2BAQA

P38alpha bound to ro3201195
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
347
structure length
329
Chain Sequence
RPTFYRQELNKTIWEVPERYQNLSPIGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDELKILDFGLAYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 14
publication title Prevention of MKK6-Dependent Activation by Binding to p38alpha MAP Kinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 107
structure length 329
sequence length 347
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2005-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2baqA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2baqA01
2X7OA 1Y91A 1GAGA 3R01A 3WYXA 4MBLA 5DRDA 5AP2A 3C5UA 1Q3WA 4UBAA 3ZONA 4EZ3A 4RBLA 4N4SA 5HIBA 3PJCA 4AZTA 5AUTA 1UKHA 1VZOA 4BZNA 2GQRA 1OPJA 4K8AA 3D7TB 4BIEA 1YQJA 4FR4A 3MPTA 3V6RA 2B4SB 2WIPA 1OL6A 3QLGA 3VWAA 3DQXA 2W9FB 2X7GA 2YM7A 2IVTA 3F5XA 4DGMA 5KMNA 4AE9A 2CKQA 4O7TA 3ZRLA 2OICA 4G3FA 3ZRMA 4XG8A 3RPRA 4F9BA 2QOQA 3KREA 4J96A 4LM5A 5HVKA 3CS9A 4HYSA 1RW8A 4O0VA 5CENA 4BZDA 1JSTA 4X2NA 2OJIA 3RCDA 4HVSA 1HCLA 4XV3A 4MXYA 4WRGA 3RAKA 3FKNA 4CMTA 2AYPA 1DM2A 2YAAA 3BGZA 3KXXA 4PP7A 5GINE 1JVPP 3NNWA 4U97A 3OY3A 1CTPE 3G6HA 2XM9A 2GFCA 2BTSA 2YAKA 2B0QA 3MFRA 4IZYA 3HP5A 4GKIA 5CAOA 1I09A 1BYGA 4U0IA 4HJOA 1AGWA 4L45A 4QMSA 4IANA 3EQGA 4ZEGA 3O50A 4BDFA 4ALUA 2BIYA 5L2TA 4DCAA 4E73A 4EOMA 2FSMX 4I6BA 2OWBA 2X0GA 2VTMA 4CYIA 3ZS5A 3P0MA 4NFMA 2GPHA 4FNYA 4GIIA 3TDWA 3LAUA 2XK8A 3H9FA 4FIGA 3CE3A 4I22A 5IEVA 2UUEA 2PL0A 1R78A 3ORMA 4FIEA 1H01A 4Z3VA 3HAVA 1ZYLA 3ZM4A 3OS3A 4D2TA 3SXFA 4EZ7A 3QQLA 5LMAA 3DKCA 1J7UA 4ERWA 1W84A 3TV6A 1IG1A 3PRFA 4I3ZA 3DDPA 4QP1A 2VWWA 1JKLA 3MH2A 4CTBA 3KXGA 3MSSA 3TTIA 4C33A 2QKWB 2XM8A 4O6LA 3SOCA 5FLFA 3K5UA 3VUKA 4D5KA 2C68A 3C7QA 5IPJA 3LFNA 4EWHA 1YXVA 3Q32A 5A9UA 3RZBA 3FY2A 1OI9A 1H00A 4MX9A 3RAWA 3RZFA 3FKOA 3PY3A 2YCSA 4FT7A 4YJPA 5AR2A 5AR3A 3FLNC 4FKQA 1PJKA 4U3YA 2YZAA 3UG1A 2VTPA 1DI9A 3V51A 3ULZA 5AUXA 3VBTA 3WZUA 4D1ZA 3Q9ZA 4MYGA 2PULA 4S33A 1T46A 2VWZA 3ETAA 3HMMA 2XJ1A 5DH3A 2EB3A 5FP5A 4L7SA 4O7VA 2R3FA 4ASXA 3A7GA 3MW1A 3NIEA 5HO7A 4GMYA 4FKLA 1WVYA 2B9JA 2YISA 4BY9E 4RC3A 4MNFA 1FGKA 3R71A 4IZ7A 1PY5A 4W8EA 3ZMMA 3DLZA 3QTSA 3R9OA 1EH4A 2PK9A 2A4LA 4N70A 4EQCA 5CZIA 3GCUA 2B9IA 2CNVA 4APCA 3VUIA 3GCQA 4LRMA 4ZSLA 4H3BA 4E93A 5L4QA 4E4MA 4QP4A 4ZJJA 3DKFA 1MRUA 3GOKA 3WF6A 4AGDA 4E4NA 5BUJA 1W82A 2A19B 2FUMA 5GZ8A 5CEOA 2YM5A 1OKWA 3CCNA 3ORIA 4Q9SA 2G2HA 4F1MA 4PL5A 4V0GA 3D83A 3FAAA 3GB2A 3MA3A 5G6VA 5M44A 4D9UA 5E1EA 3BEAA 3ORNA 4ACGA 3MV5A 3CP9A 4J8NA 2XJ2A 4EBWA 3FYJX 2R7IA 3W8LA 5C4KA 3EKKA 4WUAA 1DAYA 1URWA 3KN6A 4FKIA 4QTDA 4BCFA 3N4UA 4FSRA 2J2IB 3NCGA 1GY3A 1YOLA 2X8IA 4M14A 3WILA 4XLIA 3KULA 4YNEA 1ZOHA 3IS5A 5H2UA 3TV4A 3VRZA 2OFVA 2RIOA 4BDDA 2GNGA 4FTOA 2PUIA 3KRJA 5BVNA 4WKQA 3FY0A 4X2KA 3ZUUA 3L8SA 1JSUA 3MB7A 2AC3A 4HGTA 4BB4A 4R7BA 5LWNA 4G9CA 4GG5A 4O21A 2WMXA 3UP7A 4Y83A 1OIRA 2EB2A 5F94A 3VS3A 3H9RA 4FKUA 3SRVB 4F09A 3KVWA 4D2WA 1K9AA 3VUTA 4D1SA 2C3KA 4XOZA 4RIXB 3HMOA 4FTIA 3NAYA 2IVUA 4QT1A 4XRLA 4I6QA 4AU8A 1OIYA 3BBTB 2IO6A 3KRRA 4IB0A 5AP1A 1BUHA 3BRBA 4C57A 4BTFA 3QZFA 4Z9LA 2VTRA 4QO9A 3BYVA 2IW6A 2I1MA 3GC0A 4FVQA 2YIWA 4YSMA 3UVPA 3QKKA 2Z7QA 3V01A 4AZWA 1XH5A 3R21A 4CFWA 4CRSA 5KMOA 4IZ5A 4DA5A 2A0CX 3S0OA 4FT5A 3FI4A 2CJMA 2W9ZB 3ZSIA 5EYKA 2FH9A 4J7BA 4ALWA 2PVKA 2C5XA 1PRYA 3DJ5A 1MRYA 3R9DA 