2BAQA

P38alpha bound to ro3201195
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
347
structure length
329
Chain Sequence
RPTFYRQELNKTIWEVPERYQNLSPIGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDELKILDFGLAYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Mitogen-activated protein kinase 14
publication title Prevention of MKK6-Dependent Activation by Binding to p38alpha MAP Kinase.
pubmed doi rcsb
source organism Homo sapiens
total genus 107
structure length 329
sequence length 347
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2005-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2baqA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2baqA01
3K3JA 3TJCA 1PKDA 3FZRA 3KULA 4JQ8A 4F9AA 5DLSA 3HV4A 5IA0A 3KF4A 1XH8A 2BIYA 1IAHA 3PXKA 4EOQA 4EYJA 3MJ2A 4X6RA 2BAQA 4HGSA 5AV1A 4ZIMA 5BVWA 3SG8A 2XK7A 4D4YA 4NW6A 2QONA 4L01A 3KXGA 4XCUA 1OPLA 3OWKA 5HHWA 2OFVA 3DAJA 5A4CA 2ONLA 3NRMA 4O0UA 4U44A 4YC3A 4CQEA 4QPMA 4YSMA 3FE3A 2I0VA 1B6CB 3KN5A 3VS1A 3M11A 4DHFA 3TL8A 4I6FA 4FTAA 5ACBC 2PSQA 5FEEA 2Z2WA 3SOAA 3EJ1A 3FBVA 1PXOA 3DDQA 1KOBA 3KL8A 4NKSA 4RLKA 4YLJA 4TKSA 3ZSGA 4KNBA 4Y72A 5JFVA 2YIYA 4PY1A 2ITZA 4FKRA 2Y9QA 1A48A 4GSBA 1BMKA 5C4KA 2A27A 4I22A 5BUJA 1M7NA 3OCBA 3QCQA 1V1KA 4HCTA 5HBEA 5BVOA 3OY1A 1WBPA 4X0MA 3OG7A 5I9UA 3R9RA 3TT0A 3NNXA 3UE4A 5JQ8A 4IX6A 5FEQA 2KULA 4YJVA 3GU6A 3KCKA 4EZ7A 4NW5A 5M09A 4PPAA 5TF9A 4L6QA 3WF6A 4KWPA 3AG9A 3FMHA 4AUAA 3UVPA 4BIEA 2YIXA 1REKA 4C4HA 1ATPE 2C4GA 2BKKA 2QD9A 2FO0A 1REJA 3SW7A 4IVCA 3QHWA 4FIJA 3A4PA 3ORLA 3BLQA 3DKCA 4EHGA 4LMUA 2VNWA 4M15A 2W1DA 3NYXA 3ZO4A 1O6LA 1WVXA 3NAXA 1VZOA 1OUKA 4GIIA 5H8GA 3CSVA 2ITUA 4C4GA 3GQIA 2BPMA 4KRCA 1OKVA 3ZSHA 4DE4A 2UZDA 3AC4A 4RZVA 4DFBA 3ZO1A 2X4FA 1NVRA 2W1CA 3IW5A 1DAWA 3CR0A 3MIYA 2PVYA 4APCA 3HKOA 4AW1A 4DEBA 4A9TA 1K2PA 2PVKA 3QUPA 4O91A 4XG8A 4AT4A 4BTMA 3BBTB 3FQHA 1P4OA 4WO5A 5CVGA 5IQAA 4G9CA 4FA2A 3LAUA 5IF1A 3HRCA 4KKEA 3TCPA 3PA5A 2XCHA 2HZ0A 4I4FA 4QMSA 3NLBA 3QTXA 5HG8A 5HE3A 1ND4A 4KBCA 4A9YA 3RPRA 3LMIA 4OR5A 2VZ6A 1YVJA 4OBPA 1Q8YA 2ERZE 4BDGA 3MTLA 2W17A 3LFEA 1WBTA 4FYOA 3SG9A 4QP7A 4FTJA 2HZ4A 4PV0A 5CNNA 3CJGA 4HGTA 4XV3A 1VYWA 3PYYA 2UW8A 3CKXA 3QQJA 4J1RA 4N0SA 3C13A 2QOCA 5TT7A 4BCHA 4RIOA 3A60A 1ZLTA 4WHZA 1PXMA 2PUUA 4JX3A 5DH3A 3T9TA 4F65A 5CT0A 4EH2A 1T45A 3PLAE 3DBDA 1MRUA 2OIBA 4ITJA 4ZOGA 5JK3A 3AGLA 2BAKA 2JDTA 1HCLA 4D2VA 3MSSA 1BLXA 3Q6UA 5LMBA 5A6OA 5CWZA 1YOLA 3MA3A 1XH7A 4G17A 3R73A 2Y6MA 4AZSA 3HAMA 3CQUA 2E9VA 4NT4A 2HENA 2JIUA 4BIDA 3M2WA 2PVLA 4EKLA 4MXZA 4X3FC 2IVSA 4FI1A 2J0KA 2WMQA 3HRFA 3NUAA 4KA3A 1RQQA 1W98A 3ORZA 4JRVA 4ZZNA 3QCSA 3HVCA 3JXWA 4GW8A 2PMNX 4RJ6A 5AR2A 3S4QA 5EI6A 3UNJA 3ZDUA 4AP7A 3NDMA 5D7VA 4UWBA 3R22A 3COKA 3E8DA 4E3CA 4MWIA 3ZRMA 1JVPP 4BKZA 3ZBFA 4GVJA 2UW4A 3IW8A 3NVKI 4A07A 1WBOA 3BIZA 3P7AA 2WXVA 1IASA 4XMOA 3NVMB 4E5BA 2BHEA 4NIFB 3TACA 2RIOA 1XWSA 2XIYA 2ZOQA 4YP8A 4O7RA 4JAJA 4L53A 4WNPA 4BZOA 4C8BA 1OGUA 2JIIA 3BHYA 3NUUA 4E4XA 5HQ0A 2GNIA 3ITZA 2GQRA 3ZC5A 3U54A 3QCYA 4I0RA 2VX1A 3MPAA 2QCSA 3BYUA 5HTBA 5JGDA 3A99A 2JAMA 4BCGA 5BYLA 4FE2A 4D0WA 3GT8A 3GC0A 4TYGA 4H39A 2BDFA 2ETKA 4F64A 3EFWA 4AF3A 3I4BA 5A4TA 4QTDA 4CSVA 3POZA 1W84A 4YC6A 3RM6A 2XS0A 4O0WA 5ANKA 5GZ8A 2XP2A 1PRYA 1KSWA 1RW8A 2Z7LA 3G33A 5HI2A 2WIPA 3QD0A 4L43A 2IZSA 4OTDA 4QMUA 5HU3A 5HE0A 4NFNA 3PY3A 5KMNA 5BVEA 4UYNA 2XK6A 5JEBA 4IAKA 3SXFA 4WT6A 4C58A 1G8AA 2WOTA 2ITOA 3UIXA 4ERKA 5GJGA 2GQSA 3PPJA 1BI7A 3QTUA 4E26A 1FQ1B 2DUVA 4IJ9A 5A14A 4UWYA 3NS9A 4KSPA 3MESA 3LW0A 2H9VA 3PXFA 4KIKA 4DG2E 3ZUVA 3BHTA 4FT0A 4JNWA 3ERKA 4J99A 3BELA 3E3PA 3KXXA 5AUTA 4C3PA 1OVEA 4FTCA 1CMKE 4FKIA 3PXYA 2PWLA 4QMYA 2JDSA 4EJNA 1GIJA 4UY9A 5EDPA 4MVFA 4HJOA 4O7ZA 3LFDA 4K18A 4FL3A 4MYGA 1DM2A 2QOLA 2UZNA 4JG6A 4JR3A 3ULZA 3IG7A 3TV6A 4ZLYA 3FZPA 3AT4A 3RJCA 4XG2A 2DQ7X 2IN6A 2OWBA 4JXFA 3AMAA 2X39A 4H1MA 4N70A 3OTVA 4YR8A 3ZDIA 4R77A 1YI6A 4G3DA 3UIMA 4Q9ZA 3D5VA 5HBHA 2H96A 2C1BA 2G01A 2KTYA 4KRDA 1PMNA 4JR7A 4MD7E 4RRVA 1R3CA 2Z7QA 2GHLA 4NL0A 4PF4A 2C30A 2OZAB 4ZTRA 1GIHA 2C3LA 5I9VA 3O7LB 5BQ0A 3D5UA 4W9WA 2WO6A 1OL6A 2ZM1A 3AMYA 3P4KA 4CTCA 3FC2A 5EQPA 4C02A 4JDKA 4NJ3A 4P90A 2VTPA 5AP1A 1G5SA 3R7OA 4EBVA 5IEYA 4F4PA 3ORPA 2W4OA 1LR4A 3VQHA 5FDPA 5IZFA 3ETAA 5E8TA 3SV0A 4O6LA 2X7GA 3E87A 3EH9A 3UG2A 3U8WA 5K5NA 3FUPA 3VS6A 3L1SA 4G6LA 3PRFA 5DRBA 4EOLA 2RFNA 4IW0A 4KIPA 5EM8A 3DBCA 5IH4A 3VBXA 3K3IA 3PG1A 2J7TA 2Z7RA 5AMNA 1U5QA 4QMPA 3V5WA 3D4QA 4R8QA 5C26A 3ENHA 1OZ1A 2BHHA 2X8EA 2ACXA 1SVGA 2W9FB 3P5KA 2VX0A 3D7TB 3PIZA 4X21A 3VWAA 3R8UA 3TZ9A 5AP6A 4G31A 4CFUA 4JT3A 2XEYA 3LCDA 4BY9E 2W99B 3AD4A 3OS3A 5E8ZA 3GP0A 3EN5A 2EXMA 4C7TA 1UNGA 5HU9A 3ROCA 3PWYA 3ORTA 5JN2A 3GU5A 4AT5A 5CSXA 4C4IA 1OM1A 5A4EA 2CNUA 1YI4A 3LLTA 4F7JA 3F3UA 4JG7A 4L42A 4M8TA 1NVQA 4YGAA 3KXHA 2WMWA 5LCKA 1H00A 2X6DA 2PVHA 2V62A 2W5BA 3L8PA 3R63A 4IX4A 4UB7A 5CSHA 5E8YA 3ZFXA 2Z02A 4IWOA 4QMLA 3SXSA 4KS8A 4CNHA 4W4XA 4P7EA 2XJ2A 1Q62A 4M69B 4ERWA 3QKKA 4QMMA 5BPYA 1XBAA 2PMLX 2GU8A 3HMNA 5BYYA 3PWDA 5JSMA 2CCIA 2EU9A 