GUBA 2GS2A 2BRMA 4R3RA 4WSQA 4W4VA 2B1PA 3W16A 1B39A 2V55A 5BVKA 4IZ7A 4NM3A 5CVGA 2E2BA 2JDSA 2PUUA 3ZSIA 1Q5KA 1CKPA 2I0VA 5HI2A 2Z02A 3SD0A 3UQCA 4IJ9A 4QNYA 3DPKA 3TTIA 3FSFA 3W2CA 2ZMDA 1GIIA 4QP7A 3Q6WA 5FUTA 3HV3A 4QD6A 4ASEA 5CAVA 4Q2AA 3AOXA 5CALA 2UZEA 4DGLC 3I7BA 4FVPA 4KKGA 3DFCB 5K5XA 4H05A 2PU8A 2O5KA 3F61A 4FVQA 3A2CA 5AP1A 1WCCA 4BFMA 3EQCA 2C6TA 3FLWA 4NT4A 2OKRA 3C4ZA 3ZLXA 4I0RA 3VUIA 5DIAA 4OTDA 5EOLA 4RJ8A 4RVKA 4BDAA 4OBOA 5EH0A 1IRKA 1QPCA 3WIGA 5D1JA 2XVDA 4BI1A 3AG9A 1H1QA 4FKTA 3ITZA 4JQ7A 3IW8A 3ZEWA 5CQUA 4H3BA 2O0UA 5DN3A 3WI6A 4DEDA 5IDPA 4FTAA 4EWQA 2WKMA 4I92A 5ICPA 4F6WA 3R28A 2XYNA 4J8NA 3GOKA 5GJFA 3UG1A 1PHKA 2ZV7A 1IA9A 2J2IB 4ZTRA 4FTIA 2C6EA 3FQSA 2F7XE 4J99A 2CN8A 4BBMA 2W7XA 3ETAA 4F64A 4QPSA 4E6CA 3BIZA 4F08A 4ZY5A 5HLNA 2B7AA 3A7FA 3FQEA 3PA4A 4TYHA 3GVUA 3PZEA 1BKXA 5HNBA 3DCVA 4L67A 4MQ2A 3PXYA 3V6RA 5HD7A 4CGAA 5DWRA 4ID7A 3R00A 5KZIA 4RJ5A 3TNPC 1ATPE 3DBCA 4FZDB 3VF9A 2ITXA 2YWPA 4BC6A 4S32A 3B2WA 1BMKA 5TR6A 2W9FB 2AUHA 2ZMCA 3HZTA 1SNUA 3R71A 3RGFA 3QKMA 4DG2E 4O81A 2J51A 4IWOA 1WZYA 2WZJA 3CPCA 4FV8A 4GT4A 3I81A 1W98A 3GU7A 5HEZA 3NS9A 3VJNA 4O84A 4KKHA 5IF1A 3EQIA 5J87A 4FA2A 4HVDA 4XOZA 2X81A 5BMMA 3R7VA 4EZ3A 1Q24A 5LARA 4IWQA 2ETMA 3ALNA 3GUBA 2AC3A 2B0QA 1FMOE 2VWWA 2WMSA 3KULB 4L46A 4MH7A 5AV2A 4HVGA 4IB1A 5HIEA 2FH9A 3ORLA 3EL8A 3E7VA 1TKIA 2QR8A 3QCXA 3R04A 2QOIA 3BKBA 4AX8A 5JK3A 3V51A 5FXSA 2R0IA 4M69A 4UMQA 3R83A 2VWUA 1OL5A 4WHZA 4BHNA 4KKEA 3F66A 1V0PA 3VUTA 3QKLA 3GB2A 2GNGA 4UBAA 4YHTA 3FKOA 3G6HA 5M56A 3BU5A 4FIIA 4E4XA 5FBNC 3UPZA 3F5GA 4USFA 2RF9A 4PPAA 5JMSA 4C38A 3KRXA 3FKLA 4CSVA 3REPA 2XM8A 5H3QA 4RIXB 4WBBB 2R9SA 3DAEA 4QQJA 3AGLA 3UYTA 4ENXA 5IPJA 3BELA 4Y95A 5HX8A 3AD5A 3FI2A 4ITJA 2ERZE 4FV2A 4MTAA 4A4OA 3E92A 3PWDA 3W8LA 3P86A 2EVAA 4L3JA 5J79A 4UB7A 1PKGA 4ARKA 4D4SA 3POOA 3ZLYA 3ZUVA 2BIKB 3QTXA 5AR2A 2OSCA 3WF7A 5CSPA 4O7VA 4NIFB 3BEGA 4HW7A 4U0IA 2BPMA 2WMXA 3EQGA 4J96A 1KSWA 4EH6A 2VU3A 3CTQA 3QXOA 4E3CA 5A54A 4PDOA 2UV2A 3MS9A 1OL1A 2ETRA 2XH5A 3O7LD 4NH1A 2WQNA 3EFJA 3PJ1A 3BCEA 1XHAA 4GEOA 5CI6A 3VVHA 4DA5A 4P5ZA 1EH4A 3IW6A 4IAIA 2E9NA 3UMXA 5LOHA 3EQPA 3FZSA 3NR9A 4FOBA 4D55A 4EONA 5AUYA 1P4FA 3KK8A 3GCVA 2YM3A 4K1BA 4KIPA 2GS6A 1YXTA 4AGUA 5AX9A 4BCOA 1NT2A 1XR1A 4BDCA 2JBPA 3I6WA 1PW2A 1U59A 2JDRA 3QTWA 4ZP5A 4BDEA 4QTEA 3AMBA 1JSVA 1OPLA 1JBPE 1Q8WA 4QMTA 3I60A 4CEGA 4NTSA 5AR5A 3G6GA 4N4SA 4DFXE 5T3QA 4UN0C 5KKRC 4ACDA 1PKDA 2GNLA 4FODA 4AOIA 4CNHA 3SG8A 1ZOHA 4EOIA 2BTSA 3QYWA 5A4TA 3UVRA 4CVAA 4PTGA 4MNFA 3OC1A 2XNBA 3TZ9A 1I09A 4NK9A 4RWLA 5IA0A 2UZWE 2VO0A 4M68A 3S00A 3HA8A 1OL7A 3LXLA 3SVVA 1PXJA 2HW7A 5FXQA 5H2UA 3FMEA 2QO9A 2YAKA 3N9XA 3MH2A 4DINA 3F2AA 5L2WA 2UVXA 3ANRA 3UG2A 3QLFA 3ELJA 4RRVA 3FE3A 5HCZA 1ZWSA 3PE2A 1Y8YA 1ZZ2A 3PXZA 2OH0E 4E93A 3OXZA 2UW3A 4M3QA 4R5SA 4TNDA 4G1WA 4IC7A 2FVDA 4YURA 3CCNA 4ASDA 3QALE 5HKMA 4EK3A 4F7JA 4IE9A 3JPVA 3K54A 4HYHA 5DT0A 4GKIA 5FTQA 4UYAA 1UKIA 3U51A 3FLZA 5GZ9A 5GHVA 3TZMA 1OKZA 2OZOA 3KRWA 4A7CA 2Y7JA 1GZKA 1U54B 3F5PA 3LM0A 3TACA 3O8TA 2PZPA 2PE0A 2BVAA 2HWPA 3W2SA 4X2FA 1PMEA 3LCKA 4ANBA 4BDDA 3C4FA 4EC9A 3BLQA 1KOAA 5LVPA 4ACCA 4EYMA 3MH0A 2YLFA 2A27A 3I79A 2GQGA 5M4IA 5L2IA 3T9TA 4R78A 4FTMA 3WYYA 