3DBQA

Crystal structure of ttk kinase domain
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
282
structure length
259
Chain Sequence
NECISVKGRIYSILKQIGSGGSSKVFQVLNEKKQIYAIKYVNLEEADNQTLDSYRNEIAYLNKLQQHSDKIIRLYDYEITDQYIYMVMECGNIDLNSWLKKKKSIDPWERKSYWKNMLEAVHTIHQHGIVHSDLKPANFLIVDGMLKLIDFGIANQMVGTVNYMPPEAIKDMSISPKSDVWSLGCILYYMTYGKTPFQQIINQISKLHAIIDPNHEIEFPDIPEKDLQDVLKCCLKRDPKQRISIPELLAHPYVQIQTH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Dual specificity protein kinase TTK
publication title Structural and Mechanistic Insights into Mps1 Kinase Activation
pubmed doi rcsb
source organism Homo sapiens
total genus 71
structure length 259
sequence length 282
ec nomenclature ec 2.7.12.1: Dual-specificity kinase.
pdb deposition date 2008-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3dbqA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3dbqA01
3HMMA 2XK7A 3LCKA 5K0KA 3F3VA 1KUTA 1J7LA 5H8GA 1CKPA 3UQGA 3ZO1A 3MA3A 3O7LB 5DIAA 3KF7A 1BLXA 2QG5A 3QHWA 5JK3A 4ZEGA 3BYUA 4JIKA 4L8MA 4FF8A 5DGZA 3W2PA 5ETCA 3D2IA 4MKCA 3ZONA 5DYJA 4PY1A 4WOVA 5EI8A 4GKHA 4CEGA 4W4YA 2ONLA 2QI8A 4WSYA 4H05A 3E87A 5IPJA 4XP2A 5DMZA 4XYFA 5AP3A 5G1XA 2RFDA 3DQWA 3OWKA 4U3ZA 4IJPA 3NIEA 3RINA 1L8TA 1KE6A 2ERKA 4L67A 1JBPE 3F7WA 3MDYA 1FGKA 1XJDA 3QD3A 3LJ0A 4GCJA 2FA2A 4GEOA 4YHFA 3MPAA 4MD7E 2VO6A 1ZYDA 4MWIA 1VR2A 3NYXA 4LOOA 5DEWA 1YOLA 4AA5A 4EQCA 2OJIA 4QP9A 3Q5IA 4O81A 2Z7LA 3EHAA 4H1JA 3E8EA 4YLLA 2B9HA 4MXXA 3RWQA 5AV2A 4BWPA 4EK3A 5C26A 5IZFA 2XK9A 3TG1A 2WO6A 1U54A 4HCVA 4J52A 2JKQA 3QTRA 1UVRA 4FVRA 4TYGA 4PV0A 4U97A 3O2MA 4NTSA 4FVQA 3JVSA 5A54A 4DF3A 4ALUA 3F82A 4TNDA 5LVOA 2CKQA 4AZTA 4W8EA 3W55A 4UMUA 4N4SA 2GTNA 4FKOA 3ZLSA 3KQ7A 1M17A 2P55A 2UZNA 4L3JA 1Y8GA 3F5XA 3NNWA 5HNGA 2RKUA 3B2WA 4JQ7A 4YTCA 2GPHA 2OJ9A 5EW8A 4S31A 2GQRA 4QNAA 3GI3A 3UJGA 4TNBA 3CTHA 3PTGA 4WRSA 1UNGA 3KXMA 4ERKA 3QRTA 4MWHA 5CZHA 3BEAA 5EYDA 2XIZA 4HCTA 1BL7A 5ETAA 3SC1A 4HVDA 3EL8A 3PXQA 5EKNA 5AUVA 1XBBA 4PTEA 4KBKA 4IWQA 3Q4TA 3BU5A 3RHKA 3IKAA 5CQWA 3MFSA 2ZM1A 2JAMA 4K18A 3TWJA 3EN5A 4F9BA 5F95A 5C9CA 5AWMA 4FIJA 4NFMA 2C0TA 2XJ2A 2YFXA 3R71A 5EM5A 4AU8A 1B38A 2BZHB 1NVSA 4DGGA 2WQBA 3GGFA 2BAJA 4CFUA 5HTCA 4EHVA 4QTDA 3V8WA 2OH0E 4WNPA 4AGUA 4JIAA 4QQCA 1PXMA 2WQMA 4J71A 4C34A 3UO4A 3DXNA 4YNOA 5HICA 4KAOA 3KULB 2JITA 4FR4A 4UZDA 4FV1A 4G17A 1G5SA 1BKXA 1V0PA 4JNWA 2XM8A 2OJFE 5DR2A 5AR7A 3GC9A 5HX8A 5KMLA 3IPHA 4ZZNA 4ACHA 3ZRLA 2PE1A 3CE3A 4USEA 4FV7A 4I22A 4BDHA 4ITJA 4BZNA 3PRFA 3F5UA 3GQLA 4JBVA 1W82A 4HNFA 5IMXA 3BGPA 5HVKA 4G9RA 3PP0A 3F2AA 4RLLA 1UKIA 5A46A 3QQFA 3KULA 4K2RA 4X2KA 3MFRA 4R3CA 3JVRA 4BYIA 3KRRA 3LLAA 1OIQA 3RMFA 3RAHA 5BYYA 4FV6A 5EM6A 4EZ7A 1K9AA 3RPYA 2OO8X 4X6RA 3H9OA 5HE3A 3SAYA 4TWCA 2F4JA 5CVGA 2X8EA 5C4KA 4MAOA 2NPQA 3LMHA 4L9IA 3QUDA 3PLAE 3LLTA 3UNKA 3SV0A 4EBWA 4QP8A 3QCYA 5C01A 3QBNA 5M57A 3VUTA 3G0EA 3QZHA 4UWYA 4F99A 3AC1A 1BL6A 2DUVA 4Y83A 4EOOA 3NSZA 2CPKE 4UN0C 3R7EA 4FOBA 3A61A 3EQHA 5KX8A 5ANGA 3I0QA 1GIHA 2W1GA 4ZIMA 2OFVA 3DFCB 2WQNA 2Z8CA 1M2QA 4TPTA 3KXGA 3BWFA 4BHZA 4QP1A 3M42A 4TXCA 2RIOA 4BZOA 4C3RA 4KBCA 2XS0A 4X7QA 5J9YA 2V7OA 4B7TA 5HIEA 2VWIA 3UGCA 2BHEA 3Q3BA 4L46A 4IMYA 4UALA 4ZTQA 3F6XA 4L42A 3LFFA 4XCUA 4X2NA 3TNPC 2QNJA 2BPMA 3E8NA 4FKGA 4GL9A 4BRXA 5HIDA 3AC4A 3QKKA 3ZCLA 3F5GA 4D0WA 3DXPA 2VTTA 3KN6A 3R1QA 3D5WA 1ND4A 1Q8YA 2C5XA 3GC7A 5CF5A 4BIBA 1REJA 3Q32A 1H1QA 3KL8A 4RRVA 5KE0A 3UZTA 4O84A 5B7VA 5DH3A 4O1OA 4JG8A 3UODA 2BMCA 4YPSA 1GIJA 5IEXA 4DLIA 3QGWA 4RFMA 3PA5A 2IN6A 3MPTA 2OF2A 5ANIA 3Q96A 2O2UA 3QXPA 5KMKA 5DE2A 5HTIA 4BYJA 4RIOA 4GG7A 3W10A 1PMNA 3JUHA 4PX6A 3FAAA 4KBAA 2OZOA 5E4HA 3P78A 2R4BA 4NW5A 2QO7A 4G3DA 2PVHA 3U51A 3KGAA 3RI1A 5CALA 1FBNA 3ZFYA 3BHYA 1JSUA 2W1EA 4O21A 3L8PA 3FKOA 3E5AA 4C02A 3LQ5A 4OBPA 4E26A 1HOWA 4YMJA 4L45A 3QA0A 4PL3A 5FXSA 1HCLA 4QMZA 4D4RA 4EOIA 3GU7A 4FUYA 4CCUA 3N51A 3AGLA 1PXKA 4O6LA 1UWJA 3DB8A 4FSNA 5D1JA 4DH1A 3FYKX 3QQLA 4JAJA 5I4NA 5K5NA 2R3HA 3EN6A 5AUYA 3PWDA 1YXUA 1OPLA 5LVNA 3O50A 2R3FA 4Z16A 3ZLXA 3MA6A 2ITUA 1YHSA 3QUPA 2X7OA 4RIXA 3VQUA 3E63A 1OPKA 3Q6UA 5CVHA 5ETIA 5M4CA 3C4WA 2QHNA 4EHZA 4O27B 3EIDA 4UYAA 3LMIA 4W9XA 2VNYA 3VS5A 2I6LA 4E6CA 2PY3A 2OK1A 4ANQA 4DGOA 2YISA 3IDPA 3TIZA 3C5IA 2VWYA 4X3FA 5HO6A 2QO9A 3SKCA 4CXAA 3AD6A 3PYYA 4GT4A 3NNXA 5BUEA 4ACGA 2NP8A 3UNZA 1MQBA 2UZWE 3V6RA 3L8VA 4FYOA 4BDKA 1GZOA 4K8AA 3FXZA 3MH1A 3OG7A 2CKOA 4I93A 2QG7A 4PQNA 5DVRA 2YIYA 1PY5A 4IC7A 3AC8A 3LM5A 5ACBC 3W2RA 3FZOA 3GOKA 3IDCA 3KCKA 3W18A 3PIXA 4R6VA 3HV5A 3ORXA 4RIWA 4RLKA 1FVRA 4IWPA 3R2BA 2G01A 4WUAA 4HGEA 4RC3A 3FMEA 4DYMA 3GB2A 4QMMA 4F4PA 1BYGA 3N4TA 3QKLA 4XS2A 4BGHA 3W8QA 3E64A 5DI1A 4PTCA 3FI8A 2XKCA 2VWZA 4E1ZA 4D0XA 3PG3A 3E88A 3QLGA 1UA2A 2YJRA 4G31A 4ENYA 3Q9ZA 2C3IB 3PXKA 5DLSA 3ZTXA 2YM8A 3PY0A 4E6DA 4FTUA 4BCFA 2ITYA 4FTKA 3MTFA 4WG4A 3D94A 3U4WA 4QTCA 5AP7A 5JH6A 3OWJA 3UOKA 3IW8A 3RBWA 2YACA 3NYVA 3WF6A 4PMMA 4BBFA 2EUFB 2C6LA 4KWPA 3ZZWA 1AQ1A 4ANOA 5CF4A 1IA9A 2YWVA 3UPZA 2UW5A 1YW2A 3DOGA 2F7XE 4RVTA 1EH4A 4R5SA 4XBRA 5CEQA 4A4LA 3ZFXA 4ANNA 3QAME 5EQYA 