3HX4A 1ZXEA 3FDNA 4GFMA 3VULA 5JGBA 3GCVA 4O86A 1IA8A 1BI8A 5JRSA 4ASXA 3D5WA 3SQQA 2Y6OA 2XNEA 4FMQA 2ZM4A 2B54A 5AUXA 3KCFA 1KV1A 2OF2A 4FV0A 4JAIA 3GC9A 3PVUA 4B99A 4C3FA 1KE6A 1NW1A 4YZMA 3JVSA 3FI4A 3W8LA 3VUGA 2XNBA 2QOBA 3HUCA 4XBUA 4O82A 2JKMA 3W1FA 3OWLA 3NZ0A 5A3XA 5HCYA 5GHVA 5EOLA 3I6WA 4TYHA 3TN8A 1OPKA 3U4WA 4D2RA 4FK6A 4EOIA 4DH3A 4QMTA 3O8TA 2JIVA 3MFSA 1NA7A 1ZMWA 2Y4IC 4FSMA 4L9IA 4TZRA 4XOZA 3RK7A 3W18A 3V5TA 5CF8A 4ZSJA 2WQEA 3BRBA 3LFBA 2RGPA 4FTMA 5EDRA 4RIYA 1Q41A 4M68A 3PRIA 3R00A 4K9YA 3QTWA 3VUDA 4H3BA 3WF7A 2C3KA 3D5XA 3DNEA 5FQDC 4I21A 5AP7A 4CEGA 2I0HA 3R30A 1OIRA 3U55A 1QL6A 3BYVA 3UGCA 4BVUA 2XK3A 3SRVA 4EOOA 4LRKA 3CY3A 1FGKA 4OTPA 2BRMA 4EK8A 3FZSA 3HZTA 1PMUA 3LXPA 1U54B 5CXHA 5DR6A 2CNQA 3OTUA 4FGRA 3UZRA 2IWIA 4UMQA 4MAOA 3EN4A 4WIHA 4J52A 4KBKA 4E20A 5CEPA 3C4ZA 3U9NA 5EH0A 2WEIA 3FC1X 4XBRA 5F94A 4PMPA 2G2FA 2IW6A 2IZTA 2J2IB 4PRJA 4RWJA 1CTPE 4MXYA 5IU2A 4EUUA 3OD6X 3AOXA 5J1VA 4K11A 2QG5A 5E92A 5AAEA 3P7BA 4EBWA 3VIDA 1MRVA 2B55A 3QF9A 4KIOA 4UXQA 3K2LA 3WZEA 4Y85A 2ITWA 2BKZA 1PXJA 4FR4A 5GIOE 4HNIA 1PYEA 3ATSA 4DGMA 5ANDA 1Q8TA 4OAVB 3NUYA 2C6TA 3SKCA 4CYJA 2FH9A 2W5HA 5C03A 2VO6A 2XZSA 2VX3A 3HV3A 4IM0A 3ZYAA 1GZKA 2RSVA 3G51A 4QNYA 4AZVA 3A62A 4FVPA 3U87A 4D4SA 1YXUA 3KXMA 5C01A 2JDRA 2YM5A 3VS7A 4BKJA 3QRTA 4NM5A 3WF5A 4H05A 3KVXA 3OOMA 4FSNA 4MKCA 2C5YA 4DC2A 2OU7A 4F7LA 2NPQA 4I0SA 5KZ0A 1P5EA 4EOKA 3AC1A 3BLHA 1QPEA 4ZSEA 3DCVA 3W2SA 2ZMCA 4QPSA 2LAVA 3C0IA 4XLVA 5TKDA 2QOKA 4QTCA 2QO9A 2UVXA 3SW4A 3ZS5A 4AZFA 4JLCA 2OSCA 1Z9XA 5T68A 3QXOA 3PZHA 3U9CA 5DT3A 5JFWA 1QCFA 2UW9A 3ZLXA 5IMEA 1OIYA 2V7OA 3DBQA 3PJ3A 4I23A 4WNKA 3L8XA 4K77A 3HYHA 4B7TA 3BBWA 3KRXA 5A6NA 4YTCA 3Q32A 3R6XA 2FYSA 5IISA 4F70A 5HBJA 5FTGA 2P3GX 2PZ5A 3QQKA 4C61A 4DEIA 3KFAA 3W10A 3BZ3A 2O5KA 1XBCA 2QODA 2BZHB 3TIZA 3KULB 1R0EA 4CRLA 4M84A 2OK1A 2JDVA 4FIGA 1J1CA 4HVIA 3PXQA 4C3RA 3GUBA 4HVDA 1XKKA 3R2BA 2FUMA 1UNLA 2HK5A 4PTCA 4RT7A 3V51A 3IQ7A 2YWPA 2QURA 2JD5A 3OF0A 3DKOA 4FKUA 2J0LA 4Y95A 1YI3A 4GRBA 4D55A 3I7CA 3C4CA 3DTWA 4BDDA 1H8FA 4EHVA 4U79A 2P33A 2XJ1A 3G5DA 1JNKA 4EH8A 1JSUA 3R83A 3WE4A 4HVGA 3MS9A 4X3JA 5JFXA 2F7ZE 4DYMA 4E8AA 4AGWA 4MH7A 5J87A 3O17A 2R5TA 3HDNA 4MEDA 5FXQA 2QHNA 5AIRA 2J5FA 5M53A 4RIWA 1BL6A 1PXPA 4ZY6A 2E9UA 3BEAA 3MH0A 5DEYA 3SLSA 4AA5A 5KBRA 3EFJA 3JY0A 1HOWA 5B0XA 3RPSA 3DY7A 4IVBA 3QU0A 5LVNA 3RAWA 1XH6A 2QU6A 3NUNA 2J5EA 3QYWA 3MH3A 4JS8A 4BTJA 4DH5A 4F9BA 2ETMA 3BQCA 1VEBA 4CFFA 3BGPA 2YM4A 3QRUA 3BHHA 3BU5A 3Q3BA 5EG3A 3V3VA 3RAHA 3C50A 5DGZA 4C4FA 4PPBA 1ZMVA 3AC3A 3OWJA 3LFNA 2ITYA 2W1HA 1GIIA 3GBZA 3QZFA 5AUWA 5KZIA 5CAPA 1H01A 2YCFA 4PPCA 4BDKA 2GCDA 3R9OA 3H10A 5AFVA 4IDVA 2O8YA 2A19B 3R1SA 3MH2A 3ORXA 1TKIA 4ANMA 4O7NA 4C4JA 4YTIA 2J6MA 2R3HA 3QWJA 4IM2A 2B9HA 2W1FA 2FSTX 1H26A 5HZNA 2PZIA 4L8MA 3RWPA 3UQGA 1YRPA 4ZP5A 4XEYA 4EJ7A 4G3CA 4GT4A 3VAPA 4F08A 4PWNA 1F3MC 4HGLA 5IA5A 4BF2A 3FMLA 3LXKA 2C69A 2QOOA 4BHNA 1CKJA 4FTOA 4RJ5A 4JBQA 3T3VA 4C0TA 4JDJA 2UW5A 2VWBA 1GY3A 4E4NA 4NJDA 2VTMA 4D58A 2PE0A 4UEUA 3Q4UA 1OL7A 2WB8A 4QP1A 4V04A 3CE3A 3OY3A 3FY2A 3CPBA 1UNHA 2VN9A 4G5PA 3NW6A 4HYIA 3FI8A 3FL4A 1CDKA 3C51A 4YLKA 3QBNA 3CD8A 5B2KA 4LMNA 3V01A 1Q3DA 5HE1A 3L9PA 4J71A 4IQ6A 5EKOA 5HLWA 4R5YA 4IZ7A 5EYDA 3V5LA 5DMZA 3RKBA 2XNMA 3DS6A 3LFSA 5J7HA 5M57A 1PMEA 3A7GA 4D5KA 3SGCA 2C0OA 3NNVA 3PY0A 4BZDA 2QO7A 3KMUA 5AX3A 4DFZE 4GK2A 5A46A 1DS5A 1MP8A 2I6LA 3FV8A 3C1XA 4B4LA 3DJ5A 5AR7A 2R4BA 4IBMA 4O1PA 4PQNA 3O0GA 2WD1A 3QRJA 4GU6A 4EH6A 3UNZA 3RALA 4AQCA 5KMOA 2F57A 4Q5EA 1UKHA 4OTQA 4Y83A 3V04A 3PP0A 3PA3A 2I0YA 3FMNA 3Q6WA 3WF9A 4QRCA 2XIKA 4P5QA 5FP6A 4BWKA 2H34A 4M0ZA 5CU6A 5TE0A 3RCJA 3FEGA 4GL9A 2PUPA 3RNIA 5I3RA 5BMSA 1CKPA 2YDIA 2C5VA 2OO8X 3JVRA 3H30A 2C6DA 1J3HA 4ALWA 4D1XA 4QQTA 4L45A 2PZYA 4FL1A 4W4YA 3GCSA 4R78A 1PXNA 1FVTA 2G1TA 4CZYB 4W9XA 5EHOA 4NK9A 5J95A 2VTOA 3HECA 1KOAA 5IUGA 3VUIA 1Q8ZA 5HVYA 4V0GA 3F7WA 1E1VA 4F6WA 5C9CA 3I79A 4RFMA 5DBXA 2WQNA 4B6LA 3ZZEA 2W05A 3QAME 5I5ZA 4CLJA 3ORMA 4MBIA 5DT0A 5IUIA 4NKAA 4TWOA 3R21A 4I92A 5CT7A 4CKJA 1H07A 3L9LA 4WG3A 4FV6A 3CS9A 4RC3A 4AGCA 3NAYA 2YM7A 2JDOA 1FGIA 1YWNA 2W96B 3S3IA 3V8SA 2IZUA 3OCGA 3N4UA 3F5PA 2VU3A 3TZ8A 5J7BA 3VN9A 1GAGA 3QL8A 4L68A 3UMWA 4YJRA 3C4EA 4RX9A 4ZS0A 3PFQA 3MFTA 4OBQA 4QMVA 4WD5A 2WZJA 3E92A 4ANOA 2BZKB 3EN9A 4U42A 1OBGA 2VTSA 2VO7A 3MWUA 4QP4A 2I1MA 4G9RA 4FYNA 3ZO2A 4B9DA 3C4XA 4BCMA 5EW8A 1JSTA 4YBJA 1Y8GA 3GU7A 3H9FA 2OW3A 3O2MA 3QZGA 4O0VA 5LMKC 3OCSA 5CU3A 5EM5A 3AD6A 4OAUC 3BPRA 3T8OA 2Y4PA 2VUWA 4DA5A 4CMOA 2XRUA 4JDHA 4O84A 5GJFA 2QVSE 1U4DA 2GMXA 2V0DA 3DB8A 3W55A 4BICA 5L6PA 2E9PA 4GVAA 2UZVA 4BWPA 3NWWA 4DBXA 4UV0A 1A06A 2VTQA 4GT5A 5T6KA 2IJMA 5E90A 3MFUA 3LVPA 2P2HA 3MH1A 4S31A 2CGXA 4FTKA 1Q4LA 5C1QB 3P7CA 4L00A 1ZOHA 5IA1A 3QTSA 2FSLX 3CD3A 4WBOA 3E8CA 5HESA 5LVLA 3D14A 2PYWA 4RA5A 3E93A 5HCXA 4BDCA 4FSUA 2DWBA 4O6EA 4XYFA 4ZTQA 1V0OA 3PY1A 5FD2A 3T3UA 4WOVA 3RCDA 4TW9A 4RLLA 4EQUA 2ZV2A 3LQ8A 2RG6A 4DFUA 2OXDA 1NXKA 4TY1A 3MGYA 1OI9A 4OT5A 4KUJA 1A9UA 3IPHA 5C8KA 4QP9A 