5GIPE 4X6QC 3W32A 2BRGA 3HMNA 5H8BA 1Q4LA 4FG8A 3TNQB 5HBJA 5HQ0A 5EHOA 4J8MA 4DG2E 1YXSA 4LOPA 5KMMA 2X39A 4ZJVA 2G15A 4FZ7A 4ZTLA 1TKIA 5FEEA 5GIOE 4CFNA 4F0GA 4RG0A 5BUEA 1MP8A 3IW8A 1H08A 3QBNA 3TNWA 4IWOA 5AFVA 5AP4A 5IDNA 1BMKA 3VHEA 4IX3A 4QYHA 2OFUA 5CAPA 4M13A 3OG7A 4S2ZA 4ANBA 4BTJA 3HV7A 4D5HA 4X2FA 4UX9A 4J99A 3RI1A 5LVLA 5CXHA 1Q8TA 5AV3A 3LIJA 3O96A 1PMEA 2XNGA 3A7HA 3RAHA 3Q9XA 4YZ9A 2PUNA 4R78A 2XK7A 3TDVA 4F0IA 4FKPA 3ACJA 2J0IA 4MF0A 2GMXA 3CY2A 3VUHA 4O82A 2W5AA 3E8EA 4I4FA 2YITA 5KMIA 4ZS4A 2WMRA 4D2VA 3CY3A 4WG5A 4A9RA 1NVRA 4FNZA 4ITJA 3COHA 1H1PA 2Z7RA 5KMJA 2AUHA 1NW1A 3D5VA 5L2WA 2UW7A 4FBXA 3OBJA 1KOAA 5E1SA 2ITNA 4HVIA 3MFUA 3NCZA 4FTAA 1URCA 2I6LA 3OC1A 4BDIA 3WIKA 3JUHA 1CKPA 5CQWA 4OBQA 4TY1A 5AM7A 5AP6A 4AFEA 4AW1A 4FF8A 4F6WA 5L3AA 2BHEA 4ARKA 2R3MA 3A8WA 3PWDA 4TYJA 1F3MC 4YJQA 3VN9A 3L8VA 3QTQA 3FHIA 1OKVA 4XS2A 5CVGA 3UODA 3QUPA 4QYGA 3BYOA 5KBQA 2QHNA 3WF7A 4IWDA 4PNIA 4YSJA 2VTAA 4L42A 5M56A 4YHJA 4AOJA 3PY0A 4KBCA 5EW8A 1IR3A 3PYYA 4PP9A 3W8QA 2CGXA 2LGCA 3LOKA 4GH2A 2JKOA 3AQVA 1MUOA 2P2IA 2Q0BA 2VO0A 3MTFA 5ANGA 5FQDC 4BDHA 2W1FA 4A07A 4DEBA 4ACHA 4EI4A 4NM7A 2VTSA 2HZ4A 5HCZA 1QCFA 5L2QA 1PKDA 3TIZA 4QMMA 2X8DA 1P14A 2YIXA 3P5KA 4OTGA 3KKVA 4WO5A 3SXSA 5FBNC 3OCSA 3ZO1A 1KE6A 4BCMA 2XEZA 2YERA 3GVUA 4JR7A 2ITUA 3OT8A 4O7YA 2IG7A 3IQ7A 4PPBA 3COMA 4U6RA 3W10A 3SW4A 2ESMA 3PWYA 3KA0A 3TKIA 1CSNA 2W99B 4AN3A 4IQ6A 4R7HA 1KE8A 3WOWA 1J7IA 4NH1A 2HENA 5AJQA 1YHSA 4BGHA 3LJ1A 1V1KA 3QQUA 5CTPA 5LWMA 4AGWA 1H1SA 3R28A 1XWSA 4BZOA 5E8VA 3NDMA 2WTIA 4W4WA 5AUWA 3R04A 3E93A 2XIRA 5EOBA 4GW8A 2P33A 4QTBA 1CKIA 3AT3A 1H0VA 3QA0A 4XG3A 2C6IA 4XX9A 4EK3A 4MD8E 5CAQA 3QXPA 2XYUA 5GJGA 2C3IB 4YR8A 1W83A 2A2AA 2R3PA 4C4JA 3DXNA 3R2YA 3UIUA 5AAFA 4IM0A 4MXOA 2BDFA 4YZCA 3VC4A 1PMVA 4PV0A 1Y8YA 2XIXA 4XV9A 4UMUA 4KRCA 3CD3A 4Y72A 3SC1A 5C4LA 4M66A 4PTCA 4JDIA 3DV3A 1P5EA 3JR1A 4MH7A 4PDYA 5I9ZA 4G31A 2WAJA 4JAJA 4L9IA 1LPUA 4U42A 4LMUA 4C0TA 1U59A 2YDJA 3ZBFA 3C0GA 2GHGA 2ZM4A 3OUKA 4E20A 2BHHA 3JY9A 4MNEA 4EH6A 4NM5A 4O1OA 4CD0A 5CASA 3UZPA 5KHWA 4EOJA 3R00A 1V0PA 2RL5A 3C50A 4WSYA 5F9EA 1R1WA 4LL0A 3MY0A 3CIKA 2EWAA 2VWBA 3ORKA 4FSUA 4GUBA 3NNUA 3DDQA 4CVAA 1FOTA 2EVAA 3HDMA 2C0TA 1H07A 3OOGA 2W1IA 1R0PA 3FQSA 1H4LA 1UNLA 4NU1A 4ZIMA 1H1RA 3DOGA 4QMTA 4U40A 2QI8A 3RAIA 3DKOA 3R1QA 3O8PA 4O7SA 3OF0A 3BBWA 4ZY6A 3V5TA 1BL6A 2OZAA 2QOOA 3NZ0A 3UPXA 4F7LA 4QQJA 4AOIA 3PZHA 3EB0A 5EDQA 4RIYB 4GUEA 3IW4A 3QUDA 2YABA 4KSQA 1J7LA 1GZOA 2ITYA 3A61A 3D2KA 4O6EA 4USDA 3BU3A 4Y8DA 4EH5A 2B1PA 3M2WA 4YBKA 1KWPA 1OL5A 4RWKA 4EOOA 4EH3A 5AUUA 3QYZA 4H36A 5EYCA 3PJ8A 5DBXA 4IXPA 3ROYA 3TEIA 2X9FA 3QYWA 4J1RA 4YTIA 3CTJA 4NCTA 4XOYA 4X2GA 4XRJA 2C3LA 4RSSA 4KUJA 4HVGA 2RG6A 4KIKA 4KS7A 3Q4TA 5IQAA 4DH5A 3JYAA 5IU2A 3NNXA 2FSTX 2W1GA 3CXWA 4ZZMA 4JQ8A 5BYZA 5K5XA 4FSNA 2GFSA 3VBWA 3A62A 4WNOA 2WIHA 3U6JA 4DYMA 3POOA 4NM3A 5AUZA 5B0XA 5CSXA 4PY1A 4ZSJA 3P23A 1M14A 4QYEA 5FM2A 3IONA 2Z2WA 3QGWA 5ETAA 5LVNA 4LG4A 3CR0A 4BDEA 2JBPA 3PPKA 4TWPA 5K3YA 1JLUE 3JVSA 2WTCA 4LFIA 3E64A 3MA6A 3BIZA 1J1CA 2H34A 3R02A 3TKHA 4JG6A 1QPEA 5FTQA 3FLYA 2VWXA 3UE4A 4UWYA 3QUEA 2VWVA 5HLNA 1WVWA 3F7WA 3BU5A 3DBCA 4RVMA 1BI7A 5EG3A 4O7RA 3OXZA 2EXEA 2YJRA 3G6GA 3LFFA 3PVUA 3D14A 3MIYA 4L3PA 2XIYA 2J6MA 3SG8A 4L6QA 3Q6WA 2Y4PA 2XRWA 4F63A 2B55A 1PMUA 3KF4A 1XH9A 4IWPA 5CANA 3QQFA 4RA4A 4C3RA 2W0JA 5E8SA 4KIQA 3SQQA 4OTWA 1Y8GA 2UZEA 