3ZRLA 3U54A 4KINA 2OJ9A 4FT7A 5EKNA 2FA2A 2G1TA 5HTCA 4DEBA 4M84A 5DA3A 1Q3WA 3K5VA 4W4YA 5KUPA 4DFBA 3CSVA 3TJDA 4EOKA 2C3KA 4B7TA 2OWBA 4EZ7A 4M97A 4JL9A 3HV6A 4QTBA 4CV9A 4OTQA 5A4CA 4EOQA 3L9LA 2PE2A 4NM7A 4DLIA 1G8AA 2F57A 3CBLA 3S3IA 2X2MA 5DMZA 3HMIA 4NW5A 4YJRA 3QCSA 4MXYA 2FUMA 3PVWA 3Q9YA 5F94A 4E1ZA 3BYVA 3OWJA 4R1VA 3V5PA 3CLYA 4GRBA 4YSMA 5B7VA 5LJJA 1MUOA 1FVTA 2F7EE 5T6KA 4DC2A 2WEIA 3R8LA 5I9VA 5L8KA 1GNGA 1OGUA 1YXSA 4PP9A 5CEKA 5I0BA 4XYFA 5F1ZA 3HYHA 4ACHA 3I0OA 3UNJA 2IVTA 3MB6A 2WTIA 5H9BA 5E92A 5DLSA 1YHWA 5A6OA 4M7IA 5C4KA 3MPMA 5CQWA 4JVGA 2QO7A 4GYGA 4CXAA 1FBNA 2XEYA 5HVKA 5IA3A 3ORTA 2VTOA 4FZAB 3V8SA 1WVYA 1ZLTA 1A48A 3CPBA 4F7SA 2PVHA 5EW3A 2C3LA 4CKJA 3IW4A 4ALUA 5LCJA 4K18A 3TNHA 4FZ6A 3PFQA 3CIKA 3QYZA 4HZSA 5HG9A 4C7TA 4U7ZA 5A9UA 1BUHA 2W1FA 5IEXA 4FV1A 1S9IA 2WMRA 4RT7A 3ENHA 3KY2A 5AUUA 3TL8A 5BUEA 4AGCA 3PZHA 2Z60A 3FMMA 4DH3A 3LQ5A 3MFUA 4D2SA 2WIPA 2CCHA 4QT1A 4D4RA 3HUCA 4UWCA 4YTHA 4X2NA 4FEQA 4E4NA 1R78A 3D5WA 5CF8A 4BTJA 2C3IB 2J0LA 2W4OA 4EWHA 4R7BA 2PVMA 5K4IA 4MCVA 4YSJA 5AP6A 4IZAA 1WMKA 2KTYA 1NY3A 4BDBA 2PTKA 4CMOA 1JOWB 2OBJA 2CKPA 1SYKA 3W33A 1PMNA 2O65A 4LUEA 2BUJA 3GENA 3VS1A 5KMJA 2OU7A 3M1SA 3FZRA 2GNHA 2ONLC 3KVWA 3DBEA 1A06A 2G15A 4RZVA 4CMTA 4RIXA 1GIJA 2YJRA 2WEVA 5TF9A 4O91A 3T3VA 4WOVA 4DE4A 2J0IA 3W2PA 1Q4LA 3P08A 4JBOA 3V5LA 4HNIA 2BRGA 3JY9A 2JFLA 2ITWA 5IQEA 3SW4A 2WXVA 3SV0A 4HYUA 4I1ZA 4X6RA 2W4JA 4YTIA 3DTCA 5DG5A 3OZ6A 4G3GA 2UZBA 2J4ZA 4I94A 4IH8A 3TV4A 4GUEA 4ZTQA 3QA8A 3VUHA 3PIXA 4DFZE 1YI3A 5L2TA 4RWIA 1L8TA 2XK7A 3HVCA 3I4BA 4ERKA 4F70A 3KCFA 1Z57A 5A4QA 2HIWA 2XNEA 1M52A 2WD1A 1PXIA 4LL0A 5FG8A 4CT2A 1KUTA 3QRIA 4A06A 2UZLA 4DCEA 4UMTA 4AZTA 3FXXA 4ZTMA 3VF8A 1K3AA 4H1JA 2XJ0A 5AP5A 3LAUA 4YHFA 3GCUA 3WYXA 4APPA 3V5TA 4BGQA 3GC7A 3FAAA 4EHGA 1O6YA 3HECA 3LFAA 2FO0A 4F6SA 3ORXA 3OF0A 3G5DA 1KE8A 5FP5A 2OLCA 2UW9A 4W8EA 5AUZA 3AC5A 2X1NA 4CTBA 3TDWA 3HDMA 3R9OA 1TQMA 4XUFA 3FC2A 4FG8A 2A0CX 3MDYA 2HZNA 4YZMA 3P78A 5EM7A 4ZTSA 5AV3A 5KNJA 3R1YA 2CNVA 3QTQA 5HX6A 2C68A 2XS0A 4EUUA 3WZUA 2DQ7X 3WOWA 3CJGA 4C37A 4M14A 4QP4A 5CSVA 5HIDA 3MPTA 3NWWA 4IX3A 4WG3A 3L8SA 4RIOA 1WBSA 5E8XA 3DXPA 3JR1A 4USDA 4Q5HA 4YZDA 1YWNA 4TZRA 2VWYA 1XWSA 4XEYA 3VBQA 3DTWA 3FBVA 2XIRA 2OF4A 5HNGA 4I4FA 4I5PA 4EKKA 3H9RA 3TNWA 3KF7A 1URWA 4K9YA 3ZHPC 3MVLA 5HO8A 1YOLA 3DJ5A 4JS8A 4C4EA 2V0DA 2X6DA 4JRVA 1P5EA 3MFSA 4YPDA 2P33A 3DBFA 1U5QA 2OJFE 3KMMA 4E5AX 4RQVA 4YZBA 3T9IA 4G3FA 1CSNA 3PPZA 4L9IA 3BE2A 1MRVA 3BYOA 4C4HA 5DEWA 1ZY5A 4AFEA 1E1XA 3Q9ZA 4M12A 3BBTB 4ITHA 2CGUA 4MD7E 3DNDA 4K11A 5ITAA 3B8RA 3Q32A 2PY3A 3RHXA 2UZNA 2VWVA 4G9CA 3GT8A 1RQQA 1JSTA 4Y72A 2QD9A 4G9RA 4NL0A 3G0EA 5L6PA 3CC6A 4IB5A 3R9HA 3LFFA 4MF1A 2R3NA 3VBTA 5L4QA 3DJ7A 3RZFA 4ANMA 1CMKE 3DDPA 3A4PA 3P7CA 1PXNA 3PVUA 5AAGA 3UO6A 5M4UA 3VO3A 2PVNA 4PRJA 3UTOA 1H08A 2X7GA 3AC4A 2WHBA 3LM5A 4ZSAA 5IQIA 4P5QA 1M2PA 3MN3A 3OFMA 5LVOA 3ROYA 3FSKA 4DFUA 3F3WA 3EKKA 3SAYA 4L8MA 4O82A 2PVYA 4X3FC 3RBWA 3BQCA 2ZV8A 2Y4IC 3VUKA 3FLNC 3ZLWA 5JKGA 3DBQA 5BVFA 3MPAA 3IG7A 4OW8A 2BRNA 1E1VA 1H07A 2VTAA 2VWIA 3CD8A 4KRCA 3E87A 4B6LA 4FTRA 2CN5A 4LYNA 1DAYA 4QMXA 4FKOA 1O9UA 3QF9A 3Q4CA 4TYHB 3ZCLA 2FSTX 4GH2A 5DRBA 3F88A 1OUYA 3BX5A 5I5ZA 