3DBQA

Crystal structure of ttk kinase domain
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
282
structure length
259
Chain Sequence
NECISVKGRIYSILKQIGSGGSSKVFQVLNEKKQIYAIKYVNLEEADNQTLDSYRNEIAYLNKLQQHSDKIIRLYDYEITDQYIYMVMECGNIDLNSWLKKKKSIDPWERKSYWKNMLEAVHTIHQHGIVHSDLKPANFLIVDGMLKLIDFGIANQMVGTVNYMPPEAIKDMSISPKSDVWSLGCILYYMTYGKTPFQQIINQISKLHAIIDPNHEIEFPDIPEKDLQDVLKCCLKRDPKQRISIPELLAHPYVQIQTH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Dual specificity protein kinase TTK
publication title Structural and Mechanistic Insights into Mps1 Kinase Activation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 71
structure length 259
sequence length 282
ec nomenclature ec 2.7.12.1: Dual-specificity kinase.
pdb deposition date 2008-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3dbqA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3dbqA01
4YMJA 5EHOA 3QRTA 5FDXA 1L8TA 4HGTA 4QMLA 3VF9A 5AA9A 2Q0NA 5AUWA 3G33A 4E5BA 5HOAA 2NRYA 2GHLA 3QKLA 5CAUA 3UQFA 2VX3A 1OL7A 5GHVA 3ZUUA 5JZJA 3R1SA 5FTQA 5CAQA 4EK5A 4RVTA 4EHVA 3LOKA 4JAJA 5AUUA 5BUIA 2QG7A 1OKYA 4IEBA 4Y72A 3UVRA 1OL6A 1WVWA 2PSQA 4AFJA 3EQRA 5FM2A 2ZMDA 2R64A 2AC5A 4ZP5A 5HBEA 2PPQA 2XIXA 5ANJA 3VULA 4Y5HA 3IW4A 4OW8A 4ZTLA 5HIEA 3COMA 5C1QB 3ZS5A 3M11A 4NIFA 3PWYA 1W83A 4FTAA 4TXCA 4UYAA 5CENA 4EBWA 3PVBA 4QP9A 2QOCA 3OS3A 2X4FA 5I3RA 3KMWA 3RPVA 2RFSA 4C61A 5AP4A 2OZAB 4MXZA 2UVXA 1G8AA 4CYIA 5IUHA 5FXQA 2FGIA 2YM3A 4D0WA 3LIJA 4FV6A 3E3BX 4EK8A 2QKRA 1ZMUA 3WOWA 2VTHA 2ZV9A 3U8WA 4Y73A 5KMNA 3ZM4A 4R6VA 3CE3A 3ZO1A 3SG9A 1LEWA 4KIOA 5LXMA 2IVTA 3BU5A 4NFMA 5AV3A 4AXAA 2IG7A 2YDKA 3SKCA 4FNXA 3DJ5A 3W1FA 4IIRA 3KCFA 3RAKA 3HUBA 3EOCA 4S30A 4G1WA 3EJ1A 4FZAB 4RX8A 3VUHA 4CNHA 5AUXA 1CKJA 3EQPA 3GFEA 3T3VA 3VBVA 2PU8A 3DAKA 2Z60A 5HX8A 3ATSA 3MW1A 3W2CA 3GU5A 3M42A 5CI7A 2GCDA 5IISA 5CAOA 2VTTA 3CGFA 5EYKA 2HW6A 3KF4A 4MBIA 1U54A 3PRIA 4CG8A 4G9RA 4GEOA 5B2LA 4EYJA 4NCTA 4AACA 5BQ0A 2B9HA 4XBUA 4OT5A 1A06A 3ZFYA 5DMZA 5LMAA 5M44A 3VW8A 3EWHA 1ZY4A 3FYKX 3PE2A 3N9XA 4PPAA 3IGGA 2ETRA 4E6QA 4ZS0A 4ORKA 4EOOA 1ZLTA 3DDPA 3LLTA 2W99B 4ALVA 1J1BA 4B8LA 3RI1A 4YU2A 4ZJVA 2IJMA 3PJ2A 4CT2A 4PMSA 5M06A 2UW0A 4C57A 2QHMA 2YLFA 1I44A 4ITHA 4MHAA 2YCSA 4S34A 5FBNC 5F20A 4FA2A 2RIOA 2PE0A 4X2NA 5AP6A 2GS2A 1KSWA 2YISA 3LAUA 3NEWA 2X8EA 3PJ8A 4FYOA 5M4FA 3RAHA 2ETMA 2QONA 3KCKA 3KB7A 3POZA 2QOLA 3G0FA 4GG5A 3QYZA 4TYGA 4QMOA 5L6WL 3RK5A 3FMKA 3T9TA 3ZSHA 4FSYA 3CTJA 4FTQA 3FLQA 2HXLA 4P90A 1O6YA 4FSWA 3PVWA 3ACJA 4AT4A 1L3RE 1YI4A 1PXPA 4FX3A 1Q5KA 2WMSA 4D2RA 3A7JA 3VJOA 3WF6A 4DT9A 1OMWA 5L2WA 1XKKA 4H3QA 1SNUA 3QTWA 5J87A 2CDZA 1RDQE 4FV1A 3QF9A 4MXCA 2X1NA 2CSNA 3DFAA 3C0IA 3MVMA 4EH6A 4CD0A 5CAPA 4YO6A 3L1SA 4KS8A 1M17A 2WMBA 3UO4A 3LZBA 1NY3A 4FKQA 4NTSA 3LQ5A 4RJ8A 4IFGA 4JT3A 4BDBA 2OKRA 4TPTA 5JRSA 4P7EA 2F4JA 4ZSEA 3KVWA 4DITA 5CXZA 3DKGA 5HO6A 3PRFA 3L8VA 5HORA 5HE3A 1CDKA 4D5HA 4Z16A 5BUJA 2OFVA 5EFQA 5IQAA 5DLSA 1YQJA 5I0BA 3QQKA 4I6FA 1BLXA 3MYGA 4KIPA 4H05A 5A3XA 2W5HA 3N51A 2WFYA 2E9UA 3QTIA 3T9IA 1ZMVA 3KU2A 1CKPA 3AMAA 4XX9A 5A4TA 2OLCA 3G2FA 1CSNA 3ORPA 2ITTA 4NM0A 2VTSA 5HG5A 4ZSGA 4QQJA 4HCTA 4OTFA 3QRUA 4YZCA 2PVMA 2VGPA 3BE9A 3ZZWA 4J53A 4R3RA 3HV7A 3CTHA 4FV5A 3UMXA 3ZXTA 4DFYA 4EZ5A 4R7IA 4IB3A 2VNYA 4BY9E 4QMTA 4A9SA 4DF3A 2HZNA 4EHGA 3B2WA 3DXPA 2O2UA 4AOIA 1NVRA 2BRBA 4H1JA 3R8PA 1GZ8A 3ZFXA 4OUCA 5JT2A 3LMGA 5CU3A 3A7GA 4I5PA 1OPLA 1H25A 2UZDA 3NNVA 4DFBA 4FSQA 3OCGA 4BF2A 5LVNA 3F61A 5L2SA 3O50A 2W9ZB 5ANKA 4HJOA 4HVDA 3U6IA 3DBCA 4AW0A 4LGGA 5AR2A 4AE6A 4RIYB 2YN8A 5F9EA 4XG4A 3E93A 1V0OA 2CGVA 3BI6A 3LXKA 4WOVA 3DAJA 3AQVA 3DY7A 2QOBA 3F3VA 3R7EA 3MWUA 4BCQA 2R2PA 4EKKA 4PF4A 3DCVA 4NJ3A 4JDJA 4QYFA 3WYYA 4BCPA 2EXCX 4QTBA 4EH7A 4FSMA 4LOQA 4Q5EA 4UMQA 5TR6A 5KNJA 4TWNA 3V5TA 1YXTA 5AUYA 4AT3A 2C6LA 2UZOA 5E90A 4FT7A 4TZRA 5ITAA 3D2IA 2B0QA 4LQMA 2GNLA 4DT8A 3PY0A 4MNEB 3LFBA 1ZXEA 4CEGA 4ZTMA 4JDHA 4XP3A 2WQEA 2Y4IC 4CFNA 4BL1A 2XNGA 4IDVA 3UG2A 3I79A 2W17A 3WARA 2RL5A 4AW5A 4FTOA 5JFSA 2HY0A 1DM2A 3E8CA 2GNIA 3QTRA 4GFOA 5HO7A 4B0GA 3QC9A 3RCJA 3R9DA 4IXPA 4NKAA 5I5ZA 2QC6A 4BGHA 3UZTA 3OVVA 5JH6A 4ZY5A 4CKJA 1WVYA 4K77A 5J9ZA 2BILB 1YDRE 2WTCA 3QQJA 4FT5A 5HLNA 5E9EA 1PKGA 4OTPA 3MY0A 3MPTA 3C4CA 2EXMA 2WMXA 2BUJA 3D9VA 3FL5A 3GFWA 4GT4A 2OIBA 4A9UA 3IG7A 4FTRA 4F1OA 1KE9A 3GP0A 4CXAA 1FVTA 4ZSLA 4KB8A 3LJ1A 4UY9A 1MQ4A 2OH4A 3IOKA 5KHXA 4R5YA 4YPDA 3E3PA 4Y85A 5E92A 1PXIA 3I0OA 5L3AA 1UKIA 3HX4A 2UW9A 1K3AA 4DGOA 5GIPE 2Y6MA 4AG8A 1G3NA 3E7VA 5DRDA 4YO4A 1DAWA 3GQLA 2OIQA 2PUUA 1VYWA 3SG8A 3FZTA 1GZOA 3IPHA 3ZO2A 2R3KA 3PXRA 4IWQA 2V5QA 3FMEA 1H4LA 4FT0A 4PX6A 3OXTA 5LVLA 3PY1A 5AX9A 4JRVA 3A4PA 4Y8DA 4YJVA 5DR6A 3ID6C 1EH4A 4NW5A 4IADA 3UIXA 1H1RA 3QD3A 4FF8A 4HNIA 4XG9A 3A8XA 3MBLA 5LWNA 4CGAA 4BWXA 1FQ1B 2GQGA 3U4WA 3KK9A 3QHRA 3QTXA 4I6HA 4RC2A 2F7XE 4RQKA 4CTBA 4JG8A 4ZLYA 4DEHA 5M51A 4F4PA 2YJSA 2OIDA 4QNAA 4IH8A 2YIRA 3NUPA 3TZ7A 4CQEA 4FKJA 3H3CA 1M14A 4OTHA 4BHZA 4CFMA 4DEDA 2O65A 4EK6A 3R2YA 2BIKB 4YJQA 1H1QA 1ZZLA 4D2WA 2HWOA 4FV8A 2G1TA 5EYCA 3A7IA 2R3FA 2ZJWA 3FZRA 1R39A 