2BVAA 4OTFA 5FM3A 5C03A 3MFSA 4CKJA 3NYXA 3I6UA 3AT4A 3IG7A 4M15A 4RC2A 2BMCA 3L9PA 4UWBA 3ZXZA 4AT4A 4BTKA 3DGKA 4DBNA 2BZJA 5CQUA 3S4QA 4WUNA 4CFXA 4YUQA 4X3FA 3REPA 4C62A 4YLKA 4YURA 5CU3A 3HEGA 5C8KA 4AOTA 1JKSA 3VS2A 1XR1A 2X2KA 5HNGA 4RWIA 4NCTC 3LCOA 4O0TA 5CI7A 3U9NA 3ZC5A 2YACA 4AFJA 5I9XA 3A60A 5KBRA 3ZO3A 1U4DA 2C6LA 3EQHA 4LRJA 1GZKA 4H05A 3I60A 4DTKA 4F64A 4S32A 2X81A 4WBBB 5HOAA 1Q3DA 3QTRA 1XJDA 5A3XA 3SD0A 2IZRA 4IDTA 4YBJA 4CLIA 4GYIA 2OJ9A 2BRNA 3Q5ZA 4F0FA 4FODA 4DF3A 5ANEA 4DINA 5CY3A 4FKGA 4GL9A 4YC3A 4E6AA 4BDGA 2UW8A 4RFYA 4BVUA 5J79A 3GEQA 3QD3A 4IH8A 1M7NA 4NW6A 5EM7A 2B9HA 2Z60A 4JXFA 4AWIA 1FBNA 2R3RA 2JEDA 3B8RA 2RF9A 3PPJA 5GHVA 3TJCA 4U41A 5EI2A 3R83A 4MXXA 2XK3A 3KQ7A 4C4EA 4DH8A 2QD9A 4CXAA 2W1DA 3DT1A 1OECA 3MVJA 4OBPA 4R3CA 3TTJA 3P86A 5HTIA 4TNBA 5F1ZA 2R3HA 3P7CA 1OPLA 3E8CA 4F9CA 5CEIA 3BE9A 4GSBA 4F1OA 5GNKA 2BR1A 3T3VA 5BVEA 5A4QA 5CF5A 5CT7A 1O6LA 4DGOA 1YHWA 2C6OA 5E8XA 2C5NA 2Y7JA 3K3IA 2W96B 3QCYA 4HYUA 4BCHA 2C1AA 2QOIA 5EM8A 5LCKA 1PXIA 3BHUA 4O0SA 1G3NA 2BALA 4ONAA 3WYYA 2CGUA 4GFOA 1OUYA 2O63A 4FMQA 2PMOX 2ZAZA 3FPMA 3RHXA 2YCQA 3OWJA 4IAKA 4ZY5A 3R30A 3CLYA 3UJGA 4R3RA 2J90A 3BPRA 5T3QA 4CQEA 4XJ0A 4X3FC 4CV8A 3D15A 4LOQA 4RT7A 1LR4A 5E7RA 3ZFXA 3PXFA 3ODZX 4ITIA 4YC6A 2XS0A 3PJ3A 4I5PA 1YRPA 4MF1A 3NUXA 3ORTA 3FEGA 3OD6X 2SRCA 5BVFA 4YP8A 2Y6MA 3UP2A 3PG1A 4ZZNA 4QQTA 4IX6A 4Q5HA 3MB6A 3DBDA 1QPDA 3KB7A 3UNZA 3IDBA 3M1SA 5GJFA 3PTGA 1P4OA 1FVTA 4UALA 3VNTA 1B6CB 4BCGA 3DK6A 3QHWA 5FEDA 5E8UA 4GK2A 4EONA 4RJ5A 3L1SA 2G01A 3HA8A 5AP0A 5M4UA 3LFCA 2B52A 3C4EA 3DTWA 2CKOA 3CGFA 1U54A 3MN3A 4LUEA 4Y85A 3ZLXA 4USEA 1UU3A 2FSOX 2HZ0A 2NNWB 4P5ZA 5FRIA 4CT2A 3DA6A 2PVYA 4FI1A 3PP1A 2ZDTA 4ZP5A 5JRSA 2OXXA 3EMGA 5M4FA 3U4UA 4PMTA 3UMWA 3RM6A 1KE9A 4RQVA 4YO4A 3GC7A 4RJ4A 4QNYA 4DGLC 3GFEA 5EHYA 3C4XA 3DNEA 3BHHA 4NFNA 1WCCA 1E1VA 4EK6A 3EN5A 4GK4A 3FJQE 5DOSA 3RK7A 2NO3A 5AUVA 3AGLA 3VS0A 4RLKA 3ZEPA 4EHVA 4D2PA 3V5WA 5IEXA 3F6XA 3MVHA 1XH7A 3VW6A 1ZMVA 2XKFA 2YM4A 2PVNA 3EL7A 3W2PA 4DH1A 2Y8OA 3NR9A 4FYNA 2WQEA 2CNUA 3PXRA 2FYSA 5IQEA 5FTGA 1H1WA 2OSCA 2VAGA 5EM6A 1R3CA 4YGAA 4L67A 3C51A 1PXJA 4NKSA 3LE6A 4RJ6A 5IKWA 3MI9A 4M84A 5M57A 1WBWA 4PNKA 3HUCA 4UEUA 3OWKA 5EH0A 4KINA 1YWNA 2WMUA 3LCSA 3NUYA 4ENXA 4UYAA 2ZV7A 3QRUA 4CZTA 4QMYA 4A9YA 5E90A 3R7UA 3EN6A 4KBAA 4UZDA 4QP2A 3BLRA 1AD5A 3P7AA 3T8OA 1YI6A 3VIDA 2WTWA 2B54A 3NWWA 4OUCA 5K4JA 3DBFA 5AA9A 5EI8A 2GNFA 3HNGA 5AMNA 3ZLWA 2GTNA 4BI0A 2E9PA 3AC5A 5IQFA 2ZV8A 1OPKA 3VHKA 3F82A 1KE7A 3GNIB 4FNXA 1E1XA 4TPTA 2P3GX 3UQCA 4GYGA 3KRXA 5I3RA 2IZTA 4PDPA 4ZS0A 4HW7A 3R9RA 1YDSE 3OBGA 3JY0A 5TF9A 5DWRA 4D4YA 1S9JA 1Z9XA 3BLQA 4XMOA 2YHVA 2BCJA 1Q24A 2P0CA 4CZYB 3R1YA 3Q9YA 3NSZA 3A7FA 4CQGA 2QCSA 5T68A 2XNBA 4FGRA 2XIZA 3OZ6A 4YZBA 3KXZA 2VTQA 2GHMA 4ZZOA 4IHPA 5BPYA 4BDAA 5HEZA 5B2LA 2HCKA 4E5WA 5A4TA 5CAUA 4FTJA 1XO2B 3N9XA 5CSWA 2ERZE 3PSBA 3BLHA 5J87A 3KFAA 1JOWB 2UZVA 5CAVA 3OHTA 3QRJA 4HNIA 1WFCA 2ZDUA 4FTLA 4L46A 4HVHA 5TR6A 3HAMA 4X3FB 4OW8A 3DAJA 4JX3A 5EKOA 2JC6A 4H58A 3KN5A 3KF7A 4QTAA 4BKZA 1V0OA 4XHKB 4XV2A 2JKMA 2WMAA 4D4SA 1OL7A 3FMNA 2YN8A 1IA9A 4CGAA 3EJ1A 4UMPA 5IG1A 4Y5HA 3CBLA 4GS6A 4K2RA 3HV6A 4D28A 4KBKA 2PVMA 1Q8ZA 5D1JA 4BBEA 4RRVA 5L6OA 2W4OA 3DFAA 3F3WA 2R3KA 2BRMA 4TZRA 3EFLA 3E63A 4RA5A 2VV9A 3SA0A 4ZAUA 3BQRA 4XG2A 4C37A 2XRUA 3FDNA 4FKJA 2YCRA 3I1AA 4J95A 5AP5A 5AV2A 4ENYA 3FZSA 4JLCA 4WSQA 