3WYXA 4BI1A 4E4XA 2XNNA 5E8YA 3FZTA 5FQDC 5L8KA 5I9YA 3QX2A 3II5A 3GCSA 4L00A 3ZUTA 3P7CA 4MF1A 3BBWA 3DA6A 2E9OA 3QD4A 5J87A 3LFCA 4AZVA 4FE2A 1UU9A 4PL4A 3K5UA 3HUBA 2PYWA 3F9NA 4DFXE 4I94A 2PUPA 1F0QA 3GCQA 5FM3A 5GINE 2OJJA 2JDTA 4ANMA 5L2IA 4FEXA 3OCBA 3FMDA 4P4CA 4ARKA 2YIWA 1YI3A 1J7IA 4ANLA 4DBXA 3HMPA 2VTJA 5M4FA 1LEWA 2W4KA 2JD5A 5BX0A 4M68A 3I7BA 1BI7A 5AP0A 1H1SA 2B4SB 1UWHA 5AUTA 5JEBA 2IZUA 2W1CA 2Z02A 3FY0A 5JGBA 3CKXA 3O8PA 3OTUA 3MV5A 1R0PA 3RNIA 4CCBA 5IQAA 4JRVA 2W7XA 4YTFA 1MRYA 3HAMA 3OD6X 3RPVA 1PW2A 4FTAA 2B55A 3D2KA 3DBCA 2IJMA 1XH8A 3PJCA 3TJDA 3VUGA 2GNIA 4HYIA 4L01A 3CSVA 4FEWA 3UG1A 5KZIA 3ORZA 2C0OA 4BN1A 4DH3A 1UNLA 4RMZA 2W9FB 2FB8A 4FNXA 4RJ8A 4EKLA 3W2CA 2UZUE 5BUJA 4H36A 2W1DA 3S1HA 3R6XA 3QQKA 3P86A 5EFQA 5I0BA 2WQEA 5IU2A 3VVHA 4XOZA 4XG7A 2VO3A 3MY1A 4XP0A 4XV2A 1XHAA 4BKYA 3VULA 4RBLA 3JPVA 1Q8WA 3H0YA 2XF0A 4J97A 2J0KA 4U9AA 3A2CA 4RG0A 3R00A 2YAAA 4RFZA 4WIHA 4HW7A 1GNGA 3NEWA 3VJNA 4NFNA 3TUCA 3QA8A 4EOPA 4CFMA 2ZJWA 2A4LA 2F7ZE 4YTHA 3KB7A 3KVWA 5L2QA 3UO6A 2V0DA 3KC3A 2BRMA 3NLBA 3NX8A 3S2PA 4B8LA 1ZZLA 4M0ZA 3V8SA 4IJ9A 2PPQA 3CQUA 2BKZA 5EOBA 2FSLX 3FJQE 2XNOA 4C0TA 4E5AX 3QTZA 5HU9A 3QZGA 5AFVA 2QLQA 3FDNA 2XIXA 4FEQA 3KRJA 4MX9A 5B0XA 3ORNA 3UIMA 3ZUUA 5FP6A 5JFWA 3HDNA 1QL6A 4AE6A 5GIOE 3KA0A 3TKIA 3G51A 3ETAA 3AD4A 4BTMA 4EZ5A 4DA5A 4KKEA 2CN8A 3EFKA 3MH2A 4TYEA 3HL7A 3SRVA 2EXEA 1WBWA 2G9XA 5AR8A 3TNHA 5BVFA 1DI8A 1DAYA 3BI6A 3PY1A 4RSSA 5CU6A 1R39A 4MXZA 5LVLA 1CKIA 4JDIA 3AMBA 1NXKA 5F9EA 4O7LA 2Y4IC 3K2LA 3R9OA 2KTYA 2ONLC 4C36A 2GNHA 5EDRA 5A4LA 2VV9A 4I23A 2WB8A 2XCHA 4APCA 4CQGA 5AEPA 1LP4A 2P2HA 1YXTA 4GW8A 2ITOA 2C1AA 2C1BA 3PA3A 3QRUA 4IAFA 4G3CA 4M0YA 5EYKA 1YXVA 4BCHA 3R9DA 2X2LA 3ZMMA 5K3YA 5JGAA 4MK0A 4U42A 2PZ5A 4E20A 4W9WA 3NAXA 3D5XA 5C27A 4R5YA 4MBIA 4ASZA 5JZJA 4YTIA 1R78A 5E8SA 1XQZA 4EC8A 2VGPA 5HG8A 4EOMA 3S3IA 3ZXZA 1PXJA 4JQEA 4MXOA 2W4OA 2XEZA 3UG2A 4AUAA 2QR8A 2O3PA 3TL8A 4E73A 2ITZA 4KUJA 4EOSA 4M8TA 4AOTA 2WTJA 2BTSA 4BCJA 4WNOA 2X6DA 4O0VA 5CF8A 1IA8A 4C3PA 2IVUA 4QMNA 3EL7A 2B7AA 4L43A 4ZTSA 3FY2A 5F94A 4XNEA 4UWCA 4RGJA 2R3PA 4O7WA 4NIFA 4FEVA 5CI7A 1CSNA 3HRBA 3EKKA 4GJ2A 3EN7A 3O17A 4UWBA 2UZBA 4GYGA 1WFCA 5DT0A 3VUDA 4YU2A 3W33A 3TV4A 3OY1A 2PMLX 4F08A 5FEEA 2PWLA 3FUPA 3H9FA 4G6OA 4L6QA 5HVJA 1YDTE 3CR0A 3W1FA 3L8SA 1GY3A 1FMOE 1IRKA 4G5PA 3UBDA 4YJVA 3PUPA 3NPCA 1ZMWA 1ZOHA 2C6EA 4IVBA 1FPUA 2HOGA 1KE7A 3E8CA 5ANKA 2XNEA 3G0FA 3RALA 3PE1A 4E5BA 3R2YA 3GFEA 1FINA 2J51A 3IW4A 3FLWA 4I6FA 2G1TA 3VS2A 4YZ9A 4EHEA 5F1ZA 4S32A 2ERZE 3QZIA 4FA2A 3UOJA 2PUNA 1JKSA 2EVAA 5A6NA 3KMUA 5KMOA 3OT3A 1Q3DA 4YHTA 2ZDTA 5E1EA 2NRYA 5EDQA 3PWYA 3EYHA 4R3RA 5CANA 4U44A 5D41A 3Q9YA 3BHUA 3A7FA 3ERKA 1Q41A 4FZFB 3Q60A 3FMJA 3MN3A 2H96A 4GT3A 4D58A 4EORA 4FV3A 2X81A 3KXNA 1VYWA 3VS4A 3PZEA 3KRLA 5CQUA 3AD5A 3AC3A 1PMUA 3HLLA 3R63A 1DS5A 3SW4A 4O7ZA 1FOTA 1GIIA 4D28A 3N4UA 5HQ0A 3OUKA 1OBGA 4HJOA 4JX7A 3F3UA 3QWKA 3TNQB 5FTOA 2GSFA 3OBJA 5CXHA 4HYSA 5K4JA 4GSBA 3SA0A 4O7VA 1YXSA 4M84A 3K5VA 4IADA 2JDSA 2WU7A 3C4XA 3ORTA 5AAFA 4BCIA 4D2PA 3TDVA 3HKOA 3W2QA 2WFYA 2CGVA 4I24A 5HE1A 5AAGA 1RE8A 2HK5A 4IB1A 4ASXA 2Y7JA 4MD9E 3PJ3A 5BPYA 3EQPA 3WZKA 2QOOA 2RSVA 4M67A 5M4IA 4E6AA 3ZYAA 4CD0A 3REPA 3GOPA 3T8OA 2R3OA 3DT1A 4FV9A 3BPRA 2GNFA 2UZVA 3R7VA 4C59A 4UMRA 3EN9A 4IX4A 4P90A 2PMIA 3ET7A 3NUYA 4FSMA 4FG8A 2UZEA 3THBA 3MESA 4F64A 1IAJA 2YM3A 4G5JA 1OKYA 4RA4A 2R7BA 3C0IA 3QTXA 5E1SA 1APME 3MYGA 4KRCA 3VQHA 3ZLYA 3OXIA 4WHZA 1ZOGA 3TV7A 4AN3A 1H4LA 4RC4A 3WIKA 3ZDUA 4L7SA 4X0MA 3FLYA 4L3LA 3MVLA 1P4OA 1WBOA 5FBNC 3CBLA 3WE4A 3ZBXA 4TZRA 3R1YA 2C3KA 3WOWA 3C50A 4JR3A 1ZYCA 4YC3A 4EYMA 5EW3A 2KULA 5AR4A 5HCYA 2HXQA 3HMOA 1PXOA 4XP3A 3R8ZA 5IA0A 5BYLA 4FVPA 3BLQA 4Z7GA 3C0HA 4IQ6A 3R7YA 3EFJA 3UQCA 5M55A 5DT4A 2W1IA 4MXYA 3FKNA 5A3XA 2BTRA 2FSTX 3MH0A 4AGCA 1Q8UA 4IANA 3VS1A 4F6WA 3Q52A 1OITA 3BQRA 3FL5A 2WEIA 3NCGA 4Z3VA 3CQEA 2J5FA 2GS6A 4XBUA 3VHEA 3RTPA 3NYOA 3NR9A 4WRGA 4C35A 3NDMA 5J1VA 2VO0A 3QQJA 3EFLA 3FLQA 3LZBA 4NT4A 4NZWB 3CXWA 4XG9A 3NW5A 4EWQA 1H1WA 2REIA 2QOLA 4OGRA 5CSHA 3RPOA 3U6JA 3KXXA 4E4LA 5JRQA 4BDGA 4RJ3A 2B1PA 5IQCA 3DZOA 3PSCA 4LL0A 4DTKA 3OS3A 2WMWA 2VWVA 3PJ1A 4M13A 4MXAA 4RWKA 3W2SA 1OL2A 5IUHA 2QR7A 1UV5A 3N4VA 3EMGA 2OICA 2X8DA 3BYMA 3DJ7A 4LUDA 3TZ9A 4EH7A 2GDOA 3C51A 4BDDA 4BTKA 4EYJA 4Y85A 3QHRA 4NU1A 3A7JA 5E9EA 4O83A 3ANRA 4HVSA 2WD1A 1ATPE 3EOCA 3IO7A 3NCZA 5GZ8A 4FKQA 4V04A 1ZYLA 4FSQA 1YXXA 2I0VA 4AW5A 3I79A 3LFNA 4DFYA 2BVAA 5KHXA 4M69B 4AZSA 3ZXTA 2WOUA 3AXWA 4KABA 3WYYA 4PDOA 2CHLA 4WUNA 2UW9A 2Y4IB 3R8PA 1Z9XA 1PRYA 4ZY6A 5KBRA 3BHTA 4ASEA 4DFUA 4AWIA 4O6EA 3F61A 5KBQA 3ZC5A 4LGHA 2H34A 2VD5A 4I4FA 4S2ZA 3QL8A 4A07A 1Y91A 3ODYX 4F6UA 4CLJA 5M44A 5IUIA 2XBAA 4I0RA 2I0YA 4FT9A 2WMBA 4M97A 3HV3A 3IQ7A 2EB3A 3PPZA 2CNQA 3SXSA 2XKDA 4M69A 3NUUA 4F0IA 3GQIA 4I6QA 3VUMA 2YCQA 2C3JA 2GHLA 4FTMA 4FG7A 5ANEA 1YI6A 3ZSHA 1OIUA 3C4ZA 3KU2A 2C0IA 4GV1A 2DQ7X 3H0ZA 2G15A 2Y4PA 4HGSA 2OU7A 4IW0A 4QPSA 3FL4A 4X3FC 3UIXA 5BMSA 5E8VA 3NRMA 1M14A 3LFBA 2IW9A 3LFAA 3COKA 4ZZMA 2WMTA 4AW1A 5CEOA 3QQGA 