3LCDA 4LMNA 4YZMA 3V04A 3OG7A 3UVPA 4AUAA 3RNIA 1XBCA 3KXGA 4DH7A 5KMMA 3RK7A 2OFUA 3VRZA 4JVGA 5L6OA 2E9PA 1OI9A 3AD4A 3HV5A 3HMOA 3V51A 2XRWA 4WT6A 2B54A 3ZCLA 4N4SA 4D2VA 2XKDA 3O2MA 4UWYA 5KMKA 2E2BA 3G5DA 4FR4A 2WTWA 4G6OA 4M69B 3EZRA 4MD8E 4DH3A 2VTPA 5AUTA 2XK9A 4BWPA 1OIQA 2JGZA 2NP8A 2Z2WA 2VAGA 3PZEA 2VWBA 5AR8A 3PIYA 4L46A 3TDVA 1Y6BA 5M4UA 2YDIA 5C4LA 4RLKA 1FBNA 5CF4A 2C3JA 5DEWA 5EI8A 2PUPA 4G16A 4U97A 5BYLA 4TWPA 2R3GA 5CEMA 4G3FA 4YLLA 2I1MA 5JRQA 3VUDA 3ZLSA 5D12A 3AGMA 3GU8A 4FIJA 3PY3A 4IAAA 2WTVA 3R04A 5B2MA 3DT1A 3OUNB 5J8IA 3BCEA 3SLSA 4C3FA 4FSNA 4HCUA 1YWNA 4I5MA 4EWQA 3ORXA 3F7WA 2ITXA 3N4TA 2FSLX 5J1VA 2ZM1A 3DBEA 5HTIA 2WD1A 3W8QA 3AC2A 1Y8YA 1PHKA 5EK7A 2HZ4A 3TCPA 1H8FA 3PJCA 1BKXA 4JQ8A 4X2JA 3UGCA 3HLLA 2VO6A 3ZU7A 5EHLA 4BYJA 4WNMA 4KRDA 5GZ9A 5HBJA 2IVSA 3L9MA 3N4VA 2XYNA 4XLVA 4F64A 5DA3A 3PYYA 4AN9A 3CLYA 5CEKA 2JDRA 4FVRA 4QMUA 3G51A 2EUFB 3DLSA 5I9ZA 3CPBA 4PRJA 2CHLA 2JAMA 4IB5A 4E5WA 2IW6A 4WA9A 2C1AA 4OTWA 3MB6A 4YHJA 3BEAA 4AW1A 5D7VA 3QD4A 4MXOA 4WNPA 1M52A 3SRVA 4ASEA 2ZV8A 3MA6A 1LPUA 2YIYA 4UB7A 4V01A 3VBXA 3EN6A 4JOAA 4BIEA 5KX8A 3K3IA 3U4UA 5TF9A 4JIAA 1JQHA 4RIWB 3UC4A 1VJYA 3FZ1A 3GBZA 3LFEA 4XS2A 3TWJA 5BVNA 3FV8A 4D1ZA 3NUSA 2BZIB 3E8DA 1URWA 3TTIA 2VU3A 1SMHA 3D7TB 2PHKA 3R63A 4O0TA 3K54A 2C3IB 2NPQA 3BLQA 4BI0A 4KKEA 4O86A 4YZ9A 2QO2A 2Q83A 4IAFA 4IZAA 5DT3A 3HECA 3SXFA 4AAAA 4D1SA 4E4XA 4F9BA 5I9WA 5GJDA 4WUAA 4A4LA 1M7QA 1YI6A 4BTKA 1K2PA 3ZBXA 5C8KA 3GC0A 1E1VA 3C4ZA 3MIAA 4L7SA 4FKSA 3TM0A 4XG6A 1W7HA 3UP7A 2OZOA 4OLIA 3QQFA 2KULA 4YTCA 4ZY4A 1YOJA 4FTNA 4BDEA 1P5EA 4UZDA 2XNMA 3PVUA 1AGWA 5G1XA 5H8EA 4GYIA 5IQFA 2JAVA 3R8ZA 4QMQA 3U87A 4AT5A 3B8RA 2ITNA 2GDOA 3OCSA 4ALUA 4X6RA 4O7ZA 1Q4LA 2QO7A 3R01A 3AT2A 1GIIA 3A4OX 4TY1A 4E93A 4EHZA 4HVSA 3WZEA 4PNIA 2QQ7A 4EORA 1WBWA 1GY3A 4FKPA 3PPJA 4FEWA 2XZSA 4O2PA 4OGRA 2R3RA 5EH0A 5A4EA 4R78A 3MVHA 1IG1A 3QC4A 4KRCA 1OUKA 1ATPE 3DA6A 3HP2A 4IWOA 4CVAA 2ZV7A 4BCHA 4JIKA 1A48A 4LM5A 5TOZA 3OY1A 4ENXA 3P9JA 5GINE 4DTAA 3LFFA 2QU5A 4EJNA 2H6DA 4KBKA 2NNWB 3ULIA 2JDTA 4H3PA 4PMTA 4DFXE 5BUEA 3FZPA 3BBWA 3EQIA 4GVAA 4PL4A 4BI2A 5IUIA 4YZBA 4GUBA 1FGKA 4J71A 5D11A 4AA4A 5LJJA 5HD4A 3B2TA 3QAME 4L01A 2R3NA 3MI9A 2XNOA 2WMUA 2BMCA 3GU6A 2B53A 1YI3A 3O8TA 4M97A 3BWFA 3R83A 2JDVA 4BKYA 1XR1A 4XOYA 2ONLA 4WBOA 3TNQB 4GIHA 4F0GA 5DT0A 3GCSA 3WZUA 4D2SA 4KA3A 5E8VA 1ZYCA 5HKMA 3EIDA 4CLIA 4FMQA 3SW4A 4I41A 2W4KA 4QMXA 2HYYA 2WO6A 3V5LA 2VWWA 2BR1A 3PPKA 4BKJA 5IPJA 2ZB0A 3ODYX 2BDJA 4HOKA 3UZPA 5IEYA 4QP3A 4A9TA 5L2TA 2GTMA 2QO9A 4FKRA 3COKA 4I93A 3FHIA 4A4OA 4A9YA 2A1AB 4IW0A 2IW8A 2LGCA 4FNZA 4IHPA 4F63A 1OKVA 2B7AA 4BBMA 5FDPA 1Q8YA 1OZ1A 2QLUA 4EH5A 1R1WA 5JGBA 4DGMA 3AT4A 4FG7A 3V5WA 4BDFA 1OL1A 4F7JA 4ACCA 3EQBA 3UO6A 5HCYA 3LMIA 1QPJA 2X6EA 2JKOA 2PZYA 4QMSA 3BZ3A 4FL3A 1M2PA 3JPVA 3HDNA 5FXRA 4GT5A 5AP0A 3R8UA 3V8TA 2X9EA 4U6RA 5LCKA 2PVJA 4F65A 3MH3A 4I23A 1WAKA 5C01A 3SC1A 3UOJA 2V7AA 2ZV2A 4LOPA 2ZDUA 4J95A 4O7YA 3EQGA 2HZ0A 3HZTA 2FSTX 3OZ6A 3PJ1A 3BV3A 4HVHA 5J5TA 3EKNA 3E5AA 3D94A 3F5PA 4LL5A 3AC1A 3FI4A 3QD2B 4IZ5A 4V05A 5B2KA 5KE0A 2HK5A 3VHKA 3ORZA 1Q41A 3FL4A 4XV1A 4KD1A 4E7WA 5KHWA 4FV9A 4XG2A 5ANGA 5EKOA 5EG3A 5H8GA 2ETKA 4K6ZA 1H0VA 1YVJA 1GOLA 4FTMA 3TNPC 5CALA 5LMKA 4G3DA 5IH5A 3LKMA 3U6JA 4R1VA 4L67A 4C36A 3IDCA 2J90A 4FTKA 2GFSA 1QPCA 3OD6X 4GL9A 1O6LA 4EEVA 2PYWA 2OU7A 2VWIA 3DKCA 3LFAA 4DG3E 1DI9A 2IVUA 2OF4A 4DBXA 4M12A 2JITA 2X2LA 3DZQA 2UZBA 2X4ZA 3CXWA 2VX0A 4CCUA 2FH9A 2Y6OA 4FIIA 4G9CA 2ERKA 3LM5A 2HENA 3UOLA 1F3MC 4CZYB 4U3YA 1MP8A 3W2SA 1CMKE 4O2ZA 2WU7A 2EWAA 3MTLA 3Q32A 2QKWB 4MF1A 5F94A 4G6LA 5KMOA 1PRYA 5M09A 1Q8ZA 4L6QA 3E63A 4RFZA 1WBPA 3UTOA 4DN5A 4GKHA 5CVFA 3CS9A 1B38A 1SYKA 1HOWA 3I7BA 3OEZA 4DAWA 1JKLA 3OWKA 4I6QA 4JDKA 1H1SA 4NJDA 5FQDC 3F2AA 3ZLYA 5HTBA 1Q99A 4IAIA 4OR5A 4USDA 3ZLWA 3O8UA 5JN2A 4EOJA 3DQXA 3COHA 2EVAA 3JXWA 2Y7JA 4U40A 3QX2A 3C50A 3BHUA 2V55A 4APPA 3CR0A 2V0DA 3MV5A 2PWLA 4QO9A 4RA5A 3TJDA 5M4IA 2VTIA 3CQEA 5IZFA 4PTEA 1NT2A 4TYEA 2F7ZE 4TKSA 2R5TA 4XUFA 4ONAA 2I6LA 4LGHA 4ANBA 3P08A 4C7TA 4EL9A 2C5XA 3MVJA 4RWLA 1XWSA 4RGJA 3QKMA 5FD2A 2FO0A 3UVQA 5KZ0A 4NU1A 3HAVA 1V0BA 2OJJA 2CN8A 4I5CA 3MGYA 4YJNA 4PUZA 1H1WA 1R0PA 3PXZA 4L9IA 2QVSE 2YIQA 4YJSA 3PXFA 3HYHA 3O0GA 3Q9WA 3WZJA 4C37A 3BGQA 4NIFB 3R9HA 1V1KA 4HPTE 3NIZA 3CTQA 2ZB1A 4ACHA 5J5SA 4FL2A 5HU9A 4Z3VA 4NM3A 3QCXA 2BCJA 2JDOA 2DWBA 4U5JA 4I3ZA 3VIDA 4QPAA 4C4FA 2WU6A 1PYEA 4IWDA 5GZ8A 5BYZA 3V8SA 3EMGA 3ORIA 4V0GA 3C0GA 5AP2A 5AWMA 3OMVA 2YA9A 1H28A 2QOOA 5HBHA 1BMKA 4NZWB 2XNNA 3FLYA 4D28A 3DKOA 3POOA 3QGYA 4GRBA 4NM7A 3P1AA 3ULZA 4DTBA 3P0MA 3TXOA 4FKVA 4R5SA 4E4NA 1H0WA 2IZTA 4B99A 5KCVA 2HAKA 3A2CA 4JBPA 1SVEA 2ZDTA 3VUTA 4Z7GA 4BB4A 2XMYA 4RWKA 3LFSA 4KINA 4LRKA 4MBLA 5DG5A 5F1ZA 3ZO4A 2YAKA 3L9PA 2X8DA 4O7LA 3RCDA 4RT7A 4Y46A 3U9CA 1ZZ2A 1P14A 4MKCA 1E1XA 4F0IA 1U54B 4G5PA 4RC3A 5AMNA 3BEGA 5IQEA 4DCEA 3ODZX 2W1ZA 3EN5A 4GU9A 2HXQA 4J99A 1OITA 2R7BA 3P4KA 2YFXA 3DTCA 3GENA 4MXAA 3IW5A 1KE7A 3WILA 4ZMFA 1W8CA 2G2FA 5CT0A 4CZTA 3QLFA 4KSPA 4IAYA 2C6MA 4XNEA 4O7NA 