2QHMA 2YDKA 4YJRA 5A6OA 2DUVA 2H8HA 3VBVA 5C27A 4J98A 2ZOQA 3UO6A 3HV3A 5BQ0A 3R73A 4X6RA 4AN2A 4ACMA 3G15A 4TYEA 3MY5A 1K2PA 3OCBA 4IM2A 5HBEA 2GU8A 1Z5MA 2QOFA 4ACDA 3QGYA 5CVHA 2YA9A 3AXWA 2UVZA 2VO7A 3ZSHA 2HWOA 4EOSA 5AWMA 5EYDA 3MPMA 2ZM3A 1JAMA 4BFMA 5E92A 5TO8A 2C6MA 2QONA 3FL5A 5IEYA 4AG8A 3QAME 1G8SA 4ZOGA 2X1NA 3MH1A 4Y5QA 1DI8A 4ZTNA 4K77A 5LMKA 2V7OA 5DFPA 3IPHA 3QRIA 3ZHPC 2UZLA 4GK3A 4RMZA 5CF8A 2YCFA 2E9OA 5I9UA 4CKIA 4FA2A 3LKMA 1FGIA 1SVHA 4JDKA 4NJDA 4AN9A 2OXYA 5EQPA 3C9WA 4G1WA 1NT2A 5H8EA 5JGDA 4I4EA 4RVKA 3U6IA 4F65A 2C0IA 3G5DA 3UTOA 3VS6A 4EC9A 1SMHA 1FVVA 3F69A 3Q2MA 5FWKK 4OT5A 4BWKA 4FYOA 1FVRA 1VJYA 3PRIA 4IIRA 4FKWA 5JT2A 3OW4A 4B8MA 1YOJA 4JS8A 4FKTA 5FD2A 5B2MA 5FG8A 4DT8A 4IE9A 2C6EA 2ITVA 4FVRA 3W16A 4CFUA 3NPCA 4FTTA 2CHLA 2E2BA 3D7ZA 2C0OA 1H27A 5DPVA 4JBVA 2ETRA 5M53A 2WMVA 1G8AA 5HI2A 5B7VA 4AA0A 4LRKA 5C01A 4D2SA 4RJ8A 5IH5A 4JR3A 5FDPA 4M0ZA 4G16A 4IC8A 3WE8A 4U9AA 3UBDA 4KKHA 5HU3A 2BFXA 2VTJA 2XH5A 3DU8A 2RGPA 3F5GA 3QU0A 4JQEA 4OTRA 4AW0A 3QTXA 4D0WA 3COKA 4OTQA 5M55A 1ZAOA 2ACXA 4E26A 2V7AA 4F6UA 5CF6A 1Q62A 4EK5A 3EH9A 3O7LB 3UIBA 2OZOA 2EXMA 2PTKA 2Z02A 5DR6A 4NL0A 2IW9A 4BI2A 4BIDA 3SLSA 2WHBA 4E3CA 2BAJA 4YO6A 3G2FA 4L68A 4G3DA 1H26A 2XMYA 5ANKA 3PVWA 4ZTRA 2YWVA 2BAKA 2HXLA 1NY3A 1PXOA 3LPBA 4C3PA 3M11A 3TIYA 2QG7A 3DCVA 3L8PA 3IW6A 3UOJA 4II5A 5CVFA 4M69A 4EOPA 1H0WA 2R7BA 3DK3A 4FT0A 2JFMA 4GVJA 2XEYA 3IECA 4ZSAA 2UW4A 3MH3A 2R2PA 2W5HA 1JSVA 2RG5A 3D5UA 4FKSA 4G2FA 1YVJA 1IASA 4IVBA 3VF9A 4M97A 2JKQA 3BX5A 3VUGA 3WF9A 1ND4A 4IACA 2Y4IC 4ACCA 1KSWA 4O0WA 4C2VA 4DFYA 3TACA 3NUUA 3E92A 3PVBA 1E9HA 2RFDA 2VZ6A 1ZY5A 3OCTA 2E9UA 2Q0NA 2Z7LA 3ALOA 3RPSA 3DJ7A 3C4FA 4MQ1A 4HGSA 4RIWA 3UYTA 2QG5A 3H3CA 3ORZA 4LL5A 1CKJA 1GOLA 3QALE 4DFLA 4EOKA 5F20A 4QTCA 3PP0A 4IBMA 1CM8A 4FOCA 5E9EA 4FSZA 3VS5A 1XBBA 4AXAA 4CFVA 4F99A 4U8ZA 3FXXA 4PDOA 5I5ZA 2RFSA 5AA8A 3I7CA 4WIHA 4LOOA 2F2CB 4HCTA 4YTCA 5DYJA 3PA5A 3NUNA 5HE3A 2PUPA 1OIUA 2YJSA 5ACKA 1IRKA 4QOXA 4HGEA 5DT0A 4EH8A 5DN3A 4C34A 4YC8A 3LZBA 2YLEA 4R8QA 1UV5A 1OMWA 1WBNA 2R5TA 4DEDA 5CSVA 2UZUE 3KRLA 5L8KA 4BGGA 2V5QA 4O22A 4RVTA 4PL3A 3SDJA 2C6KA 1YXTA 4JG8A 3SKCA 3W2OA 2I40A 3ZO2A 3Q96A 3CEKA 5D11A 5D10A 3MPAA 2BZHB 2J0KA 1WBPA 4PTEA 1VYWA 4P5QA 2PUUA 2PVLA 3VS1A 3BYUA 5CU4A 5HORA 1XHAA 2PVHA 3QF9A 2GQGA 4FIIA 2W7XA 3UGCA 4R5YA 2IZUA 5M08A 3E62A 2BIKB 4NEUA 4E5AX 4YTFA 3VAPA 2QOBA 5AX9A 3SGCA 3F7ZA 4W4VA 1ZOEA 4O7NA 3WZKA 1I44A 4DFNA 4JT3A 3O8TA 4TW9A 3CQEA 4BR3A 3QQJA 3BHVA 4CSVA 4TYGA 1FINA 5ANJA 3GCVA 4EH9A 2DS1A 4FT3A 4O83A 3R0TA 5LVPA 3UZRA 1UA2A 4MAOA 4OAUC 5J5TA 4DEGA 3VS4A 4ZSEA 4AA4A 4WOVA 4L52A 3F3VA 5H3QA 3MESA 4FG7A 3AC1A 3AG9A 2WOUA 3ELJA 4RQKA 1A48A 2C1BA 3R9NA 2WNTA 4MD7E 2CN8A 4WNKA 4OR5A 3Q3BA 2OJGA 3K3JA 4DEEA 3OY1A 4IZAA 3MWUA 2QOHA 3QA8A 3O7LD 2RFNA 5I9WA 3A4OX 1PHKA 3V5JA 2XCKA 3NYNA 1ZYSA 4GJ2A 2QC6A 4IAAA 2J9MA 2JDSA 2XZSA 3EQPA 2RSVA 4H3QA 4J52A 4JVGA 3VBQA 4YNOA 4PL4A 2OJFE 3UQGA 4BWPA 4F9AA 3S00A 1UU9A 2YIQA 3ZZEA 1UU8A 4XBUA 2JAVA 4FOBA 4QP6A 4UZHA 1TQPA 4XUFA 4I93A 4KWPA 5L8LA 3H0ZA 3D2IA 3R2BA 3I0QA 2XNNA 4I5HA 4EH2A 2X2MA 3HP2A 5KZ0A 5JH6A 3N4TA 4JL9A 3ZTXA 1LUFA 4M3QA 4A06A 5CLPA 4M8TA 5DEYA 3H0YA 4RPVA 5EK7A 1RQQA 4I5CA 3AT2A 3ZUVA 1VEBA 4RFZA 2PSQA 3R8VA 2YIYA 1YXUA 2ITXA 2J50A 5JFXA 3D5XA 4BL1A 3RK5A 3E87A 5JEBA 2BKZA 5E4HA 3FMEA 1UWJA 2BPMA 5LQFA 4DFUA 1JNKA 2HOGA 4ORKA 3EN7A 5ANIA 2BZKB 