1W83A 4M15A 5CZIA 2R3LA 5L8JA 1U54B 5CENA 3U6IA 3UVRA 2HYYA 3COIA 3W16A 3QX4A 5LJJA 4O0SA 3G5DA 1H25A 3KF4A 4BDEA 4EH9A 1F3MC 5JQ8A 5TR6A 3DFAA 4WBBB 1YWVA 4ZTLA 1MRUA 4NKAA 4IZAA 4RWJA 3ZC6A 3D9VA 3L8XA 5I9WA 5AUZA 3EH9A 1YKRA 2W9ZB 3D15A 4D2SA 4EUTA 2BDWA 4O86A 4DINA 4H58A 4I5PA 3ZBFA 2V55A 2UVYA 1OECA 2P4IA 3LXNA 4A9TA 2WQOA 1BX6A 4U6RA 4BTFA 1M2PA 5DG5A 2CNUA 4L3PA 1IEPA 3A62A 3ODZX 4ITHA 1ZXEA 3COHA 1YDRE 4KS8A 1OBDA 3LAUA 2YCRA 3LMGA 2A19B 3T3VA 2BILB 2F57A 3IOPA 5EHOA 4H3PA 3E7OA 1ZAOA 2ZV2A 3VJOA 1Z5MA 4FYNA 5CEKA 2BFYA 5IEVA 4I5CA 3ALOA 3Q5ZA 3Q9XA 3DS6A 3FMKA 3QUEA 4LMUA 4OTWA 3KRWA 3KRXA 4CFVA 4RX7A 3FBVA 4DCAA 4C61A 4LRKA 4UMQA 2BR1A 4X2FA 3ACKA 4TYIA 5DOSA 3A8WA 3CJFA 3EQBA 5KHWA 4FNZA 5IQIA 4RFYA 3ZRKA 2FSOX 4IE9A 4NJ3A 4PL5A 3E7VA 1V1KA 4BR3A 4GVAA 4EOKA 4TWNA 2ITWA 2YCSA 3R21A 4AZWA 1I44A 2PMNX 4FC0A 4FX3A 4EBVA 4EH8A 4DT8A 3GBZA 1STCE 4BI0A 4I1ZA 4O82A 3L9PA 4F9CA 1SMHA 2I1MA 1SM2A 3CTJA 4JXFA 1KV1A 2X2MA 3PPKA 5AM7A 4AN2A 2XB7A 4ANSA 3UO5A 3RKBA 2B53A 4CT2A 1Q61A 4AFJA 5CAOA 5DHJA 2XKFA 4C37A 1V0OA 4DHFA 5AADA 1MRVA 3P9JA 5GJDA 3RCJA 1JKKA 2R0IA 4FIFA 2A0CX 1WCCA 4HYUA 4ZTNA 4L53A 4N0SA 3VUHA 4BVUA 2XMYA 2Y0AA 5GIPE 5CSWA 3ZO2A 1YWRA 4WSQA 4DC2A 3DAEA 2FGIA 3OWPA 5EQEA 3D0EA 3JY9A 3OEZA 3QU0A 1DAWA 5CAQA 2WTCA 4FUXA 3KCFA 1H1PA 2RGPA 3JYAA 5HCZA 3VO3A 1X8BA 1TQPA 3L9LA 3Q2JA 2QU5A 4A4OA 3C9WA 4Q5HA 4FIEA 1G8AA 5K0XA 4D4SA 3QTSA 2X2KA 1PXIA 4FGRA 4CT1A 2X7FA 2IO6A 4HYHA 4DH5A 2VX1A 1HCKA 2ZVAA 5DT3A 4D4VA 3VBTA 1XKKA 4UX9A 1A48A 4ZSAA 5CNOA 5C8MA 3NVMB 2VNWA 3G33A 2VAGA 4NEUA 1H07A 3QZFA 1JWHA 4NM7A 3ZM9A 4E7WA 4R1VA 4C33A 4NYEA 2J0LA 3AC2A 3ACJA 4N70A 3CS9A 5A4EA 4FKIA 3OXTA 3I6WA 3DK3A 3O8UA 3C4CA 1URWA 4TT7A 5AM6A 3RGFA 2ZV8A 5L4QA 4U45A 3BELA 2DYLA 3O8TA 4KIKA 2YZLA 2UZTA 3GU8A 2PVJA 3DQXA 4XRLA 1E9HA 3ORMA 2I0EA 3C5UA 2Q0BA 2UZLA 3KXHA 3FMMA 3VBWA 4BTJA 4YZMA 2OXYA 3QTWA 1A06A 5CT7A 5IG1A 3HV6A 5L6WL 5DRDA 4FZAB 5EI6A 3FXWA 2Y8OA 2PVRA 4JBPA 4RA5A 4FIHA 5AV0A 4H39A 4BB4A 4CGAA 4ZY5A 1FGIA 1MP8A 3R9RA 2QOFA 4P5ZA 3IGGA 4QP2A 3D7TA 3NIZA 4X6QC 2YDJA 2J0IA 4K6ZA 3DLZA 4RVKA 5AMNA 4KS7A 2UVXA 3G9LX 5G6VA 4FNYA 2FSMX 2E2BA 3FLZA 1Y6AA 4CZTA 2X0GA 4AOJA 4ORKA 5IQDA 4R3PA 5I5ZA 3WE8A 4JAIA 2XNGA 4ZS0A 4EZ3A 5HORA 5FP5A 4O1PA 3UPXA 3GFWA 3BYSA 3ENMA 3OW4A 3PP1A 3KVXA 2QO2A 1IASA 2UVZA 2BAKA 3VBQA 2YEXA 2IVTA 4U0IA 3DNEA 4BWXA 1WVYA 3OTVA 5DRBA 2W5AA 5EYMA 3IW7A 2NNWB 3R30A 4FTQA 2G2HA 4FL1A 3ZU7A 5E8UA 2HW6A 4QNYA 3KK8A 3KFAA 2PVKA 2GCDA 4IZ7A 3ATTA 1SZMA 1YRPA 2C5NA 3I1AA 3AGMA 4P5QA 4RIXB 5IMEA 2WMUA 3FPQA 4PWNA 2UW4A 3R1SA 5CTPA 4YPDA 3RPSA 4IAKA 2HAKA 4KKHA 3VS0A 3LFSA 2BZKB 3RK7A 4BCOA 2CGUA 4GT5A 3R9HA 3R83A 4B4LA 2GNGA 2B0QA 2X4ZA 3FC2A 2PE2A 3TEIA 3VS3A 1ZMUA 2YHVA 3ZEPA 1FQ1B 2WTIA 4G9CA 4QP6A 3UC3A 4X3FB 3AT4A 4FKLA 3MVMA 4ZOGA 4MQ1A 4TYHA 4DCEA 3HAVA 4YC8A 3V3VA 4AFEA 5CWZA 1U5RA 2CMWA 4WNMA 4EHGA 3DU8A 2CCIA 3IW6A 1U46A 4HOKA 4QMOA 3MVJA 3L1SA 1QPCA 3HVCA 4YJSA 2YLFA 3CC6A 3HMIA 4MNFA 5J9ZA 2X8IA 1JKTA 1B6CB 4RIWB 2YN8A 3BBTB 5C03A 4YZNA 3VBXA 2WTKC 3OC1A 4BDIA 2J0JA 2O63A 5HLWA 2JC6A 2ZAZA 3Q4CA 4OLIA 4AGDA 2CSNA 4QOXA 5DA3A 4YZBA 2XCKA 1XBCA 4WO5A 3LFEA 4B6LA 3JR1A 1QPEA 3EQCA 3MJ2A 3ZOSA 1R0EA 2YM6A 2WOTA 4JOAA 2YIRA 4BF2A 4LOPA 2VO7A 4QYYA 4S34A 4BIDA 3QRJA 2GQGA 4BCPA 1BUHA 4FTOA 3LPBA 4FSWA 4WNKA 4HPUE 4O7YA 4II5A 4YLKA 4AA0A 3HUCA 2HELA 5TKDA 3EZRA 2JFLA 2PZIA 2GS7A 2XRWA 5AIKA 5KCVA 1Q8ZA 3OVVA 2FUMA 5AJQA 4ZTHA 2JIVA 2AC3A 2VTNA 4QD6A 1IR3A 1YOMA 3BYVA 4Y72A 2ITNA 4ACCA 3SHEA 3AMYA 3E92A 3VW6A 3ZHPC 4RJ4A 4WG3A 4KRDA 2R3IA 4PPAA 4YP8A 2IZSA 5CSPA 3RVGA 4AACA 2GNLA 4I6BA 3IGOA 2XK3A 3TNIA 5J5SA 5DR9A 4YJUA 2ITTA 4B0GA 3U54A 3LXLA 3A7IA 3GC8A 5BMMA 5GZ9A 4RIYA 3FI4A 5IA1A 2V5QA 5D7VA 4UZHA 2Z60A 2R7IA 1RDQE 1WBNA 2XNBA 3P4KA 4B99A 4ERWA 2Z7RA 2EB2A 2O64A 3FQHA 1PKGA 2OJGA 2PTKA 4D55A 2CDZA 3ZZEA 5EDPA 4UMTA 2WHBA 2FYSA 3LCTA 1OPJA 3QCQA 1XO2B 5TT7A 1G8SA 3BRBA 5AV4A 4DH7A 5EK7A 4XG4A 3CQWA 1O9UA 3D83A 2IZRA 5HEZA 4J53A 3FSFA 3B8QA 3CY3A 4IACA 4K11A 4FKUA 1NY3A 2IG7A 3OXZA 3GCVA 4FTTA 4FKVA 4F63A 4C8BA 1JAMA 4B8MA 2XBJA 3V04A 3T9IA 2C6KA 3PSBA 4I3ZA 5KMNA 3V5QA 4AT5A 1K3AA 5AP1A 2O5KA 4BFMA 4FGBA 3RP9A 4JT3A 3QF9A 2C3LA 2WTVA 5A4QA 5IISA 2R3KA 1H08A 5IH6A 1SVEA 3ANQA 3POOA 3RNYA 4ZY4A 5D9HA 3BYOA 5J95A 3MY0A 1OUKA 4IX5A 4RPVA 4IAZA 2GTMA 3LXPA 2BRGA 4O2PA 4A9YA 4DFLA 2VTOA 4DTAA 4CNHA 4QT1A 4AP7A 5HO8A 2CJMA 4H1MA 2JKMA 3QKMA 3L9MA 5CT0A 2WMSA 4IXPA 3POZA 4IEBA 2J0MB 4F6SA 4U8ZA 4A4XA 2QODA 4RVMA 1MUOA 3S4QA 2C6TA 5BQ0A 4HVGA 2B9IA 5EQPA 4CMOA 4K33A 4O0RA 2BUJA 1QPJA 5KMIA 3NUPA 5FBOA 1H1RA 4IVDA 5IA2A 3DTCA 3R8LA 3CP9A 3QYZA 3BE2A 5FDPA 2C4GA 3OHTA 5CI6A 4IM0A 1NVRA 4PMTA 1O6YA 3CD3A 1QCFA 1DI9A 1J91A 2YCFA 3F3ZA 5D12A 3WF9A 2WZJA 1U4DA 3HA8A 3QCSA 4DBNA 4E5WA 5ICPA 3MTLA 4Q5EA 3SRVB 5JMSA 2Q83A 1LUFA 5LCKA 4EEVA 3A4PA 4U41A 5ETFA 3HX4A 4QMSA 3FMHA 4GS6A 4QMYA 2J50A 4RJ5A 1H28A 4F9WA 2JKKA 4QRCA 3U9NA 3DJ6A 1WZYA 1YHWA 4WG5A 4MNEA 2ETMA 4KSQA 5HO7A 2J2IB 3DV3A 3V6SA 3VBYA 5LMKA 3AC5A 3TV6A 2A2AA 2W0JA 3GENA 3GU6A 3LFDA 4G2FA 2J6MA 3ZS5A 4CLIA 