3EKNA 5E9EA 5IQCA 4QMVA 1AQ1A 2HY0A 3QQGA 4QMNA 4QMPA 3AC1A 4NZWB 3D83A 4M15A 3DA6A 2X2KA 2VNWA 1P2AA 1JKSA 3QD3A 4AE6A 4OUCA 2W9ZB 3V5WA 3TDVA 4DEAA 2VWXA 2B53A 5JQ5A 1K2PA 4DLJA 3FY2A 1H25A 2IVVA 3DU8A 1GZNA 3OUNB 3KRJA 4FUXA 1LEWA 4E8AA 5JGAA 4YJVA 3DS6A 3MI9A 4L7SA 2C30A 3FLSA 2WMQA 4I5CA 3NUPA 1BX6A 5F20A 5I4NA 4W8DA 5DYJA 1O6KA 4ZJJA 4F9YA 4RVLA 5CU3A 3AXWA 4R7IA 4G17A 3E63A 4EHVA 4PV0A 3VS2A 2W5HA 3P4KA 5HQ0A 4IB3A 4D2PA 4FTTA 1Y6AA 4GK4A 1J1BA 3F3UA 1UU7A 4TWNA 4M69B 3F7ZA 5FWKK 5IU2A 4YNOA 5L2SA 1V0OA 3NEWA 4IVCA 1QMZA 4TNBA 1H0VA 3COHA 4I6HA 4M67A 4YNEA 4AW1A 3ACJA 4P4CA 4AQCA 3WE4A 4BTFA 2OO8X 2C6LA 3OVVA 4FIEA 4BDHA 4O7ZA 4DHFA 5GINE 3GGFA 2B55A 3BYUA 4GJ2A 4BCGA 1R0EA 2E9OA 2RIOA 4R6VA 3UIBA 4BBFA 5L8LA 2YDKA 2ZDTA 3V6SA 3LMHA 2ITPA 4XJ0A 4L44A 2VWBA 4AXAA 3A99A 4ZXTA 5ETFA 4C2VA 3ZSHA 1J7LA 3DXQA 3VS3A 5HBJA 3EWHA 4YJSA 5IQBA 2XIKA 4RZWA 2C3JA 3DKFA 5AAFA 4ACMA 1XH6A 1R39A 2ITUA 2IZTA 4LMNA 3O50A 4D4VA 2PMLX 3HKOA 4BDKA 4C58A 1ZXEA 1FVVA 2IPXA 3QTRA 3V5QA 4FKPA 4U41A 5HVJA 3ZFYA 3QFVA 4WKQA 3QCYA 4F99A 2JKMA 3W1FA 5JZNA 3QKKA 4UALA 5IKWA 2QQ7A 3JYAA 1R0PA 2GQRA 3NYVA 5D11A 4R7HA 1OVEA 4BI0A 4ERWA 4IAYA 3H9FA 3C0IA 4DEGA 3W10A 2PVFA 2UZVA 3QL8A 4NJ3A 3EZVA 4I0TA 1OPKA 4I5HA 4XH6A 2V22A 4PMSA 5AV1A 4BIEA 4OTWA 2ITNA 2QOHA 5DH3A 5DGZA 3TZ7A 4LG4A 3NUUA 2C0OA 3TM0A 4RMZA 3LHJA 4DN5A 3IPHA 2FGIA 3BHTA 3NAXA 3T3UA 4Q9ZA 4M13A 5IA5A 4PP7A 4AFJA 4IC8A 2WAJA 3PPJA 3D7TB 4XV3A 4PDSA 3Q6UA 3QUDA 3F3ZA 4UMUA 1XH5A 4I41A 3W2OA 4FIGA 3SG9A 2WB8A 2YABA 3V5JA 5AADA 4JBVA 3OXTA 3PIZA 3F2NA 3V04A 2YLEA 3DV3A 4L52A 1JKTA 4BDIA 1J7UA 3QZHA 2WU6A 4CFVA 5BX0A 2CHLA 3NZ0A 1Y91A 5KBQA 1M2RA 4KWPA 5L2QA 2VTPA 4AE9A 2YWVA 4TWPA 3PY3A 4TWOA 4F4PA 4E6QA 4FTQA 4YBJA 3KCKA 3HV7A 5L8JA 5LCKA 5DE2A 1Q41A 3GCPA 3HRCA 4G3EA 4Y5HA 2J0KA 4O2ZA 1UNLA 3E62A 3K3IA 4V0GB 4YZNA 4PMTA 4AZVA 5LXMA 1XKKA 2YIYA 3AC3A 2YJSA 3MTLA 4O0SA 2HK5A 3RHKA 4CFFA 3MY5A 2I6LA 4ZLYA 1GY3A 2I7QA 4AA4A 3LXPA 4IBMA 4L53A 2W06A 3D0EA 3D5UA 4WNMA 3EQRA 1Q8UA 3LVPA 4P2KA 5ANJA 3DK7A 5C03A 3N4UA 3H30A 3IDBA 4KD1A 3LFEA 3F9NA 3Q60A 4I23A 3UPXA 3QXPA 2P55A 3R9DA 4DEEA 3BGQA 1GJOA 1B38A 4GIIA 3R0TA 3NCZA 2I40A 4NKSA 4K0YA 4EUTA 2R3GA 5JT2A 2P2IA 2WFYA 2R3OA 5AUVA 2O2UA 1J7IA 4XV2A 4ALWA 4IXPA 4E5BA 3SRVA 3LW0A 4MQ1A 1L3RE 2QCSA 2R7IA 5LMAA 1FOTA 2RFDA 3HGKA 4O83A 4TPTA 3D5XA 3A8XA 2NRUA 4XNEA 2H6DA 2WMBA 3PG3A 2JIUA 2VO7A 2WELA 3VAPA 4NYEA 2W4KA 4M0ZA 2GS7A 2JIVA 5BVWA 2CSNA 4Y8DA 3A7IA 3Q9XA 4FKLA 4HOKA 2H8HA 4LQMA 4JIKA 4LV5A 4U3ZA 4F0FA 2VGPA 4W9WA 5AM6A 1NW1A 3UC4A 3O51A 3FMNA 5CAQA 4RJ3A 4QMLA 4OTRA 4RSSA 1OBGA 2FSOX 3QD2B 3A7GA 4YLKA 5CNOA 3QQLA 4J95A 4FMQA 5JFXA 2GHLA 2OXYA 4BZNA 1OB3A 3M42A 4ZS0A 4EK8A 2WTKC 2ESMA 3AMAA 2FYSA 3L8XA 3F2RA 4YJTA 3UVPA 3FPMA 2EU9A 3MTFA 4J52A 5JQ8A 3KREA 2ZDUA 4EORA 4OAUC 4HPTE 2QKRA 3R7UA 2PSQA 4DGOA 4IZ5A 1ZY4A 2QODA 5CU6A 3CQEA 4MD8E 1B6CB 3LFQA 2X9EA 5G1XA 2RSVA 5ACKA 3DNEA 2V7OA 4QRCA 4L3LA 4JX3A 3FZTA 4LRMA 3UC3A 1VZOA 3G33A 2VRXA 4D0XA 4DCAA 4BZDA 4BWXA 5EYCA 4O6LA 4CLIA 2WQOA 2JAVA 3Q4ZA 4I6BA 3R7IA 3TT0A 3E8CA 4R1YA 4V04A 4IFCA 4O1OA 4KIOA 4UZDA 3SGCA 3R73A 4OTPA 3R2BA 2HZIA 4MF0A 5EDQA 4X6QC 4DITA 4BBEA 4WNOA 2XA4A 3ATTA 4YJPA 4CFXA 3BHUA 4O0UA 