2PVJA 3L9NA 4O38A 2BILB 4XBRA 5AR5A 3ORPA 1JKKA 5C9CA 2V0DA 5HG9A 4WG4A 3UO4A 3EQBA 5LJJA 3PPZA 4JNWA 4R1YA 4JBOA 3R8MA 5HESA 4JBQA 5C8NA 4PMPA 3T3UA 2VRXA 5DE2A 4ANMA 4FTMA 3DB8A 4FL1A 1YDTE 2FSLX 5BVOA 3P79A 3THBA 2JLDA 4DG0E 3OW3A 4E6CA 2GNJA 3EQRA 3F3UA 3JS2A 4TXCA 5EHLA 5KZIA 4CEGA 2UZTA 1SVEA 3ZC6A 5E8WA 3DJ6A 5AIRA 4H1MA 5AUYA 3B2TA 3PLAE 4HYIA 3RM7A 2A27A 4YZDA 4F7SA 4V0GB 3UNKA 1WAKA 3LCDA 3FXWA 4WNMA 2O65A 2Z8CA 4FEUA 3UDBA 3ODYX 4U3ZA 3WZJA 1QL6A 4JIKA 1GIHA 4JRVA 4AZFA 1R39A 2W1CA 4I0TA 4QMXA 4ITHA 5M4IA 3TN8A 3R1NA 5IQIA 3FMDA 3KULB 4YMJA 4UMQA 4ZTSA 5AV1A 3BI6A 2GS7A 2JDOA 4EWQA 3ZUTA 5KHXA 2Y0AA 4LGGA 2PHKA 2ZM1A 4KIPA 3G90X 4RJ3A 1L3RE 3NRMA 2HIWA 3P4KA 4EQUA 2B9FA 4I0SA 4NZWB 4XH6A 4D0XA 4FZFB 4G3EA 3RTPA 2R4BA 2XKEA 5IF1A 3RP9A 4IW0A 2ONLA 2F57A 3HV5A 4MTAA 4PQNA 3FMHA 2OBJA 4S30A 2ZB0A 2GTMA 4LUDA 5M51A 1H8FA 4C4GA 4FV4A 4QMPA 1DAWA 2UVYA 4R5SA 3CTHA 4X21A 1RE8A 2J4ZA 2XB7A 3GU6A 1YXXA 4MCVA 3TJDA 3UO5A 4UYNA 5DA3A 5DRBA 4EHZA 3UVQA 3F3TA 1H24A 2C5VA 3DNDA 4AGUA 4QQ5A 3BHTA 4FTNA 4MBJA 3EQCA 3ORLA 4MWIA 4E6QA 2YIRA 4G6NA 2J0MB 1HCKA 2R3GA 4I24A 1KV1A 5CNNA 4AS0A 1YKRA 4BBMA 3SOAA 4AE6A 4TT7A 2REIA 3QRKA 4FT9A 2QNJA 4W4YA 2XCHA 5BNJA 4YJVA 3LFAA 4FC0A 5D9HA 4DEHA 3F5PA 1OBGA 2BROA 4FSWA 5LVOA 3QD2B 3C0HA 5LOHA 3UOLA 4TWNA 5LCJA 1ZYCA 3FZPA 3HRFA 2OXDA 3TKUA 4MKCA 2WTJA 4O2PA 2GDOA 4QTEA 1BLXA 3Q5IA 4EK8A 3PIXA 4O0XA 5EQYA 4Z55A 3R22A 1XH8A 3UC3A 2VTOA 4YJSA 5CYIA 2R3OA 3IW7A 3FZ1A 4U45A 5FEQA 4DGNA 4FNWA 4ALVA 4BCKA 1XKKA 3AGMA 3HMPA 4LV8A 4KKEA 4F70A 3PUPA 4Z7GA 4ZTMA 3LFEA 3GBZA 3RWQA 1A06A 3ACKA 1P2AA 3OVVA 3Q52A 4G6LA 3BELA 3FLWA 5J7BA 4C2WA 5IISA 2WTKC 1BX6A 2Q83A 4HVDA 3V04A 4YJNA 4E7WA 4G17A 1Q41A 3RKBA 5HVJA 3T9TA 4ANSA 2C3JA 3G0EA 3BYMA 3O0GA 4QQCA 4DH7A 2XA4A 2ITOA 2ONLC 2WTDA 4GT4A 4CT1A 2VTNA 4OAVB 3BGQA 4MBIA 4I20A 5M07A 1Q61A 2WO6A 4AW5A 3PDTA 2QVSE 3G51A 3R1SA 5CEPA 5BX0A 2QU6A 4WA9A 3V3VA 2ITQA 3KXMA 2OIBA 3KMMA 3N4VA 2BTRA 2YWPA 1Y6BA 1SNUA 1PXNA 5BVDA 3DTCA 3FMKA 2PZYA 3ORXA 3GFWA 3U54A 4BCPA 3K54A 3II5A 2GS6A 3KY2A 3KXNA 2GNHA 3JPVA 5KCVA 2C6TA 3AMBA 4JDHA 3PXKA 2IZSA 4JDJA 3GENA 2HWPA 2CLXA 3WBLA 2GS2A 4UV0A 2FO0A 2CCIA 3TWJA 4G5PA 1LEZA 1Q8UA 5IDPA 3E8DA 4X2JA 5EDRA 4F08A 1CMKE 5EW3A 5D12A 3Q4UA 3ZSGA 5IMEA 4Z7HA 5E8TA 3RJCA 4P90A 3V5PA 3PVGA 2G2FA 3RNYA 4A4LA 4O7LA 3LFSA 3D7TA 3FHRA 1V0BA 4EOQA 4JRNA 4FTRA 4MXCA 4YTHA 3HDNA 2F9GA 4EHGA 4ZLOA 4CLJA 5I9VA 4FV3A 3U87A 2WQOA 2X6EA 3Q60A 2R3LA 4FZ6A 5CT0A 1UNHA 2BUJA 2G2IA 1REKA 1OVEA 3EYGA 1M2RA 5GZAA 1SNXA 4L8MA 3BV2A 3IGOA 3NEWA 3A7IA 3F2RA 2QLUA 3UYSA 4NTTA 5L2SA 5IQCA 2VD5A 5J1VA 5EW9A 4TL0A 5FP6A 5BVKA 5C1QB 5CU0A 5A4CA 4AW2A 1L8TA 5AX3A 3RMFA 3Q2JA 5HE2A 1PF8A 2W1ZA 1PXKA 1APME 4OBOA 4YJTA 3DB6A 4F6SA 3FI8A 4W8DA 3UZTA 5HKMA 2WEVA 4K11A 5JMSA 4G3CA 3ZU7A 2CNQA 4APPA 2YZLA 3GGFA 4U7ZA 3LFDA 4OTIA 4DH3A 3MH0A 4I6HA 4XG6A 4C61A 2R0IA 3LLTA 4KKGA 4PPAA 4AF3A 3BEGA 3NX8A 5AR4A 4HZSA 5DR2A 5E8YA 5JGBA 4DG3E 1Z57A 2PWLA 4ZK5A 3FSFA 4EC8A 4AAAA 3Q04A 4BCJA 5IA3A 2HW7A 2C4GA 4U44A 4F9YA 5IUHA 3C4WA 5ACBC 3MJ1A 4QMOA 4E5BA 3PXYA 4JAIA 5DT3A 2J7TA 2ITZA 4BBFA 1SYKA 4XP3A 3MVMA 3FXZA 5TOZA 4WRSA 4NSTA 2IPXA 4O84A 3FQHA 3PLSA 5HD4A 3A8XA 5ICPA 4LGHA 4RLLA 2BRHA 3E5AA 4C58A 4IAYA 3BU6A 4LQMA 3BQCA 2X2LA 4M0YA 4DGGA 2R3NA 4IX4A 2BDWA 3OCGA 3HA6A 4MVFA 4CFMA 5GJDA 2W4JA 3OOMA 1NA7A 3FI2A 3RPOA 3B2WA 4MNEB 3A4PA 3E88A 3NUSA 3OWPA 4R77A 2F4JA 