4X3FA 4JDIA 1ZYSA 4NZWB 1IRKA 2OICA 3EHAA 4LGHA 3TV4A 3OC1A 2R3LA 4LUEA 5IQHA 5CVFA 2G2HA 5K0XA 4BDAA 4E5WA 2NP8A 5E7RA 4YJSA 2IO6A 4FKLA 5JT2A 4IADA 2UZLA 1M17A 4HGEA 4YZDA 2GNFA 3D9VA 4QYHA 4RBLA 3UQCA 3QTRA 3ZM4A 4U8ZA 4ZLOA 2WGJA 5CSVA 5EW9A 4MHAA 3KMMA 4HYHA 4D9TA 2BZIB 1Y57A 5J5TA 3VBYA 2R7BA 3S2PA 5FM3A 5ICPA 1RJBA 3PG3A 4LFIA 3HV6A 4A7CA 4BDFA 3TZ7A 2X7FA 4E1ZA 5HG9A 2CGWA 5DNRA 1M7QA 5AR8A 4YMJA 5AM7A 4BGQA 3Q04A 3QQHA 4NYEA 2BR1A 3NYOA 3MV5A 3CTHA 3R8VA 2OXYA 4FV9A 2WEVA 3CIKA 4AU8A 4RVTA 5FRIA 4W4VA 4BI0A 4K0YA 3A2CA 3KREA 4ORKA 4I4EA 4DH8A 4WNOA 5HIBA 2WTKB 3IGGA 4LOPA 5E8WA 4RVLA 3EQDA 2XBJA 4MXXA 4BFMA 4UMUA 3KU2A 3OXZA 5K0KA 4O7YA 3BWFA 5FWKK 4O83A 4FG8A 4AA0A 3NYVA 4FKWA 2QQ7A 2XM9A 5KMMA 1PXIA 3G0EA 2UZOA 3SDJA 1Q8UA 1I44A 3BCEA 3DPKA 4TYHB 4GG7A 5L2TA 2ESMA 3CJFA 5F20A 3TXOA 3LM0A 4MNEA 4AACA 5E8UA 3POOA 3WI6A 3TZMA 2XVDA 3ALOA 3LCKA 5I3OA 4G34A 2WMBA 1J91A 4RIYB 2JBPA 4ZY5A 3OMVA 3F69A 3QCXA 2VTHA 3GC7A 1CM8A 5BYZA 4M66A 5ANGA 3TKUA 4QTBA 3EQPA 4RWLA 2WMXA 4X2JA 3H0ZA 3OT3A 3SRVB 3VJNA 3R02A 3ZXTA 1W82A 4QT1A 4AX8A 3KK9A 5BVKA 4LV8A 5JGAA 3C5UA 4FTNA 4QMOA 4CCUA 4ITHA 3A7HA 3C9WA 1JBPE 2AC5A 2C5XA 2YITA 3PSDA 3TNIA 1UU3A 2XB7A 3FLSA 4QPAA 3K5VA 3THBA 5DN3A 4ZEGA 2CCHA 4FZ6A 4CFVA 1KE9A 4O7LA 4J53A 3KEXA 5CF6A 1S9IA 3LOKA 3FL5A 1OB3A 3LJ0A 4AN3A 4BDEA 3SX9A 2R3JA 2X81A 3QALE 5CI6A 5TOZA 3DZQA 1O6KA 2IZRA 4ACGA 4EQCA 2OKRA 4JVGA 2PZPA 3GEQA 3GCUA 3RAKA 4NM3A 4F9CA 2VWYA 3PP1A 3TEIA 4ZTHA 4F0FA 3ZTXA 4D2TA 4DEDA 4FF8A 1Y91A 3MVLA 4RWIA 3CC6A 2OXXA 3KXZA 4IFCA 4XG7A 4AT3A 1PXKA 4N57A 2P2IA 2IG7A 3RM7A 2YISA 5HGIA 2X2KA 3LKMA 3ENMA 4DTBA 3RPVA 3GVUA 3QGWA 1M2PA 2ZB0A 5IA4A 4EOPA 1V0BA 4OTRA 1FPUA 4TYIA 2QU5A 3TDWA 3UO6A 1I09A 3DDPA 1OIQA 4WA9A 4XRJA 4BTKA 4YHJA 5K9IA 5LXMA 2I7QA 1DAYA 1R1WA 4WSYA 3I81A 3P78A 4FKPA 3RP9A 2CKPA 3WIKA 4A9UA 3BU6A 2Z8CA 2OH4A 4I5CA 4RVKA 2O2UA 4A9SA 4QMWA 5DWRA 2C6OA 2UZTA 4ALUA 3WOWA 4OTGA 4RIXA 3IECA 4GUBA 2BZJA 3EB0A 4GYIA 4OTFA 4I5MA 3UJGA 3TNQB 3UOJA 3W2RA 4F9YA 4H1JA 4ZAUA 4GU9A 2OLCA 3P9JA 3C5IA 3A4OX 3Q4CA 2ZDUA 3KRWA 2B1PA 3I60A 2REIA 4IC8A 1SMHA 1R0PA 4PDOA 4Y46A 4RJ7A 5DFPA 2B9IA 2YIRA 4PL4A 5HO8A 2ITQA 4FODA 3BGQA 3HMPA 3LM5A 2G2IA 4CFMA 5HLNA 3N4TA 3R7IA 2AUHA 2FSOX 3ZEWA 5B2LA 5I4NA 4QYFA 4ZS4A 3R8LA 3ZUUA 1YHSA 2OIQA 5EDQA 3UC4A 5M4FA 2W0JA 5EFQA 3W32A 4FNZA 3A61A 3UC3A 5F95A 4FKSA 5CNOA 4E5AX 3CLYA 1YOJA 5AAFA 2JFLA 3JPVA 4AFEA 2GSFA 4HNFA 3Q4TA 4CXAA 3TUBA 2W1EA 3QZHA 4I6QA 3NUSA 2OJ9A 4XOYA 5BUEA 2HWPA 4U7ZA 5CAVA 4A4LA 3EWHA 1Y8YA 2XKDA 5KCVA 2ITPA 4RIWB 4DGGA 1XH4A 3UNKA 4XP2A 2QOHA 5H8EA 2ZV9A 3F66A 5BX0A 2PE1A 3A7JA 4ANLA 4FIIA 2YM8A 3FLZA 4FOCA 2QKRA 3KKVA 2PHKA 2J90A 3PJ2A 3RAIA 3KY2A 4FVRA 3SVVA 4DN5A 4IB0A 5E4HA 5E8VA 4C36A 4L44A 5T3QA 1FBNA 5M4IA 2ZJWA 5DOSA 4HW7A 5HORA 3UZPA 2BDJA 3OBJA 3W2QA 1KUTA 4NH1A 4TRLA 3TUDA 3DOGA 4RX8A 2B9FA 4DAWA 4BCQA 2EWAA 4CD0A 5KKRB 5LWMA 3SXRA 2O0UA 2GS2A 1K3AA 2X9FA 3MVMA 3FZOA 4OT6A 2VWIA 5J1WA 3NNUA 1STCE 4D2SA 4F99A 3ZFYA 3C4FA 4IZAA 4UYAA 5ETCA 2WTVA 2CJMA 2QI8A 1GNGA 3F82A 1SM2A 3OVVA 4QP3A 1LEWA 2BRHA 1Q8WA 3PVBA 4IACA 4QP8A 4O27B 4CZTA 4YPSA 2ZM3A 4IE9A 3EKNA 4OBOA 4E4LA 5HO7A 5M4UA 2VTLA 4A4OA 4AN2A 2R3MA 4AW0A 2Q0NA 1JKSA 3LLAA 4J98A 5EYMA 4FV4A 4O0RA 2UVZA 5ETIA 4E73A 2Y0AA 2VTIA 3WARA 4AAAA 3NPCA 5CY3A 2YEXA 3P0MA 4UN0C 2VV9A 3CGFA 5HX8A 1WCCA 2HOGA 3FWQA 2OG8A 3KXNA 2O65A 4U5JA 2R0UA 4M67A 5AA8A 4AS0A 3W2OA 3ORKA 4XV2A 4BCOA 4TYEA 2BCJA 3IKAA 4HPUE 1Z57A 3OW3A 4S33A 1M14A 1JKLA 2WAJA 5D11A 1JLUE 4QP6A 2ITTA 3FQSA 2H6DA 4F1TA 1MQ4A 2WNTA 3Q9XA 4JBVA 5CI7A 4PP7A 3BLRA 3VC4A 3R7VA 3QA0A 4Z3VA 4S2ZA 4QYGA 4AOIA 2PUNA 4MQ2A 3UP2A 5DR9A 4FKJA 5BVFA 3UVRA 3JY9A 3DQXA 5G1XA 4U3ZA 5FBNC 2IVUA 4FKTA 4G5JA 3O8PA 4Q2AA 2QOQA 5E91A 2XH5A 3V8TA 3W2PA 5L2SA 4MTAA 4ZTMA 5L3AA 3WZDA 2C6LA 4LM5A 5G6VA 3WIGA 4QTAA 1K9AA 4IVAA 5DPVA 2PMIA 1SNXA 2X4ZA 5EKNA 2C6MA 2PY3A 3NCGA 4IAZA 2CLXA 1XBBA 4FZFB 1AD5A 4MNFA 1H0WA 4JX7A 1MQBA 3FY0A 3COIA 3MTFA 4YJNA 3QYZA 3O51A 3TNWA 1YKRA 3O8UA 5CAUA 5KMKA 2YHVA 5GJDA 3ORNA 3Q53A 2PTKA 3FKNA 5JFSA 4AG8A 4N6ZA 3TV7A 3BHVA 2ZVAA 3P79A 4JBPA 3GOPA 5HO6A 2P55A 4USFA 4H36A 5CASA 5L8KA 2WMTA 3EOCA 3EQHA 4ZY4A 5IUHA 2CMWA 3MA6A 4YJPA 4TWNA 3R8PA 5AEPA 1OPJA 4OTWA 5HVKA 2YJRA 4V0GB 3H9OA 1SYKA 4BR3A 4BL1A 3R28A 2QO2A 3Q2JA 2RG5A 3MDYA 1H24A 3GGFA 4JQ7A 3RI1A 2QOFA 3C0GA 2WTWA 3E3BX 4EC8A 2B7AA 2WTJA 1OKZA 1PY5A 5FEDA 2XYUA 3ZMMA 2G9XA 4ALVA 4F7NA 1ZOEA 3DA6A 4JQEA 4BCIA 1H08A 5K3YA 2ZV7A 3NUXA 5D9HA 3ZOSA 5BUIA 2IVVA 3LFCA 3FLWA 2X0GA 5DIAA 5HG5A 3ZU7A 4UMRA 3HGKA 2Q0BA 2XEZA 5LQFA 3MVJA 3IDCA 3ID6C 3ZLSA 2PUIA 5EHLA 2BRBA 4Y8DA 4PL3A 5A4LA 3QKMA 4XNEA 3FMMA 3JUHA 4MK0A 1H1SA 2SRCA 1UU9A 2UZWE 4FZAB 4XJ0A 4GK4A 1YHVA 2W1GA 2XM8A 3QQGA 2V7AA 3R9DA 3VBWA 3NW7A 5GZ9A 5IA3A 3EFLA 4GCJA 4FV2A 3VUHA 1QPDA 4I5PA 1H25A 3FXXA 3VF9A 4HVHA 2F2CB 3PIYA 5BVDA 3U6IA 4YO4A 4MXCA 2OGVA 2W9ZB 4G1WA 4IZ5A 4BBEA 5KBQA 5FUTA 3NEWA 4D1SA 3TM0A 1ZMUA 3MJ1A 3O50A 3O96A 4YZCA 1WZYA 4ASZA 1DI8A 3DK6A 3NIZA 1YOMA 1IG1A 2C6IA 3D2IA 4UALA 4UX9A 4BGHA 