5B2LA 3O2MA 3RINA 3U55A 1DAWA 1ZYCA 3LLAA 2VUWA 3RAHA 1UU3A 3ZUTA 4O0TA 1VR2A 3QGYA 2ZB0A 3OEFX 3ODYX 3RK7A 3BHYA 4HCVA 5DBXA 4FT0A 4YJNA 3KGAA 3ZRKA 3OHTA 3WF6A 1REKA 2F7ZE 3PLSA 1TQPA 4O22A 5FQDC 3KRRA 3SHEA 3C4WA 3OY3A 5EG3A 1JQHA 4O96A 1ZAOA 2REIA 3GC8A 3PXFA 4D2WA 1BI7A 2WOTA 4BDJA 5M07A 4JBQA 4E7WA 4GKHA 2PUPA 3UNKA 2R3QA 3NCGA 4RLLA 4TYGA 3LFDA 4PNIA 2PZ5A 5EYKA 5CY3A 2R2PA 3ZU7A 3I5ZA 5AUXA 4EOOA 2X8EA 3LJ2A 4OTIA 4WRGA 2JD5A 5A14A 2BKZA 3QTZA 1VEBA 3IGOA 4F7NA 2UVYA 3FXWA 4BDGA 2NRYA 3CQWA 4K6ZA 3K2LA 3WILA 4MYGA 1JPAA 2OJIA 4ZEGA 5JGBA 4EH4A 3EFLA 4UYNA 4QMZA 2UZTA 4MWIA 3COMA 1WBTA 3GP0A 4U43A 4QP1A 3COIA 5IMEA 1V0BA 2W1ZA 2W1EA 4EQCA 5KMIA 4QYGA 5E8TA 3O71A 3UIUA 1SVHA 3HMPA 4H39A 2GNIA 2SRCA 4A9YA 4HGSA 4A4XA 3PIYA 4PNKA 5DVRA 5CF5A 2R3RA 4FKQA 4BCFA 4RFMA 3DAKA 3OEZA 1ZYSA 2ZM1A 3IECA 4HJOA 1UA2A 4J7BA 4MKCA 3ORKA 3GFEA 2GSFA 5E8YA 3SC1A 1BI8A 4XG3A 4ZY6A 4LL5A 4F65A 3P7BA 4FIJA 3F69A 3MVHA 5EQEA 4FVRA 3VQHA 4BICA 3ZZEA 2BHEA 4I0SA 4EL9A 3ZBXA 3ZM4A 2XKFA 3VULA 2EXMA 3NW7A 4F09A 3UOJA 4AA0A 4BR3A 3I1AA 3AMYA 1RE8A 3GI3A 5M53A 3AT3A 2J5FA 3Q5ZA 3IO7A 3LOKA 3T8OA 5IQAA 3D7TA 3II5A 1OIYA 4OTGA 4EOSA 3H0YA 4FV6A 4Z7HA 2CKEA 4XG8A 1XH9A 5EM8A 4KUJA 3D5VA 5C9CA 3S1HA 1MQ4A 4IMYA 2WNTA 1YKRA 5HG8A 3V8TA 4JQ8A 4DH5A 3NRMA 2BRBA 3RI1A 1Y8GA 2CJMA 1YXVA 5AIKA 4IX5A 3TV6A 4YTFA 3U6JA 3D15A 4YC3A 2WTVA 5AR7A 3BEAA 4O0RA 4FL3A 5JFVA 1OZ1A 3R7YA 3WARA 4CYIA 3OCBA 3GCQA 3SX9A 4LOOA 5ANOA 3ERKA 1ZZLA 4B9DA 3UIMA 3U9CA 4CT1A 4V0GA 1XH8A 1IG1A 1YW2A 2W1CA 5J1VA 3VUMA 4O86A 5GZ8A 1ZMVA 4Z7GA 4PF4A 5CXHA 3FY0A 3OTUA 2B4SB 4FNWA 4TYEA 5EI6A 4U42A 4F9WA 4D9UA 1R3CA 3EQDA 3LFNA 4G5PA 3DB6A 3ORIA 4RJ7A 5CX9A 4ZOGA 5K3YA 3V01A 1H24A 4BCIA 4BCPA 4G2FA 2VV9A 4GU9A 3UVQA 4APCA 1UU8A 2UZOA 4V01A 3ZO4A 4LM5A 4NM5A 4PDYA 4HGTA 4KAOA 5D7VA 5LVNA 4BCHA 3N4VA 4JR7A 5LMKC 3PJ2A 2BR1A 4Z9LA 3LMIA 5AJQA 2XRUA 5FEEA 2VTHA 5DHJA 2QKWB 1AGWA 3DK3A 2XNNA 5EDPA 3FHRA 5A46A 5CEOA 4A9RA 5IDNA 3KFAA 5CF4A 3KQ7A 4PY1A 3MB7A 2XIZA 4IAAA 3QTUA 4RBLA 2R3FA 4J71A 3S4QA 1RDQE 4EKLA 3W8QA 3JXWA 5J5SA 2OIQA 1OIRA 2GTNA 3FZ1A 1IR3A 5HIBA 2ZV9A 3L9PA 2UZDA 4HGLA 4YJOA 4I24A 4DBNA 3R9NA 1H8FA 5HTIA 3C51A 3R7GA 1J3HA 4RG0A 4Y5QA 4KIKA 4CFNA 2JITA 3PY0A 4O6EA 4G6OA 4XMOA 3UP2A 3N4TA 3EJ1A 1XBBA 4GG5A 4RC4A 4QP2A 4WUNA 3CE3A 3QZFA 2EB2A 2JDTA 4QMUA 3WZKA 5F95A 1YXUA 3QTSA 2O63A 1FGKA 2DWBA 4QP6A 3MSSA 4BVUA 2X4ZA 3RPRA 5CAOA 3MIAA 3ZXZA 4CQEA 3AD4A 3VW8A 4PPCA 4ZS4A 3B2TA 5K5NA 3LMGA 4U3YA 5F4NA 2JLDA 3DT1A 3VBWA 3ACKA 3KXZA 2PVLA 5IQFA 5M09A 5AA9A 2VO6A 1BLXA 2YISA 3LCDA 3FYKX 4O27B 2OK1A 2O8YA
chains in the Genus database with same CATH superfamily
1ZMWA 4TTHB 3NW6A 4BCJA 5C1QB 3F7WA 3KVXA 5DFPA 2P0CA 4BWPA 4ORKA 4QO9A 2NNWB 1VJYA 2HCKA 4XS2A 5TE0A 4A9UA 2E9UA 4FSZA 3UOLA 3V8WA 2R3HA 4JNWA 4LRKA 5EKOA 3ZFMA 4C4JA 1APME 3O96A 3Q52A 3VBYA 2C5VA 1AD5A 1ZYDA 5FTGA 1QCFA 2WU7A 4CKRA 2G2IA 3TUBA 3KIOC 5AFVA 2ZV2A 2WQBA 4KRDA 4DT8A 3Q53A 3TUDA 3UODA 3Q5IA 4RFZA 4RC2A 5I9XA 4U5JA 5C27A 4H36A 3FZPA 5HBEA 3DJ6A 1DM2A 1YDSE 4FRFA 3I0QA 1JNKA 3OWKA 4JDJA 2QOLA 4C57A 4ZLOA 3OD6X 2YDIA 1OKYA 2XKCA 4AW0A 3ENMA 3ANQA 2XCKA 4LI5A 5FDXA 1M7NA 4BKZA 5J1WA 3P9JA 1OKVA 2OFUA 2QVSE 2VTMA 2GFCA 3AC2A 3IOKA 4H1MA 