2CDZA 3R7VA 3ZDIA 2H6DA 1U5RA 2QR8A 2W4KA 2DYLA 4KIOA 4KRDA 4NKAA 5JSMA 2BDJA 3R6XA 3NYOA 4DTAA 2QR7A 4KA3A 4YHTA 5DR9A 1J1BA 3F3ZA 5BYYA 2WFYA 4AA5A 2XNOA 5KX8A 2HELA 2IVVA 3BV3A 2BRBA 4XEYA 4RX5A 4IC7A 5I0BA 1BI8A 2FA2A 3LJ0A 1F0QA 3QXOA 1U46A 4BF2A 2WMBA 5K0XA 1ZMUA 4UY9A 5IQGA 3AD6A 2F7XE 4YZNA 2F7ZE 4LV5A 2OZAB 2VTLA 3FL4A 3GXLA 5KMKA 3UVRA 4C3FA 1UU7A 5ANOA 3PE2A 5DT4A 4QYFA 4D4RA 1OL1A 1QPCA 3QWJA 2VO6A 3E3PA 1KE5A 3H4JA 4FSMA 4QMQA 4CRLA 4FX3A 2H9VA 4DCEA 4L3JA 5AR8A 2UW6A 2OO8X 5LARA 2ERKA 4PTGA 4ZSGA 3V8TA 2F2UA 3VQUA 5IZFA 3DAEA 3PIZA 3NVMB 4IB1A 1ZLTA 3HUBA 3FE3A 3I5ZA 5DLSA 3NAXA 5CSHA 4TYIA 4GRBA 4EORA 4EL9A 4I94A 3BGPA 2OJJA 4KIKB 2WELA 2JFLA 3WI6A 1GZNA 3OTVA 5IH4A 5HTBA 2YM3A 1H25A 2CKPA 3FQEA 4PUZA 5HZNA 3Q4CA 2UW3A 5LMBA 2WPAA 1RDQE 2JBOA 2OIDA 4K0YA 2VX3A 4J53A 4FTUA 3OXIA 1QPJA 1H1QA 1GJOA 3KMUA 4I6FA 1XH4A 3EZVA 3PIYA 4AQCA 4CFFA 5I4NA 1RJBA 2G1TA 4DEAA 2ITTA 2OG8A 3NNVA 2WMQA 4E6DA 3LQ3A 2GNIA 4QP9A 3LMHA 3UOKA 2PU8A 1REJA 2O64A 4BC6A 5A4EA 4RIXA 4NK9A 4N0SA 5IQBA 4XP2A 3BWJA 4A4OA 4CV9A 4FSTA 5HLWA 3RBWA 3GT8A 3U4WA 2WQBA 1U5QA 2YM8A 3EFKA 4LMNA 3MJ2A 4ANLA 5HG7A 5HICA 3LM0A 1NXKA 4BHNA 4CG8A 2R0UA 3EOCA 3TUDA 3H30A 5B2KA 3LXPA 4O91A 3R8ZA 3RPYA 1ZZ2A 1KUTA 3A99A 1W0XC 3ZZWA 4FIJA 4B0GA 3D5WA 2HXQA 3IOKA 4GV1A 1G5SA 3SHEA 2OIQA 5EYMA 2VN9A 5C8MA 3F2AA 1KV2A 4QP3A 4IVDA 4BDJA 4KB8A 3ZH8A 3OTUA 4ZMEA 2PZ5A 3GU8A 4AACA 2XIKA 3MYGA 4L44A 2R3JA 3CKXA 2J51A 1GNGA 3OUNB 3CQWA 4QP8A 5EI6A 5HNBA 4N6YA 3TXOA 3HVCA 4C8BA 3LQ5A 3OWLA 4HZRA 2OKRA 4MK0A 2HAKA 2YM6A 3KCKA 3RVGA 4ASEA 4RWLA 5M09A 3FYKX 3VJOA 3PA4A 1PXMA 1SVGA 1Q5KA 2OLCA 2PE2A 3TZ8A 3IKAA 1B38A 2CCHA 3DY7A 2QOKA 2C30A 3EN4A 2IJMA 2YFXA 4PPCA 2R64A 4EKLA 3MFTA 4BHZA 3QCQA 4C4HA 4BCNA 3R9HA 2JDVA 2VTIA 3C5IA 3DFCB 4P2KA 4P4CA 3ITZA 2RFEA 1WBOA 1PW2A 2XUUA 3BKBA 3SG9A 5EQEA 4C38A 4C7TA 4CNHA 3VBXA 3O23A 2GNLA 4ASDA 5KNJA 1YWVA 2X7FA 5JKGA 5KKRC 3KCFA 4FUXA 4A9UA 4BDKA 3R7GA 1J3HA 3DZQA 3GC8A 3C0IA 4OTDA 3C4CA 4XG4A 2BKKA 4QMLA 2P2HA 5HE1A 4K9YA 3G0FA 4W9WA 4MXAA 1OGUA 1UVRA 2VWUA 4FV9A 4IB3A 4B8LA 5HU9A 2QOLA 3DQWA 2BZIB 4U79A 2BAQA 3PA3A 3GQIA 3ZFMA 4AZSA 4X3JA 2C5OA 3QTWA 3LFQA 4LGDA 2IN6A 5J8IA 2F49A 3LHJA 1M52A 2IVSA 3FMLA 3G9LX 3VVHA 3ULIA 3QWKA 4N57A 3MVLA 4TN6A 4O0RA 3HRBA 5E91A 3I6WA 4FK6A 3TL8A 1Q8WA 5HIEA 4OGRA 3U51A 3QRTA 4K1BA 4JBPA 3O71A 1HOWA 2ZJWA 2VWIA 4PMMA 4Q5EA 4BCIA 3FC1X 3QD0A 5BMSA 5JQ5A 3IO7A 4QYYA 2ZVAA 5H9BA 1M2PA 3ZYAA 5JFVA 5IQDA 2XNPA 3DPKA 4V04A 4YHFA 4PX6A 4XNEA 4D1XA 4NIFA 2PE0A 4B99A 4N6ZA 4DN5A 3C1XA 2PMLX 4MEDA 1U54B 4NJ3A 4C36A 2AC5A 2JDRA 3ZO4A 2JKKA 3LCTA 2HZNA 4ZTQA 1J91A 4YU2A 2E9VA 3GCPA 4O96A 3FKLA 1MRVA 3VULA 4D2RA 4FL3A 4D55A 5C26A 3TT0A 4BCOA 4O81A 3PY1A 2ZYBA 2OU7A 2UW9A 3IDPA 3AC2A 3WE4A 3W2SA 3E3BX 2WU6A 4FV8A 5CZHA 4R1VA 1BKXA 1BL7A 1H28A 1PYXA 1Q97A 3LMGA 5CNOA 4EH4A 4GU6A 2J5FA 1OITA 3FLZA 5TKDA 3RWPA 3TNPC 4M68A 5HIDA 5LMKC 4IVAA 5FGKA 4Y73A 2UW5A 3EIDA 4UB7A 5J9ZA 4O7ZA 4TNDA 5EOLA 5FXSA 2A1AB 4O1PA 2G9XA 4QPMA 2HY0A 3FI3A 4DAWA 5JZJA 3I4BA 2GSFA 3RK9A 3HL7A 3T9IA 3C13A 4AX8A 2C5YA 3P9JA 4FV0A 4FV2A 4QMZA 5JGAA 2FB8A 4I0RA 3DXQA 1YI3A 4UWCA 2E9NA 3RHKA 5LVMA 4FEXA 4E1ZA 2Y6OA 3QTIA 3EQFA 5H8GA 2XBAA 5IMXA 3ANRA 4CTCA 4GVAA 4AZVA 3MY1A 3RINA 4QMUA 4FGBA 4F7NA 4MD9E 4BTMA 1TVOA 3ALNA 1ZARA 4L00A 2QURA 3CD8A 3ANQA 3QX2A 2LAVA 4Q2AA 3RGFA 4KNBA 4ZY4A 4GCJA 3WIGA 3B8QA 2PE1A 3MS9A 3OFMA 4JOAA 3BWFA 