3E62A 3GU4A 4E8AA 4FTRA 4F09A 3UYSA 4F9AA 5AUWA 4DG3E 5FDXA 2BFXA 3WZDA 4NTTA 5FD2A 5EM7A 3RZFA 2BROA 3PPJA 4M14A 5AV3A 5KO1A 1U5QA 2PVNA 5HBEA 3RM6A 3ZM4A 1BMKA 3R8MA 4Z55A 2OXDA 2F7EE 2CGXA 3UIBA 4OBQA 2YWPA 5CU4A 4DEHA 4LOQA 2HZ4A 3DK6A 2DS1A 2IPXA 2QOHA 3R28A 3UVQA 3SG8A 2QOQA 4XG6A 3NUSA 2XKEA 4YJPA 3GCPA 5DR6A 2SRCA 3I0OA 3UTOA 4C4IA 1AGWA 2VX0A 1PMEA 4CVAA 3LCDA 3LVPA 1OIYA 2RFSA 3AOXA 3WZUA 4O7SA 1WBSA 5IQHA 3EN4A 3IK3A 4FSRA 5CF6A 1YQJA 4NIFB 3OWLA 3NVKI 5FTQA 2C6IA 2EWAA 3CTQA 5F4NA 4BBMA 4MD8E 4AZEA 3FC1X 3K54A 4F7SA 1OKVA 3BLRA 4YO4A 4M66A 5IKWA 5EYCA 2RFNA 3BV3A 5BYZA 3Q4UA 4LYNA 2XK8A 4CZUA 4YGAA 5B2LA 5IQGA 4M12A 1A9UA 5EM8A 3QYWA 4DN5A 4QO9A 4YJOA 4IZYA 5HZNA 3M11A 5CS6A 2XK6A 5EKOA 2B9FA 2WIHA 3FKLA 2JEDA 3IG7A 3OW3A 3R0TA 3H9RA 3SD0A 4CFXA 4FV0A 4EK8A 2WTKB 5FG8A 5CEMA 4K77A 3ORIA 4D1XA 3PVBA 1CMKE 2R9SA 4FTCA 2WU6A 3ULZA 3VUKA 2B54A 1FVVA 1Y57A 5HBJA 4O7TA 4GRBA 3DGKA 4YBJA 4AX8A 5D10A 4FV5A 3FZRA 4YNEA 4UXQA 5L3AA 3GP0A 5HCXA 2AC5A 3OBGA 3ELJA 3P08A 3I5NA 1O6LA 4GIIA 2P33A 4UB7A 4MTAA 5AP2A 2PU8A 3QGYA 2WXVA 2Y9QA 4PRJA 5JFSA 3TZ7A 2QD9A 2R2PA 4OTHA 5KKRB 2BZIB 3QALE 1YWNA 2HIWA 4ITIA 3OT8A 5LVMA 3U87A 2VUWA 2C6MA 5FEQA 4GKIA 4R7BA 3LE6A 3LXKA 2W5BA 1YI4A 3PLSA 4NSTA 3OUNB 5B2KA 4RWLA 2ZV7A 3I6UA 4G1WA 3UYTA 1NW1A 2CNVA 4L52A 4IB0A 5DN3A 3VC4A 3BKBA 2VTIA 2C5YA 4FIIA 3PVGA 3A7GA 3BV2A 1H0WA 4ZSLA 3P79A 3H4JA 4PMPA 3BLHA 4DG0E 2GU8A 4F0GA 3MFUA 3LQ3A 1KOAA 2WMAA 4E6QA 3BHVA 4CRSA 5M08A 4W8DA 3VS6A 5K5XA 2W1ZA 2ACXA 4U40A 3VF8A 2P3GX 3GCUA 4CQEA 3H10A 3U6HA 2O8YA 3VHKA 3PFQA 1DM2A 3DAJA 3PXYA 4MVFA 4UY9A 3U4UA 1ZARA 4IAAA 4AN9A 4JQ8A 3G6HA 4QYEA 3DKGA 4U79A 4BCQA 2R3QA 3DTWA 3F2RA 3F7ZA 5IA3A 3BWJA 4AW2A 4JBQA 2QC6A 4GMYA 4NK9A 4RX5A 4J8NA 3G90X 4F65A 1CM8A 3HEGA 3VUIA 5BVNA 4OTRA 2XUUA 4EOQA 5M07A 5IA4A 4YUQA 4YR8A 2VWWA 2CKEA 1OL6A 4OTIA 4TWPA 4CKRA 3G15A 2QVSE 2ITPA 2X6EA 4EUUA 3OROA 4O7RA 2GHGA 4YSMA 4DEEA 2UW7A 2PVMA 3UQFA 3MIAA 4K1BA 4OAUC 4GIHA 4W4WA 3COMA 4FTIA 3QC9A 4C2VA 3UOHA 4DH8A 1IAHA 2HY81 4WKQA 5CU2A 3TZMA 3Q4ZA 2QOCA 2JLDA 4RQKA 4DLJA 5HLNA 4ZTRA 3QTIA 2QCSA 4FTLA 4FV4A 4IB3A 4DEIA 5K9IA 5LOHA 4DT9A 3ID6C 2HZ0A 2XIKA 3SLSA 4FKWA 3OMVA 4A9RA 3TM0A 3UZPA 2DWBA 4DGLC 2CN5A 2UUEA 4CKIA 5KNJA 2XA4A 4J95A 5FGKA 2IW8A 2XK4A 3FI3A 2R3MA 3BHHA 3LKMA 1LR4A 5JQ5A 4UBAA 3V8TA 4D1SA 1LPUA 5FEDA 4BI2A 3DNDA 5I9UA 1JLUE 4EK6A 4F9YA 2H9VA 4YJNA 3RAKA 2QU6A 3K3JA 4ZLOA 5LVPA 3IW5A 3RCDA 4I20A 5JRSA 3B2TA 4GK4A 1OGUA 4WD5A 4QMTA 2C69A 2W06A 4LQMA 3DPKA 3PVWA 2PZRA 3TNWA 2OI4X 3FQEA 5IDPA 3DKCA 4G3GA 3UIUA 2GFCA 4TWOA 3VN9A 2HXLA 3B8RA 2EXCX 3BU3A 4EWHA 3AQVA 2JAVA 3RK9A 3D5VA 5C8KA 1KOBA 3ZDIA 3O7LD 4B9DA 1P5EA 5AP4A 3ORLA 5CAPA 3ZSIA 3FMLA 1OMWA 4M3QA 4ZMFA 4C38A 3WZEA 4EH6A 1JSVA 5ITAA 1UU8A 2R3RA 3ITZA 3O71A 5HG5A 1H26A 4EKKA 1SNXA 5IH5A 3WILA 4AE9A 5CEIA 3IONA 5FWKK 2BIYA 5GNKA 2YIQA 4NJDA 4FT0A 4EC9A 3F3TA 5ACKA 3LHJA 2OZAA 4IHPA 2HCKA 4X2JA 1TKIA 4I21A 3V5TA 5IEYA 2PE0A 2QHMA 2E9VA 5M56A 5I9ZA 4DGMA 4FG9A 5H8BA 4KINA 4CV8A 3BCEA 1KWPA 3OFMA 1SVHA 4JDKA 4BGQA 3GXLA 4NM0A 5AA9A 5DWRA 3FZ1A 2QQ7A 3SOCA 4YJQA 5EHYA 4E4NA 4IAIA 4K0YA 5LWNA 1J7UA 2OH4A 2R3JA 5CY3A 4FI1A 1SNUA 3FEGA 2JDRA 4FSTA 1KV2A 4G3EA 4MXCA 5CLPA 2WEVA 5AR2A 5HKMA 5TF9A 4QMLA 4FSZA 2OGVA 4IVCA 4EOJA 5BUIA 3FI2A 4FKJA 2H6DA 4GK2A 4L7FA 3F69A 3PIZA 3A4OX 2J7TA 5D11A 4LRMA 3NW6A 4RJ6A 5LMAA 3DJ5A 3ZEWA 2YM5A 4PUZA 3BGQA 3R73A 4K9YA 4ID7A 5AP6A 5I3OA 4AGWA 4IFCA 3DZQA 4CTBA 4Z7HA 2Y6OA 2XH5A 4XG8A 4ALWA 4P2KA 2YIXA 5C8NA 3P7AA 5IH4A 4PP9A 4OTPA 3QCXA 2E9UA 4IC8A 1CKJA 2GHMA 4OAVB 5JGDA 3R7OA 4QMXA 4DFBA 4JRNA 4MHAA 2JBPA 2QKWB 4O96A 2X9EA 4JR7A 4RZVA 3R04A 4HGLA 1SVGA 2OF4A 2X9FA 5HX6A 5IUGA 1Q24A 3VS7A 1KSWA 4DE4A 4ZLYA 1AD5A 3Q53A 2UV2A 4X3JA 3WF8A 2OW3A 4D1ZA 1XH7A 3DB6A 1BI8A 3PXZA 4IH8A 1Q5KA 4J96A 1KE8A 4MYGA 5JZNA 4E4MA 5GHVA 5HU3A 3DKOA 4KIPA 5HESA 2BKKA 4ZZOA 3HECA 2OSCA 4EJNA 4Y46A 1WBTA 1PMVA 2JBOA 2JIIA 4GFOA 3KN5A 4XV3A 5CSXA 3UC4A 5CASA 3Q9WA 3HA6A 2A1AB 3DCVA 3UE4A 4DG2E 5E91A 4J7BA 4QMVA 1KE9A 2VRXA 3AMAA 2YITA 3KY2A 3HRCA 1OL7A 3FZSA 4JDHA 4UYNA 3UMWA 1NT2A 5H8EA 3JY0A 4DFZE 4JX3A 2XEYA 3T9TA 3ROYA 3WF7A 1GZNA 1NVQA 2RL5A 5BNJA 1ERKA 4KIQA 5J7HA 1OZ1A 4LRJA 4PDPA 4FKSA 3NW7A 5EW9A 4BDBA 4RVLA 4PPBA 5AX3A 2J9MA 5GJGA 5HGIA 4CFNA 3A7HA 2W17A 4D5KA 1TVOA 3CPBA 4FBXA 4JI9A 4QMUA 3UP2A 4M7IA 2OG8A 5M51A 2WKMA 3OP5A 2OIBA 2R3NA 5HTBA 2QOKA 3LCOA 3LM0A 4BCNA 4Q9ZA 4Y5QA 2C5VA 4LMNA 5F20A 4EOLA 3EB0A 4OTQA 3CCNA 1JNKA 5ANJA 1H24A 4MQ2A 4LFIA 3QTUA 4AW0A 3AG9A 3TKUA 3FQSA 5CYIA 3CJGA 2HWOA 4ACDA 1WBVA 3E3PA 3FLSA 4IFGA 4JL9A 1ZLTA 2WNTA 4I4EA 4TW9A 4I0TA 3MFTA 3P0MA 5A14A 4RX8A 3V5PA 5FM2A 4LGDA 3BEGA 4OUCA 5KMMA 1T46A 3UOLA 3PE2A 3TIYA 4ZJVA 3MIYA 2ZOQA 1UKHA 5IDNA 5HE0A 4AXAA 4A06A 4CV9A 4BCKA 3QLFA 4ZSEA 5GJFA 4JG6A 3VW8A 5J5TA 2V62A 4CRLA 4O22A 4IAYA 1REKA 2RG6A 3CKWA 1ZYSA 3MBLA 3VBVA 5A4CA 4ZMEA 4RJ7A 4G16A 5GZAA 3RWPA 3MH3A 4W4VA 3HP2A 2VTPA 4KIKB 3C0GA 4OTGA 1GOLA 4PNIA 1ZYJA 4Y5HA 4AZFA 5J79A 4H3QA 4QTBA 4AOIA 5CSVA 1ZOEA 5TE0A 5FRIA 2XJ1A 3SX9A 2QURA 4NCTA 1RJBA 4AQCA 3BQCA 4BDCA 