1H1PA 3HRCA 5J1WA 1NA7A 4E5AX 4G3CA 4GT3A 2Z7LA 4JL9A 3PZHA 3L8PA 1YXSA 4JR3A 4N0SA 5E7RA 4ANOA 3MJ1A 2YAAA 3PA3A 4DE4A 3FY2A 3LXNA 4I0RA 2IPXA 1Q97A 5A4LA 3HP5A 5L4QA 5HI2A 5EHYA 4QP1A 4E73A 2GNFA 4S33A 3R7YA 3QCSA 4BDAA 3QU0A 2J2IB 2VNWA 3OCTA 2CKPA 3O7LD 2UV2A 4OAUC 4YC8A 2J5FA 4QOXA 3UYTA 1OIYA 2C47A 3HUCA 4AZFA 3NSZA 3UG1A 4I0TA 1KE5A 3EFJA 1PYXA 4BYIA 5IQGA 4LFIA 4C59A 4CKIA 4UX9A 4CYJA 3BBTB 3KRLA 4QT1A 4ZTHA 2QR7A 3R22A 3UNKA 4DEBA 5HZNA 3FSKA 4KSQA 3REPA 3M2WA 4WG3A 4O6LA 5AV4A 3HV6A 3AT3A 3OWPA 3KULB 4MXYA 2OZAA 4RWJA 3DJ7A 3O51A 5HIBA 1YWRA 4FSZA 5L8LA 3JR1A 1WBVA 2BFXA 4FK3A 4FKLA 1TKIA 3F3TA 4KAOA 4W4YA 3UQCA 3RHXA 2OSCA 3TKIA 3Q3BA 4I22A 2CLQA 4R7HA 3BGZA 4YUQA 3RKBA 2VN9A 1XBBA 2J6MA 2PUNA 2C1BA 3DLZA 4FK6A 1AD5A 2Y4PA 2WOUA 5IDPA 1SVGA 3Q6WA 4KBAA 4CLJA 3ALOA 2CCIA 3NS9A 3VS6A 5IA0A 2BRHA 2PL0A 4IX4A 2IO6A 5FG8A 1IRKA 4U79A 4AGUA 4ARKA 4XRLA 3I6UA 1NW1A 4UMUA 3OTVA 1GJOA 3OT3A 4YHFA 4A4XA 3GB2A 4CRLA 2UZTA 4IVBA 3H4JA 4F9AA 2YCFA 3BYVA 4R8QA 2DS1A 4HVIA 3EQFA 4IFCA 4TYIA 3BLHA 4I5HA 1H24A 4YZNA 4ZSAA 4F9WA 4M67A 1PXOA 3ET7A 4BDGA 2XM8A 2W4OA 2X39A 2XCKA 2XK6A 1XH4A 2J0KA 3MFUA 4RBLA 4L52A 3HA6A 3LMHA 4QTAA 3FDNA 4EC8A 3NLBA 3AC8A 4BCKA 4EZ3A 4GVJA 3BGPA 4UBAA 3FLNC 4L3JA 4BIBA 5BPYA 1DI8A 4U3ZA 1UU9A 3QZGA 3L8XA 3FKOA 3QCQA 4ZLOA 4BR3A 5AM7A 1JSTA 2C30A 5DHJA 3TV6A 4F6UA 1QPDA 3NRMA 3G6HA 5JFXA 3LCOA 3LLAA 2IZRA 5IU2A 4BDIA 1APME 3Q9ZA 3I6WA 1QCFA 3QX4A 3BYOA 5JSMA 3R30A 5DYJA 2A2AA 2WMWA 3SD0A 5EM7A 3HKOA 1LR4A 5E8ZA 4AN2A 2PVHA 2I0YA 5EM8A 5M55A 1HCLA 3GCUA 2VTNA 4ZJJA 4AA5A 3DBFA 3GCQA 4CMOA 4I24A 3D5XA 4TYJA 4W4VA 2BDWA 2VWXA 1FMOE 3KY2A 3RZBA 2WMAA 3DNEA 3VF8A 5HX6A 2VO3A 4FODA 3WF5A 5CQUA 2HIWA 2YCRA 5FTOA 4AA0A 3G15A 3KXNA 4C4JA 4M66A 1GIJA 3AC4A 1UV5A 4HCVA 5CU4A 4YLKA 4C3PA 3EYGA 3BHVA 3QZIA 4ANSA 4EONA 3ZM9A 3RHKA 3QL8A 4DG0E 5D9HA 3SOAA 5EOBA 4OT6A 4IBMA 3K2LA 3I0QA 5T6KA 4QNYA 3HRBA 4JDIA 4ANLA 4RX5A 1UWJA 3O96A 2PK9A 3Q6UA 5FGKA 3UPXA 1H01A 3ZRMA 5IA2A 3EFLA 2PVNA 3E8EA 3EZVA 3FHRA 3UIBA 4E8AA 4L68A 4BGQA 2R3JA 5AA8A 2GQSA 4RPVA 3ROYA 5AAFA 3R7VA 2QD9A 3DU8A 3P7CA 3HDMA 4C33A 4MTAA 3A60A 4RA4A 4LL0A 1PMEA 1ZYJA 4EK4A 3F66A 4JXFA 4RJ4A 5IQIA 4AP7A 5A4QA 1UU8A 2YM4A 4M7IA 4P2KA 3VS2A 4O7RA 4JNWA 3DGKA 4U8ZA 5EOLA 5AAGA 2QG5A 4FZ7A 3IDBA 5CZIA 3KRXA 1MRUA 4YZDA 3CQUA 1ZYLA 3S4QA 4LV8A 2ESMA 5DVRA 4AZWA 5AV0A 5BVWA 5JGAA 3DNDA 4FEVA 1YKRA 1AQ1A 2A27A 3MSSA 3THBA 4BCNA 4GJ2A 2J50A 5BNJA 4O81A 5DIAA 2C68A 4I4FA 4Z55A 4FZDB 4A9RA 5JFWA 1IR3A 2PZPA 3I5NA 4PMPA 1IA9A 1WBOA 4K8AA 4N70A 5HHWA 3U51A 2XEZA 3RM6A 5K0XA 2G01A 2X7FA 3ANRA 1Q24A 4G3GA 1R0EA 5HVJA 3TG1A 2PTKA 4ZEGA 4AU8A 4MH7A 3QTZA 5HLWA 5AP1A 5L8JA 4F99A 4X21A 4QP2A 3MH0A 2XA4A 2B9IA 3HMIA 3NYOA 2WHBA 5CEIA 2OK1A 4D4VA 4WBBB 2ERZE 4ZY6A 2WQBA 4U7ZA 2XJ0A 4YJOA 3V3VA 3GXLA 3U9NA 4C02A 4XMOA 5M4CA 5HE2A 3PTGA 3F2NA 2R3OA 2V7OA 3OBGA 4M0ZA 4RJ3A 3QTQA 1YDSE 2OXYA 5LWMA 3G6GA 3KN5A 4ID7A 1KV1A 2PVYA 4MNEA 4AS0A 4BFMA 4E4MA 3Q9YA 4FTTA 4N6YA 4K0YA 4YJPA 4YC3A 5I9YA 5CZHA 4P4CA 4XV9A 1YHWA 4GU6A 2QCSA 3DFCB 3LJ2A 3VS1A 1YXVA 2XP2A 3DB6A 3EKKA 3RPRA 2Y0AA 3IONA 5M08A 2C5OA 4DFZE 1Q8TA 4C4GA 2WAJA 3BHHA 4LOOA 5DE2A 4X0MA 4KUJA 3TZ8A 4PL3A 2PE1A 1YWVA 2BFYA 4PWNA 4QMPA 2R3HA 3EQCA 3NW5A 4CRSA 2C3KA 2R0UA 4MQ2A 3VHEA 1GZKA 2PMOX 3NPCA 4WG5A 2PMIA 2WKMA 5AV2A 5DR9A 3TNIA 3Q4UA 4FNWA 5CAVA 4XOZA 5GJFA 1ZAOA 3R00A 5CNOA 3KXHA 4OAVB 2W7XA 2Y4IB 4HGSA 2YM8A 5EKNA 4E26A 5E8YA 4FL1A 1XH9A 4BDJA 1BI8A 1OGUA 4M13A 4F7SA 2WEVA 3S2PA 4EZ7A 4YNEA 2NO3A 4F08A 4G6NA 5KKRC 4FT3A 5ETAA 4ZTNA 3C4XA 5A9UA 4TYHB 4K1BA 3FYJX 2CLXA 3MS9A 4CV9A 1WBSA 1VYZA 2J0LA 2H96A 2DYLA 2BKKA 5BX0A 4DBNA 3TZ9A 4A7CA 4UMPA 3BE2A 3SVVA 4FGRA 4X3JA 4DCAA 3BPRA 4DH1A 4QQCA 5CSXA 2QNJA 3IO7A 4UV0A 4BCFA 3D2KA 3FMMA 3RTPA 3BWJA 4QMYA 4O0SA 2G2IA 2BZHB 3NGAA 4FOCA 4MVFA 4EH8A 1XH6A 3EFKA 4GK2A 4OTIA 4CFVA 1ZOGA 4W9XA 4UMRA 5K5NA 2VTMA 3FQSA 2WQMA 2XJ2A 3VVHA 5AR4A 3UJGA 4C3RA 4XYFA 4BTFA 3QA8A 4DTKA 5C8NA 3B8QA 5HGIA 2V62A 5JGDA 4X7QA 2BAKA 2J51A 4FG8A 5CWZA 5CASA 3SRVB 3VO3A 4ZAUA 3OEFX 3GCPA 3MN3A 3R8VA 2HW7A 4II5A 4W4XA 4YTIA 3MPAA 3JYAA 2VTAA 4UALA 5HVKA 3LFDA 4O84A 1JSUA 2C0TA 4NFNA 4JQ7A 4UYNA 1KE6A 4TW9A 4LMUA 4E1ZA 3FI3A 3RWPA 4FE2A 4NKSA 4IJ9A 5J95A 4EOLA 4IM2A 4X6QC 4IDTA 3ZBFA 4O1OA 3E64A 1U46A 3BYSA 4LYNA 4JG6A 4XP0A 2WNTA 2XCHA 1KUTA 3D15A 3GT8A 1M2RA 3MJ2A 3PPZA 4GW8A 5TO8A 3TKHA 3QUEA 4K2RA 3BELA 3FC1X 3ZFMA 4KBCA 4ZTQA 4CKRA 1B39A 5IF1A 4XCUA 4M69A 2JC6A 2QODA 4C0TA 4FSUA 3PLAE 4K9YA 2H34A 3CJGA 3HMMA 3Q2JA 4ACDA 1GNGA 4M8TA 3UE4A 1J91A 1UU3A 3DXQA 2O0UA 4IX6A 3H9FA 4RVMA 2ZOQA 5DFPA 3C1XA 5ANOA 4IX3A 4TWOA 1UKHA 2YM6A 3VUKA 4B6LA 2YM5A 4B9DA 4BCGA 1CKIA 4E4LA 4FSRA 4FTLA 3W2PA 5IA4A 4Z9LA 4AFEA 1BL6A 3ZHPC 3S1HA 1PXLA 5E8XA 5HD7A 4ZLZA 2FSMX 4FSTA 4EH4A 4R3PA 5I9XA 2PZ5A 4UXQA 1ZRZA 3RPSA 3AC5A 5HTCA 4M3QA 2BHEA 4EQUA 2YJRA 3T3UA 4EOQA 1TQIA 4YTHA 4D0XA 3Q04A 3R21A 2JDSA 4GUEA 4QMZA 3UO5A 2JKQA 1CM8A 4H1MA 4KKHA 4YJTA 5IMXA 4RSSA 3JUHA 5LVPA 4DFNA 3R1QA 4N57A 4CFFA 3OHTA 4EK3A 4HYUA 3U54A 5A54A 4TTHB 2YERA 5A6NA 2X9FA 3BHTA 4FTUA 