3VJNA 4XCUA 1PXPA 2OH0E 3ZRKA 3EZRA 4TWOA 4KS8A 4QMWA 3N51A 1MQ4A 1Y6AA 3JXWA 5AP7A 2O5KA 4ANQA 1WVXA 2VU3A 5K9IA 4Z16A 5AV4A 4HYHA 3EKNA 4C4FA 4CCBA 2PZIA 3TNIA 1A9UA 4BI1A 5HO6A 3ZM9A 3BZ3A 2O8YA 2ZMDA 4ZMFA 2J0LA 5AP3A 4I92A 4KAOA 2PVFA 4IADA 4UMTA 3S3IA 4Q9ZA 2XKDA 4U5JA 3LM5A 4J97A 3QZIA 5AM6A 3MDYA 3TV7A 3KK9A 4IWQA 4QNAA 3RPVA 4RIYA 3QLFA 4UN0C 3LFBA 3PFQA 4RGJA 1WBTA 3KVXA 3R7IA 5KKRB 4R3PA 3AMYA 3OEFX 4MQ2A 5ETCA 3CQUA 2XVDA 4HCUA 4FKOA 1XQZA 2OW3A 2CLQA 4AT5A 3Q9WA 5J1WA 3NYVA 2CPKE 4L01A 1OBDA 3I79A 3VF8A 4EYJA 5ITAA 2HZIA 3W2CA 4CMOA 3UQFA 2GQSA 4JG7A 3EFJA 3FWQA 2XKCA 1NVQA 3MGYA 5EDPA 4FICA 4IX5A 1WMKA 1VYZA 4IM3A 2ETMA 2PZRA 4CYJA 4V01A 3TNHA 4FIHA 3HZTA 2JGZA 3DZOA 3HRCA 3Q53A 2NRUA 4YPDA 4GG7A 3QQKA 1KOBA 5HCYA 5CI6A 2X4FA 1IA8A 4H3PA 4B4LA 5CXZA 2V55A 3PSCA 4EOIA 5FDXA 4EUTA 4CKRA 3S2PA 4KABA 3ATSA 3AOXA 3NS9A 4Y95A 3K2LA 5CU6A 3ZCLA 1JBPE 2I0YA 2XBJA 2XF0A 2JIUA 4HPUE 3GQLA 4GEOA 1TQMA 2WOTA 4OLIA 3WZDA 4NWMA 3IGGA 1FQ1B 5JK3A 3VUMA 4D58A 4DFBA 3CJGA 4JJRA 1M7QA 3SXRA 1STCE 1Q8YA 3CC6A 1SZMA 4ZTHA 2XK4A 4DT9A 3OT3A 3E7VA 1B39A 3IK3A 4QRCA 3DS6A 5IA2A 3L8XA 1LEWA 1ZOGA 2EUFB 3L9MA 3VBYA 2EU9A 4DFZE 3SX9A 2XNMA 4BGQA 4QPAA 4ASZA 2CSNA 5CEQA 3BE2A 1CDKA 2NRYA 1W7HA 2UZNA 4ZXTA 2C47A 2Y4IB 2VWYA 2KULA 3HGKA 3HKOA 4F9WA 5CSPA 1M17A 2RKUA 3KK8A 3GP0A 5BMMA 4BRXA 4DBXA 2WGJA 4DHFA 2R3QA 4G3GA 2WMWA 4FTQA 3HV4A 1AQ1A 3L9LA 4WNPA 1O9UA 1JPAA 2C6DA 4BKJA 3KRWA 1Q99A 3GCSA 3TZMA 3QCSA 4RZVA 2I0VA 3TCPA 1ERKA 2HYYA 3IW5A 5AV0A 4A4XA 4A7CA 3LJ2A 5EKNA 5IA0A 4EZ5A 2WZJA 4D4VA 5AAEA 3R8LA 2OF4A 2VO3A 5AEPA 3KL8A 1PXLA 2WU7A 3LVPA 2KTYA 4H39A 4IAFA 4X7QA 3W1FA 4BKYA 2ITPA 4IB5A 4NIFB 4NT4A 1OIQA 3DBQA 2WQNA 3OROA 3UC4A 3UOHA 3O17A 3V6SA 3PJ1A 3KGAA 4HCVA 3AC4A 5AADA 3ATTA 4BYJA 3R7OA 2WEIA 4D9TA 5A14A 3R63A 5HGIA 1ZXEA 2NPQA 4RZWA 3GOPA 5HLPA 4DLIA 3IOPA 1ZYDA 4DFXE 3DAKA 3GU5A 4KD1A 3R8PA 4FV1A 3TUCA 3BCEA 1ATPE 2X9EA 3UG2A 4EEVA 1GIIA 4TRLA 4B9DA 4CCUA 5JZNA 2WB8A 2UVXA 5L2IA 2ZV9A 1XBAA 2YEXA 4M69B 3LMIA 4M67A 3TUBA 2Y9QA 3FSKA 4GFGA 4FVPA 4O27B 3FMMA 1JKTA 4IFGA 3AC8A 2P4IA 3OMVA 5DI1A 3LLAA 3W2RA 1R0EA 4HNFA 3G33A 3LXNA 5D7AA 3VS7A 1YW2A 3QX4A 4FV6A 5A46A 5DNRA 3A7JA 1SM2A 2W05A 4EK4A 5IH6A 5JFWA 3NMUF 4PRJA 3R8UA 3RCJA 1JQHA 5IA5A 1OB3A 2VGOA 4F7JA 4RIWB 5FXRA 4FSYA 5K4IA 1W98A 4FG9A 3PJ2A 3I5NA 3UNJA 3UIMA 3FZOA 4FSQA 4A9SA 2O2UA 4RC4A 1O6YA 2VX0A 5FUTA 4V05A 4AUAA 3LCKA 4EBVA 4O86A 2QO9A 1DS5A 3I7BA 4WHZA 5D7VA 2UV2A 2OK1A 4EUUA 5EM5A 3EHAA 5T6KA 4I1ZA 4IDVA 4I21A 4IEBA 3COIA 4PDSA 1YHVA 3LXLA 3QCXA 2I7QA 1OL2A 3O51A 2VUWA 5IA1A 5HHWA 4FL2A 2OH4A 4XLVA 1LP4A 2XJ0A 4NM0A 5BUIA 4HOKA 4I23A 3ET7A 2FVDA 3POZA 4UMRA 5D41A 3P7BA 2IWIA 4GIHA 4CMUA 3W2QA 4EKKA 4IFCA 4QMNA 4O7WA 5KE0A 3CSVA 5CEKA 3K5VA 5HG8A 3MBLA 3ZFYA 4OT6A 5K0KA 4DLJA 4GFMA 5KUPA 5CS6A 1ZY4A 4TYHA 3SW7A 3CGOA 3JVRA 1MQBA 5HX6A 4ZLZA 3EFWA 5HCXA 2XK6A 4BCQA 5IUIA 4P7EA 3NUPA 2HW6A 4G6OA 3RNIA 4EHEA 3AD5A 2CKEA 1WBSA 2CN5A 1OM1A 3M42A 1P4FA 5BVWA 2YDIA 4EYMA 4U43A 4BIBA 5EFQA 3EWHA 4JIAA 4O0UA 2F7EE 4YPSA 4QMVA 3HECA 4IJPA 2W1HA 2WKMA 4R7IA 3DKGA 3SVVA 2XYNA 4O0YA 3ZBXA 3NUAA 4USFA 5J7HA 4YJUA 5M06A 2OGVA 3IDCA 4IAZA 4WD5A 2JD5A 4OTPA 1W8CA 2X6DA 4U80A 3AC3A 4FKVA 4M7IA 1OUKA 4BN1A 4LI5A 5HX8A 5L6PA 4YZMA 4CG9A 3F66A 5J5SA 5J9YA 4DTBA 3D9VA 3OEZA 4FE2A 4FTKA 3QQGA 3D4QA 3AD4A 3ERKA 4F4PA 5DHJA 5A4LA 4NYEA 3CPCA 3TZ9A 5IQHA 5HNIX 2JIIA 2P55A 3FUPA 