4WO5A 3Q9WA 5HHWA 3RAWA 3VN9A 4BB4A 4ZMFA 2OZAB 5FXRA 1RW8A 3E88A 4IX6A 4BDFA 3BBWA 2Z8CA 4ANNA 3OY1A 2PUIA 2BILB 3EN5A 3D2KA 1G3NA 2Y6OA 3E7OA 2XJ2A 3KN6A 4JG7A 5D12A 3DAJA 1PYEA 1WBVA 1YI6A 2BALA 2F49A 3RNYA 4O7NA 4NCTC 3W2QA 3NW5A 2DS1A 1G8KA 3FKNA 1Z5MA 4XCUA 4CFUA 4KIQA 4RGJA 3LFCA 2JKQA 4YU2A 3BWJA 2IJMA 2QOFA 2XMYA 3PYYA 5BVDA 1Q99A 4OLIA 5LVMA 4FEWA 3QU0A 4ZJIA 4XV1A 3LCTA 4B8LA 4PL5A 4GT5A 3FXZA 3TIZA 3M2WA 4C3FA 4IACA 4RIYA 3I7CA 2QG7A 5CU2A 4C3RA 2IWIA 3KXXA 3LLTA 3VHKA 5IQGA 3DXNA 2ZYBA 3MA3A 2HAKA 2BKKA 3KF4A 3QQKA 1IAJA 2GNFA 5M44A 2W5BA 2YZAA 1ZOEA 4EBWA 2OXXA 3D9VA 3VS0A 3S2PA 3U6IA 2GPHA 5HG7A 4O0YA 4E73A 4Z55A 3S0OA 4DH1A 3OXIA 3C7QA 3QQFA 4AT4A 3OT8A 4CTCA 4DTAA 2X9FA 4TYJA 2RG6A 4HVHA 4O7YA 4EYJA 3RAKA 2ONLA 2OIBA 4CKIA 2W1HA 2EWAA 4AZFA 5KCVA 3R22A 4XG4A 4G6NA 4JOAA 4Z3VA 4XP0A 5JSMA 2X7OA 2ETKA 5B2KA 1PY5A 2XBJA 1YWRA 2XNOA 5TOZA 3JVSA 3FMKA 3E8DA 3SOCA 4IX4A 3DOGA 2C5NA 3BZ3A 4GSBA 4FOCA 2QOKA 2ERKA 2O64A 4IFGA 4N57A 4OTHA 1U5RA 4X3JA 5J9ZA 3ORZA 1GOLA 1UWHA 3CQUA 3NUYA 2Q0BA 4S31A 4WIHA 2ZVAA 3GBZA 1OUKA 4Z16A 3FMHA 4EBVA 5EOBA 4ONAA 3VRZA 4ZTNA 3G0FA 5JH6A 4ANLA 1V1KA 2X0QA 4CZYB 2OF2A 2IW6A 5KHXA 2AC5A 4QYFA 4FGBA 3ZYAA 4FUYA 5M55A 1Q62A 2PHKA 3KMUA 2FSLX 4GW8A 3IKAA 4S2ZA 4LV8A 4U79A 3TKIA 4BF2A 4F9CA 3EFWA 3EN6A 3MVJA 5CTPA 5CU4A 2RFEA 4L43A 4HPUE 3RM6A 5JFWA 4UX9A 5C8MA 3C4EA 5ANGA 4KS7A 2PUNA 3HMNA 3SRVB 2FB8A 4E4LA 3VWAA 1K9AA 4O4EA 1FGIA 2BTRA 4PQNA 4FTCA 5EQPA 4ASXA 2ZAZA 4BCQA 1KOBA 3MJ2A 4OTFA 4DF3A 3JY0A 4MAOA 4CFWA 1OPJA 1CDKA 3F5UA 3WE8A 4C3PA 5BNJA 4CRSA 2CKOA 3WZEA 1H1PA 1WFCA 3DZQA 2CKQA 2JAMA 1ERKA 2BDJA 3BL9A 2J6MA 4C35A 2IVSA 5GIPE 2XIXA 4YP8A 2R3IA 2VNYA 1H28A 2A1AB 4K2RA 4LOQA 5B0XA 2CCIA 4IM0A 5C8KA 4FC0A 1IEPA 3QCQA 4D4YA 2VAGA 2PWLA 4CG8A 1H00A 4ZTHA 2HWOA 3GXLA 4YLLA 2C1AA 2XNMA 4TXCA 2H96A 4RIWB 4IDVA 5JEBA 1H27A 2JC6A 3ET7A 3TV7A 1P14A 4O0XA 4TRLA 2JBOA 3FV8A 4I20A 4IAFA 3MY0A 1WBNA 2ITQA 3PXRA 3G15A 1W2CA 3P23A 3ID6C 3OCSA 4MNEA 2W1IA 3WBLA 3BHHA 5HG5A 5CEMA 4OT6A 4XP3A 1Q8ZA 3OCGA 3PUPA 4F78A 4CD0A 2VTQA 3HRBA 5BPYA 3TWJA 4W9XA 2R0UA 3PDTA 2OIDA 1U4DA 5HBHA 1VLRA 2YCQA 3KA0A 5GNKA 3VRYA 2WMTA 1NVQA 3FEGA 3DB8A 3FLYA 4FV5A 4GS6A 3NGAA 3VJOA 3E3BX 3C4CA 4TYIA 5KBRA 2R5TA 5TO8A 3W32A 4ZAUA 5E4HA 1OIUA 3R8ZA 4YBKA 2XZSA 4BIDA 3EFKA 2PE1A 3GFWA 3C5IA 4IW0A 4QPAA 3UO4A 4K33A 4FEXA 4R77A 4JG6A 3EYGA 2ZM3A 4JT3A 1KV2A 5CZHA 4BTKA 4FKJA 1YWVA 4QQCA 4RLKA 4FICA 4NUSA 4OBQA 4RA4A 3RPOA 4BKYA 2QI8A 3QRJA 3OOGA 4TKSA 5M06A 2XJ1A 2WTKB 4JIAA 4LFIA 5BYZA 2RKUA 2LAVA 4AXCA 4YGAA 3FZOA 5ANEA 4FL2A 4IJPA 4C33A 3LKMA 3FMDA 3QRKA 4QPMA 4EEVA 4AS0A 4DHIB 2NP8A 3FPQA 4I6QA 4ZJVA 2WMVA 2RG5A 5FLFA 1UNGA 5A4EA 2C5OA 3JVRA 5ANKA 1WBPA 2YA9A 3VS5A 4CZTA 3R30A 4E6AA 3QQUA 3KB7A 4DFYA 3C50A 5AA8A 5TKDA 2BFYA 3PP1A 4LMUA 2C6DA 4GU6A 4FKVA 4Y46A 5FM3A 2YAAA 3UGCA 3OWLA 4O38A 4AUAA 3RK5A 2YCRA 3MY1A 1PJKA 2BAQA 2WIHA 3R1NA 4FSNA 4UEUA 3ZO1A 3TUCA 3NPCA 3OUKA 4F7LA 4AAYA 4OBPA 3PSBA 1PXPA 2XK6A 1F5QA 3K5UA 3UMWA 5CT0A 3MBLA 3H4JA 4CYJA 5HE0A 5A3XA 4ZY4A 2I0YA 4FK6A 4UXLA 2YHVA 4D9TA 4FG7A 3BV3A 2OZAA 4UXQA 4DFLA 5CANA 4C8BA 3RAIA 3CJFA 1H01A 4J97A 5IA2A 5JRSA 3QRUA 2WPAA 2YIRA 1FVRA 1VYWA 3MFRA 5CWZA 3IDPA 4AACA 4AWIA 3RALA 