2BVAA 4MAOA 2J0MB 2VZ6A 3F7ZA 4UXLA 2QOHA 3OT8A 5LMKC 1TVOA 3QRJA 2FYSA 2WMQA 3HAMA 2RGPA 4QRCA 3VUIA 2G15A 2PMNX 3TJCA 3PXKA 4HVGA 4E6DA 2VO7A 5ICPA 5BVDA 4RVLA 5EQYA 3R0TA 4RIWA 3ORKA 5CEPA 4ZMEA 5H2UA 5IDNA 5E8WA 4IB1A 3VUMA 3BU6A 1M2QA 1BYGA 3D7TA 3NAXA 3E62A 3QQLA 4MK0A 3C4FA 3RPOA 1G8SA 3GNIB 4BCIA 5K5XA 2JIIA 4U0IA 4X2KA 4D9UA 1Y6AA 2J4ZA 5EDQA 3KC3A 3P5KA 4MWHA 5CANA 5H9BA 3T8OA 3FZOA 4QMNA 2CCHA 3C13A 4XG3A 4C35A 1JBPE 4QTDA 5B7VA 5DGZA 3FZSA 3LE6A 3E88A 3NYXA 3R71A 5CVGA 2J7TA 4I94A 3WF7A 3FPQA 4QP8A 3TDWA 3VBYA 2OI4X 4J8MA 4MD9E 5AX3A 1H27A 1XH5A 2UZWE 4W4WA 1OVEA 5K4IA 3HRFA 3VBTA 2PVLA 5DNRA 4BCJA 4QPMA 4AWIA 3DJ6A 3ZC5A 2YDJA 4X2GA 4FKOA 1T46A 1JVPP 5CSVA 1CTPE 2WTKC 3NUYA 4YURA 4PPBA 4BBEA 4ERWA 3K3JA 3WF8A 3NYNA 4NTTA 3HL7A 3UQGA 5EI2A 4YBJA 4QP7A 4YJRA 3EB0A 3HMNA 4X3FC 4H3BA 3TT0A 2VRXA 2HZIA 3JY9A 4M84A 2ZYBA 3NZ0A 3V5JA 5JMSA 3TUCA 4JLCA 2UW7A 3PIXA 4WKQA 5CEQA 4CFXA 4EH3A 2ITUA 3GU7A 1RJBA 4CSVA 3F88A 3NAYA 4IQ6A 5AAEA 4FNYA 4EJ7A 4JBVA 2R9SA 2XKFA 2CNVA 4O0XA 4MF0A 4G34A 3IK3A 1P4OA 2XRUA 4D2TA 1MQBA 4TL0A 5I9VA 4FKUA 2QHNA 1FOTA 2XIKA 5ANIA 1M7NA 2WMTA 4ACGA 5HE0A 3BIZA 2HOGA 3CD3A 2FVDA 4J1RA 3ORNA 4BZOA 4F1MA 2XK7A 5J79A 3PG1A 3FKNA 4FG9A 4O0RA 5AR7A 2JKKA 3F5UA 4JJRA 4I1ZA 4MD7E 4BBFA 1J7LA 5DH3A 2X81A 3DV3A 4H36A 3QA0A 3PXQA 3FMDA 4AOTA 4RVKA 4YPSA 3ANQA 3ITZA 2QOQA 5CTPA 2WZJA 5F95A 1ZYDA 3KXZA 3VS0A 3E7OA 3F5GA 4RMZA 4W8DA 5IMEA 3N4UA 4Y83A 2C6DA 4WHZA 4O0YA 3MY1A 4FZFB 4S32A 5HLPA 4C38A 1J7UA 3C9WA 1QMZA 1SVHA 3OBJA 1P2AA 4MYGA 1OIRA 2BDFA 4QYGA 1XBAA 3NX8A 5L6PA 3TUDA 5CSHA 3TIYA 3FLSA 3QLGA 5IG1A 4C62A 2WGJA 3GC8A 3H0YA 3CC6A 2J5EA 1JKSA 3TKUA 3KMMA 3AMBA 5CU6A 4O38A 3RVGA 5HNIX 4ITIA 5ETIA 2P33A 3EQDA 4O7TA 2RFNA 3UNJA 2W1GA 3W10A 2P2IA 1WBTA 3Q9XA 4WO5A 2OJGA 3D14A 4FBXA 4IWPA 1A9UA 3CD8A 2JEDA 2W1FA 5HCXA 4B4LA 4NT4A 4EQMA 4FTCA 1LP4A 2R7IA 4S31A 5CYIA 1OBGA 4GKIA 2XVDA 2WTJA 5HG8A 4ZK5A 5CEOA 3LFNA 3WBLA 2ZAZA 1FPUA 2WTKB 5HIDA 3R1YA 4NL0A 3KK8A 4L3PA 3RBWA 5DPVA 4RIXB 4Q5HA 5AUVA 4D4RA 4MNFA 5BVOA 4PNKA 4BDCA 4KS7A 3AXWA 3I60A 2R0IA 4FKTA 4X3FB 2P2HA 2YM7A 5E91A 4OBPA 4NCTC 4UN0C 3QUDA 3R7GA 3AGLA 4J7BA 1E9HA 1YOMA 3PE1A 4TRLA 1GAGA 1NVQA 3R7OA 3CQWA 1WZYA 3EN4A 2BAJA 3TNWA 1U5RA 2HCKA 3O17A 3IS5A 5LVOA 2RFDA 4CZUA 5LMBA 3QRKA 1ZYSA 4JRNA 3I7CA 5HO8A 3R7UA 3NUXA 3FI8A 4KIQA 3OOMA 1Z9XA 1KV2A 2IZSA 2UVYA 3ZRKA 4I92A 4DFLA 1YW2A 1FGIA 2X2MA 2JFLA 2BZKB 4L53A 1PXKA 5C9CA 2Z7QA 2BTSA 2GS6A 3VBQA 3DKFA 3R8MA 4BTJA 3VN9A 2G9XA 5LARA 3BHYA 3JVRA 3ZMMA 2Z8CA 4IX5A 1OUYA 2R3QA 4Y95A 5CF6A 4FV3A 4CCBA 3S0OA 3D83A 3ZC6A 2CNUA 4AX8A 2VTQA 2CGWA 3F5XA 1GIHA 1JKKA 2W9FB 3HMPA 5FEDA 5HNBA 5IH4A 2W1IA 3ZYAA 4EI4A 4U44A 4YSMA 3OROA 3Q60A 1PMVA 2WIPA 4HNFA 3LXLA 4YSJA 1LEZA 5C8MA 2OH0E 3UBDA 3W2QA 4R77A 4BI1A 4PDOA 3PP0A 4PL5A 1DAYA 4OTDA 3D5VA 2DUVA 2E9VA 2YIXA 4DLJA 4WG4A 2F2CB 2YLEA 2UZUE 3I81A 3QYWA 4YLJA 4DG2E 2C0IA 4DH8A 4N6ZA 1W98A 4L45A 2CGXA 4R3CA 1F5QA 3DAEA 5FEEA 1P4FA 4EQCA 4RFMA 3D5WA 1UNLA 2C0OA 2UW8A 4KIKA 4QYYA 5HICA 2B55A 1Q62A 2W1HA 2XK8A 3OW3A 3R28A 5CLPA 1UVRA 5ACBC 3V5QA 5E4HA 3F3UA 2XF0A 2ZVAA 5CVHA 2W5BA 2YHVA 3M1SA 4LG4A 2JFMA 3FE3A 3VQUA 4AZSA 1ND4A 3DB8A 2QU6A 4YP8A 3U55A 1JSVA 2Y8OA 2OBJA 4F9YA 1REKA 3VS4A 2B52A 3FEGA 3ZH8A 3BV2A 2JBOA 5JKGA 4QMWA 3JVSA 4WRSA 5E1SA 2GHGA 2UW6A 5IQDA 1Q3WA 3SX9A 4IJPA 3FMNA 5AR3A 1ZWSA 3ZUTA 3O23A 3II5A 4XV2A 2HY81 3LXPA 2REIA 4GV1A 4RFYA 1Q8UA 2O3PA 4KKGA 3NNUA 4TNDA 2IW9A 3R9OA 3LCTA 3NW7A 5IEVA 3HVCA 4PPCA 5EYDA 4OTQA 3ZO3A 4J8NA 5LCJA 3NR9A 5IQCA 3QZFA 3LQ8A 4LUEA 5AADA 3Q5ZA 4GJ3A 5KO1A 2XUUA 3DZOA 1OL2A 2VD5A 5KBRA 3QXOA 5DBXA 2ITZA 3VNTA 3ETAA 4O0VA 2C4GA 3NYVA 3QUPA 1H07A 3S00A 4TN6A 2I0HA 3GC9A 4E6AA 3AC3A 3P86A 3G9LX 4YNOA 3KRRA 2W06A 4U9AA 3NVMB 4HZRA 2C6TA 2VV9A 2GPHA 3OXZA 3RINA 2O64A 2PZRA 3KRWA 4R1YA 3SOCA 2PVRA 3RZFA 3C4EA 4GYGA 2O8YA 2RF9A 1JNKA 2X2KA 4ZTRA 4F09A 3TI1A 1SZMA 4DGLC 2AUHA 4LV5A 5H3QA 5BMMA 3EYHA 4GIIA 4J52A 4XBRA 5F4NA 4BCMA 5FRIA 2OJFE 3GOKA 5L2IA 3QD0A 3A7HA 5HNGA 4QTEA 1OL5A 3L9NA 2EB3A 2JLDA 4AE9A 4G5JA 2VWYA 3FKLA 3FMLA 4OTRA 4RIOA 3ENMA 2VWZA 3IW6A 4BTMA 2C69A 4MBJA 5JFVA 4FICA 4WSQA 3QQHA 4GK3A 3F3ZA 4IVAA 4AZVA 4JBQA 4YBKA 2B1PA 2A19B 5E1EA 4U41A 2QI8A 4LRJA 5DI1A 4D2PA 3ELJA 3OWJA 3GC7A 4NH1A 1PJKA 2GHMA 4WRGA 4MQ1A 2Z7SA 3C5UA 5JEBA 2XNBA 1IEPA 5EI6A 3FXWA 4APCA 3Q2MA 3KA0A 3V01A 4WUNA 5AP5A 3MTFA 3JS2A 2J0IA 3QTSA 2CMWA 3ZONA 2ITVA 3GGFA 4RLLA 2WXVA 4RG0A 3S3IA 4ZZMA 2VTOA 1Y91A 3TV7A 4BHNA 3ENHA 2R4BA 2UW4A 4BDKA 5CF5A 1U4DA 4O21A 4GS6A 1XQZA 4HYHA 4FUYA 4PV0A 5AV1A 4EOIA 3OCBA 5J9YA 3ZTXA 3HA8A 4XLIA 3V6SA 1U5QA 2BRMA 2B9FA 1Q3DA 2W1EA 4ZSJA 3LHJA 3BRBA 4ZXTA 2BKZA 3I5ZA 5JK3A 4EUTA 4ANMA 3KFAA 5M56A 1OM1A 4YR8A 4PP7A 4DINA 2F9GA 3OW4A 3A7FA 4JX7A 2GNJA 3NUUA 2CN5A 4U45A 3ATTA 3GEQA 3C0HA 3COIA 5EQEA 4IE9A 3UPZA 3RJCA 3KULA 5DT4A 3TL8A 3E8NA 1O6KA 5K3YA 3VBWA 1OBDA 5GZAA 4IM0A 5DWRA 5KMIA 3Q4TA 4JBOA 1PY5A 2ITOA 2YEXA 2XIRA 3MH2A 2F57A 4RWIA 5J7HA 3FXZA 4IB0A 2WQNA 4USFA 2WTIA 1YOLA 3PWDA 1J3HA 4EOKA 3C51A 3MY5A 2GNGA 4RQVA 4UZHA 2WEIA 4O22A 4JI9A 3Q4ZA 