3NSZA 5KX8A 5CEOA 1OKYA 3N51A 2W1IA 3WF8A 4M14A 2WHBA 3EMGA 4IAFA 3RINA 3KN6A 1OITA 2BMCA 3BYOA 3WZJA 2YDJA 4Z9LA 4D4VA 4EH5A 4FEWA 5GINE 4FV7A 4AZWA 3DFAA 4O0TA 4C33A 1J7IA 4CYIA 1DI9A 4USEA 4F63A 2WMUA 4DGLC 4UMPA 4I20A 1KE7A 3ACJA 4GJ2A 2W1ZA 3AMBA 5L6WL 4AXAA 1OIUA 4GFGA 4PDPA 2CKEA 3FPQA 2EUFB 2GTMA 3LFFA 3UOKA 4II5A 3A8WA 2OZOA 4JBOA 2X1NA 4FEVA 4O1OA 1GZNA 2C6KA 4X3FB 2P0CA 2BTRA 4L3LA 4DG3E 3VS5A 3B8QA 2C3IB 3QQFA 3PZEA 2XMYA 2IW8A 4ZK5A 4JJRA 4FEUA 1IR3A 3G0FA 2JKOA 4FZ7A 4FL2A 4J97A 3VF8A 3D83A 4F09A 3EQGA 4QMQA 4EOSA 5KO1A 4MD8E 5M55A 3EN7A 2X8IA 4BWXA 3ULIA 4XRLA 4YHFA 3VW8A 2WTIA 4JIKA 5J9LA 4NM0A 4HPTE 4RA4A 3BYSA 4YPDA 1H27A 3G2FA 3KC3A 1OUYA 3R1NA 5I9ZA 2BILB 3CQEA 4ASEA 4HVSA 3LCSA 2J0JA 3AC5A 1PXLA 4D9UA 4W8DA 4LQMA 2QR8A 4U80A 5DVRA 4O0XA 2QG7A 1YWRA 4WUNA 4XUFA 1ZZLA 2PVFA 3DT1A 1UU7A 3FKLA 2GHGA 4Z7GA 3F2AA 3G9NA 4LGGA 1AGWA 2GNJA 1J7UA 4I24A 3F6XA 3HMIA 5K4JA 2VWXA 2GDOA 4FSQA 4NU1A 5AUVA 2ERKA 4IAAA 4FT5A 4K1BA 3SD0A 4C2WA 2RL5A 2NO3A 5FXRA 5LVPA 4F0GA 5FTOA 5AA9A 5CU0A 4MQ1A 5ANIA 1YDRE 5IEXA 2UZEA 1PW2A 3RBWA 1Y6BA 2OJGA 3PJCA 2R0IA 3ZRLA 2R3RA 2PPQA 4Z7HA 2F9GA 3O71A 3TNHA 3GI3A 3UIBA 4R5SA 4FEQA 5E1SA 2OFUA 5D41A 2ZDTA 3GB2A 2ITVA 3IS5A 3QFVA 3R1QA 4I5HA 1YXXA 1T46A 3OT8A 4LOOA 4EI4A 3F3WA 3PTGA 4I41A 1YXTA 3IW7A 1M52A 3LJ2A 4WKQA 4EH4A 3F7ZA 2Q83A 4UZDA 5ANJA 4MD9E 4HCUA 5AX9A 4XP0A 5LMKA 1JSVA 4BDHA 3CGOA 3UTOA 4CKIA 3VUMA 4DGOA 4Q9SA 3HV5A 4GG5A 4MNEB 4BCNA 3E88A 3UODA 4GKIA 4GMYA 4CLIA 4FICA 3II5A 3I0QA 2BDWA 4FTIA 4QD6A 5KE0A 4R3PA 3ET7A 3EQBA 2PZRA 3FMKA 5CANA 3QLGA 4BBFA 3W8QA 3H0YA 5CTPA 4DINA 2R3OA 3R7YA 4TTHB 4CVAA 5D1JA 3RK9A 1ZYJA 2VTRA 4AE9A 5JMSA 4CT1A 3Q4ZA 2R64A 4R6VA 3DGKA 1YXSA 1JQHA 1YDTE 3O23A 4EK3A 5AADA 4ZZMA 4U40A 4XLIA 2WQMA 3FLNC 4IJPA 3RNYA 3WZKA 4NCTC 3FYKX 4KBAA 4U43A 5DHJA 3U51A 4RFZA 4BI1A 1LUFA 1TQMA 3P86A 4RFYA 3A7IA 3QQUA 5C4LA 3DAKA 4M0YA 1WVYA 3EQRA 4U45A 3QHRA 4L52A 4MBLA 3ANQA 2YLEA 5IKWA 3DKGA 5FGKA 4QMXA 3ZLWA 1U54A 1WFCA 4E4MA 4BCKA 3FLYA 1UWJA 2CPKE 2QC6A 4S30A 5CAOA 5I9WA 4MF1A 3M1SA 2CN5A 5IQDA 5HD7A 2Z60A 3QD3A 4CV9A 1XO2B 4FKOA 3LQ3A 2LGCA 5AAGA 2I0EA 2X7OA 2HXQA 4YZ9A 4F0IA 1URWA 2PL0A 3AT3A 4YO6A 4V01A 5HEZA 3ZLYA 3BE9A 1FINA 3E8NA 2V5QA 2VO0A 4O7WA 4J8NA 2XK9A 4O2PA 3TTJA 3I1AA 3R8MA 4FSRA 3ZM9A 2XK8A 2JEDA 1PMVA 2FB8A 4RMZA 5HD4A 3EFKA 3IOPA 2NRYA 2XF0A 3WZUA 3PJ8A 3FAAA 3NGAA 4PP9A 4ACDA 4FTUA 4O96A 3EYGA 3UBDA 4APPA 3HMOA 4YLLA 4M12A 4TWPA 1RDQE 2YDKA 3ZONA 2C0IA 4IB5A 3UPXA 4KIKB 5IA2A 4YJOA 4C62A 4CFXA 1MUOA 1W0XC 3RWQA 4CV8A 4RIXB 3QKLA 3NUPA 3NW5A 1BX6A 4R7IA 2HCKA 3QA8A 3RHXA 4EQMA 3FI2A 4A4XA 2R3FA 4AFJA 4QYYA 4BTFA 4ZSAA 3CEKA 2UW0A 2CN8A 5DYJA 2UW7A 2ZYBA 3PSCA 4FKVA 5HX6A 4FKQA 4S32A 4KIQA 3W16A 5IDNA 3KF7A 3CXWA 2J0MB 2YCQA 4ZMFA 1Q5KA 2R2PA 3MY5A 4CTBA 3ZHPC 4UMTA 1FMOE 3LCOA 3ZUTA 3DJ7A 4G6OA 4C35A 3QTQA 4RGJA 5FDXA 4AWIA 4D2PA 1NT2A 5K4IA 3OW4A 4ZJJA 2X8DA 3DXQA 3SOCA 3M42A 4GK3A 3S0OA 3HL7A 2QOIA 2Y4IB 4CG8A 4FV1A 3ROYA 3LFAA 1FMKA 4FKGA 2PVMA 4C59A 4XG3A 3D0EA 4R7BA 1YHWA 4ZSGA 3EZRA 5IQBA 4FTQA 4HZSA 4K8AA 2OJFE 1H1WA 1ZYCA 3ATTA 2OJIA 3ANRA 1YWVA 4EWHA 2V55A 1URCA 4QQJA 3VVHA 4FK3A 2XIXA 4FUXA 2BFYA 5HKMA 3UO5A 2C5NA 3R1YA 1J7LA 4GT3A 4AA4A 2YERA 3QRKA 4RX5A 4Y5HA 4GH2A 3QC4A 3BQRA 1FVRA 2J0IA 2VTAA 3ZBXA 3TNPC 1R78A 2E9NA 2XA4A 2HZNA 3WBLA 1M2QA 4FG7A 2YZLA 4DFYA 4QNAA 4DTAA 3DXNA 3K54A 3QTIA 3AGMA 3C0HA 2JC6A 3DZOA 4I6BA 4PMTA 3LIJA 2O3PA 1F0QA 3RVGA 4YTHA 5DI1A 5HNBA 4MCVA 5EOBA 3REPA 1KV2A 1WBVA 2A2AA 3ELJA 3WYXA 4O81A 5CQUA 3Q5ZA 2UV2A 5E8XA 4C37A 3WILA 3COHA 5J8IA 3F2RA 4N4SA 5J5SA 4L7SA 3DLZA 1WBWA 1H0VA 3UPZA 4P5ZA 3VUKA 2P4IA 4JIAA 2XKEA 4DITA 4L67A 4EEVA 2B53A 4BCJA 4L3JA 3FSFA 1O9UA 1ZRZA 3B2WA 3BV3A 3LCTA 4FG9A 1WMKA 3JYAA 4I6HA 1E9HA 4WBBB 3W2CA 5FM2A 3TWJA 2WQOA 4C34A 4EH7A 4WNMA 3FKOA 4ZTNA 4B8LA 3Q60A 5FXSA 5AJQA 4KKHA 2XNNA 2WIHA 4BN1A 5L4QA 2BTSA 2ITNA 3OROA 4QQ5A 3VBTA 4BKYA 4CRSA 2V22A 5I9XA 1W8CA 1QPCA 2OF4A 1Q99A 1SVHA 1PKGA 1H1PA 2VTTA 3H3CA 1OMWA 5HVJA 3BX5A 4GV1A 2C5OA 4BC6A 4F7SA 3PDTA 2WKMA 1V0PA 2C0TA 2R3KA 3EQIA 1U59A 4RC4A 5IQEA 3BGZA 3Q2MA 5EQEA 2HW7A 4HYUA 4EH9A 5EW3A 5DR2A 4X2FA 4YJTA 2HIWA 1OL2A 2YIWA 5BMMA 5I0BA 2FGIA 3H9RA 4X7QA 2B0QA 4H3QA 5A9UA 2PK9A 3FPMA 3VBQA 3OWPA 3PE1A 2UW6A 4FTTA 4FVQA 4IANA 3OP5A 2ONLC 1H4LA 4IWQA 4WG5A 3RMFA 4V05A 3DU8A 3VRYA 1VR2A 1M2RA 2VTNA 2XCKA 5AR5A 4EL9A 5J79A 2J50A 4BZNA 2XRWA 2YAAA 3I7BA 4PTGA 1ZYLA 4FTLA 3CTJA 4XG6A 4PMMA 3U4UA 5E8SA 5CENA 4XG4A 2YABA 5CX9A 3BHUA 1H1QA 2A4LA 2B52A 3I5ZA 3GQLA 3LMGA 4RPVA 3VS2A 4XP3A 3HP5A 2XKCA 4FUYA 3GC8A 4G2FA 1Q97A 1PHKA 4FV3A 4LL0A 3RZFA 4EHZA 3FLQA 3IO7A 1Q24A 3PUPA 1UVRA 3HUBA 1L8TA 3UOLA 3TI1A 3EQCA 5F1ZA 4J96A 4OGRA 1XJDA 2YZAA 4LRJA 5EM6A 4QO9A 3HRBA 2JGZA 4NFMA 4TL0A 2R7IA 5FBOA 3JS2A 4G6NA 2J51A 3OBGA 5ANEA 5KHWA 3CPCA 1WAKA 1WVWA 2QHMA 5CZIA 3R8ZA 3GCQA 2GNGA 3IDBA 3MYGA 3HMMA 3TIYA 4K2RA 4MF0A 4UBAA 4L46A 4WUAA 4E93A 4E6CA 3MW1A 4ZLZA 3F5UA 4BHZA 2F7XE 4AZEA 5AR4A 3NCZA 5A4QA 4O0SA 5CSPA 2VWVA 3EL8A 3QD4A 4FX3A 4FT7A 3LJ1A 4BDJA 