3HX4A 3ZONA 3LCOA 4OAVB 4LDTA 1XJDA 2V62A 3MH1A 4XG7A 3ZZWA 2QLQA 4J8MA 2B9FA 2WMUA 1J1CA 2X8IA 4QYHA 3VUDA 4QP8A 2PVJA 4BTMA 2BZJA 4AOTA 2IZUA 2Z7RA 4FSMA 1QPEA 2W17A 4RX9A 3THBA 4QTAA 4WBOA 3AKLA 4QMMA 2CNUA 2QONA 3RCJA 4QEBA 4F9AA 5EDRA 3MIYA 4NKAA 5EI8A 4D1SA 4XLVA 3JS2A 1JSUA 1XH7A 5CT7A 2YIXA 5J7BA 4QQTA 2QOCA 4CV8A 1Q3DA 4O7WA 3CTJA 3VUGA 3HNGA 2Y9QA 3ZDUA 4DGMA 3A7JA 3BHVA 4RVTA 4FV7A 1TVOA 5JRQA 4H3QA 3MESA 1SMHA 2YM8A 5AR3A 2G2HA 1KE5A 4EK6A 4X7QA 3ZC6A 3IS5A 2XNPA 4GYIA 5IUIA 5J5TA 5E8WA 2JKOA 3VBXA 1PMUA 3AT4A 2QLUA 4IVDA 1OM1A 3BV2A 4O21A 3LQ3A 3UQGA 4AT5A 1MP8A 1PXMA 1WAKA 4XG2A 5HLPA 3DFAA 2XYUA 2ACXA 3P5KA 1KE7A 3HRFA 3QAME 2XKEA 3HLLA 2QHMA 4D1XA 1LPUA 3FI8A 3QQJA 4FSRA 3NUXA 4II5A 1PXLA 3UZPA 3PXKA 2R3JA 4FKSA 3EHAA 4KBAA 4WNKA 2IG7A 3E8EA 2W1DA 2XALA 1DS5A 3FQHA 5H8BA 4A9SA 5IISA 3MYGA 4FEUA 1M17A 1A9UA 3ZDIA 4I5MA 3QQHA 4QYEA 4DGGA 4JRNA 2OXDA 3BL7A 2GQSA 3R9RA 3F6XA 3FJQE 3KRLA 3P0MA 3VHEA 2P3GX 4BL1A 4FYNA 4FT9A 5FTOA 4USEA 4BYJA 5BVNA 2ZB1A 3EN4A 2WQMA 3KXHA 4FTLA 3LQ8A 2R3PA 1WBOA 5JGDA 3VBVA 3QHRA 2J0MB 4LRJA 1URCA 1CM8A 4U45A 2XUUA 5I3OA 4LUDA 4F1OA 4L45A 3BWFA 1DI8A 2E9VA 5HU9A 5KKRB 2HYYA 3OG7A 4CFMA 4QNAA 2BAKA 3BU3A 4RQKA 5HE1A 5A6NA 3G51A 3NDMA 4FIFA 4ZSEA 5BQ0A 4O4DA 5EHYA 4CZUA 5DR9A 4FSYA 1LUFA 5A4LA 1JKKA 5M4FA 1Q8YA 4IAZA 5ETCA 2YFXA 1H1SA 4FKRA 3PY1A 4K8AA 5AUTA 3ZM9A 4IANA 1W0XC 2QOQA 4E26A 1QPJA 4FG9A 4C02A 4EI4A 3SXRA 4ZMEA 5DEYA 2F9GA 3NIEA 3PPKA 4C61A 3CGOA 3GOPA 4BCMA 5IEVA 4GL9A 5AP3A 5AEPA 1G5SA 3QTIA 3D4QA 4KIKB 4C34A 5CEQA 4EH2A 2W5AA 3O23A 4F1MA 4YTCA 3C13A 2ITOA 3Q2MA 2I0EA 4IQ6A 2J5EA 2OG8A 4RIWA 3OMVA 3CKWA 4WA9A 5T68A 4WRSA 1YI4A 2YCFA 3QUPA 3RMFA 4FTUA 3VS7A 3TNQB 2AYPA 5EFQA 2YM4A 3HA6A 2QURA 2H34A 3HP5A 4HNFA 5E8SA 3BU6A 4E20A 1JKLA 4EH5A 4FNZA 4B4LA 4DH8A 5BVOA 2YN8A 2YITA 4IWDA 4IM2A 1OIQA 3KU2A 4RVMA 5IZFA 2XM9A 3GU6A 1QL6A 4FYOA 4KA3A 4QP3A 3NAYA 5C26A 3UQFA 4DYMA 3R2YA 4QMQA 4AU8A 2PVRA 2PK9A 4BIBA 4H3PA 5CAPA 3NNXA 3U4UA 2QOOA 3BPRA 4I3ZA 3RPVA 1OL2A 3H0ZA 4R5YA 3C0HA 4DHZA 3NMUF 4AN3A 2JEDA 2X4FA 3ODZX 4LGHA 4BHZA 4BRXA 1UU9A 2WMAA 2HY81 4X2GA 4FTKA 4FV4A 1YDTE 5IEYA 3PRIA 4RA5A 3P79A 4D5KA 1XBCA 2R3LA 2W05A 3TZ8A 1MQBA 1SZMA 3KXNA 3ZS5A 1IA8A 2EB3A 4JI9A 4ZIMA 4F9BA 3SXFA 3G2FA 3KXGA 4WSYA 5J7HA 4FKGA 2QU6A 5EI2A 3KL8A 4JQEA 4XRLA 3WZDA 5K4JA 1GAGA 4JAJA 2PZIA 4XBUA 3QWJA 4MVFA 2W99B 3EMGA 4D28A 5LWMA 4EC8A 5JN2A 3R8PA 2HW6A 3CXWA 3W2RA 3R8UA 4YPSA 3LJ1A 4Y85A 3PVBA 4OR5A 5L6WL 3WF8A 2R3KA 5AX3A 2C6OA 2VTRA 3UO5A 4DBXA 2F4JA 3L1SA 3FDNA 4BGHA 3EIDA 5I9WA 5HTBA 5AP4A 2Y6MA 1E9HA 3BLHA 4JLCA 3R8VA 2WTWA 1S9JA 5HICA 1ZRZA 2GHGA 1W8CA 1NA7A 2PPQA 3QWKA 4YMJA 3ROCA 4XG9A 5IQHA 4EH9A 3NNUA 3BYMA 3WIKA 3AD6A 4N6YA 5F9EA 4PX6A 4FI1A 5E91A 1M2QA 4GK2A 3NYOA 5FP6A 3AC8A 3IOPA 4RPVA 3OROA 4DFNA 5IH6A 1P4OA 2HOGA 2J7TA 2PMOX 4MHAA 3DKOA 3OW3A 4U80A 3H10A 5HGIA 3L8PA 1MRYA 3LCSA 4F63A 3U4WA 3SLSA 4FJVA 4KABA 5EK7A 4RIYB 4FE2A 3NYXA 3CY3A 2XK3A 5ANDA 5B2MA 3EOCA 2ZOQA 1LP4A 4M66A 5KMKA 1PRYA 1UV5A 4QP9A 3K3JA 3EN7A 3S95A 4G3DA 3L9MA 4A9TA 3O0GA 3NNWA 2GCDA 4IZYA 4QMSA 2CPKE 4H58A 1FINA 5KMOA 3ZH8A 1YDRE 4ANQA 2A19B 3I6UA 1BYGA 2OFVA 2IZSA 2BRHA 4KSPA 4CMUA 2J0JA 4U9AA 5FRIA 3EYHA 1T46A 5AR4A 