2P55A 5EYMA 4QP4A 3F3WA 2XBAA 4FEUA 4BRXA 4GK4A 4YHTA 4MEDA 2IVVA 5FTGA 4EYMA 5EDPA 2UVZA 4O82A 4WD5A 1WFCA 3LVPA 3TEIA 1OECA 4PTGA 4FIGA 3QFVA 4QQ5A 3IECA 4WIHA 4EOMA 1OPJA 4RX7A 4L43A 3D5UA 3LFCA 3SXSA 3E87A 4BVUA 5IUGA 2W5AA 4UEUA 4E20A 4JG7A 3RALA 2CJMA 4PY1A 2QLQA 4QD6A 4D55A 2CKOA 1S9IA 3FLZA 3H9OA 4EUUA 3U6HA 2YWVA 3TUBA 1FVRA 4U43A 3CSVA 3KREA 3FUPA 3BQCA 2G2HA 2VX1A 2XK4A 5KMJA 3QWKA 4L3LA 4EHEA 4TWCA 4DEEA 3R9NA 3EN9A 3UODA 3C5IA 3VW6A 2BTRA 4E6CA 3O8PA 3PSDA 4FV0A 3TIZA 5M57A 1OB3A 1XO2B 1DS5A 1JKTA 4JS8A 2BIYA 2PVFA 4IANA 2YITA 2F2UA 2XM9A 5BMSA 5L8KA 1BL7A 3IKAA 5CQWA 4RZVA 2R3MA 3TTJA 3HV4A 4M68A 4K11A 3QBNA 2YWPA 3UDBA 3IW7A 3P7AA 4J96A 4BICA 3UYSA 5DOSA 1R78A 2W1CA 3MFRA 3PLSA 3Q5IA 1XH8A 4H39A 3ZXZA 2ACXA 1YXXA 2OGVA 2VTLA 4GCJA 1IASA 5CXHA 2XKEA 1JWHA 3PDTA 1ZY5A 3I1AA 2BAQA 4BDHA 5LVMA 2WTDA 1WCCA 2ZMCA 2R3LA 4JQEA 4L44A 4L7FA 2YACA 3IQ7A 4IC7A 1KOBA 3AD6A 3BU3A 4JAIA 3RK9A 4EKLA 5M07A 3GCVA 3DK6A 3ZUVA 4K33A 4S2ZA 3LCKA 4AQCA 5TE0A 5FWKK 3A99A 4RJ7A 4PTCA 4RIYA 4CFWA 4FIEA 4XG7A 1MRYA 3KGAA 4HW7A 5G6VA 2I0EA 4ZJIA 2OICA 5CY3A 4ZOGA 5EW9A 5L2QA 3OXIA 4LGDA 5I3OA 3G90X 4C4HA 4CTCA 2O63A 3CKWA 1HCKA 3KF7A 4FGBA 4HYIA 1JAMA 2XK3A 4M15A 4F0FA 4QTCA 1J7IA 4O7VA 3BX5A 3EH9A 2Y9QA 4FKWA 3TNHA 3KL8A 3OC1A 5E8TA 3ZRLA 1W84A 4A07A 3P7BA 4GH2A 2OF2A 2P4IA 4FTIA 5K0KA 5HU3A 2IZUA 2W4JA 3IW8A 4TT7A 1F0QA 2OXXA 4RJ6A 4I20A 3QALE 4L42A 4OTGA 4ACMA 3L8SA 3RP9A 3CBLA 3EN7A 3QXPA 4PQNA 4M0YA 3SAYA 4AF3A 2X7OA 1I09A 2XIZA 2XB7A 5DEYA 3GUBA 3KQ7A 5FBOA 3R6XA 5CSPA 2O5KA 5FXSA 2Z02A 2UW3A 5FM3A 4P5QA 4CQGA 5CNNA 3W2RA 2XEYA 5M53A 4JR7A 3DBDA 3QGWA 3SXRA 2C5NA 2XH5A 3ORMA 5K9IA 1RW8A 3GU4A 3LM0A 5C26A 4PDPA 5HQ0A 3CP9A 4EC9A 1K9AA 1BUHA 1PMUA 2W0JA 2BROA 3LFQA 3MFSA 4KNBA 4JX3A 2XIYA 4DA5A 2X0GA 4QMMA 1Y8GA 5E8UA 5HESA 3V6RA 3O7LB 1IAJA 3FC2A 3H10A 2PZIA 3UOHA 2JIUA 5A6OA 3PG3A 4P5ZA 3H30A 3PIZA 4DH5A 3SGCA 3K5UA 2WOTA 1FVVA 5I4NA 1SNXA 4EWHA 5D41A 5C4KA 5T3QA 4IZ7A 3DTWA 2W96B 5EW8A 3K5VA 3D7ZA 5BVEA 3RM7A 3ROCA 4CV8A 3CIKA 3ZEWA 5D1JA 2UZEA 3KKVA 4FUXA 4A06A 4QMVA 5BVFA 4O0WA 4R7BA 3BYMA 4XP2A 3TN8A 4O96A 3AG9A 4O7SA 2QOKA 3VAPA 4GFMA 2YABA 4QPSA 5TKDA 3RPYA 4AOJA 1UA2A 1ZOEA 2XNEA 4NM5A 4RJ5A 3HGKA 5AIKA 1MRVA 3FQHA 4DGGA 1JPAA 3FBVA 1SM2A 2NRUA 2HWPA 4HYSA 5AEPA 5GIOE 1Z57A 3C4WA 1G5SA 4IVCA 2AYPA 3WYXA 2GNHA 4PDYA 2QOIA 5FUTA 1OKWA 5TT7A 4CG9A 3BYUA 3PSBA 5GNKA 1BI7A 3GI3A 3SDJA 1H08A 4HGEA 3QQUA 4XRJA 2PY3A 3OP5A 4BWKA 4G17A 3QQGA 5ACKA 2QURA 3NW6A 5DRBA 2E9OA 4AZTA 4W8EA 3EHAA 3WI6A 3P78A 5FEQA 1W0XC 2C3LA 2WMVA 4O6EA 3CY2A 2I40A 1PXNA 3FWQA 3FY0A 4UMTA 1O9UA 1QL6A 3QKKA 4F6SA 1OIUA 2YZAA 4HPUE 3BLRA 3EL8A 3BKBA 4ZIMA 1WVXA 3S95A 4BN1A 5IH6A 2JKMA 4O83A 1YHSA 3TACA 3AMYA 3FXXA 4I6BA 4FKIA 5EM5A 2BRNA 4NUSA 5D7AA 5T68A 2ONLC 5AM6A 3RAIA 5HG9A 2FA2A 3VUGA 1PXMA 2ZM3A 4NW6A 4ASZA 1S9JA 3AD5A 3P23A 2WB8A 4LRMA 4BZDA 4XEYA 2Z7RA 3KVXA 2C6OA 3VRYA 3WE4A 3WF9A 4DGNA 4D58A 3CCNA 1XH7A 1Q8WA 3KEXA 4TYHA 2ITWA 3NNXA 3W55A 1PMNA 4FVPA 4U42A 5ETFA 4USEA 4C4EA 4I4EA 3PSCA 5CSWA 3SW7A 1JLUE 4ASXA 5B0XA 4YGAA 5FLFA 4IMYA 2PMLX 3W16A 4B8MA 5AP7A 3RAWA 5FP5A 5KUPA 1Y57A 1MUOA 2UUEA 1URCA 3NVKI 1ZOHA 2VWVA 4GG7A 1V0PA 3FLWA 2V22A 2VGOA 3QRIA 4F7NA 3PUPA 4DC2A 3W18A 3DXNA 4J98A 3ZEPA 4GFGA 3QHWA 4C8BA 3DPKA 5LQFA 3PP1A 2DQ7X 2GS7A 3UNZA 4MWIA 5KKRB 3ZSIA 4BCOA 4IZYA 4BDDA 4FEXA 4IM3A 3KXXA 4FVQA 4BC6A 2BPMA 4LUDA 4FT9A 4KABA 2GU8A 4IACA 3SHEA 4FIHA 2IWIA 1TQMA 4QYEA 2OG8A 1WMKA 3W8LA 3ZDUA 3ZOSA 2J0JA 4RZWA 2XKCA 1KOAA 2KTYA 4CMTA 4WSYA 4NEUA 2X6DA 3DBQA 2CPKE 2YCQA 3FMJA 4O0UA 3CKXA 4GMYA 3LW0A 3H0ZA 4O1PA 3UMWA 2IN6A 5AJQA 3FSFA 3NIEA 3I4BA 4G3EA 1QPEA 3D4QA 4W9WA 4NYEA 4XHKB 3KMUA 4D4SA 2ITPA 3C7QA 4FTJA 5J9LA 1YHVA 4QQTA 3L9LA 2FUMA 1NVSA 1NXKA 5CS6A 5A14A 5AP3A 4FIFA 4RRVA 3PA5A 1VR2A 4D4YA 3UZRA 5IA5A 4YJUA 3NMUF 3QCYA 1STCE 3GOPA 2B4SB 3R9RA 3DK3A 3F2RA 2JD5A 3R73A 5BVKA 5CI6A 2A0CX 1X8BA 1UNGA 4YTFA 4G2FA 3GQIA 5C27A 5JZNA 3D0EA 4HZSA 4BZNA 2GSFA 2W05A 2GMXA 3FI2A 3IOPA 5CU2A 3OF0A 3ZZEA 4FV4A 4XG8A 1B6CB 2PE2A 3NWWA 5EM6A 3KXMA 4C58A 4CFUA 1T45A 1LUFA 4XH6A 1R3CA 4B7TA 3W32A 4FEQA 3V5PA 4AGDA 4E3CA 3F6XA 4AW2A 1RQQA 4TNBA 4D5KA 2UW5A 4FV2A 4MX9A 3RNYA 5CU0A 1ERKA 2RFEA 4FYNA 1VEBA 3NUAA 4ENYA 3EQHA 3PA4A 4IAKA 3PJ3A 4YC6A 3CEKA 5K4JA 2GQRA 3WZDA 1UU7A 2VTRA 4XJ0A 2PUIA 5FP6A 3CY3A 5IQBA 1Z5MA 3GVUA 4Q9ZA 3ERKA 3E92A 2VTJA 2WMRA 2X7GA 3NCGA 4ZZOA 4PDSA 1IAHA 4FC0A 3UIUA 5DN3A 4D1XA 3WIGA 3F69A 1UWHA 3P79A 5EQPA 3LQ3A 3KN6A 3MPMA 3WIKA 4QP6A 4V04A 2AC3A 2ITQA 3CGOA 5AUZA 3RGFA 4AGWA 3CPCA 2P0CA 5HCZA 4D9TA 3QWJA 4DEAA 2OXDA 1XHAA 3IDPA 1YDTE 3FAAA 2FSOX 2WELA 3R2BA 3MESA 4FOBA 2F7EE 4NK9A 5J7BA 2VO0A 1JOWB 5JQ8A 4ASDA 3NDMA 2W1DA 4OBOA 3FJQE 3Q4CA 4Z7HA 4UWCA 4F70A 4ANNA 4F9CA 4MCVA 4ZS4A 2WIHA 4ERKA 3ORLA 2C5YA 2J9MA 2JIVA 2RSVA 5ANEA 2OJIA 2X8IA 3A62A 2ZM4A 5KZIA 2BRGA 3MVLA 4EBVA 4IVDA 3ZLXA 4EOPA 2WQOA 2BZJA 4IC8A 2EXEA 5ETCA 3OWLA 1XJDA 4L8MA 4O27B 4DEGA 2RG6A 2C6IA 1OKZA 3VWAA 3G0EA 3OOGA 3HEGA 4XV3A 1PXJA 5IEXA 4LI5A 4I21A 3PXYA 5AIRA 3UP2A 3WZKA 2RG5A 4CMUA 1H26A 5IQHA 2R3IA 