2BDJA 5H3QA 1W98A 2Z7SA 4FZ6A 4LI5A 4KA3A 4F7NA 4O0TA 3SXFA 3QXOA 4NM5A 3D7TB 3JXWA 1MQ4A 2C68A 5BVEA 1P14A 3PJ2A 4KKGA 3FXXA 5DEYA 3SOAA 4USDA 5L8LA 4IZ5A 2F2CB 4LG4A 3F3WA 3PXRA 1UU3A 4ZAUA 5JKGA 2PVLA 3TT0A 4EQUA 1QMZA 3ALNA 4ZLZA 3DBEA 1VYZA 2XP2A 5IQEA 3NUNA 3EQIA 3VIDA 2UW8A 5LMKC 1T45A 4ENXA 4QPAA 1JPAA 2VGOA 5L6PA 1ZRZA 5HD7A 4EH4A 1JVPP 1RW8A 4YLJA 2XNPA 2AUHA 1OUYA 2J5EA 4N6ZA 3OF0A 4WA9A 4NL0A 4J1RA 3FMNA 1PHKA 4OTDA 4C2WA 4DITA 4O7NA 2IW6A 4QMWA 4CFWA 3QQUA 5BVDA 3DBQA 3FPMA 1PKDA 1H00A 3OEFX 2YM4A 5LCJA 4USFA 4C58A 4A9UA 4BICA 1GZ8A 4BDFA 2W99B 4FSYA 5LQFA 1PYEA 2VWBA 3LJ2A 3WI6A 4F1MA 4CMUA 2C6DA 4XHKB 2H8HA 3OY3A 4O0YA 1ZY5A 3ENHA 4C4HA 3TUBA 3ORPA 2OLCA 4GH2A 5I9XA 5CXZA 2O0UA 4EK5A 1G3NA 3I60A 4JS8A 3ZO4A 2W1HA 4QYFA 4AG8A 5CU3A 3KXZA 5ANOA 3PSDA 4FL3A 4BDAA 1WVXA 1YOJA 4NM3A 4DEDA 5AR3A 3I4BA 3FWQA 2ZB0A 4TYHB 5B2MA 3IDBA 4IX6A 4W4XA 4U43A 3HZTA 5DPVA 4FODA 3KKVA 1J1CA 4I92A 4OT5A 1J3HA 1IG1A 4AF3A 2NO3A 2CLXA 2W05A 5CX9A 3QQHA 3VF9A 2WAJA 4C4EA 4H3BA 4R7IA 3EWHA 3CGFA 2ZV9A 3CEKA 3I7CA 2JDVA 5HLPA 2O65A 3MVHA 3EJ1A 3UP7A 2YZAA 1B39A 3S00A 3QFVA 4EL9A 3ZFMA 2VTRA 1P2AA 4JJRA 1V0BA 3GUBA 1UNHA 2ZYBA 3UZRA 3OOMA 2I0HA 4XG2A 3RM7A 4D2RA 4BCMA 3PVUA 4KNBA 3MSSA 2G2IA 4ZSJA 3SXRA 3V5LA 4BKZA 3MPMA 3RPRA 1OKZA 2XM9A 3H30A 4FK6A 4I41A 1UU7A 2IWIA 3P5KA 3TI1A 5LARA 2ZB1A 1QPDA 4GFGA 2OFUA 4MEDA 5AAEA 2WELA 5M53A 2QOIA 4TKSA 4R78A 4U81A 4NW6A 4FT7A 4QMQA 3CLYA 3LCSA 4APPA 2WMVA 3NYNA 4PMSA 4QYGA 4CSVA 1Q3WA 2XIRA 4NH1A 4BBEA 4Y95A 4G6LA 4XRJA 1WBPA 4GG5A 2Y6MA 4QP4A 5AA8A 3F88A 1LEZA 2PSQA 3C4EA 2R3GA 3EFWA 4P7EA 5KKRC 4CYIA 3CY2A 4FTJA 4WBOA 5DFPA 3V01A 5HOAA 4CG9A 1XR1A 5E8WA 1GZKA 4RIYB 2VTSA 5EG3A 4ASDA 4DTBA 4QP3A 4HGTA 3T3UA 4PNKA 4GFMA 3BGZA 1KE5A 1OI9A 3RJCA 4AAAA 3EQDA 2X39A 2WTWA 3FZPA 1XH9A 1NA7A 3HDMA 4OBOA 2X1NA 2VTQA 2ITVA 4IWOA 3ROCA 5KMJA 5JFXA 3DLSA 4FT5A 5H2UA 3TACA 2YERA 2I7QA 3D7ZA 2UW6A 4ZS4A 1PF8A 4YJRA 3MWUA 2UZOA 3UNJA 3WZJA 3Q04A 4D9UA 4FICA 5AP5A 2CCHA 3CD8A 4BKJA 3EKNA 4AT4A 4GK3A 3CGOA 5CU0A 5EH0A 5C1QB 3GU5A 1RQQA 4UXLA 3ZH8A 3A8XA 4ZXTA 4BCGA 3FSKA 4JDJA 5AX9A 2ZMDA 3NNUA 3QRKA 3Q2MA 3A99A 3TDWA 2E9PA 1OKWA 4BZDA 3MB6A 5T3QA 3FE3A 4TYJA 3SGCA 5A6OA 5HG7A 4A7CA 3JS2A 2OIQA 4D4YA 2AYPA 2JKOA 1PXPA 2UW3A 1YVJA 1XH6A 1P4FA 5CVFA 3NUAA 1JQHA 1OIRA 2ZDUA 4KD1A 5AR5A 4BHNA 4N57A 3S95A 5HG9A 3W32A 4PDYA 3MJ1A 2VTHA 4V0GB 3NZ0A 4GYIA 3FLNC 4O91A 4QQ5A 1FVTA 5TO8A 4HPTE 4EI4A 5KUPA 4QQTA 4KB8A 3A60A 3MS9A 4FTNA 5FLFA 2F49A 5HNIX 2B52A 3SVVA 2C30A 1M52A 2FO0A 2VX3A 2YABA 4BC6A 3VNTA 5CEPA 2EU9A 2LGCA 3C13A 4UV0A 4DAWA 3DAKA 3SDJA 4XJ0A 4FZDB 5JT2A 4MBLA 1Q4LA 3FYJX 4IDVA 4MCVA 1U59A 4C4JA 2WMQA 5HD4A 4RQVA 4V0GA 4ZP5A 3D14A 2V7AA 1TQIA 3E3BX 3C1XA 3KMMA 4CZYB 5JSMA 4FKPA 2XIYA 2P0CA 4FNWA 3KK9A 2VU3A 3DK7A 4GVJA 2X7GA 2ESMA 3AT3A 3N9XA 4TRLA 5IQFA 4S30A 4YC6A 2WTDA 4YO6A 2C47A 3Q6WA 3OCTA 1OL1A 2W1FA 4FSUA 4FV8A 3QD0A 2BAQA 1I09A 5J8IA 4LM5A 3V5WA 5EOLA 2XYNA 3ORKA 3BIZA 4MNEB 1W7HA 3HMNA 5AV1A 4N6YA 2ITQA 3MGYA 3VWAA 3DXQA 4L44A 4CMTA 3CPCA 3DY7A 4FKRA 3LOKA 1O6KA 3O96A 1Z57A 4C3FA 5LXMA 4C4FA 2JDOA 4NUSA 3VAPA 4R1YA 4BY9E 3OOGA 1FMKA 5D7AA 4O0XA 4R8QA 4I5HA 3P1AA 2PUIA 3P7BA 2A27A 4JBOA 4XOYA 3OCGA 4FIGA 3RAIA 1Q62A 4A9SA 4V05A 3ULIA 3TCPA 2PZPA 2UW0A 3V5JA 3H3CA 5LWMA 3PDTA 5M09A 4LL5A 1H01A 2QOBA 2BZJA 4OW8A 2BALA 3WARA 4FL2A 3KMWA 2WGJA 4S33A 2NRUA 3UDBA 5K4IA 3LIJA 2ETRA 3K3IA 4U3YA 1S9JA 4O2ZA 5L2WA 2RG5A 3DDQA 4U5JA 3TJCA 1Y6BA 2CKPA 4IDTA 4CFFA 3QRIA 3AT2A 2OKRA 3RHXA 3TUDA 2VZ6A 3EQGA 4O0WA 4RX9A 2WPAA 5DBXA 2GMXA 4ZSGA 3E93A 1XH5A 3EQFA 4PTGA 3RK5A 1M7NA 1H0VA 2EXMA 2F2UA 3GVUA 4PPCA 4O0UA 5L6OA 2RFEA 4RC2A 2R0UA 3ZLWA 2PL0A 4U80A 2YDKA 3P23A 4C4GA 2PULA 5BVKA 4QP7A 1Q99A 3NAYA 2BRBA 2Q0NA 3RZBA 4XLIA 3O51A 3KREA 5FXQA 4J99A 2C5OA 3DKFA 4FZ7A 2VTAA 2E9NA 2HZIA 5HNBA 4XLVA 3R1NA 4BL1A 2GS2A 1OB3A 5E92A 3F2NA 1M7QA 5IA5A 2IZTA 4HNIA 4E3CA 3MI9A 4XX9A 4EQMA 3UVPA 3L9NA 3HYHA 4IIRA 3FV8A 4MF0A 2YM7A 5CNNA 5HVYA 3HGKA 4LV5A 3NUXA 2YA9A 4TTHB 4D9TA 2PVYA 4ONAA 4D2VA 4QTEA 4EJ7A 1L3RE 5M4UA 2GNJA 3RAWA 2YLEA 3VRZA 3WIGA 1YHVA 1PYXA 4U7ZA 5AUUA 2ZM3A 2W5HA 3HNGA 4XUFA 1H27A 2X4FA 2ETKA 1ZMVA 4CG8A 3TXOA 2OWBA 4AT3A 4E93A 3NGAA 4I6HA 3R7IA 4KSPA 4XEYA 3QTQA 2PVFA 5I9VA 4Q9SA 4RZWA 1TQMA 5IQBA 4Q2AA 4EH2A 4FMQA 2J90A 2ZM4A 1PXLA 3HV7A 4TY1A 2VTLA 3NS9A 3PXFA 2Z2WA 4YZCA 4Z9LA 4LV8A 3G2FA 5TOZA 2V22A 5FXRA 5IF1A 3MW1A 4R77A 4OTFA 1CTPE 2HY0A 2W4JA 3QC4A 1Q8TA 3R8UA 5E7RA 4FK3A 5A9UA 3PIYA 5FUTA 3BE9A 5JN2A 1VZOA 2JGZA 3DBDA 1K2PA 3NWWA 2ZMCA 4RWIA 3DBFA 2IVVA 3R7UA 2Z7QA 1M2RA 4CKJA 4BGGA 1XH4A 2BRHA 4X21A 3FHRA 4D2WA 2GQSA 3O0GA 1XWSA 3ZSGA 3LW0A 1Q97A 4GUBA 3E8DA 4XH6A 3PG1A 3HRFA 1JOWB 1OL5A 4IWDA 4LGGA 4TN6A 2PK9A 5KZ0A 3W2OA 3LJ1A 4IB5A 3R01A 3M2WA 4J98A 2CLQA 5BVOA 5JFVA 1VJYA 2PZYA 2WIPA 3ZO3A 5LMBA 4OT6A 4G34A 3LFQA 5T6KA 5C4LA 2PHKA 5M06A 3TZ8A 3C7QA 2BCJA 2GFSA 3M1SA 3PZHA 2BRNA 3OZ6A 4FV2A 1Y8YA 4QMPA 4YZDA 4HZRA 4MBJA 1CDKA 2QONA 4WT6A 2CGWA 5BVWA 4HVIA 4EH5A 3R7GA 4IBMA 4XG3A 2VN9A 4GU9A 3EZVA 2FVDA 5ANDA 3WBLA 3IECA 2WMXA 1OVEA 2R64A 