4NFMA 5IH4A 3IQ7A 2UW6A 2VTNA 3RNIA 3WZJA 3I5NA 2I1MA 1LR4A 3ZO2A 4ACGA 3RVGA 1YQJA 2NO3A 4PWNA 3A4OX 5E8ZA 4HZRA 2IW8A 3NSZA 2B9IA 4BGGA 3FC1X 4BN1A 3N51A 4O4FA 4IVBA 2CGWA 2JGZA 4R3PA 4QOXA 1IASA 3UOHA 4BCNA 4X0MA 2Q83A 5E1EA 2C1BA 5HNIX 4YJQA 4R8QA 3W0OA 4IAKA 5DR6A 5M57A 3UZTA 3EN9A 1H26A 4YHJA 2OW3A 1OL6A 4Q5EA 5HORA 2X6EA 1JLUE 3DQWA 5I9YA 1FPUA 2R3MA 4Y83A 2C6IA 3A61A 3P7AA 4FT5A 3UBDA 1BL7A 2FSMX 4C2WA 1ZYLA 2E9PA 2QO2A 2B52A 3C5UA 4D2VA 4EOLA 3O5AA 3OWPA 3ZFXA 4AGDA 2OJGA 2WTDA 3QD0A 4GK3A 1M7QA 4L3PA 1U46A 4KB8A 3GCSA 2C6MA 5HE3A 4IVAA 4AF3A 1UNHA 5FEDA 3E64A 3GQIA 4S30A 5CSXA 4EJ7A 4PL3A 3BQRA 4JR3A 5KMNA 3U6HA 5KMLA 3QX2A 2VN9A 3DBDA 3ORNA 2IO6A 4GCJA 1CKJA 5D7AA 3RZBA 4C4FA 3CEKA 1GZOA 3ZRMA 3HV5A 3MH3A 4ALVA 2CGVA 2GHMA 2PMNX 5KZ0A 3UDZA 5EW9A 5E90A 3RM7A 2RGPA 1Y57A 4FV3A 4N0SA 4FV9A 4GFGA 4GMYA 4QYYA 4TT7A 3CY2A 3OT3A 4J53A 4EOJA 3PXQA 5EYMA 2QU5A 4AN9A 3VC4A 2XK4A 4LGDA 3UIXA 3DK6A 2C5XA 2PULA 4ANSA 2P4IA 3QGWA 2LGCA 3H9OA 3IDCA 4KBCA 4MUQA 5AV0A 2XP2A 2F2UA 2HENA 3PVGA 3QUEA 4PDPA 4WNPA 3KN5A 1Y6BA 5CEPA 5FDPA 4KNBA 2BROA 3TJCA 2BMCA 4U6RA 3RCDA 1SVGA 5CXZA 1XQZA 2VTSA 3VQUA 2YACA 5JFSA 3DY7A 3ATSA 4O0VA 4HVIA 1UWJA 2BDFA 3PSCA 2HXLA 5D10A 4MNEB 1NXKA 3OBGA 4G31A 3C0GA 5DPVA 5CI7A 4GJ3A 3TG1A 4EQMA 4L7FA 3ZC5A 2JIIA 3HMMA 1LEZA 3IW7A 4MEDA 2R64A 2PMIA 4EOPA 1FQ1B 3OP5A 4MXZA 4O1PA 3LIJA 4I4EA 3PG1A 5CVFA 2UVZA 4IIRA 4D2RA 3PJ8A 4Y73A 3R21A 5GJDA 2JDVA 5AR8A 4B8MA 4DG0E 4L42A 5GZAA 2CGXA 2CNQA 4FTJA 4NWMA 5ACBC 5IMXA 4N6ZA 1YHVA 4QTDA 5LMKA 4ENYA 4UY9A 5BMSA 3IGGA 4CRLA 1OECA 5AP0A 2WGJA 4RFYA 3P1AA 3FMJA 4OT5A 3VNTA 1KWPA 3Q96A 2AQXA 4JDKA 4F6UA 3E5AA 2OI4X 3QD4A 5AMNA 3KMWA 1I44A 3TKHA 2JDOA 4NM0A 4D1ZA 4F0GA 3DLZA 2IVUA 3SKCA 4EOMA 5BVEA 4X3FB 2WTJA 4FKWA 5CAUA 4I21A 2Y4IB 3QHWA 4AGWA 4E6DA 4M8TA 1UKHA 5IUGA 4EH3A 2B9HA 2Z7SA 4HCTA 4IEBA 4RWJA 4ZZOA 5HE2A 3UE4A 4J98A 4XRJA 5M08A 2YM5A 3LFSA 1JAMA 3A62A 3KEXA 4QMYA 1H1WA 4FR4A 3H3CA 2B9JA 2O3PA 2V5QA 5EW8A 3GC9A 1NVRA 1OBDA 4O7RA 4PMMA 3DLSA 3HV4A 3Q2JA 5EHLA 3EZRA 4QQ5A 3ORPA 2W1GA 5H8EA 3SW7A 2VGOA 4IADA 3QZIA 5DR2A 3SQQA 2GDOA 4O4BB 3ZLSA 3E93A 4YC8A 2HXQA 3IW5A 2IN6A 1ZYJA 4ASZA 4FGRA 2Q0NA 2QC6A 3UOKA 3ZBFA 3HAVA 2C0TA 5EYDA 2QHNA 3ORMA 2Y0AA 4L6QA 4MX9A 1VYZA 4WG5A 2UW0A 4GV1A 1Q97A 2BZHB 3Q4UA 4RX8A 5IG1A 3TEIA 3U8WA 4EK4A 5C4LA 1SNXA 3ULIA 2RFNA 3ZTXA 2DYLA 3QX4A 2G01A 3HAMA 3BYSA 4G6LA 2X2LA 1J91A 3F82A 4EQUA 2JFMA 4IDTA 1FMKA 1STCE 2Z2WA 4L68A 3TKUA 4GFMA 3LE6A 1W82A 3RK9A 5I9ZA 3NVMB 4EK5A 4AXFA 5ETAA 3KULA 4A4LA 4TY1A 5AP7A 4EH8A 4FSQA 5D9HA 4EZ5A 5FM2A 1KV1A 1YOMA 4ZZMA 4FT3A 3RWQA 4K77A 4MBIA 3OOMA 3QZGA 4L00A 2WMWA 2H9VA 2OJJA 3VIDA 5IUHA 5KHWA 4ZSLA 4MD9E 5HD4A 5HU3A 3G9LX 2XIYA 1W84A 1WVXA 3TN8A 1YOJA 3HL7A 4ZK5A 4D2TA 3EQHA 4RWKA 2C5YA 3OBJA 1REJA 2QR7A 5E1SA 4TL0A 5CSWA 5K9IA 5HVYA 2BHHA 5KMMA 3PLAE 3R7EA 4CCBA 3UZRA 3E3PA 3F5XA 3OS3A 3PE1A 2C0IA 2R7BA 4AZSA 4RC3A 5IH5A 3UP7A 4JG8A 4FSWA 5DI1A 3R7OA 2Y4PA 3NX8A 1CKIA 4MXAA 4U40A 3FMLA 4XHKB 1H0WA 3MGYA 4G34A 4PPBA 3TCPA 1PYXA 2C69A 3IONA 4YZ9A 3NLBA 4NIFA 4FTNA 4TW9A 3D7ZA 4WT6A 3ZEPA 3DKGA 4QTCA 2XCHA 2CDZA 4GIHA 2RFSA 5DOSA 2BIYA 1M14A 4FL1A 3RKBA 4NCTA 4F1TA 4G16A 4FZFB 4FX3A 1CTPE 4R3CA 1KE6A 3MFTA 4AW2A 