4U80A 5AR5A 2PULA 4DHFA 4C2VA 1REJA 2LAVA 3R02A 1KWPA 1FMKA 3RMFA 3F9NA 4IAZA 3PVGA 3H9RA 4C4IA 1YRPA 4WNKA 4X2FA 4AGCA 2GTNA 5LOHA 2P3GX 3TZMA 3PFQA 4BIDA 3NCZA 2C5VA 4H58A 3UC3A 2OO8X 3OUKA 4NWMA 1VZOA 4G31A 4HGLA 4I0SA 4OBQA 3A61A 3VS7A 5C03A 1PKDA 4QYHA 5DR2A 2QOFA 4AN3A 5A46A 3DOGA 2I7QA 3NUNA 3Q96A 4Q9SA 2QR8A 2XNPA 3FPMA 4AZEA 3VQHA 1WBNA 1FINA 2ITYA 5BYYA 3VJNA 5IA3A 1J1CA 2UZVA 1KE8A 4O7WA 5ANDA 3FQEA 5CF8A 5HVYA 3AOXA 1OPKA 2A4LA 3DK7A 2UZNA 2XJ1A 3DQWA 3VS5A 1YXUA 3G9NA 1PW2A 5IKWA 1PF8A 3V8WA 4ANQA 2XYUA 2R3PA 3MIYA 4MXXA 4KWPA 4C2WA 2FB8A 1W82A 3OTUA 5H8BA 1Q61A 4M14A 4RX9A 5HEZA 3VC4A 3NNWA 5JQ5A 4PMMA 3IGOA 2H9VA 4L00A 4O91A 2EB2A 2RKUA 3WE8A 3W2OA 3EL7A 3DS6A 5HG7A 2CKQA 4U81A 3OY3A 3MA3A 3LJ0A 3MH1A 5AFVA 2YZLA 3LCSA 3MFTA 3TV4A 4FZ6A 3CJFA 1IA8A 3SV0A 3Q52A 3Q53A 4RC4A 3FMHA 2BALA 2PVKA 4EOSA 3O71A 4F1TA 2CNQA 2C6EA 3EFWA 4Q2AA 4FI1A 1U59A 2CKEA 4K18A 3MB7A 3SA0A 3ACKA 4ALWA 3F82A 4ITJA 4V0GB 4F6WA 3ZSGA 2OJ9A 4KIKB 3HV3A 2VUWA 3R7IA 3VS3A 1ZMWA 3MDYA 5D10A 2EU9A 4J97A 4DYMA 3ALNA 5EDRA 1TQPA 4UWBA 4F7LA 2HELA 2OWBA 2Q0BA 2XBJA 4BGGA 4Y5QA 4C34A 1ZARA 5KBQA 1BX6A 4ZTSA 5A4CA 3QZHA 2YIWA 4DFUA 4DEIA 3R1NA 3RWQA 3DDQA 3OFMA 2B9JA 2C6KA 2H8HA 1UNHA 3HNGA 2JBPA 4ZZNA 3UOKA 5IA1A 4EH9A 3QTUA 4FV7A 2GFCA 1RE8A 4RIXA 3ZDIA 4FKGA 2BHHA 5EW3A 2WPAA 4X3FA 4GSBA 2VWUA 1H00A 2UZLA 5GJGA 3A8WA 4PP9A 5HE1A 4NSTA 4DLIA 4EH2A 2SRCA 2CGUA 3UIMA 3W33A 5CX9A 2F49A 5CT7A 2E9NA 3KRJA 3ORTA 4CT1A 3BQRA 4BKZA 5KMLA 1GZNA 2XS0A 3JY0A 3LPBA 4WNOA 5I9UA 3R8LA 2OW3A 2I0VA 5E8SA 3SQQA
chains in the Genus database with same CATH superfamily
4YMJA 5EHOA 3QRTA 5FDXA 1L8TA 4HGTA 4QMLA 3VF9A 5AA9A 2Q0NA 5AUWA 3G33A 4E5BA 3TMOA 5HOAA 2NRYA 2GHLA 3QKLA 5CAUA 3UQFA 2VX3A 1OL7A 5GHVA 3ZUUA 5JZJA 3R1SA 5FTQA 5CAQA 4EK5A 4RVTA 4EHVA 3LOKA 4JAJA 5AUUA 5BUIA 2QG7A 1OKYA 3TYKA 4IEBA 4Y72A 3UVRA 1OL6A 1WVWA 2PSQA 4AFJA 3EQRA 5FM2A 2ZMDA 2R64A 2AC5A 4ZP5A 5HBEA 2PPQA 2XIXA 5ANJA 3VULA 4Y5HA 3IW4A 4OW8A 4ZTLA 5HIEA 3COMA 5C1QB 3ZS5A 3M11A 4NIFA 3PWYA 1W83A 4FTAA 4TXCA 4UYAA 5CENA 4EBWA 3PVBA 4QP9A 2QOCA 3OS3A 2X4FA 5I3RA 3KMWA 3RPVA 2RFSA 4C61A 5AP4A 2OZAB 4MXZA 2UVXA 1G8AA 4CYIA 5IUHA 5FXQA 2FGIA 2YM3A 4D0WA 2ZFYA 3LIJA 4FV6A 3E3BX 4EK8A 2QKRA 1ZMUA 3WOWA 2VTHA 2ZV9A 3U8WA 4Y73A 5KMNA 3ZM4A 4R6VA 3CE3A 3ZO1A 3SG9A 1LEWA 4KIOA 5LXMA 2IVTA 3BU5A 4NFMA 5AV3A 4AXAA 2IG7A 2YDKA 3SKCA 4FNXA 3DJ5A 3W1FA 4IIRA 3KCFA 3RAKA 3HUBA 3EOCA 4S30A 4G1WA 3EJ1A 4FZAB 4RX8A 3VUHA 4CNHA 5AUXA 1CKJA 3EQPA 3GFEA 3T3VA 3VBVA 2PU8A 3DAKA 2Z60A 5HX8A 3ATSA 3MW1A 3W2CA 3GU5A 3M42A 5CI7A 2GCDA 5IISA 5CAOA 2VTTA 3CGFA 5EYKA 2HW6A 3KF4A 4MBIA 1U54A 3PRIA 4CG8A 4G9RA 4GEOA 5B2LA 4EYJA 4NCTA 4AACA 5BQ0A 2B9HA 4XBUA 4OT5A 1A06A 3ZFYA 5DMZA 5LMAA 5M44A 3VW8A 3EWHA 1ZY4A 3FYKX 3PE2A 3N9XA 4PPAA 3IGGA 2ETRA 4E6QA 5BV3A 4ZS0A 4ORKA 4EOOA 1ZLTA 3DDPA 3LLTA 2W99B 4ALVA 1J1BA 4B8LA 3RI1A 4YU2A 4ZJVA 1G8KA 2IJMA 3PJ2A 4CT2A 4PMSA 5M06A 2UW0A 4C57A 2QHMA 2YLFA 1I44A 4ITHA 2XALA 4MHAA 2YCSA 4O4DA 4S34A 5FBNC 5F20A 4FA2A 3UDSA 2RIOA 2PE0A 4X2NA 5AP6A 2GS2A 1KSWA 2YISA 3LAUA 3NEWA 2X8EA 3PJ8A 4FYOA 5M4FA 3RAHA 2ETMA 2QONA 3KCKA 3KB7A 3POZA 2QOLA 3G0FA 4GG5A 3QYZA 4TYGA 4QMOA 5L6WL 3RK5A 3FMKA 3T9TA 3ZSHA 4FSYA 3CTJA 4FTQA 3FLQA 2HXLA 4P90A 1O6YA 4FSWA 3PVWA 3ACJA 4AT4A 1L3RE 1YI4A 1PXPA 4FX3A 1Q5KA 2WMSA 4D2RA 3A7JA 3VJOA 3WF6A 4DT9A 1OMWA 5L2WA 1XKKA 4H3QA 1SNUA 3QTWA 5J87A 2CDZA 1RDQE 4FV1A 3QF9A 4MXCA 2X1NA 2CSNA 3DFAA 3C0IA 3MVMA 4FRFA 4CD0A 4EH6A 4YO6A 5CAPA 3L1SA 4KS8A 1M17A 2WMBA 3UO4A 3LZBA 1NY3A 4FKQA 4NTSA 3LQ5A 4RJ8A 4IFGA 4JT3A 4BDBA 2OKRA 4TPTA 5JRSA 4P7EA 2F4JA 4ZSEA 3KVWA 4DITA 5CXZA 3DKGA 5HO6A 3PRFA 3L8VA 5HORA 5HE3A 1CDKA 4D5HA 4Z16A 5BUJA 2OFVA 5EFQA 5IQAA 5DLSA 1YQJA 5I0BA 3QQKA 4I6FA 1BLXA 3MYGA 4KIPA 4H05A 5A3XA 2W5HA 3N51A 2WFYA 3KIOC 2E9UA 3QTIA 3T9IA 1ZMVA 3KU2A 1CKPA 3AMAA 4XX9A 5A4TA 2OLCA 3G2FA 1CSNA 3ORPA 2ITTA 4NM0A 2VTSA 5HG5A 4ZSGA 4QQJA 4HCTA 4OTFA 3QRUA 4LDTA 4YZCA 2PVMA 2VGPA 3BE9A 3ZZWA 4J53A 4R3RA 3HV7A 3CTHA 4FV5A 3UMXA 3ZXTA 4DFYA 4EZ5A 4R7IA 4IB3A 2VNYA 4BY9E 4QMTA 4A9SA 4DF3A 2HZNA 4EHGA 3B2WA 3DXPA 2O2UA 4AOIA 1NVRA 2BRBA 4H1JA 3R8PA 1GZ8A 3ZFXA 4OUCA 5JT2A 3LMGA 5CU3A 3A7GA 4I5PA 1OPLA 1H25A 2UZDA 3NNVA 4DFBA 4FSQA 3OCGA 4BF2A 5LVNA 3F61A 5L2SA 3O50A 2W9ZB 5ANKA 4HJOA 4HVDA 3U6IA 3DBCA 4AW0A 4LGGA 5AR2A 4AE6A 4BJJB 4RIYB 2YN8A 5F9EA 4XG4A 3E93A 1V0OA 2CGVA 3BI6A 3LXKA 4WOVA 3DAJA 3AQVA 3DY7A 2QOBA 3F3VA 3R7EA 3MWUA 4BCQA 2R2PA 4EKKA 4PF4A 3DCVA 4NJ3A 4JDJA 4QYFA 3WYYA 4BCPA 2EXCX 4QTBA 4EH7A 4FSMA 4LOQA 4Q5EA 4UMQA 5TR6A 5KNJA 4TWNA 3V5TA 1YXTA 5AUYA 4AT3A 2C6LA 2UZOA 5E90A 4FT7A 4TZRA 5ITAA 4AXEA 3D2IA 2B0QA 4LQMA 2GNLA 4DT8A 3PY0A 4MNEB 3LFBA 1ZXEA 4CEGA 4ZTMA 4JDHA 4XP3A 2WQEA 2Y4IC 4CFNA 4BL1A 2XNGA 4IDVA 3UG2A 3I79A 2W17A 3WARA 2RL5A 4AW5A 4FTOA 5JFSA 2HY0A 1DM2A 3E8CA 2GNIA 3QTRA 4GFOA 5HO7A 4B0GA 3QC9A 3RCJA 3R9DA 4IXPA 4NKAA 5I5ZA 2QC6A 4BGHA 3UZTA 3OVVA 5JH6A 4ZY5A 4CKJA 1WVYA 4K77A 5J9ZA 2BILB 1YDRE 2WTCA 3QQJA 4FT5A 5HLNA 5E9EA 1PKGA 4OTPA 3MY0A 3MPTA 3C4CA 2EXMA 2WMXA 2BUJA 3D9VA 3FL5A 3GFWA 