4G3GA 4PNKA 4ACMA 2GFCA 3OHTA 3L9MA 3BU3A 3MB7A 5CEKA 4FIHA 3IK3A 3P1AA 4FT3A 4J95A 5TO8A 5D7AA 4O7TA 3EQFA 1G3NA 3V5QA 5LVOA 3BYMA 4DT8A 2CHLA 2EB2A 4NWMA 5LCJA 5J9YA 3F3ZA 2QNJA 1YXVA 2PVJA 4IXPA 4XG9A 3UOHA 4B0GA 4ITIA 3NNWA 4QP2A 3HLLA 5CXZA 4YNEA 2BIKB 4YU2A 2IVTA 2X2MA 3Q9YA 3NX8A 3IOKA 1JOWB 4W8EA 4FEXA 2ITXA 4XV9A 3FHIA 3G90X 3VQUA 3E7VA 4PDYA 5M51A 4IEBA 2WU7A 2X6EA 3RHKA 3IW6A 3UG1A 2F4JA 2CSNA 2H8HA 3ZH8A 5JZJA 3T9IA 3S1HA 2CKOA 2VWZA 4EZ5A 4IZYA 1LPUA 2YFXA 3DTCA 4OTIA 3FXZA 4DEEA 2F7EE 5EQYA 3PPZA 1ZZ2A 3VHKA 5IDPA 4ANNA 4P2KA 3MBLA 4E6QA 4X2KA 5DRDA 4CGAA 5HLPA 3ZRKA 4MWHA 1NY3A 3E63A 4WRSA 3EZVA 4BI2A 4O21A 3U6HA 4DG0E 1VYZA 2HY0A 2XYNA 4WSQA 4UWCA 1BKXA 1G8SA 2PVRA 3GCPA 1BYGA 3TTIA 2UZUE 1L3RE 4LRMA 3GU8A 2BALA 4GJ3A 5H8BA 4A06A 3V6SA 3P08A 5FTQA 3CCNA 4C2VA 4YNOA 4EK5A 4IWPA 3KRJA 1MRYA 3IW4A 4FGBA 1H1RA 4EC9A 4IFGA 2BFXA 3QUEA 2PE2A 2ETRA 3CQWA 5FLFA 4I3ZA 3EIDA 2HAKA 2FA2A 4EONA 2VNYA 3PJ1A 4LGDA 3DQWA 4ASDA 3OXTA 2VWWA 3DBEA 5DG5A 5AP2A 1ZAOA 2UW3A 4G16A 4O38A 3R01A 4ZSLA 4USDA 2R3QA 3QRIA 5EM7A 5EK7A 4FV8A 1XR1A 3VO3A 3NR9A 4ANBA 3MVHA 4NEUA 4EHEA 3DV3A 4PNIA 4H58A 3OEZA 3E8EA 3OCTA 5IG1A 4EOMA 2C3JA 5JQ5A 3NMUF 3BWJA 3OUKA 4I94A 3MPMA 5HOAA 3IONA 4RZWA 3CBLA 3GXLA 5EHYA 3LPBA 1ZARA 3VW6A 4F9WA 3IGOA 3MI9A 3OXIA 1WBSA 3DKFA 2QR7A 5IQGA 1VJYA 2W4KA 4Z55A 4EKKA 3SAYA 2VGOA 4YJUA 2CLQA 2W7XA 1LEZA 4O2ZA 4ID7A 5J9ZA 4MBJA 5HICA 4PMSA 3AC2A 3ZXZA 3V6RA 3ODYX 3QXPA 4KS7A 4YTFA 1PJKA 2RFEA 1JAMA 4O22A 3DJ6A 4YSJA 4IWDA 3N4VA 4ZJIA 4EZ3A 4NSTA 4QYEA 1TQPA 5HNIX 5AIKA 4FTRA 3CTQA 4ACHA 1KWPA 5IMXA 1SVEA 5HG7A 3UP7A 4U6RA 2IPXA 4IAYA 1ZY5A 4RG0A 3ZC6A 2VAGA 3Q96A 1UKIA 4GS6A 1B38A 3TKHA 3CP9A 4U41A 5CQWA 5L2QA 4D28A 4M7IA 3BKBA 4L7FA 4PTEA 3TDVA 4CQGA 3R7EA 2W06A 3F3VA 3RPOA 4D0XA 5ITAA 5KMJA 3F5GA 3VS0A 2C6EA 4JL9A 3PE2A 5KMIA 5D12A 2PU8A 1LP4A 3DAEA 4HZRA 4DEGA 4BYIA 3GNIB 5L2WA 3MY0A 4DLJA 1TVOA 3IDPA 2JKQA 1SZMA 2XBAA 5HIDA 5CAQA 2VRXA 3GFEA 3L9NA 4KB8A 3MN3A 4DFXE 4FV5A 4IX5A 3WE8A 4U81A 4EWQA 3PA4A 4FZDB 2CGUA 4XHKB 5JH6A 4LV5A 3LE6A 3EYHA 3NYNA 4RJ3A 4DH7A 1XHAA 4P4CA 1JKTA 3F9NA 3E5AA 2C47A 4C4EA 5M56A 4CMTA 2OBJA 3D15A 3Q52A 4D5HA 2CNVA 2FVDA 4ZXTA 3R04A 4TNBA 4LYNA 3H4JA 3VRZA 5F9EA 5ANOA 5CEIA 4BB4A 2JITA 4ZTLA 3RPYA 4NTTA 4RJ8A 2WTDA 2YCRA 1CKIA 3NIEA 2ZV8A 4TNDA 3EKKA 5C8MA 4UZHA 2YIQA 2Z7SA 2YA9A 3KVWA 5C27A 5CEMA 2ZMDA 4GYGA 4AE6A 4YJQA 1U46A 3Q9WA 4OW8A 3RZBA 3UO4A 4CZUA 2AC3A 3I6UA 3A7FA 3LZBA 3OOGA 2XKFA 4ENXA 2R3PA 5CU2A 5DA3A 3VNTA 3UMXA 1KE5A 4AW5A 3DLSA 4N6YA 4R1YA 4B8MA 4EK6A 4NIFA 1CSNA 1AQ1A 4RVMA 5CSWA 5AV0A 4DLIA 5KMLA 5AP3A 1Q3WA 1X8BA 1BL7A 4K6ZA 1B39A 2WMAA 3D94A 3DNDA 3DBFA 3CY2A 4UXLA 4DF3A 3HV7A 4FC0A 4EOJA 4LUDA 2CKQA 2I40A 4X6QC 3ZO3A 2WQBA 5CYIA 2GPHA 4GIHA 5DEWA 2BRGA 5KHXA 4GKHA 4I0TA 4BYJA 2E9OA 4W4WA 4CMUA 4DFNA 1ZYDA 5AUYA 5FP5A 4NM7A 2PMOX 5LMAA 4RWKA 3GU4A 4R3CA 4JRNA 4K33A 4YBKA 5HCZA 1OKWA 3TJDA 5AUZA 4GEOA 4EK4A 1GZOA 3SA0A 2WPAA 1W83A 5AR3A 2C1AA 5CVHA 2HWOA 3ACKA 3QUDA 3MPTA 4R7HA 2J4ZA 3V5PA 4XV1A 4F6SA 5HTCA 3L8SA 2QLUA 1QPJA 2O64A 5BNJA 2BROA 3E64A 2F2UA 3F3TA 5L2IA 3GENA 3VBVA 3HDMA 2WTKC 3Q5IA 1Q61A 3PPKA 3UDBA 4DT9A 3KQ7A 2DYLA 3BV2A 4ARKA 3FMEA 4DTKA 5M44A 5AV2A 2YAKA 4JOAA 1FOTA 1BUHA 2VGPA 4WRGA 1ZY4A 4TXCA 1YQJA 3HA8A 3I0OA 4TWCA 1GZ8A 4PL5A 5HE2A 4IAIA 3RTPA 4QTEA 4KINA 1UA2A 1QMZA 4YC8A 3ZCLA 3DK3A 4JG8A 2EXEA 4IB3A 5I9YA 4FSTA 3R7GA 2GS6A 5ETAA 2YLFA 5K5XA 1H28A 3ZFMA 2JLDA 3UZTA 2FSMX 2CDZA 4GUEA 4OLIA 4NTSA 3QTZA 3VS4A 1P14A 4FSWA 4TT7A 4PDSA 3V5JA 1EH4A 2YM3A 2UZBA 3R9HA 4RC2A 3R9NA 3FSKA 1OBDA 4MXAA 3LQ5A 5JKGA 2EVAA 2WOUA 5H3QA 5ETFA 1TQIA 3R71A 3L8VA 4PUZA 5L6OA 4CFNA 3LHJA 4LI5A 4BIBA 3S00A 4IDTA 4MX9A 4F1OA 5F4NA 3VUTA 4QMNA 2HW6A 3PVWA 3FHRA 4DGNA 3R2YA 3QZIA 5E1EA 5LVMA 5GIPE 1JPAA 2AYPA 3BEGA 1WBNA 3F2NA 3DFCB 3WYYA 2WMVA 4M13A 4ZMEA 4CT2A 4IX3A 3S95A 4BCFA 5B7VA 5C8NA 2WFYA 2X9EA 5H9BA 2OZAA 2IW9A 3LXLA 4BDIA 4NCTA 3AD5A 3ZZWA 3AC8A 1XH5A 4QQCA 3QX4A 4IM3A 3PIXA 3KK8A 4JI9A 2OJJA 4X2GA 2QKWB 3G15A 1XH9A 1R39A 4D1ZA 2UVYA 2R3NA 3G6GA 5D10A 5LJJA 5CALA 3HA6A 3DB6A 2RF9A 4FNWA 4MXOA 1YW2A 4AGUA 4DBNA 4LG4A 3GOKA 4M97A 2VWUA 3HNGA 5CLPA 2UUEA 5HIEA 2XIRA 2YJSA 4H3PA 4DEHA 3FJQE 3F5XA 3JR1A 4RJ4A 4U97A 3LXNA 3FZTA 5CS6A 4XS2A 4FOBA 2YM6A 4DEAA 4I1ZA 3PVGA 5IH6A 3KA0A 2O63A 4ZTSA 3E62A 1IEPA 3AT2A 2R3IA 2XJ0A 3D7TA 3E7OA 1HCKA 2A0CX 2XNGA 3FYJX 4FBXA 4Y5QA 1Z5MA 3UIUA 4EH3A 4I93A 4FNXA 4DFLA 3MY1A 5DE2A 3KMWA 4WG4A 3W33A 5M07A 2NRUA 2R3GA 2W4JA 2NNWB 2GQGA 2QLQA 4M3QA 4FSZA 2XUUA 4J7BA 1E1XA 3FQEA 2RFSA 4OTHA 4E6AA 3D7ZA 3OEFX 5L8LA 3Q9ZA 4C57A 3TUCA 4TYJA 4R3RA 4YZNA 2B4SB 4BDBA 2XNOA 3VJOA 3AXWA 5L8JA 3UQFA 3MFRA 3VHEA 3C4WA 3V8WA 2XK4A 4A9RA 2PVNA 4Y73A 2JKKA 2RFDA 3U6JA 5EI2A 3HAVA 4M69A 3ZSIA 3UVQA 3C7QA 3KB7A 4IIRA 4FT9A 2WELA 5LARA 4ZZOA 4CKRA 3ORIA 5IPJA 1UWHA 4YZBA 5AWMA 3A8XA 4TPTA 3ZEPA 4YURA 4G3EA 3OZ6A 1IA9A 2BUJA 3ALNA 4AGDA 3QWKA 4KD1A 3OUNB 4YHTA 2JAVA 4HCVA 5IQIA 2BAJA 4E6DA 3SHEA 5CEQA 3R7UA 2WMSA 2VTJA 4XH6A 2VO3A 2C68A 4LL5A 2HYYA 4BBMA 2EB3A 1OL5A 