1H8FA 4JVGA 2VWUA 2FH9A 2P2IA 3FHIA 1SYKA 4FKTA 4FEUA 4QTAA 3G9NA 4LUEA 4CYJA 1JKLA 4YJTA 4NCTC 5A4TA 4QQJA 3C4FA 2HW7A 2WMRA 2XRUA 4I0SA 4XV9A 3TTIA 3BZ3A 5EHLA 4YURA 4G6NA 3PA4A 3W8LA 1PJKA 2HWPA 3IOKA 2YDIA 5E90A 5HIBA 4C7TA 3SW7A 4MH7A 4G3FA 1OM1A 4DEAA 4UEUA 1ZZ2A 1R1WA 3R02A 4AS0A 4OR5A 1F5QA 2R5TA 4HCUA 3SG9A 4D2TA 4GU6A 3D4QA 4Y73A 4I5MA 5L2TA 2IVSA 3KEXA 3OCSA 1VEBA 4DEBA 3TN8A 4YBKA 1PXNA 2OBJA 3BU6A 3U9CA 4ZTMA 4C62A 1R3CA 3O23A 4F1TA 4F7LA 1E1VA 5HHWA 4X2GA 4YSJA 5AUXA 1JSTA 4JLCA 2YJSA 1URCA 4DFNA 3ZRMA 4D5HA 2XYUA 3HV4A 3F66A 4PF4A 5FTGA 2G2FA 2PMOX 2VTMA 5AIRA 2BIKB 3G6GA 3I81A 4ANBA 3NNVA 4BIEA 4J8MA 4RT7A 4BDJA 1S9IA 1XBAA 3I5ZA 3QWJA 2LAVA 5J1WA 1GJOA 4EONA 4EH3A 3F5PA 4TL0A 3WF5A 2W96B 2C6OA 1ZWSA 3GT8A 1WMKA 5EI2A 4AA4A 4F1OA 4UMPA 5L2SA 5DNRA 3S0OA 5J9LA 3MY5A 3GNIB 3R9NA 4DGNA 2BHHA 4HZSA 5T68A 4F7JA 2OZAB 4ZJJA 3U8WA 4JG7A 5J7BA 2HZNA 3VRYA 3GEQA 5CAUA 3EYGA 2PUUA 1W0XC 4IM3A 3QD2B 2RF9A 4IVAA 3GC0A 4IM2A 4O38A 2JFMA 2XVDA 4QYHA 1W8CA 1WVWA 1ZY4A 2OXXA 1J1BA 2F9GA 4Y8DA 4DEGA 2UZDA 4GUEA 4QPMA 3TKHA 4C57A 4NKSA 1W84A 4CTCA 5CAVA 2B9JA 3TTJA 2XNMA 4XMOA 4PP7A 1GAGA 1YDSE 3V51A 3U55A 2BDFA 2OIDA 4HVHA 5E8ZA 3ATSA 3PY3A 3IS5A 4BWKA 3NMUF 3CIKA 5HI2A 4PDSA 5I3RA 2I40A 3R8VA 1E1XA 2QKRA 2HENA 2YAKA 3SQQA 2JIUA 3D5UA 5E8TA 4FOCA 5HE2A 4FT3A 3PRIA 2ITXA 4F70A 1WAKA 3LQ8A 4NWMA 3EQRA 4F0FA 4KIOA 4ZK5A 4XV1A 4GJ3A 4IX3A 3ZUVA 4ALVA 3DDPA 2XZSA 4V01A 3HP5A 4ZJIA 3R22A 5E8XA 4R7HA 5H9BA 2J4ZA 4ACMA 5HBHA 3PJ8A 4YHJA 3BX5A 4L68A 3UMXA 3MB7A 2QLUA 2VWXA 2XJ0A 4EK4A
chains in the Genus database with same CATH superfamily
3HMMA 2XK7A 3LCKA 5K0KA 3F3VA 1KUTA 4DHJA 1J7LA 5H8GA 1CKPA 3UQGA 3ZO1A 3MA3A 3O7LB 5DIAA 3KF7A 1BLXA 2QG5A 3QHWA 5JK3A 4ZEGA 3BYUA 4JIKA 4L8MA 4FF8A 5DGZA 3W2PA 5ETCA 3D2IA 4MKCA 3ZONA 5DYJA 4PY1A 4WOVA 5EI8A 4GKHA 3TMOA 4CEGA 4W4YA 2ONLA 2QI8A 4WSYA 4H05A 3E87A 5IPJA 4XP2A 5DMZA 4XYFA 5AP3A 5G1XA 2RFDA 3DQWA 3OWKA 4U3ZA 4IJPA 3NIEA 3RINA 1W2DA 1L8TA 1KE6A 2ERKA 4L67A 1JBPE 3F7WA 3MDYA 1FGKA 1XJDA 3QD3A 3LJ0A 4GCJA 2FA2A 4GEOA 4YHFA 3MPAA 4MD7E 2VO6A 1ZYDA 4MWIA 4O4BB 1VR2A 3NYXA 4LOOA 5DEWA 1YOLA 4AA5A 4EQCA 2OJIA 4QP9A 3Q5IA 4O81A 2Z7LA 3EHAA 4H1JA 3E8EA 4YLLA 2B9HA 4MXXA 3RWQA 5AV2A 4BWPA 4EK3A 5C26A 5IZFA 2XK9A 3TG1A 2WO6A 1U54A 4HCVA 4J52A 2JKQA 3QTRA 1UVRA 4FVRA 4TYGA 4PV0A 4U97A 3O2MA 4NTSA 4FVQA 3JVSA 5A54A 4DF3A 4ALUA 3F82A 4TNDA 5LVOA 2CKQA 4AZTA 4W8EA 3W55A 4UMUA 4N4SA 2GTNA 4FKOA 3ZLSA 3KQ7A 1M17A 2P55A 2UZNA 4L3JA 1Y8GA 3F5XA 3NNWA 5HNGA 2RKUA 3B2WA 4JQ7A 4YTCA 2GPHA 2OJ9A 5EW8A 4S31A 2GQRA 4QNAA 3GI3A 3UJGA 4TNBA 3CTHA 3PTGA 4WRSA 1UNGA 3KXMA 4ERKA 3QRTA 4MWHA 5CZHA 3BEAA 5EYDA 2XIZA 4HCTA 1BL7A 5ETAA 3SC1A 4HVDA 3EL8A 3PXQA 5EKNA 1ST4A 5AUVA 1XBBA 4PTEA 4KBKA 4IWQA 3Q4TA 3BU5A 3RHKA 3IKAA 5CQWA 3MFSA 2ZM1A 2JAMA 4K18A 3TWJA 3EN5A 4F9BA 5F95A 5C9CA 5AWMA 4FIJA 4NFMA 2C0TA 2XJ2A 2YFXA 3R71A 5EM5A 4AU8A 1B38A 2BZHB 1NVSA 4DGGA 4AXFA 2WQBA 3GGFA 2BAJA 4CFUA 5HTCA 4EHVA 4QTDA 3V8WA 2OH0E 4WNPA 4AGUA 4JIAA 4QQCA 1PXMA 2WQMA 4J71A 4C34A 3UO4A 3DXNA 4YNOA 5HICA 4KAOA 3KULB 2JITA 4FR4A 4UZDA 4FV1A 4G17A 1G5SA 1BKXA 1V0PA 4JNWA 2XM8A 2OJFE 5DR2A 5AR7A 3GC9A 5HX8A 5KMLA 3IPHA 4ZZNA 4ACHA 3ZRLA 2PE1A 3CE3A 4USEA 2ZFYA 4FV7A 4I22A 4BDHA 4ITJA 4BZNA 3PRFA 3F5UA 3GQLA 4JBVA 1W82A 4HNFA 5IMXA 3BGPA 5HVKA 4G9RA 3PP0A 3F2AA 4RLLA 1UKIA 5A46A 3QQFA 3KULA 4K2RA 4X2KA 3MFRA 4R3CA 3JVRA 4BYIA 3KRRA 3LLAA 1OIQA 3RMFA 3RAHA 5BYYA 4FV6A 5EM6A 4EZ7A 1K9AA 3RPYA 2OO8X 4X6RA 3H9OA 2IF8A 5HE3A 3SAYA 4I6LA 4TWCA 2F4JA 5CVGA 2X8EA 5C4KA 4MAOA 2NPQA 3LMHA 2A98A 4L9IA 4FJVA 3QUDA 3PLAE 3LLTA 3UNKA 3SV0A 3W0RA 4EBWA 4QP8A 3QCYA 5C01A 3QBNA 5M57A 3VUTA 3G0EA 3QZHA 4UWYA 4F99A 3AC1A 1BL6A 2DUVA 4Y83A 4EOOA 3NSZA 2CPKE 4UN0C 3R7EA 4FOBA 3A61A 3EQHA 5KX8A 5ANGA 3I0QA 1GIHA 2W1GA 4ZIMA 2OFVA 3DFCB 2WQNA 2Z8CA 1M2QA 4TPTA 3KXGA 3BWFA 4BHZA 4QP1A 3M42A 4TXCA 2RIOA 4BZOA 4C3RA 4KBCA 2XS0A 4X7QA 5J9YA 2V7OA 4B7TA 5HIEA 2VWIA 3UGCA 2BHEA 3Q3BA 4L46A 4IMYA 4UALA 4ZTQA 3F6XA 4L42A 3LFFA 4XCUA 4X2NA 3TNPC 2QNJA 2BPMA 3E8NA 4FKGA 4GL9A 4BRXA 5HIDA 3AC4A 3QKKA 3ZCLA 3F5GA 4D0WA 3DXPA 2VTTA 3KN6A 3R1QA 3D5WA 1ND4A 1Q8YA 2C5XA 3GC7A 5CF5A 4BIBA 1REJA 3Q32A 1H1QA 3KL8A 4RRVA 5KE0A 3UZTA 4O84A 5B7VA 5DH3A 4O1OA 4JG8A 3UODA 2BMCA 4YPSA 1GIJA 5IEXA 4DLIA 3QGWA 4RFMA 3PA5A 2IN6A 3MPTA 2OF2A 5ANIA 3Q96A 2O2UA 3QXPA 5KMKA 5DE2A 5HTIA 4BYJA 4RIOA 4GG7A 3W10A 1PMNA 3JUHA 4PX6A 3FAAA 4KBAA 2OZOA 5E4HA 3P78A 2R4BA 4NW5A 2QO7A 4G3DA 2PVHA 3U51A 3KGAA 3RI1A 5CALA 1FBNA 3ZFYA 3BHYA 1JSUA 2W1EA 4O21A 3L8PA 3FKOA 3E5AA 4C02A 3LQ5A 4OBPA 4E26A 1HOWA 4YMJA 4L45A 3QA0A 4PL3A 5FXSA 1HCLA 4QMZA 4D4RA 4EOIA 3GU7A 4FUYA 4CCUA 3N51A 3KIOC 3AGLA 1PXKA 4O6LA 3UDSA 1UWJA 3DB8A 4FSNA 5D1JA 4DH1A 1G8KA 3FYKX 3QQLA 4JAJA 5I4NA 5K5NA 2R3HA 3EN6A 5AUYA 3PWDA 1YXUA 1OPLA 5LVNA 3O50A 2R3FA 4Z16A 3ZLXA 3MA6A 2ITUA 1YHSA 3QUPA 2X7OA 4RIXA 3VQUA 3E63A 1OPKA 3Q6UA 5CVHA 5ETIA 5M4CA 3C4WA 2QHNA 4EHZA 4O27B 3EIDA 4UYAA 3LMIA 4W9XA 2VNYA 3VS5A 2I6LA 4E6CA 2PY3A 2OK1A 4ANQA 4DGOA 2YISA 3IDPA 3TIZA 3C5IA 2VWYA 4X3FA 5HO6A 