5C8NA 2ITZA 3DKCA 4QMWA 3C9WA 4FNYA 4ANOA 4CQGA 2F2CB 4DTKA 3R1QA 2A4LA 5FD2A 2OH4A 2GFSA 3DGKA 3BGZA 2YIQA 3BI6A 2C6KA 5LWNA 3MW1A 5K0XA 2WQEA 4U8ZA 4FEVA 2XB7A 2YM6A 4KBKA 2IW9A 3ZSGA 3FLQA 2QNJA 3VS6A 4EH7A 4X2JA 1PXKA 3RWPA 2C47A 4XLIA 2XK8A 3QBNA 5CNNA 5CU0A 3ZXTA 3D14A 4UMPA 5D41A 1W7HA 5HCYA 5KE0A 5EM5A 4D0WA 4RX5A 5IA1A 2HZ4A 3KC3A 4DGNA 4QDEA 4KS8A 3QLGA 5HOAA 1PXOA 3CKXA 2GU8A 2UW4A 3KKVA 4GVJA 5CSHA 3PWYA 4X21A 4NEUA 3NUNA 3FI4A 3HUBA 2R4BA 2PZRA 2XF0A 3R02A 4FSTA 4NTTA 3SDJA 4FKUA 4TWCA 4PMPA 4DH7A 3WF5A 4UWYA 3Q4TA 4XP2A 5I3RA 3VW6A 1G8SA 2GMXA 1IAHA 3SOAA 4IWPA 5ANIA 4S34A 3QC9A 2Z7QA 2BDWA 4YC6A 2PL0A 2UW8A 4B0GA 2W96B 4UV0A 2J50A 1NVSA 4DG3E 3OTVA 2X0GA 3PP0A 3V3VA 3Q04A 3ZOSA 4NJDA 4MXOA 4U81A 1JVPP 4I93A 4XV9A 4YJUA 4YO6A 3CR0A 4P7EA 2EXEA 4PTCA 3O17A 5AAEA 3AGMA 4AZWA 4C36A 1YXXA 2CLXA 4YR8A 4C62A 4A07A 4BY9E 5IQDA 3G9NA 2B54A 4C0TA 4JDHA 4BKJA 2XKDA 3PJ3A 4BWKA 1JWHA 5CEIA 3O8UA 2QG5A 5AP2A 3HP2A 4O7LA 3WF9A 4DTBA 2GNJA 3NVKI 3PA3A 4FSUA 1Q61A 4GT3A 2A2AA 4ZSGA 5CYIA 3FL4A 4AOJA 3CD3A 2OICA 1U54A 1F0QA 1XH4A 3RJCA 2VTIA 2VTTA 2VO3A 5HESA 2YEXA 3PFYA 2VTLA 2VX3A 4JAIA 4AP7A 1SM2A 3P5JC 4S33A 3NFGB 2ITTA 2CMWA 3Q3BA 1R1WA 2BAJA 2XNGA 4NSTA 5HCXA 5C01A 4ZSJA 3POZA 3GNIB 5M51A 2I0HA 2P2HA 4MXXA 1XBAA 2QOBA 1ZMUA 2VX1A 4FIHA 2EXCX 4HGEA 2HZ0A 3CP9A 3M11A 1TQIA 2OGVA 3O8PA 4L01A 5FEQA 3TIYA 5J95A 3SA0A 2X39A 4UZHA 4WD5A 5HZNA 4NW6A 3W0NA 3LXNA 4DAWA 5EHOA 3EB0A 1OKWA 5J9YA 2PYWA 3MVMA 4J1RA 4BCKA 4G3CA 2VZ6A 4EHZA 2VX0A 3GC0A 1SVEA 3U9NA 4UMRA 4GFOA 4JBPA 2VWZA 4X3FA 1GIHA 3UDBA 2PVKA 5CS6A 5CENA 5FGKA 5BYYA 3HDNA 4JDIA 3A8WA 4U44A 1ZOGA 3A7HA 3F3TA 3COKA 2WOUA 2UZUE 4FTOA 1F3MC 4XG6A 3UYSA 2XK9A 3EL7A 4IHPA 2GTMA 2UW5A 4RJ4A 5DNRA 5E8UA 3RPSA 5EM6A 5L3AA 3ULZA 2XEZA 3RPYA 1WVWA 4ZZNA 1HCKA 1OITA 3E8NA 1W83A 2X8DA 2KULA 3ALOA 2PZYA 2YCSA 4MK0A 2ITVA 3ZO3A 4DT9A 5K0KA 5L6OA 2XAMA 5CVHA 4JXFA 4BZOA 5BUJA 1ST4A 3DZOA 5BYLA 4X2KA 3BE9A 3FYJX 1WBWA 3MWUA 3U87A 5M56A 3CTHA 4HYIA 4PL4A 2VTJA 4O2PA 2YZLA 2AEGA 2JKKA 3EH9A 3RTPA 3NIZA 1X8BA 3DQXA 4FKIA 3BGPA 4DEIA 2J90A 4C59A 1YRPA 3NUSA 2BCJA 4WG4A 5AM7A 5AUWA 5HO7A 3EQFA 4W4WA 3SXSA 3UJGA 3KK9A 4I6FA 1RJBA 3FHIA 2BZKB 4W4XA 2ZM4A 5KO1A 5GIOE 5HO6A 5I9UA 1DI9A 1O6LA 1YHSA 1OI9A 5KX8A 4Q9SA 2BZIB 3TNIA 4NFNA 4MBJA 4I22A 4GVAA 3AT2A 4QMOA 3HMOA 4ZTLA 2IZRA 5DRDA 1ZARA 1ST0A 4IB0A 5CZIA 4C4GA 3EQBA 4OGRA 5H8GA 1BL6A 5JZJA 3W0RA 3R01A 3PA5A 4ITIA 4LGGA 3ZUUA 5AV4A 2ZJWA 3FWQA 3QRTA 3D2IA 4MXCA 5AWMA 3GQLA 5ETIA 4CCUA 5HLWA 4PTEA 3W18A 3HEGA 3TXOA 3MJ1A 4FNXA 3TTJA 2NPQA 1PF8A 2ITYA 2YERA 1H4LA 4LOPA 1Q8TA 5M4CA 5J9LA 2WO6A 4G5JA 5IA4A 3G90X 3O7LB 2XRWA 4BYIA 5J8IA 4YUQA 3VONA 5BUIA 3C4XA 2Z7LA 3F3VA 4AG8A 3CS9A 4YO4A 4FK3A 3BRBA 4E4MA 2J9MA 3LPBA 2C4GA 1H1RA 3TI1A 4UWBA 1Z9XA 2WTCA 3VS4A 3PTGA 4B99A 3MA6A 3OCTA 4HCUA 3GEQA 4HVSA 2Y8OA 5CF6A 4IM3A 4CLJA 2YM7A 3R6XA 4NU1A 2YDJA 1TFFA 3R1SA 4CG9A 3GU4A 5E8VA 3FI3A 3ZMMA 4AT3A 4QDVA 4FF8A 1GZ8A 4D58A 5EQYA 2V7AA 4MBLA 1HOWA 3NUAA 4XOYA 5AIRA 4TN6A 3W55A 4E5WA 1UVRA 1QPDA 3A60A 4RX7A 1ND4A 1YVJA 4AN2A 3W0QA 4P90A 5DT3A 2G9XA 2HELA 3FUPA 5E7RA 5FBOA 4D5HA 3BLRA 5LVLA 2EUFB 4MWHA 5GJGA 4PUZA 4O7SA 3DDQA 4JJRA 4DEHA 4YLJA 3LZBA 4RJ6A 4JX7A 4FBXA 3FL5A