4GT4A 2OIBA 4A9UA 3IG7A 4FTRA 4F1OA 1KE9A 3GP0A 4CXAA 1FVTA 4ZSLA 4KB8A 3LJ1A 4UY9A 1MQ4A 2OH4A 3IOKA 5KHXA 4R5YA 4YPDA 3E3PA 4Y85A 5E92A 1PXIA 3W0PA 3I0OA 5L3AA 1UKIA 3HX4A 2UW9A 1K3AA 4DGOA 5GIPE 2Y6MA 4AG8A 1G3NA 3E7VA 5DRDA 4YO4A 1DAWA 3GQLA 2OIQA 2PUUA 1VYWA 3SG8A 3FZTA 1GZOA 3IPHA 3ZO2A 2R3KA 3PXRA 4IWQA 2V5QA 3FMEA 1H4LA 4FT0A 4PX6A 3OXTA 5LVLA 3PY1A 5AX9A 4JRVA 3A4PA 4Y8DA 4YJVA 5DR6A 3ID6C 1EH4A 4NW5A 4IADA 3UIXA 1H1RA 3QD3A 4FF8A 4HNIA 4XG9A 3A8XA 3MBLA 5LWNA 4CGAA 4BWXA 1FQ1B 2GQGA 2X0PA 3U4WA 3KK9A 3QHRA 3QTXA 4I6HA 4RC2A 2F7XE 4RQKA 4CTBA 4JG8A 4ZLYA 4DEHA 5M51A 4F4PA 2YJSA 2OIDA 4QNAA 4IH8A 2YIRA 3NUPA 3TZ7A 4CQEA 4FKJA 3H3CA 3BL7A 1M14A 4OTHA 4BHZA 4CFMA 4DEDA 2O65A 4EK6A 3R2YA 2BIKB 4YJQA 1H1QA 1ZZLA 4D2WA 2HWOA 4FV8A 2G1TA 5EYCA 3A7IA 2R3FA 2ZJWA 3FZRA 1R39A 3LCDA 4LMNA 4YZMA 3V04A 3OG7A 3UVPA 4AUAA 3RNIA 1XBCA 3KXGA 4DH7A 5KMMA 3RK7A 2OFUA 3VRZA 4JVGA 5L6OA 2E9PA 1OI9A 3AD4A 3HV5A 3HMOA 3V51A 2XRWA 4WT6A 2B54A 3ZCLA 4N4SA 4D2VA 2XKDA 3O2MA 4UWYA 5KMKA 2E2BA 3G5DA 4FR4A 2WTWA 4G6OA 4M69B 3EZRA 4MD8E 4DH3A 2VTPA 5AUTA 2XK9A 4BWPA 1OIQA 2JGZA 2NP8A 2Z2WA 2VAGA 3PZEA 2VWBA 5AR8A 3PIYA 4L46A 3TDVA 1Y6BA 5M4UA 2YDIA 5C4LA 4RLKA 1FBNA 5CF4A 2C3JA 5DEWA 5EI8A 2PUPA 4G16A 4U97A 5BYLA 4TWPA 2R3GA 5CEMA 4G3FA 4YLLA 2I1MA 5JRQA 3VUDA 3ZLSA 5D12A 3AGMA 3GU8A 4FIJA 3PY3A 4IAAA 2WTVA 3R04A 5B2MA 3DT1A 3OUNB 5J8IA 3BCEA 3SLSA 4C3FA 4FSNA 4HCUA 1YWNA 4I5MA 4EWQA 3ORXA 3F7WA 2ITXA 3N4TA 2FSLX 5J1VA 2ZM1A 3DBEA 5HTIA 2WD1A 3W8QA 3AC2A 1Y8YA 1PHKA 5EK7A 2HZ4A 3TCPA 1H8FA 3PJCA 1BKXA 4JQ8A 4X2JA 3UGCA 3HLLA 2VO6A 3ZU7A 5EHLA 4BYJA 4WNMA 4KRDA 5GZ9A 5HBJA 2IVSA 3L9MA 3N4VA 2XYNA 4XLVA 4F64A 5DA3A 3PYYA 4AN9A 3CLYA 5CEKA 2JDRA 4FVRA 4QMUA 3G51A 2EUFB 3DLSA 5I9ZA 3CPBA 4PRJA 2CHLA 2JAMA 4IB5A 4E5WA 2IW6A 4WA9A 2C1AA 4OTWA 3MB6A 4YHJA 3BEAA 4AW1A 5D7VA 1OGYA 3QD4A 4MXOA 4WNPA 1M52A 3SRVA 4ASEA 2ZV8A 3MA6A 1LPUA 2YIYA 4UB7A 4V01A 3VBXA 3EN6A 4JOAA 4BIEA 5KX8A 3K3IA 3U4UA 5TF9A 4JIAA 1JQHA 4RIWB 3UC4A 1VJYA 3FZ1A 3GBZA 3LFEA 4XS2A 3TWJA 5BVNA 3FV8A 4D1ZA 3NUSA 2BZIB 3E8DA 1URWA 3TTIA 2VU3A 1SMHA 3D7TB 2PHKA 3R63A 4O0TA 3K54A 2C3IB 2NPQA 3BLQA 4BI0A 4KKEA 4O86A 4YZ9A 2QO2A 2Q83A 4IAFA 4IZAA 5DT3A 3HECA 3SXFA 4AAAA 4D1SA 4E4XA 4F9BA 5I9WA 5GJDA 4WUAA 4A4LA 1M7QA 1YI6A 4BTKA 1K2PA 3ZBXA 5C8KA 3GC0A 1E1VA 3C4ZA 3MIAA 4L7SA 4FKSA 3TM0A 4XG6A 1W7HA 3UP7A 2OZOA 4OLIA 3QQFA 2KULA 4YTCA 4ZY4A 4DDIA 1YOJA 4FTNA 4BDEA 4MUQA 1P5EA 4UZDA 2XNMA 3PVUA 1AGWA 5G1XA 5H8EA 4GYIA 5IQFA 2JAVA 3R8ZA 4QMQA 3U87A 4AT5A 3B8RA 2ITNA 2GDOA 3OCSA 4ALUA 4X6RA 4O7ZA 1Q4LA 2QO7A 3R01A 3AT2A 1GIIA 3A4OX 4TY1A 4E93A 4EHZA 4I6LA 4HVSA 3WZEA 4PNIA 2QQ7A 4EORA 1WBWA 1GY3A 4FKPA 3PPJA 4FEWA 2XZSA 4O2PA 4OGRA 2R3RA 5EH0A 5A4EA 1ST4A 3MVHA 4R78A 1IG1A 3QC4A 4KRCA 1OUKA 1ATPE 3DA6A 3HP2A 4IWOA 4CVAA 2ZV7A 4BCHA 4JIKA 1A48A 4LM5A 5TOZA 3OY1A 4ENXA 3P9JA 5GINE 4DTAA 3LFFA 2QU5A 4EJNA 2H6DA 4KBKA 2NNWB 3ULIA 2JDTA 4H3PA 4PMTA 4DFXE 5BUEA 3FZPA 3BBWA 3EQIA 4GVAA 4PL4A 4BI2A 5IUIA 4YZBA 4GUBA 1FGKA 4J71A 5D11A 4AA4A 5LJJA 5HD4A 3B2TA 3QAME 4L01A 2R3NA 3MI9A 2XNOA 2WMUA 2BMCA 3GU6A 2B53A 1YI3A 3O8TA 4M97A 3BWFA 3R83A 2JDVA 4BKYA 1XR1A 4XOYA 2ONLA 4WBOA 3TNQB 4GIHA 4F0GA 5DT0A 3GCSA 3WZUA 4D2SA 4KA3A 5E8VA 1ZYCA 5HKMA 3EIDA 4CLIA 4FMQA 3SW4A 4I41A 2W4KA 4QMXA 2HYYA 2WO6A 3V5LA 2VWWA 2BR1A 3PPKA 4BKJA 5IPJA 2ZB0A 3ODYX 2BDJA 4HOKA 3UZPA 5IEYA 4QP3A 4A9TA 5L2TA 2GTMA 2QO9A 4FKRA 3COKA 4I93A 3FHIA 4A4OA 4A9YA 2A1AB 4IW0A 2IW8A 2LGCA 4FNZA 4IHPA 4F63A 1OKVA 2B7AA 4BBMA 5FDPA 2NYAA 1Q8YA 1OZ1A 2QLUA 4EH5A 1R1WA 5JGBA 4DGMA 3AT4A 4FG7A 3V5WA 4BDFA 1OL1A 4F7JA 4F78A 4ACCA 3EQBA 3UO6A 5HCYA 3LMIA 1QPJA 2X6EA 2JKOA 2PZYA 4QMSA 3BZ3A 4FL3A 1M2PA 3JPVA 3HDNA 5FXRA 4GT5A 5AP0A 3R8UA 3V8TA 2X9EA 4U6RA 5LCKA 2PVJA 4F65A 3MH3A 4I23A 4DHZA 1WAKA 5C01A 3SC1A 3UOJA 2V7AA 2ZV2A 4LOPA 2ZDUA 4J95A 4O7YA 3EQGA 2HZ0A 3HZTA 2FSTX 3OZ6A 3PJ1A 3BV3A 4HVHA 5J5TA 3EKNA 3E5AA 3D94A 3F5PA 4LL5A 3AC1A 3FI4A 3QD2B 4IZ5A 4V05A 5B2KA 5KE0A 2HK5A 3VHKA 3ORZA 1Q41A 3FL4A 4XV1A 4KD1A 4E7WA 5KHWA 4FV9A 4XG2A 5ANGA 5EKOA 5EG3A 5H8GA 2ETKA 4K6ZA 1H0VA 1YVJA 1GOLA 4FTMA 3TNPC 5CALA 5LMKA 4G3DA 5IH5A 3LKMA 3U6JA 4R1VA 4L67A 4C36A 3IDCA 2J90A 4FTKA 2GFSA 1QPCA 3OD6X 4GL9A 1O6LA 4EEVA 2PYWA 2OU7A 2VWIA 3DKCA 3LFAA 4DG3E 1DI9A 2IVUA 2OF4A 4DBXA 4M12A 2JITA 2X2LA 3DZQA 3NFGB 2UZBA 2X4ZA 3CXWA 2VX0A 4CCUA 2FH9A 2Y6OA 4FIIA 4G9CA 2ERKA 3LM5A 2HENA 3UOLA 1F3MC 4CZYB 4U3YA 1MP8A 3W2SA 1CMKE 4O2ZA 2WU7A 2EWAA 3MTLA 3Q32A 2QKWB 4MF1A 5F94A 4G6LA 5KMOA 1PRYA 4QDEA 1Q8ZA 4L6QA 3E63A 4RFZA 1WBPA 3UTOA 4DN5A 4GKHA 5M09A 5CVFA 3CS9A 1B38A 1SYKA 1HOWA 3I7BA 3OEZA 4DAWA 1JKLA 3OWKA 4I6QA 4JDKA 1H1SA 4NJDA 5FQDC 3F2AA 3ZLYA 5HTBA 1Q99A 4IAIA 4OR5A 4USDA 3ZLWA 3O8UA 5JN2A 4EOJA 3DQXA 3COHA 2EVAA 3JXWA 2Y7JA 4U40A 3QX2A 3C50A 3BHUA 2V55A 4APPA 3CR0A 2V0DA 3MV5A 2PWLA 4QO9A 4RA5A 3TJDA 5M4IA 2VTIA 3CQEA 5IZFA 4PTEA 1NT2A 4TYEA 2F7ZE 4TKSA 2R5TA 4XUFA 4ONAA 2I6LA 4LGHA 4ANBA 3P08A 4C7TA 2IEWA 4EL9A 2C5XA 3MVJA 4RWLA 1XWSA 4RGJA 3QKMA 5FD2A 2FO0A 3UVQA 5KZ0A 4NU1A 3HAVA 1V0BA 2OJJA 2CN8A 1TZDA 