4U9AA 4S34A 3G9LX 3HP2A 4XX9A 5EI8A 5HTIA 2OI4X 4KABA 2XIZA 4TN6A 3BE2A 3PXRA 4CCBA 4RQVA 1SNUA 1ZOGA 4U0IA 2GFSA 3RK5A 3GFWA 1FVVA 2GNHA 3CKWA 3RGFA 2BRNA 4Q5HA 2GHMA 4FIEA 4ZJVA 3N9XA 3F88A 5AV3A 5M06A 5IEVA 5IQFA 5AM6A 4BRXA 3MB6A 4L3PA 1OECA 3LFQA 3DXPA 1J1BA 3UYTA 1P2AA 4RQKA 2HZIA 2ZAZA 4RSSA 4D4RA 4EUTA 3LMHA 4KSQA 5EYCA 5EYKA 4RX7A 2WMRA 2E2BA 5AUUA 4PX6A 2HY81 3FZ1A 3QLFA 3G6HA 5CF4A 3FMJA 5A54A 5LOHA 5HNGA 2Y8OA 4QMZA 5H2UA 2A1AB 2HELA 4GFOA 4HYSA 3FXWA 4AW2A 3F61A 3KRLA 4IB1A 5B2MA 1XQZA 3COMA 5AP0A 5LWNA 3EL7A 2F49A 3R0TA 2XNPA 4EORA 1GOLA 4AOTA 5BVNA 5KKRC 2X2LA 3QX2A 4BGGA 4F1MA 1JWHA 1NVSA 2GS7A 1O6YA 3ODZX 1F5QA 3HEGA 3QQLA 4OUCA 3PXZA 3B2TA 4FSYA 2ZB1A 5CF5A 1KE8A 2GTNA 4HOKA 2JFMA 3TG1A 1W7HA 1JKKA 2R9SA 2W5AA 2OIDA 5M08A 4AZTA 4KKGA 1PF8A 4AOJA 4YUQA 2GNLA 5M4CA 1IAJA 2B9JA 4LOQA 4CFWA 1YDSE 3FI3A 1PYXA 3I5NA 3QGYA 2YACA 4FNYA 5AP5A 2WTCA 5CU4A 2OH0E 2JBOA 3KRRA 5GZAA 2BVAA 1ZWSA 2PULA 2DS1A 3P23A 2YCSA 5KUPA 4DCAA 3QC9A 4C38A 3KGAA 2RKUA 5DT4A 5E9EA 2VD5A 3PLSA 5ACKA 5JRQA 4QOXA 1RE8A 5AP4A 4E7WA 1U5RA 4EYMA 3BI6A 5JZNA 3O7LD 1S9JA 4J8MA 4IC7A 4IH8A 1P4FA 5IQCA 3MIAA 1UV5A 3D2KA 4X2NA 4ACCA 2WU6A 3K5UA 4G3FA 1APME 4FIFA 4ANSA 5IH5A 3AQVA 4IMYA 5KNJA 3DK7A 1GJOA 4F6UA 1UU8A 3SC1A 2CGVA 2YN8A 3TKIA 4O7SA 4ENYA 4AN9A 2J9MA 3B8RA 3FMDA 3PSBA 4R1VA 4CG9A 3EN6A 4NUSA 4O7VA 4Z16A 4KAOA 4ANQA 4ONAA 5TR6A 3VS3A 1OL1A 4DCEA 2Y7JA 2YWVA 3UYSA 2G15A 4BCPA 4D2WA 5CZHA 4IHPA 2EXCX 3QD2B 5FG8A 1Y6AA 4O0YA 4IVDA 4U3YA 5GNKA 5AV4A 1ERKA 3OFMA 4DH1A 2HXLA
chains in the Genus database with same CATH superfamily
3K3JA 3TJCA 1PKDA 3FZRA 3KULA 4JQ8A 4F9AA 5DLSA 3HV4A 5IA0A 3KF4A 1XH8A 2BIYA 1IAHA 3PXKA 4EOQA 3BL7A 4EYJA 3MJ2A 4X6RA 2BAQA 4HGSA 5AV1A 4ZIMA 5BVWA 3SG8A 2XK7A 4D4YA 4NW6A 2QONA 4L01A 3KXGA 4XCUA 1OPLA 3OWKA 5HHWA 2OFVA 3DAJA 5A4CA 2ONLA 3NRMA 4O0UA 4U44A 4YC3A 4CQEA 4QPMA 4YSMA 3FE3A 2I0VA 1B6CB 3KN5A 3VS1A 3M11A 4DHFA 3TL8A 4I6FA 4FTAA 5ACBC 2PSQA 5FEEA 2Z2WA 3SOAA 3EJ1A 3FBVA 1PXOA 3DDQA 1KOBA 3KL8A 4NKSA 4RLKA 4YLJA 4TKSA 3ZSGA 4KNBA 4Y72A 5JFVA 2YIYA 4PY1A 2ITZA 4FKRA 2Y9QA 1A48A 4GSBA 1BMKA 5C4KA 2A27A 4I22A 5BUJA 1M7NA 3OCBA 3QCQA 1V1KA 4HCTA 4O4DA 5HBEA 3OY1A 1WBPA 4X0MA 3OG7A 5I9UA 5BVOA 3TT0A 3NNXA 3UE4A 5JQ8A 4IX6A 5FEQA 2KULA 4YJVA 3GU6A 3KCKA 4EZ7A 4NW5A 5M09A 4PPAA 5TF9A 4L6QA 3WF6A 4KWPA 3AG9A 3FMHA 4AUAA 3UVPA 4BIEA 2YIXA 1REKA 4C4HA 1ATPE 2C4GA 2BKKA 2QD9A 2FO0A 1REJA 3SW7A 4IVCA 3QHWA 4FIJA 3A4PA 3ORLA 3BLQA 3DKCA 4EHGA 4LMUA 2VNWA 4M15A 2W1DA 3NYXA 3ZO4A 1O6LA 1WVXA 3NAXA 1VZOA 1OUKA 4GIIA 5H8GA 3CSVA 2ITUA 4C4GA 3GQIA 2BPMA 4KRCA 1OKVA 3ZSHA 4DE4A 2UZDA 3AC4A 4RZVA 4DFBA 3ZO1A 2X4FA 1NVRA 2W1CA 3IW5A 1DAWA 3CR0A 3MIYA 2PVYA 4APCA 3HKOA 4AW1A 4DEBA 4A9TA 1K2PA 2PVKA 3QUPA 4O91A 4XG8A 4AT4A 4BTMA 3BBTB 3FQHA 1P4OA 4WO5A 5CVGA 5IQAA 4G9CA 4FA2A 3LAUA 5IF1A 3HRCA 4KKEA 3TCPA 3PA5A 2XCHA 2HZ0A 4I4FA 4QMSA 3NLBA 3QTXA 5HG8A 5HE3A 1ND4A 4KBCA 4A9YA 3RPRA 3LMIA 4OR5A 2VZ6A 1YVJA 4OBPA 1Q8YA 2ERZE 4BDGA 4LV7A 3MTLA 2W17A 3LFEA 1WBTA 4FYOA 3SG9A 4QP7A 4FTJA 2HZ4A 4PV0A 5CNNA 3CJGA 4HGTA 4XV3A 1VYWA 3PYYA 2UW8A 3CKXA 3QQJA 4J1RA 4N0SA 3C13A 2QOCA 5TT7A 4BCHA 4RIOA 3A60A 1ZLTA 4WHZA 1PXMA 2PUUA 4JX3A 5DH3A 3T9TA 4F65A 5CT0A 4EH2A 1T45A 3PLAE 3DBDA 1MRUA 2OIBA 4ITJA 4ZOGA 5JK3A 3AGLA 2BAKA 2JDTA 1HCLA 4D2VA 3MSSA 1BLXA 3Q6UA 5LMBA 5A6OA 5CWZA 1YOLA 3MA3A 1XH7A 4G17A 3R73A 2Y6MA 4AZSA 3HAMA 3CQUA 2E9VA 4NT4A 2HENA 2JIUA 4BIDA 3M2WA 4DHZA 2PVLA 4EKLA 4MXZA 4X3FC 2IVSA 4FI1A 2J0KA 2WMQA 3HRFA 3NUAA 4KA3A 1RQQA 1W98A 3ORZA 4JRVA 4ZZNA 3QCSA 3HVCA 3JXWA 4GW8A 2PMNX 4RJ6A 5AR2A 3S4QA 5EI6A 3UNJA 3ZDUA 4AP7A 3NDMA 5D7VA 4UWBA 3R22A 3COKA 3E8DA 4E3CA 4MWIA 3ZRMA 1JVPP 4BKZA 3ZBFA 4GVJA 2UW4A 3IW8A 3NVKI 4A07A 1WBOA 3BIZA 3P7AA 2WXVA 1IASA 4XMOA 3NVMB 4E5BA 2BHEA 4NIFB 3TACA 2RIOA 1XWSA 2XIYA 2ZOQA 4YP8A 4O7RA 4JAJA 2NYAA 4L53A 4WNPA 4BZOA 4C8BA 1OGUA 2JIIA 3BHYA 3NUUA 4E4XA 5HQ0A 2GNIA 3ITZA 2GQRA 3ZC5A 3U54A 3QCYA 4I0RA 2VX1A 3MPAA 2IF8A 2QCSA 3BYUA 5HTBA 5JGDA 3A99A 2JAMA 4BCGA 5BYLA 4FE2A 4D0WA 3GT8A 3GC0A 4TYGA 4H39A 2BDFA 2ETKA 4F64A 2X0OA 3EFWA 4AF3A 3I4BA 5A4TA 4QTDA 4CSVA 3POZA 1W84A 4YC6A 3RM6A 2XS0A 4O0WA 5ANKA 5GZ8A 2XP2A 1PRYA 1KSWA 1RW8A 2Z7LA 3G33A 5HI2A 2WIPA 3QD0A 4L43A 2IZSA 4OTDA 3W0NA 4QMUA 5HU3A 5HE0A 4NFNA 3PY3A 5KMNA 5BVEA 4UYNA 2XK6A 5JEBA 4IAKA 3SXFA 4WT6A 4C58A 1G8AA 2WOTA 2ITOA 3UIXA 4ERKA 5GJGA 2GQSA 3PPJA 1BI7A 3QTUA 4E26A 1FQ1B 2DUVA 4IJ9A 5A14A 4UWYA 3NS9A 4KSPA 3MESA 3R9RA 3LW0A 2H9VA 3PXFA 4KIKA 4DG2E 3ZUVA 3BHTA 4FT0A 4JNWA 3ERKA 4J99A 3BELA 3E3PA 3KXXA 5AUTA 4C3PA 1OVEA 4FTCA 1CMKE 4FKIA 3PXYA 2PWLA 4QMYA 2JDSA 4EJNA 1GIJA 4UY9A 4AXEA 5EDPA 4MVFA 4HJOA 4O7ZA 3LFDA 4K18A 4FL3A 4MYGA 1DM2A 2QOLA 2UZNA 4JG6A 4JR3A 3ULZA 3IG7A 3TV6A 4ZLYA 4AAYA 3FZPA 3AT4A 3RJCA 4XG2A 2DQ7X 2IN6A 2OWBA 4JXFA 3AMAA 2X39A 4H1MA 4N70A 3OTVA 4YR8A 3ZDIA 4R77A 1YI6A 4G3DA 3UIMA 4Q9ZA 3D5VA 5HBHA 2H96A 2C1BA 2G01A 2KTYA 4KRDA 1PMNA 4JR7A 4MD7E 4RRVA 1R3CA 2Z7QA 2GHLA 4NL0A 4PF4A 2C30A 2OZAB 1ST4A 4ZTRA 1GIHA 2C3LA 5I9VA 3O7LB 