2QO9A 3SKCA 4CXAA 3AD6A 3PYYA 4GT4A 3NNXA 5BUEA 4ACGA 2NP8A 3UNZA 1MQBA 2UZWE 3V6RA 3L8VA 4FYOA 4BDKA 1GZOA 4K8AA 3FXZA 3MH1A 3OG7A 2CKOA 4I93A 2QG7A 4PQNA 5DVRA 2YIYA 1PY5A 4IC7A 3UDTA 3AC8A 3LM5A 5ACBC 3W2RA 3FZOA 3GOKA 3IDCA 3KCKA 3W18A 3PIXA 4R6VA 3HV5A 3ORXA 4RIWA 4RLKA 1FVRA 4IWPA 3R2BA 2G01A 4WUAA 4HGEA 4RC3A 3FMEA 4DYMA 3GB2A 4QMMA 4F4PA 1BYGA 3N4TA 3QKLA 4XS2A 4BGHA 3W8QA 3E64A 5DI1A 4PTCA 3FI8A 2XKCA 2VWZA 3ML1A 4E1ZA 4D0XA 3PG3A 3E88A 3QLGA 1UA2A 2YJRA 4G31A 4ENYA 3Q9ZA 2C3IB 3PXKA 5DLSA 3ZTXA 2YM8A 3PY0A 4E6DA 4FTUA 4BCFA 2ITYA 4FTKA 3MTFA 4WG4A 3D94A 3U4WA 4QTCA 5AP7A 5JH6A 3OWJA 3UOKA 3IW8A 3RBWA 2YACA 3NYVA 3WF6A 4PMMA 4BBFA 2EUFB 2C6LA 4KWPA 3ZZWA 1AQ1A 4ANOA 5CF4A 1IA9A 2YWVA 3UPZA 2UW5A 1YW2A 3DOGA 2F7XE 4RVTA 1EH4A 4R5SA 4XBRA 5CEQA 4A4LA 3ZFXA 4ANNA 3QAME 5EQYA 3WYXA 4BI1A 4E4XA 2XNNA 5E8YA 3FZTA 5FQDC 5L8KA 5I9YA 3QX2A 3II5A 3GCSA 4L00A 3ZUTA 3P7CA 4MF1A 3BBWA 3DA6A 2E9OA 3QD4A 5J87A 3LFCA 4AZVA 4FE2A 1UU9A 4PL4A 3K5UA 3HUBA 2PYWA 3F9NA 4DFXE 4I94A 2PUPA 1F0QA 3GCQA 5FM3A 5GINE 2OJJA 2JDTA 4ANMA 5L2IA 4FEXA 3OCBA 3FMDA 4P4CA 4ARKA 2YIWA 1YI3A 1J7IA 4ANLA 4DBXA 3HMPA 2VTJA 5M4FA 1LEWA 2W4KA 2JD5A 5BX0A 4M68A 3I7BA 1BI7A 5AP0A 1H1SA 2B4SB 1UWHA 5AUTA 5JEBA 2IZUA 2W1CA 2Z02A 3FY0A 5JGBA 3CKXA 3O8PA 3OTUA 3MV5A 1R0PA 3RNIA 4CCBA 5IQAA 4JRVA 2W7XA 4YTFA 1MRYA 3HAMA 3OD6X 3RPVA 1PW2A 4FTAA 2B55A 3D2KA 3DBCA 2IJMA 1XH8A 3PJCA 3TJDA 3VUGA 2GNIA 4HYIA 4L01A 3CSVA 4FEWA 3UG1A 5KZIA 3ORZA 2C0OA 4BN1A 4DH3A 1UNLA 4RMZA 2W9FB 4LV7A 2FB8A 4FNXA 4RJ8A 4EKLA 3W2CA 2UZUE 5BUJA 4H36A 2W1DA 3S1HA 3R6XA 3QQKA 3P86A 5EFQA 5I0BA 2WQEA 5IU2A 3VVHA 4XOZA 4XG7A 2VO3A 3MY1A 4XP0A 4XV2A 1XHAA 4BKYA 3VULA 4RBLA 3JPVA 1Q8WA 3H0YA 2XF0A 4J97A 2J0KA 4U9AA 3A2CA 4RG0A 3R00A 2YAAA 4RFZA 4WIHA 4HW7A 1GNGA 3NEWA 3VJNA 3NFFB 4NFNA 3TUCA 3QA8A 5BV3A 4EOPA 4CFMA 2ZJWA 2A4LA 2F7ZE 4YTHA 3KB7A 3KVWA 5L2QA 3UO6A 2V0DA 3KC3A 2BRMA 3NLBA 3NX8A 3S2PA 4B8LA 1ZZLA 4M0ZA 3V8SA 4IJ9A 2PPQA 3CQUA 2BKZA 5EOBA 2FSLX 3FJQE 2XNOA 4C0TA 4E5AX 3QTZA 5HU9A 3QZGA 5AFVA 2QLQA 3FDNA 2XIXA 4FEQA 3KRJA 4MX9A 5B0XA 3ORNA 3UIMA 3ZUUA 5FP6A 5JFWA 3HDNA 1QL6A 4AE6A 5GIOE 3KA0A 3TKIA 3G51A 3ETAA 3AD4A 4BTMA 4EZ5A 4DA5A 4KKEA 2CN8A 3EFKA 3MH2A 4TYEA 3HL7A 3SRVA 2EXEA 1WBWA 2G9XA 5AR8A 3TNHA 3BL7A 5BVFA 1DI8A 1DAYA 3BI6A 3PY1A 4RSSA 5CU6A 1R39A 4MXZA 5LVLA 1CKIA 4JDIA 3AMBA 1NXKA 5F9EA 4O7LA 2Y4IC 3K2LA 3R9OA 2KTYA 2ONLC 4C36A 2GNHA 5EDRA 5A4LA 2VV9A 4I23A 2WB8A 2XCHA 4APCA 4CQGA 5AEPA 1LP4A 2P2HA 1YXTA 4GW8A 2ITOA 2C1AA 2C1BA 3PA3A 3QRUA 4IAFA 4G3CA 4M0YA 5EYKA 1YXVA 4BCHA 3R9DA 2X2LA 3ZMMA 5K3YA 5JGAA 4MK0A 4U42A 2PZ5A 4E20A 4W9WA 3NAXA 3D5XA 5C27A 4R5YA 4MBIA 4ASZA 5JZJA 4YTIA 1R78A 5E8SA 1XQZA 4EC8A 2VGPA 5HG8A 4EOMA 3S3IA 3ZXZA 1PXJA 4JQEA 4MXOA 2W4OA 2XEZA 3UG2A 4AUAA 2QR8A 2O3PA 3TL8A 4E73A 2ITZA 4KUJA 4EOSA 4M8TA 4AOTA 2WTJA 2BTSA 4BCJA 4WNOA 2X6DA 4O0VA 5CF8A 1IA8A 4C3PA 2IVUA 4QMNA 3EL7A 2B7AA 4L43A 4ZTSA 3FY2A 5F94A 4XNEA 4UWCA 4RGJA 2R3PA 4O7WA 3PFYA 4NIFA 4FEVA 5CI7A 1CSNA 3HRBA 3EKKA 4GJ2A 3EN7A 3O17A 4UWBA 2UZBA 4GYGA 1WFCA 5DT0A 3VUDA 4YU2A 3W33A 3TV4A 3OY1A 2PMLX 4F08A 5FEEA 2PWLA 3FUPA 3H9FA 4G6OA 4L6QA 5HVJA 1YDTE 3CR0A 3W1FA 3L8SA 1GY3A 1FMOE 1IRKA 4G5PA 3UBDA 4YJVA 3PUPA 3NPCA 1ZMWA 1ZOHA 2C6EA 4IVBA 1FPUA 2HOGA 1KE7A 3E8CA 5ANKA 2XNEA 3G0FA 3RALA 3PE1A 4E5BA 3R2YA 3GFEA 1FINA 2J51A 3IW4A 3FLWA 4I6FA 2G1TA 3VS2A 4YZ9A 4EHEA 5F1ZA 4S32A 2ERZE 3QZIA 4FA2A 3UOJA 2PUNA 1JKSA 2EVAA 5A6NA 3KMUA 5KMOA 3OT3A 1Q3DA 4YHTA 2ZDTA 5E1EA 2NRYA 5EDQA 3PWYA 3EYHA 4R3RA 5CANA 4U44A 5D41A 3Q9YA 3BHUA 3A7FA 3ERKA 1Q41A 4FZFB 3Q60A 3FMJA 3MN3A 2H96A 4GT3A 4D58A 4EORA 4FV3A 2X81A 3KXNA 1VYWA 3VS4A 4QEBA 3PZEA 4BJJA 3KRLA 5CQUA 3AD5A 3AC3A 1PMUA 3HLLA 3R63A 1DS5A 3SW4A 4O7ZA 1FOTA 1GIIA 4D28A 3N4UA 5HQ0A 3OUKA 1OBGA 4HJOA 4JX7A 3F3UA 3QWKA 3TNQB 5FTOA 2GSFA 3OBJA 5CXHA 4HYSA 5K4JA 4GSBA 3SA0A 4O7VA 1YXSA 4M84A 3K5VA 4IADA 2JDSA 2WU7A 3C4XA 3ORTA 5AAFA 4BCIA 4D2PA 3TDVA 3HKOA 3W2QA 2WFYA 2CGVA 4I24A 5HE1A 5AAGA 1RE8A 2HK5A 4IB1A 4ASXA 2Y7JA 4MD9E 3PJ3A 5BPYA 3EQPA 3WZKA 2QOOA 2RSVA 4M67A 5M4IA 4E6AA 3ZYAA 4CD0A 3REPA 3GOPA 3AKJA 3T8OA 2R3OA 3DT1A 4FV9A 3BPRA 2GNFA 2UZVA 3R7VA 4C59A 4UMRA 3EN9A 4IX4A 4P90A 3W0OA 2PMIA 3ET7A 3NUYA 4FSMA 4FG8A 2UZEA 3THBA 3MESA 4F64A 1IAJA 2YM3A 4G5JA 1OKYA 4RA4A 2R7BA 3C0IA 3QTXA 5E1SA 1APME 3MYGA 4KRCA 3VQHA 3ZLYA 3OXIA 4WHZA 1ZOGA 3TV7A 4AN3A 1H4LA 4RC4A 3WIKA 3ZDUA 4L7SA 4X0MA 3FLYA 4L3LA 3MVLA 1P4OA 1WBOA 5FBNC 3CBLA 3WE4A 3ZBXA 4TZRA 3R1YA 2C3KA 3WOWA 3C50A 4JR3A 1ZYCA 4YC3A 4EYMA 5EW3A 2KULA 5AR4A 5HCYA 2HXQA 3HMOA 1PXOA 4XP3A 3R8ZA 5IA0A 5BYLA 4FVPA 3BLQA 4Z7GA 3C0HA 4IQ6A 3R7YA 3EFJA 3UQCA 5M55A 5DT4A 2W1IA 4MXYA 3FKNA 5A3XA 2BTRA 2FSTX 3MH0A 4AGCA 1Q8UA 4IANA 3VS1A 4F6WA 3Q52A 1OITA 3BQRA 3FL5A 2WEIA 3NCGA 4Z3VA 3CQEA 2J5FA 2GS6A 4XBUA 3VHEA 3RTPA 3NYOA 3NR9A 4WRGA 4C35A 3NDMA 5J1VA 2VO0A 3QQJA 3EFLA 3FLQA 3LZBA 4NT4A 4NZWB 3CXWA 4XG9A 3NW5A 4EWQA 1H1WA 2REIA 2QOLA 4OGRA 5CSHA 3RPOA 3U6JA 3KXXA 4E4LA 5JRQA 4BDGA 4RJ3A 2B1PA 5IQCA 3DZOA 3PSCA 4LL0A 4DTKA 3OS3A 2WMWA 2VWVA 3PJ1A 4M13A 4MXAA 