3MGYA 4I5CA 4YJNA 4PUZA 1H1WA 1R0PA 4DDGA 3PXZA 4L9IA 2QVSE 2YIQA 4YJSA 3PXFA 3HYHA 3O0GA 3Q9WA 3WZJA 4C37A 3BGQA 4NIFB 3R9HA 1V1KA 4HPTE 3NIZA 3CTQA 2ZB1A 4ACHA 5J5SA 4FL2A 5HU9A 4Z3VA 4NM3A 3QCXA 2BCJA 2JDOA 2DWBA 4U5JA 4I3ZA 3VIDA 4QPAA 4C4FA 2WU6A 1PYEA 4IWDA 5GZ8A 5BYZA 3V8SA 3EMGA 3ORIA 4V0GA 3C0GA 5AP2A 5AWMA 3OMVA 2YA9A 3NFFB 1H28A 2QOOA 5HBHA 1BMKA 4NZWB 2XNNA 3FLYA 4D28A 3DKOA 3POOA 3QGYA 4GRBA 4NM7A 3P1AA 3ULZA 4DTBA 3P0MA 3TXOA 4FKVA 4R5SA 4E4NA 1H0WA 2IZTA 4B99A 5KCVA 2HAKA 3A2CA 4JBPA 1SVEA 2ZDTA 3VUTA 4Z7GA 4BB4A 2XMYA 4RWKA 3LFSA 4KINA 4LRKA 4MBLA 5DG5A 5F1ZA 3ZO4A 2YAKA 3L9PA 2X8DA 4O7LA 3RCDA 4RT7A 4Y46A 3U9CA 1ZZ2A 1P14A 4MKCA 1E1XA 4F0IA 1U54B 1W2CA 4G5PA 4RC3A 3BEGA 5AMNA 5IQEA 4DCEA 3ODZX 2W1ZA 3EN5A 4GU9A 2HXQA 4J99A 1OITA 2R7BA 3P4KA 2YFXA 3DTCA 3GENA 4MXAA 3IW5A 1KE7A 3WILA 4ZMFA 1W8CA 2G2FA 5CT0A 4CZTA 3QLFA 4KSPA 4IAYA 2C6MA 4XNEA 4O7NA 1H1PA 3HRCA 5J1WA 1NA7A 4E5AX 4G3CA 1XMMA 4GT3A 2Z7LA 4JL9A 3PZHA 3L8PA 1YXSA 4JR3A 4N0SA 5E7RA 4ANOA 3MJ1A 2YAAA 3PA3A 4DE4A 3FY2A 3LXNA 4I0RA 1G8JA 2IPXA 1Q97A 5A4LA 3HP5A 5L4QA 5HI2A 5EHYA 4QP1A 4E73A 2GNFA 4S33A 3R7YA 3QCSA 4BDAA 3QU0A 2J2IB 2VNWA 3OCTA 2CKPA 3O7LD 2UV2A 4OAUC 4YC8A 4DHIB 2J5FA 4QOXA 3UYTA 1OIYA 2C47A 3HUCA 4AZFA 3PUFC 3NSZA 3UG1A 4I0TA 1KE5A 3EFJA 1PYXA 4BYIA 5IQGA 4LFIA 4C59A 4CKIA 4UX9A 4CYJA 3BBTB 3KRLA 4QT1A 4ZTHA 2QR7A 3R22A 3UNKA 4DEBA 5HZNA 3FSKA 4KSQA 3REPA 3M2WA 4WG3A 4DHJA 4O6LA 5AV4A 3HV6A 3AT3A 3OWPA 3KULB 4MXYA 2OZAA 4RWJA 3DJ7A 3O51A 5HIBA 1YWRA 4FSZA 5L8LA 3JR1A 1WBVA 2BFXA 4FK3A 4FKLA 1TKIA 3F3TA 4KAOA 4W4YA 3UQCA 3RHXA 2OSCA 3TKIA 3Q3BA 4I22A 2CLQA 4R7HA 3BGZA 4YUQA 2A98A 3RKBA 4LV7A 2VN9A 1XBBA 2J6MA 2PUNA 2C1BA 3DLZA 4FK6A 1AD5A 2Y4PA 2WOUA 5IDPA 1SVGA 3Q6WA 4KBAA 4CLJA 3ALOA 2CCIA 3NS9A 3VS6A 5IA0A 2BRHA 2PL0A 4IX4A 2IO6A 5FG8A 1IRKA 4U79A 4AGUA 4ARKA 4XRLA 3I6UA 1NW1A 4UMUA 3OTVA 1GJOA 3OT3A 4YHFA 4A4XA 3GB2A 4CRLA 2UZTA 4IVBA 3H4JA 4F9AA 2YCFA 3BYVA 4R8QA 2DS1A 4HVIA 3EQFA 4IFCA 4TYIA 3BLHA 4I5HA 1H24A 4YZNA 4ZSAA 4F9WA 4M67A 1PXOA 3ET7A 4BDGA 2XM8A 2W4OA 2X39A 2XCKA 2XK6A 1XH4A 2J0KA 3MFUA 4RBLA 4L52A 3HA6A 3LMHA 4QTAA 3FDNA 4EC8A 3NLBA 3AC8A 4BCKA 4EZ3A 4GVJA 3BGPA 4UBAA 3FLNC 4L3JA 4BIBA 5BPYA 1DI8A 4U3ZA 1UU9A 2IF8A 3QZGA 3L8XA 3FKOA 3QCQA 4ZLOA 4BR3A 5AM7A 1JSTA 2C30A 5DHJA 3TV6A 4F6UA 1QPDA 3NRMA 3G6HA 5JFXA 3LCOA 3LLAA 2IZRA 5IU2A 4BDIA 1APME 3Q9ZA 3I6WA 1QCFA 3QX4A 3BYOA 5JSMA 3R30A 5DYJA 2A2AA 2WMWA 3SD0A 5EM7A 3HKOA 1LR4A 5E8ZA 4AN2A 2PVHA 2I0YA 5EM8A 5M55A 1HCLA 3GCUA 2VTNA 4ZJJA 4AA5A 3DBFA 3GCQA 4CMOA 4I24A 3D5XA 4TYJA 4W4VA 2BDWA 2VWXA 1FMOE 3KY2A 3RZBA 2WMAA 1W2FA 3DNEA 3VF8A 5HX6A 2VO3A 4FODA 3WF5A 5CQUA 2HIWA 2YCRA 5FTOA 4AA0A 3G15A 3KXNA 4C4JA 4M66A 1GIJA 3AC4A 1UV5A 4HCVA 5CU4A 4YLKA 4C3PA 3EYGA 3BHVA 3QZIA 4ANSA 4EONA 3ZM9A 3RHKA 3QL8A 4DG0E 5D9HA 3SOAA 5EOBA 4OT6A 4IBMA 3K2LA 3I0QA 5T6KA 4QNYA 3HRBA 4JDIA 4ANLA 4RX5A 1UWJA 3O96A 2PK9A 3Q6UA 5FGKA 3UPXA 1H01A 3ZRMA 5IA2A 3EFLA 2PVNA 3E8EA 3EZVA 3FHRA 3UIBA 4E8AA 4L68A 4BGQA 2R3JA 5AA8A 2GQSA 4RPVA 3ROYA 5AAFA 3R7VA 2QD9A 3DU8A 3P7CA 1XMLA 3HDMA 4C33A 4MTAA 3A60A 4RA4A 4LL0A 1PMEA 1ZYJA 4EK4A 3F66A 4JXFA 4RJ4A 5IQIA 4AP7A 5A4QA 1UU8A 2YM4A 4M7IA 4P2KA 3VS2A 4O7RA 4JNWA 3DGKA 4U8ZA 5EOLA 5AAGA 2QG5A 4FZ7A 3IDBA 5CZIA 3KRXA 1MRUA 4YZDA 3CQUA 1ZYLA 3S4QA 4LV8A 2ESMA 5DVRA 4AZWA 5AV0A 5BVWA 5JGAA 3DNDA 4FEVA 1YKRA 1AQ1A 2A27A 3MSSA 3THBA 4BCNA 4GJ2A 2J50A 5BNJA 4O81A 5DIAA 2C68A 4I4FA 4Z55A 4FZDB 4A9RA 5JFWA 1IR3A 2PZPA 3I5NA 4PMPA 1IA9A 1WBOA 4K8AA 4N70A 5HHWA 3U51A 2XEZA 3RM6A 5K0XA 2G01A 2X7FA 3ANRA 1Q24A 4G3GA 4BJJA 1R0EA 2X0OA 5HVJA 3TG1A 2PTKA 4ZEGA 4AU8A 4MH7A 3QTZA 5HLWA 5AP1A 5L8JA 4F99A 4X21A 4QP2A 3MH0A 2XA4A 2B9IA 3HMIA 3NYOA 2WHBA 5CEIA 2OK1A 4D4VA 4WBBB 2ERZE 4ZY6A 2WQBA 4U7ZA 2XJ0A 4YJOA 3V3VA 3GXLA 3U9NA 4C02A 4XMOA 5M4CA 5HE2A 3PTGA 3F2NA 2R3OA 2V7OA 3OBGA 4M0ZA 4RJ3A 3QTQA 1YDSE 2OXYA 5LWMA 3G6GA 3KN5A 4ID7A 1KV1A 2PVYA 4MNEA 4AS0A 4BFMA 4E4MA 3Q9YA 4FTTA 4N6YA 4K0YA 4YJPA 4YC3A 5I9YA 5CZHA 4P4CA 4XV9A 1YHWA 4GU6A 2QCSA 3DFCB 3LJ2A 3VS1A 1YXVA 2XP2A 3DB6A 3EKKA 3RPRA 2Y0AA 3IONA 5M08A 2C5OA 4DFZE 1Q8TA 4C4GA 2WAJA 3BHHA 4LOOA 5DE2A 4X0MA 4KUJA 3TZ8A 4PL3A 2PE1A 1YWVA 2BFYA 4PWNA 4QMPA 2R3HA 3EQCA 3NW5A 4CRSA 2C3KA 2R0UA 4MQ2A 3VHEA 1GZKA 2PMOX 3NPCA 4WG5A 2PMIA 2WKMA 5AV2A 5DR9A 3TNIA 3Q4UA 4FNWA 5CAVA 4XOZA 5GJFA 3W0NA 1ZAOA 3R00A 5CNOA 3KXHA 4OAVB 2W7XA 2Y4IB 4HGSA 2YM8A 5EKNA 4E26A 5E8YA 4FL1A 1XH9A 4BDJA 1BI8A 1OGUA 4M13A 4F7SA 2WEVA 3S2PA 4EZ7A 4YNEA 2NO3A 4F08A 4G6NA 5KKRC 4FT3A 5ETAA 4ZTNA 3C4XA 5A9UA 4TYHB 4K1BA 3FYJX 2CLXA 3MS9A 4CV9A 1WBSA 1VYZA 2J0LA 2H96A 2DYLA 2BKKA 5BX0A 4DBNA 3TZ9A 4A7CA 4UMPA 3BE2A 3SVVA 4FGRA 4X3JA 4DCAA 3BPRA 4DH1A 4QQCA 5CSXA 2QNJA 3IO7A 4UV0A 2XAOA 4BCFA 3D2KA 3FMMA 3RTPA 3BWJA 4QMYA 4O0SA 2G2IA 2BZHB 3NGAA 4FOCA 4MVFA 4EH8A 1XH6A 3EFKA 4GK2A 4OTIA 4CFVA 1ZOGA 4W9XA 4QEBA 4UMRA 5K5NA 2VTMA 3FQSA 2WQMA 2XJ2A 3VVHA 5AR4A 3UJGA 4C3RA 4XYFA 4BTFA 3QA8A 4DTKA 5C8NA 3B8QA 5HGIA 2V62A 5JGDA 4X7QA 2BAKA 2J51A 4FG8A 5CWZA 5CASA 3SRVB 3VO3A 4ZAUA 3OEFX 3GCPA 3MN3A