5BQ0A 3D5UA 4W9WA 2WO6A 1OL6A 2ZM1A 3AMYA 3P4KA 4CTCA 3FC2A 5EQPA 4C02A 4JDKA 4NJ3A 4P90A 2VTPA 5AP1A 1G5SA 3R7OA 4EBVA 5IEYA 4F4PA 3ORPA 2W4OA 1LR4A 3VQHA 3AKJA 5FDPA 5IZFA 3ETAA 5E8TA 3SV0A 4O6LA 2X7GA 3E87A 3EH9A 3UG2A 3U8WA 5K5NA 3FUPA 3VS6A 3L1SA 4G6LA 3PRFA 5DRBA 4EOLA 2RFNA 4IW0A 4KIPA 5EM8A 3DBCA 5IH4A 3VBXA 3K3IA 3PG1A 2J7TA 2Z7RA 5AMNA 1U5QA 4QMPA 3V5WA 3D4QA 4R8QA 5C26A 3ENHA 1OZ1A 2BHHA 2X8EA 2ACXA 1SVGA 2W9FB 3P5KA 2VX0A 3D7TB 3PIZA 4X21A 3VWAA 3R8UA 3TZ9A 5AP6A 4G31A 4CFUA 4JT3A 2XEYA 3LCDA 4BY9E 2W99B 3AD4A 3OS3A 5E8ZA 3GP0A 3EN5A 2EXMA 4C7TA 1UNGA 5HU9A 3ROCA 3PWYA 3ORTA 5JN2A 3GU5A 4AT5A 5CSXA 4C4IA 1OM1A 5A4EA 2CNUA 1YI4A 3LLTA 4F7JA 3F3UA 4JG7A 1XMLA 4L42A 4M8TA 1NVQA 4YGAA 3KXHA 2WMWA 5LCKA 1H00A 2X6DA 2PVHA 2V62A 2W5BA 3L8PA 3R63A 4IX4A 4UB7A 5CSHA 5E8YA 3ZFXA 2Z02A 4IWOA 4QMLA 3SXSA 4KS8A 4CNHA 4W4XA 4P7EA 2XJ2A 1Q62A 4M69B 4ERWA 3QKKA 4QMMA 5BPYA 1XBAA 2PMLX 2GU8A 3HMNA 5BYYA 3PWDA 5JSMA 2CCIA 2EU9A 3HX4A 1ZXEA 3FDNA 4GFMA 3VULA 5JGBA 3GCVA 4O86A 1IA8A 1BI8A 5JRSA 4ASXA 3D5WA 3SQQA 2Y6OA 2XNEA 4FMQA 2ZM4A 2B54A 5AUXA 3KCFA 1KV1A 2OF2A 4FV0A 4JAIA 3GC9A 3PVUA 4B99A 4C3FA 1KE6A 1NW1A 4YZMA 3JVSA 3FI4A 3W8LA 3VUGA 2XNBA 2QOBA 3HUCA 4XBUA 4O82A 2JKMA 3W1FA 3OWLA 3NZ0A 5A3XA 5HCYA 5GHVA 5EOLA 3I6WA 4TYHA 3TN8A 1OPKA 3U4WA 4D2RA 4FK6A 4EOIA 4DH3A 4QMTA 3O8TA 2JIVA 3MFSA 1NA7A 1ZMWA 2Y4IC 4FSMA 4L9IA 4TZRA 4XOZA 3RK7A 3W18A 3V5TA 5CF8A 4ZSJA 2WQEA 3BRBA 3LFBA 2RGPA 4FTMA 5EDRA 4RIYA 1Q41A 4M68A 3PRIA 3R00A 4K9YA 3QTWA 3VUDA 4H3BA 3WF7A 2C3KA 3D5XA 3DNEA 5FQDC 4I21A 5AP7A 4CEGA 2I0HA 3R30A 1OIRA 3U55A 1QL6A 3BYVA 3UGCA 4BVUA 2XK3A 3SRVA 4EOOA 4LRKA 3CY3A 1FGKA 4OTPA 2BRMA 4EK8A 3FZSA 3HZTA 1PMUA 3LXPA 1U54B 5CXHA 5DR6A 2CNQA 3OTUA 4FGRA 3UZRA 2IWIA 4UMQA 4MAOA 3EN4A 4WIHA 4J52A 4KBKA 4E20A 5CEPA 3C4ZA 3U9NA 5EH0A 2WEIA 3FC1X 4XBRA 5F94A 4PMPA 2G2FA 2IW6A 2IZTA 2J2IB 4PRJA 4RWJA 1CTPE 4MXYA 5IU2A 4EUUA 3OD6X 3AOXA 5J1VA 4K11A 2QG5A 5E92A 5AAEA 3P7BA 4EBWA 3VIDA 1MRVA 2B55A 3QF9A 1W2CA 4KIOA 4UXQA 3K2LA 3WZEA 4Y85A 2ITWA 2BKZA 1PXJA 4FR4A 5GIOE 4HNIA 1PYEA 3ATSA 4DGMA 5ANDA 4AXFA 1Q8TA 4OAVB 3NUYA 2C6TA 3SKCA 4CYJA 2FH9A 2W5HA 5C03A 2VO6A 2XZSA 2VX3A 3HV3A 4IM0A 3ZYAA 1GZKA 2RSVA 3G51A 4QNYA 4AZVA 3TMOA 3A62A 4FVPA 3U87A 4D4SA 1YXUA 3KXMA 5C01A 2JDRA 2YM5A 3VS7A 4BKJA 3QRTA 4NM5A 3WF5A 4H05A 3KVXA 3OOMA 4FSNA 4MKCA 2C5YA 4DC2A 2OU7A 4F7LA 2NPQA 4I0SA 5KZ0A 1P5EA 4EOKA 3AC1A 3BLHA 1QPEA 4ZSEA 3DCVA 3W2SA 2ZMCA 4QPSA 2LAVA 3C0IA 4XLVA 5TKDA 2QOKA 4QTCA 2QO9A 2UVXA 3SW4A 3ZS5A 4AZFA 4JLCA 2OSCA 1Z9XA 5T68A 3QXOA 3PZHA 3U9CA 5DT3A 5JFWA 1QCFA 2UW9A 3ZLXA 5IMEA 1OIYA 2V7OA 3DBQA 3PJ3A 4I23A 4WNKA 3L8XA 4K77A 3HYHA 4B7TA 3BBWA 3KRXA 5A6NA 4YTCA 3Q32A 3R6XA 2FYSA 5IISA 4F70A 5HBJA 5FTGA 2P3GX 2PZ5A 3QQKA 4C61A 4DEIA 3KFAA 3W10A 3BZ3A 2O5KA 1XBCA 2QODA 2BZHB 3TIZA 3KULB 1R0EA 4CRLA 4M84A 2OK1A 2JDVA 4FIGA 1J1CA 4HVIA 3PXQA 4C3RA 3GUBA 4QEBA 4HVDA 1XKKA 3R2BA 2FUMA 1UNLA 2HK5A 4PTCA 4RT7A 3V51A 3IQ7A 2YWPA 2QURA 2JD5A 3OF0A 3DKOA 4FKUA 2J0LA 4Y95A 1YI3A 4GRBA 4D55A 3I7CA 3C4CA 3DTWA 4BDDA 1H8FA 4EHVA 4U79A 4AXCA 4BJJA 2P33A 2XJ1A 3G5DA 1JNKA 4EH8A 1JSUA 3R83A 3WE4A 4HVGA 3MS9A 4X3JA 5JFXA 2F7ZE 4DYMA 4E8AA 4AGWA 4MH7A 5J87A 3O17A 2R5TA 3HDNA 4MEDA 5FXQA 2QHNA 5AIRA 2J5FA 5M53A 4RIWA 1BL6A 1PXPA 4ZY6A 2E9UA 3BEAA 3MH0A 5DEYA 3SLSA 4AA5A 5KBRA 3EFJA 3JY0A 1HOWA 5B0XA 3RPSA 3DY7A 4IVBA 3QU0A 5LVNA 3RAWA 1XH6A 2QU6A 3NUNA 2J5EA 3QYWA 3MH3A 4JS8A 4BTJA 4DH5A 4F9BA 2ETMA 3BQCA 1VEBA 4CFFA 3BGPA 2YM4A 3QRUA 3BHHA 3BU5A 3Q3BA 5EG3A 3V3VA 3RAHA 3C50A 5DGZA 4C4FA 4PPBA 1ZMVA 3AC3A 3OWJA 3LFNA 2ITYA 2W1HA 1GIIA 3GBZA 3QZFA 5AUWA 3W0SA 5KZIA 5CAPA 1H01A 2YCFA 4PPCA 4BDKA 2GCDA 3R9OA 3H10A 5AFVA 4IDVA 2O8YA 2A19B 3R1SA 3MH2A 3ORXA 1TKIA 4ANMA 4O7NA 4C4JA 4YTIA 2J6MA 2R3HA 3QWJA 4JMQA 4IM2A 2B9HA 2W1FA 2FSTX 1H26A 5HZNA 2PZIA 4L8MA 3RWPA 3UQGA 1YRPA 4ZP5A 4XEYA 4EJ7A 4G3CA 4GT4A 3VAPA 4F08A 4PWNA 1F3MC 4HGLA 5IA5A 4BF2A 3FMLA 3LXKA 2C69A 2QOOA 4BHNA 1CKJA 4FTOA 4RJ5A 4JBQA 3T3VA 4C0TA 4JDJA 2UW5A 2VWBA 1GY3A 4E4NA 4NJDA 2VTMA 4D58A 2PE0A 4UEUA 3Q4UA 1OL7A 2WB8A 4QP1A 4V04A 3CE3A 3OY3A 3FY2A 3CPBA 1UNHA 2VN9A 4G5PA 3NW6A 4HYIA 3FI8A 3FL4A 1CDKA 3C51A 4YLKA 3QBNA 3CD8A 5B2KA 4LMNA 3V01A 1Q3DA 5HE1A 3L9PA 4J71A 4IQ6A 5EKOA 5HLWA 4R5YA 4IZ7A 5EYDA 3V5LA 5DMZA 3RKBA 2XNMA 3DS6A 3LFSA 5J7HA 5M57A 1PMEA 3A7GA 4D5KA 3SGCA 2C0OA 3NNVA 3PY0A 4BZDA 3W0MA 2QO7A 3KMUA 5AX3A 4DFZE 4GK2A 5A46A 1DS5A 1MP8A 2I6LA 3FV8A 3C1XA 3UDZA 4B4LA 3DJ5A 5AR7A 2R4BA 4IBMA 4O1PA 4PQNA 3O0GA 2WD1A 3QRJA 4GU6A 4EH6A 3UNZA 3RALA 4AQCA 5KMOA 2F57A 4Q5EA 1UKHA 4OTQA 4Y83A 3V04A 3PP0A 3PA3A 2I0YA 3BLAA 3FMNA 3Q6WA 3WF9A 4QRCA 2XIKA 4P5QA 5FP6A 4BWKA 2H34A 4M0ZA 5CU6A 5TE0A 3RCJA 3FEGA 4GL9A 2PUPA 3RNIA 5I3RA 5BMSA 1CKPA 2YDIA 2C5VA 2OO8X 3JVRA 3H30A 2C6DA 1J3HA 4ALWA 4D1XA 4QQTA 4L45A 2PZYA 4FL1A 4W4YA 3GCSA 4R78A 1PXNA 1FVTA 2G1TA 4CZYB 4W9XA 5EHOA 4NK9A 5J95A 2VTOA 3HECA 1KOAA 5IUGA 3VUIA 1Q8ZA 5HVYA 4V0GA 3F7WA 1E1VA 4F6WA 5C9CA 3I79A 4RFMA 5DBXA 2WQNA 4B6LA 3ZZEA 2W05A 3QAME 5I5ZA 