4RWKA 3W2SA 1OL2A 5IUHA 2QR7A 1UV5A 3N4VA 3EMGA 2OICA 2X8DA 3BYMA 3DJ7A 4LUDA 3TZ9A 4EH7A 2GDOA 3C51A 4BDDA 4BTKA 4EYJA 4Y85A 3QHRA 4O4DA 4NU1A 3A7JA 5E9EA 4O83A 3ANRA 4HVSA 2WD1A 1ATPE 3EOCA 3IO7A 3NCZA 5GZ8A 4FKQA 4V04A 1ZYLA 4FSQA 1YXXA 2I0VA 4AW5A 3I79A 3LFNA 4DFYA 2BVAA 5KHXA 4M69B 4AZSA 3ZXTA 2WOUA 3AXWA 4KABA 3WYYA 4PDOA 2CHLA 4WUNA 2UW9A 2Y4IB 3R8PA 1Z9XA 1PRYA 4ZY6A 5KBRA 3BHTA 4ASEA 4DFUA 4AWIA 4O6EA 3F61A 5KBQA 3ZC5A 4LGHA 2H34A 2VD5A 4I4FA 4S2ZA 3QL8A 4A07A 1Y91A 3ODYX 4F6UA 4CLJA 5M44A 5IUIA 2XBAA 4I0RA 2I0YA 4FT9A 2WMBA 4M97A 3HV3A 3IQ7A 2EB3A 3PPZA 3BL9A 2CNQA 3SXSA 2XKDA 4M69A 3NUUA 4F0IA 3GQIA 4I6QA 3VUMA 2YCQA 2C3JA 2GHLA 4FTMA 4FG7A 5ANEA 1YI6A 3ZSHA 1OIUA 3C4ZA 3KU2A 2C0IA 4GV1A 2DQ7X 3H0ZA 2G15A 2Y4PA 4HGSA 2OU7A 4IW0A 4QPSA 3FL4A 4X3FC 3UIXA 5BMSA 5E8VA 3NRMA 1M14A 3LFBA 2IW9A 3LFAA 3COKA 4ZZMA 2WMTA 4AW1A 5CEOA 3QQGA 1W83A 4M15A 5CZIA 2R3LA 5L8JA 1U54B 5CENA 3U6IA 3UVRA 4JMQA 2HYYA 3COIA 3W16A 3QX4A 5LJJA 4O0SA 3G5DA 1H25A 3KF4A 4BDEA 4EH9A 1F3MC 5JQ8A 5TR6A 3DFAA 4WBBB 1YWVA 4ZTLA 1MRUA 4NKAA 4IZAA 4RWJA 3ZC6A 3D9VA 3L8XA 5I9WA 5AUZA 3EH9A 1YKRA 2W9ZB 3D15A 4D2SA 4EUTA 2BDWA 4O86A 4DINA 4H58A 4I5PA 3ZBFA 2V55A 2UVYA 1OECA 2P4IA 3LXNA 4A9TA 2WQOA 1BX6A 4U6RA 4BTFA 1M2PA 5DG5A 2CNUA 4L3PA 4AXCA 1IEPA 3A62A 3ODZX 4ITHA 1ZXEA 3COHA 1YDRE 4KS8A 1OBDA 3LAUA 2YCRA 3LMGA 2A19B 3T3VA 2BILB 2F57A 3IOPA 5EHOA 4H3PA 3E7OA 1ZAOA 2ZV2A 3VJOA 1Z5MA 4FYNA 5CEKA 2BFYA 5IEVA 4I5CA 3ALOA 3Q5ZA 3Q9XA 3DS6A 3FMKA 3QUEA 4LMUA 4OTWA 3KRWA 3KRXA 4CFVA 4RX7A 3FBVA 4DCAA 4C61A 4LRKA 4UMQA 2BR1A 4X2FA 3ACKA 4TYIA 5DOSA 3A8WA 3CJFA 3EQBA 5KHWA 4FNZA 5IQIA 4RFYA 3ZRKA 2FSOX 4IE9A 4NJ3A 4PL5A 3E7VA 1V1KA 4BR3A 4GVAA 4EOKA 4TWNA 2ITWA 2YCSA 3R21A 4AZWA 1I44A 2PMNX 4FC0A 4FX3A 4EBVA 4EH8A 4DT8A 3GBZA 1STCE 4BI0A 4I1ZA 4O82A 3L9PA 4F9CA 1SMHA 2I1MA 1SM2A 3CTJA 4JXFA 1KV1A 2X2MA 3PPKA 5AM7A 4AN2A 2XB7A 4ANSA 3UO5A 3RKBA 2B53A 4CT2A 1Q61A 4AFJA 5CAOA 5DHJA 2XKFA 4C37A 1V0OA 4DHFA 5AADA 1MRVA 3P9JA 5GJDA 3RCJA 1JKKA 2R0IA 4FIFA 2A0CX 1WCCA 4HYUA 4ZTNA 4L53A 4N0SA 2NYAA 3VUHA 4BVUA 2XMYA 2Y0AA 5GIPE 5CSWA 3ZO2A 1YWRA 4WSQA 4DC2A 3DAEA 2FGIA 3OWPA 5EQEA 3D0EA 3JY9A 3OEZA 3QU0A 1DAWA 5CAQA 2WTCA 4FUXA 3KCFA 1H1PA 2RGPA 3JYAA 5HCZA 3VO3A 1X8BA 1TQPA 3L9LA 3Q2JA 2QU5A 4A4OA 3C9WA 4Q5HA 4FIEA 1G8AA 5K0XA 4D4SA 3QTSA 2X2KA 1PXIA 4FGRA 4CT1A 2X7FA 2IO6A 4HYHA 4DH5A 2VX1A 1HCKA 2ZVAA 5DT3A 4D4VA 3VBTA 1XKKA 4UX9A 1A48A 4ZSAA 5CNOA 5C8MA 3NVMB 2VNWA 3G33A 2VAGA 4NEUA 1H07A 3QZFA 1JWHA 4NM7A 3ZM9A 4E7WA 4R1VA 4C33A 4NYEA 2J0LA 3AC2A 3ACJA 4N70A 3CS9A 5A4EA 4FKIA 3OXTA 3I6WA 3DK3A 3O8UA 3C4CA 1URWA 4TT7A 5AM6A 3RGFA 2ZV8A 5L4QA 4U45A 3BELA 2DYLA 3O8TA 4KIKA 2YZLA 2UZTA 3GU8A 2PVJA 3UDZA 3DQXA 4XRLA 1E9HA 3ORMA 2I0EA 3C5UA 2Q0BA 2UZLA 3KXHA 3FMMA 3VBWA 4BTJA 4YZMA 2OXYA 3QTWA 1A06A 5CT7A 5IG1A 3HV6A 5L6WL 5DRDA 4FZAB 5EI6A 3FXWA 2Y8OA 2PVRA 4JBPA 4RA5A 4FIHA 5AV0A 4H39A 4BB4A 4CGAA 4ZY5A 1FGIA 1MP8A 3R9RA 2QOFA 4P5ZA 3IGGA 4QP2A 3D7TA 3NIZA 4X6QC 3W0QA 2YDJA 2J0IA 4K6ZA 3DLZA 4RVKA 5AMNA 4KS7A 2UVXA 3G9LX 5G6VA 4FNYA 2FSMX 2E2BA 3FLZA 1Y6AA 4CZTA 2X0GA 4AOJA 4ORKA 5IQDA 4R3PA 5I5ZA 3WE8A 4JAIA 2XNGA 4ZS0A 4EZ3A 5HORA 5FP5A 4O1PA 3UPXA 3GFWA 3BYSA 3ENMA 3OW4A 3PP1A 3KVXA 2QO2A 1IASA 2UVZA 2BAKA 3VBQA 2YEXA 2IVTA 4U0IA 3DNEA 4BWXA 1WVYA 3OTVA 5DRBA 2W5AA 5EYMA 3IW7A 2NNWB 3R30A 4FTQA 2G2HA 4FL1A 3ZU7A 5E8UA 2HW6A 4QNYA 3KK8A 3KFAA 2PVKA 2GCDA 4IZ7A 3ATTA 1SZMA 1YRPA 2C5NA 3I1AA 3AGMA 4P5QA 4RIXB 5IMEA 2WMUA 3FPQA 4PWNA 2UW4A 3R1SA 5CTPA 4YPDA 3RPSA 4IAKA 2HAKA 4KKHA 3VS0A 3LFSA 2BZKB 3RK7A 4BCOA 2CGUA 4GT5A 3R9HA 3R83A 4B4LA 2GNGA 2B0QA 2X4ZA 3FC2A 2PE2A 3TEIA 3VS3A 1ZMUA 2YHVA 3ZEPA 1FQ1B 2WTIA 4G9CA 4QP6A 3UC3A 4X3FB 3AT4A 4FKLA 3MVMA 4O4FA 4ZOGA 4MQ1A 4TYHA 4DCEA 3HAVA 4YC8A 3V3VA 4AFEA 5CWZA 1U5RA 2CMWA 4WNMA 4EHGA 3DU8A 2CCIA 3IW6A 1U46A 4HOKA 4QMOA 3MVJA 3L1SA 1QPCA 3HVCA 4YJSA 2YLFA 3CC6A 3HMIA 4MNFA 5J9ZA 2X8IA 1JKTA 1B6CB 4RIWB 2YN8A 3BBTB 5C03A 4YZNA 3VBXA 2WTKC 3OC1A 4BDIA 2J0JA 2O63A 5HLWA 2JC6A 2ZAZA 3Q4CA 4OLIA 4AGDA 2CSNA 4QOXA 5DA3A 4YZBA 2XCKA 1XBCA 4WO5A 3LFEA 4B6LA 3JR1A 1QPEA 3EQCA 3MJ2A 3ZOSA 1R0EA 2YM6A 2WOTA 4JOAA 2YIRA 4BF2A 4LOPA 2VO7A 4QYYA 4S34A 4BIDA 3QRJA 2GQGA 4BCPA 1BUHA 4FTOA 3LPBA 2AQXA 4FSWA 4WNKA 4HPUE 4O7YA 4II5A 4YLKA 4AA0A 3HUCA 2HELA 5TKDA 3EZRA 2JFLA 2PZIA 2GS7A 2XRWA 5AIKA 5KCVA 1Q8ZA 3OVVA 2FUMA 5AJQA 4ZTHA 2JIVA 2AC3A 2VTNA 4QD6A 1IR3A 1YOMA 3BYVA 4Y72A 2ITNA 4ACCA 3SHEA 3AMYA 3E92A 3VW6A 3ZHPC 4RJ4A 4WG3A 3BLAA 4KRDA 2R3IA 4PPAA 4YP8A 2IZSA 5CSPA 3RVGA 4AACA 2GNLA 4I6BA 3IGOA 2XK3A 3TNIA 5J5SA 5DR9A 4YJUA 2ITTA 4B0GA 3U54A 3LXLA 3A7IA 3GC8A 5BMMA 5GZ9A 4RIYA 3FI4A 5IA1A 2V5QA 5D7VA 4UZHA 2Z60A 2R7IA 1RDQE 1WBNA 2XNBA 3P4KA 4B99A 4ERWA 2Z7RA 2EB2A 2O64A 3FQHA 1PKGA 2OJGA 2PTKA 4D55A 2CDZA 3ZZEA 5EDPA 4UMTA 2WHBA 2FYSA 3LCTA 1OPJA 3QCQA 1XO2B 5TT7A 1G8SA 3BRBA 5AV4A 4DH7A 5EK7A 2XANA 4XG4A 3CQWA 1O9UA 3D83A 2IZRA 5HEZA 4J53A 3FSFA 3B8QA 3CY3A 4IACA 4K11A 4FKUA 1NY3A 2IG7A 3OXZA 3GCVA 4FTTA 4FKVA 4F63A 4C8BA 1JAMA 4B8MA 2XBJA 3V04A 3T9IA 2C6KA 3PSBA 4I3ZA 5KMN