4CLJA 3ORMA 4MBIA 5DT0A 5IUIA 4NKAA 4TWOA 3R21A 4I92A 5CT7A 4CKJA 1H07A 3L9LA 4WG3A 4FV6A 3CS9A 4RC3A 4AGCA 3NAYA 2YM7A 2JDOA 1FGIA 1YWNA 2W96B 3S3IA 3V8SA 2IZUA 3OCGA 3N4UA 3F5PA 2VU3A 3TZ8A 5J7BA 3VN9A 1GAGA 3QL8A 4L68A 3UMWA 4YJRA 3C4EA 4RX9A 4ZS0A 3PFQA 3MFTA 4OBQA 4QMVA 4WD5A 2WZJA 3E92A 4ANOA 2BZKB 3EN9A 4U42A 1OBGA 2VTSA 2VO7A 3MWUA 4QP4A 2I1MA 4G9RA 4FYNA 3ZO2A 4B9DA 3C4XA 4BCMA 5EW8A 1JSTA 4YBJA 1Y8GA 3GU7A 3H9FA 2OW3A 3O2MA 3QZGA 4O0VA 5LMKC 2A98A 3OCSA 5CU3A 3AD6A 5EM5A 4OAUC 3BPRA 3T8OA 3KIOC 2Y4PA 2VUWA 4DA5A 4CMOA 2XRUA 4JDHA 4O84A 5GJFA 2QVSE 1U4DA 2GMXA 2V0DA 3DB8A 3W55A 4BICA 5L6PA 2E9PA 4GVAA 2UZVA 4BWPA 3NWWA 1TZDA 4DBXA 4UV0A 1A06A 2VTQA 4GT5A 5T6KA 2IJMA 5E90A 3MFUA 3LVPA 2P2HA 3MH1A 4S31A 2CGXA 4FTKA 1Q4LA 5C1QB 3P7CA 4L00A 1ZOHA 5IA1A 3QTSA 2FSLX 3CD3A 4WBOA 3E8CA 5HESA 5LVLA 3D14A 2PYWA 4RA5A 1XMMA 3E93A 5HCXA 4BDCA 4FSUA 2DWBA 4O6EA 4XYFA 4ZTQA 1V0OA 3PY1A 5FD2A 3T3UA 4WOVA 1G8JA 3RCDA 4TW9A 4RLLA 4EQUA 2X0QA 2ZV2A 3LQ8A 2RG6A 4DFUA 2OXDA 1NXKA 4TY1A 3MGYA 1OI9A 4OT5A 4KUJA 1A9UA 3IPHA 5C8KA 4QP9A 4X3FA 4JDIA 1ZYSA 4NZWB 1IRKA 2OICA 3EHAA 4LGHA 3TV4A 3OC1A 2R3LA 4LUEA 5IQHA 5CVFA 2G2HA 5K0XA 4BDAA 4E5WA 2NP8A 5E7RA 4YJSA 2IO6A 4FKLA 5JT2A 4IADA 2UZLA 1M17A 4HGEA 4YZDA 2GNFA 3D9VA 4QYHA 4RBLA 3UQCA 3QTRA 3ZM4A 4U8ZA 4ZLOA 2WGJA 5CSVA 5EW9A 4MHAA 3KMMA 4HYHA 4D9TA 2BZIB 1Y57A 5J5TA 3VBYA 2R7BA 3S2PA 5FM3A 5ICPA 1RJBA 3PG3A 4LFIA 3HV6A 4A7CA 4BDFA 3TZ7A 2X7FA 4E1ZA 5HG9A 2CGWA 5DNRA 1M7QA 5AR8A 2X0PA 4YMJA 5AM7A 4BGQA 3Q04A 3QQHA 4NYEA 2BR1A 3NYOA 3MV5A 3CTHA 3R8VA 2OXYA 4FV9A 2WEVA 3CIKA 4AU8A 4RVTA 5FRIA 4W4VA 4BI0A 4K0YA 3A2CA 3KREA 4ORKA 4I4EA 4DH8A 4WNOA 5HIBA 2WTKB 3IGGA 4LOPA 5E8WA 4RVLA 3EQDA 2XBJA 4MXXA 4BFMA 4UMUA 3KU2A 3OXZA 5K0KA 4O7YA 3BWFA 5FWKK 4O83A 4FG8A 4AA0A 3NYVA 4FKWA 2QQ7A 2XAOA 2XM9A 5KMMA 1PXIA 3G0EA 2UZOA 3SDJA 1Q8UA 1I44A 3BCEA 3DPKA 4TYHB 4GG7A 5L2TA 4DDGA 2ESMA 3CJFA 5F20A 3TXOA 3LM0A 4MNEA 4AACA 5E8UA 3POOA 3WI6A 3TZMA 2XVDA 3ALOA 3LCKA 5I3OA 4G34A 2WMBA 1J91A 4RIYB 2JBPA 4ZY5A 3OMVA 3F69A 3QCXA 2VTHA 3GC7A 1CM8A 5BYZA 4M66A 5ANGA 3TKUA 4DDIA 4QTBA 3EQPA 4RWLA 2WMXA 4X2JA 3H0ZA 3OT3A 3SRVB 3VJNA 4DHIB 3R02A 3ZXTA 1W82A 4QT1A 4AX8A 3KK9A 5BVKA 4LV8A 5JGAA 3C5UA 4FTNA 4QMOA 4CCUA 4ITHA 3A7HA 3C9WA 1JBPE 2AC5A 2C5XA 2YITA 3PSDA 3TNIA 1UU3A 2XB7A 3FLSA 4QPAA 3K5VA 3THBA 5DN3A 4ZEGA 2CCHA 4FZ6A 4CFVA 1KE9A 4O7LA 4J53A 3KEXA 5CF6A 1S9IA 3LOKA 3FL5A 1OB3A 3LJ0A 4AN3A 4AQKA 4BDEA 3SX9A 1TFFA 2R3JA 2X81A 3QALE 5CI6A 5TOZA 3DZQA 1O6KA 2IZRA 4ACGA 4EQCA 2OKRA 4JVGA 2PZPA 3GEQA 3GCUA 3RAKA 4NM3A 4F9CA 2VWYA 3PP1A 3TEIA 4ZTHA 4F0FA 3ZTXA 4D2TA 4DEDA 4FF8A 1Y91A 3MVLA 4RWIA 3CC6A 2OXXA 3KXZA 4IFCA 4XG7A 4AT3A 1PXKA 4N57A 2P2IA 2IG7A 3RM7A 2YISA 5HGIA 2X2KA 3LKMA 3ENMA 4DTBA 3RPVA 3GVUA 3QGWA 1M2PA 2ZB0A 5IA4A 4EOPA 1V0BA 4OTRA 1FPUA 4TYIA 2QU5A 3TDWA 3UO6A 1I09A 3DDPA 1OIQA 4WA9A 4XRJA 4BTKA 4YHJA 5K9IA 5LXMA 2I7QA 1DAYA 1R1WA 4WSYA 3I81A 3P78A 4FKPA 3RP9A 2CKPA 3WIKA 4A9UA 3BU6A 2Z8CA 2OH4A 4I5CA 4RVKA 2O2UA 4A9SA 4QMWA 5DWRA 2C6OA 2UZTA 4ALUA 3WOWA 4OTGA 4RIXA 3IECA 4GUBA 2BZJA 3EB0A 4GYIA 4OTFA 4I5MA 3UJGA 3TNQB 3UOJA 3W2RA 4F9YA 4H1JA 4ZAUA 4GU9A 2OLCA 3P9JA 3C5IA 3A4OX 3Q4CA 2ZDUA 3KRWA 2B1PA 3I60A 2REIA 4IC8A 1SMHA 1R0PA 4PDOA 4Y46A 4RJ7A 5DFPA 2B9IA 2YIRA 4PL4A 5HO8A 2ITQA 4FODA 3BGQA 3HMPA 3LM5A 2G2IA 4CFMA 5HLNA 3N4TA 3R7IA 2AUHA 2FSOX 3ZEWA 5B2LA 5I4NA 4QYFA 4ZS4A 3R8LA 3ZUUA 1YHSA 2OIQA 5EDQA 3UC4A 5M4FA 2W0JA 5EFQA 3W32A 4FNZA 3A61A 3UC3A 5F95A 4FKSA 5CNOA 4E5AX 3CLYA 4BJJB 1YOJA 5AAFA 2JFLA 3JPVA 4AFEA 2GSFA 4HNFA 3Q4TA 4CXAA 3TUBA 2W1EA 3QZHA 4I6QA 3NUSA 2OJ9A 4XOYA 5BUEA 2HWPA 4U7ZA 5CAVA 4A4LA 3EWHA 1Y8YA 2XKDA 5KCVA 2ITPA 4RIWB 4DGGA 1XH4A 3UNKA 4XP2A 2QOHA 5H8EA 2ZV9A 3F66A 5BX0A 2PE1A 3A7JA 4ANLA 4FIIA 2YM8A 3FLZA 4FOCA 2QKRA 3KKVA 2PHKA 2J90A 3PJ2A 3RAIA 3KY2A 4FVRA 3SVVA 4DN5A 4IB0A 5E4HA 5E8VA 4C36A 4L44A 5T3QA 1FBNA 5M4IA 2ZJWA 1G8KA 5DOSA 4HW7A 5HORA 3UZPA 2BDJA 3OBJA 3W2QA 1KUTA 4NH1A 4TRLA 3TUDA 3DOGA 4RX8A 2B9FA 4DAWA 4BCQA 2EWAA 4CD0A 5KKRB 5LWMA 3SXRA 2O0UA 2GS2A 1K3AA 2X9FA 3MVMA 3FZOA 4OT6A 2VWIA 5J1WA 3NNUA 1STCE 4D2SA 4F99A 3ZFYA 3C4FA 4IZAA 4UYAA 5ETCA 2WTVA 2CJMA 2QI8A 1GNGA 3F82A 1SM2A 3OVVA 4QP3A 1LEWA 2BRHA 1Q8WA 3PVBA 4IACA 4QP8A 4O27B 4CZTA 4YPSA 2ZM3A 4IE9A 3EKNA 4OBOA 4E4LA 5HO7A 5M4UA 2VTLA 4A4OA 4AN2A 2R3MA 4AW0A 2Q0NA 1JKSA 3LLAA 4J98A 5EYMA 4FV4A 4O0RA 2UVZA 5ETIA 4E73A 2Y0AA 2VTIA 3WARA 4AAAA 3NPCA 5CY3A 2YEXA 3P0MA 4UN0C 2VV9A 3CGFA 5HX8A 1WCCA 2HOGA 3FWQA 2OG8A 3KXNA 2O65A 4U5JA 2R0UA 4M67A 5AA8A 4AS0A 3W2OA 3ORKA 4XV2A 4BCOA 4TYEA 2BCJA 3IKAA 4HPUE 1Z57A 3OW3A 4S33A 1M14A 1JKLA 2WAJA 5D11A 1OGYA 1JLUE 4QP6A 2ITTA 3FQSA 2H6DA 4F1TA 1MQ4A 2WNTA 3Q9XA 4JBVA 5CI7A 4PP7A 3BLRA 3VC4A 3R7VA 3QA0A 4Z3VA 4S2ZA 4QYGA 4AOIA 2PUNA 4MQ2A 3UP2A 5DR9A 4FKJA 5BVFA 3UVRA 3JY9A 3DQXA 5G1XA 4U3ZA 5FBNC 2IVUA 4FKTA 4G5JA 3O8PA 4Q2AA 2QOQA 5E91A 2XH5A 3V8TA 3W2PA 5L2SA 4MTAA 4ZTMA 5L3AA 3WZDA 2C6LA 4LM5A 5G6VA 3WIGA 4QTAA 1K9AA 4IVAA 5DPVA 2PMIA 1SNXA 2X4ZA 5EKNA 2C6MA 2PY3A 3NCGA