4Y46A 2XP2A 4WT6A 3GU7A 4C02A 2ZMCA 2UZBA 4PWNA 5ETFA 4HGLA 4FTCA 5AAGA 3UPZA 1UNGA 4FK3A 1ZRZA 3GI3A 3O8UA 3S1HA 3W55A 3DLSA 3V5QA 5L8JA 2R3IA 3LQ8A 2CGWA 1T45A 3QQHA 2WMSA 5J95A 3EL8A 3MIAA 4DE4A 2DWBA 4L43A 1NVSA 1S9IA 2VNYA 2WQMA 3DBEA 3ENHA 2VX1A 4JI9A 2ETKA 5CWZA 2J5EA 4S31A 2VGPA 4OTHA 5DVRA 4F1TA 1GIJA 5KO1A 1O6KA 4BICA 5I9YA 4RVLA 4W9XA 2DQ7X 5HD7A 2ZB1A 4A9TA 5M4CA 2QLQA 3EQIA 5JQ8A 2J0JA 3DK7A 2UZWE 4C4IA 1XBCA 3QTUA 4WBOA 4XP0A 5HE0A 5J9LA 1OKYA 4FV7A 4GJ3A 4RIOA 4YLLA 5F4NA 3NVKI 1QMZA 3V5LA 3NGAA 3CPBA 3WF5A 5DGZA 3F88A 3QD4A 3ZOSA 2PZPA 3WZEA 4GU9A 3TM0A 5K5NA 4MHAA 4ZJIA 5DEWA 5CU2A 2UZOA 4FZDB 4FV5A 2R9SA 4L53A 4RX7A 3QFVA 4FUYA 3EQDA 4K18A 2O0UA 3UMXA 5TE0A 2XK9A 3GUBA 3ZEWA 4GT5A 1IAHA 5I3OA 1K3AA 4XV1A 3WF8A 3PZEA 5HVYA 2W5BA 4NW5A 1FPUA 2FGIA 4RX9A 4FZAB 3NIZA 2JAMA 4CZUA 3H10A 4RFMA 3BHYA 3NW5A 4FEWA 2WTVA 2EXCX 2PY3A 1JWHA 2HY81 4YLJA 1WZYA 3KEXA 2JITA 4TTHB 5GZ9A 3ZLSA 1M2QA 2Z7SA 4E8AA 4TWCA 3VQHA 4K6ZA 2ZV2A 4O2ZA 5JFSA 5DIAA 3CTQA 3D0EA 5JRQA 3QZHA 3PXQA 4FIFA 2UZDA 4IMYA 4AP7A 4BDCA 2V22A 3ID6C 5E8ZA 3W18A 4ERKA 3SAYA 2BFYA 5ANDA 4C59A 4PF4A 4JX7A 1ZZLA 3QC9A 3GC9A 3CKWA 3SV0A 1FMOE 2C69A 2VTTA 4NTSA 3I0OA 4EJNA 3NLBA 4G5JA 2CGVA 4RWJA 3HYHA 5A6NA 4GKHA 5AR7A 3KXHA 3G9NA 2QQ7A 4MXZA 2W17A 3QKLA 3OP5A 4WG3A 4G34A 3ZDUA 4DEIA 2JIVA 5DMZA 3F61A 3I81A 3VUDA 4AT3A 4B6LA 4AGCA 3TZ7A 1VR2A 2B7AA 2UW0A 3O2MA 2X4ZA 1ZWSA 3PXZA 5AIKA 4BYIA 3R7YA 3DXPA 3GU4A 2X8EA 4QPSA 4EJ7A 3QZGA 3OXTA 1F5QA 5IUGA 2WTKB 4ANNA 2PMNX 4IAIA 4UXQA 4DC2A 5CX9A 3ROCA 1ZMWA 3PG3A 4J71A 5BYLA 3KMWA 1FMKA 3FPQA 5JN2A 3FC2A 5TT7A 3U55A 2VTHA 3QTZA 3KC3A 3KU2A 4ID7A 1WBVA 4FKRA 1UKIA 1PMNA 1UWHA 1TQIA 3D94A 2CMWA 4HPTE 3S95A 4U81A 5FXQA 3Q4ZA 2OI4X 3PE1A 3P08A 4GT3A 3FZTA 1GZ8A 2WXVA 3FLSA 3HLLA 1YDRE 5CALA 4ZLYA 3QL8A 1PYEA 2O3PA 2PPQA 4E4LA 5LXMA 2WD1A 2PMIA 4JQ7A 4QP7A 4YJOA 4W4XA 4EH7A 3LW0A 3QHRA 3FLQA 4IVCA 5A54A 5CF4A 4FEVA 3HX4A 3FMJA 5KMLA 4XG7A 4X0MA 3NW7A 3QKMA 2QO2A 3MTLA 3A2CA 1XH6A 5IA4A 3QC4A 2I0EA 4M12A 3BYSA 4KSPA 2I0HA 4TYHB 3P1AA 4RX8A 2H96A 2W06A 4I5MA 4AZEA 4L7FA 3U8WA 1PKGA 4DITA 3NW6A 3C4ZA 4MWHA 5FTOA 4ANOA 1OZ1A 4BDBA 4R6VA 4LYNA 3V8WA 3E7OA 3P78A 2QODA 4UXLA 3UIXA 2QKRA 3TI1A 3RALA 3VO3A 3FV8A 2B53A 3U6HA 3F5UA 3F9NA 2WMTA 2GCDA 1YWRA 3V8SA 3VW8A 4RJ7A 4S34A 2GHLA 3HMIA 1IEPA 5FBOA 3FZRA 4B7TA 4E4XA 4H1JA 3EYHA 5HTCA 2IW8A 3Q6UA 2PYWA 5HBHA 5L6WL 1YI4A 4BWXA 2W1EA 1IAJA 4XG9A 5DG5A 5G1XA 3H9OA 2OF2A 4IJ9A 3SRVA 3W33A 3CJFA 4TKSA 2ITWA 2QU5A 4QD6A 5CEMA 3EN9A 2QOCA 1OKZA 2NP8A 2JDTA 4EOLA 3WARA 3AMAA 4NUSA 2QO7A 1X8BA 2PVRA 2VNWA 3LXKA 5F95A 3VRYA 4FEQA 1YOMA 4L3LA 4XYFA 4C35A 5HG5A 2XNEA 4I41A 3FBVA 4G9RA 4PMSA 3ZLYA 5ETIA 3ZXTA 4EQMA 2YLFA 1ZYJA 3TG1A 3R7EA 3U9CA 1Y57A 2V62A 3F2NA 4K33A 5HO8A 3E8NA 2HK5A 3PSDA 3ENMA
chains in the Genus database with same CATH superfamily
2X7OA 1Y91A 1GAGA 3R01A 3WYXA 4MBLA 5DRDA 5AP2A 3C5UA 1Q3WA 4UBAA 3ZONA 4EZ3A 4RBLA 4N4SA 5HIBA 3PJCA 4AZTA 5AUTA 1UKHA 1VZOA 4BZNA 2GQRA 1OPJA 4K8AA 3D7TB 4BIEA 1YQJA 4FR4A 3MPTA 3V6RA 4DHJA 2B4SB 2WIPA 1OL6A 3QLGA 3VWAA 3DQXA 2W9FB 2X7GA 2YM7A 2IVTA 3F5XA 4DGMA 5KMNA 4AE9A 2CKQA 4O7TA 3ZRLA 2OICA 4G3FA 3ZRMA 4XG8A 3RPRA 4F9BA 2QOQA 3KREA 4J96A 4LM5A 5HVKA 3CS9A 4HYSA 1RW8A 4O0VA 5CENA 4BZDA 1JSTA 4X2NA 2OJIA 3RCDA 4HVSA 1HCLA 4XV3A 4MXYA 4WRGA 3RAKA 3FKNA 4CMTA 2AYPA 1DM2A 2YAAA 3BGZA 3KXXA 4PP7A 5GINE 1JVPP 3NNWA 4U97A 3OY3A 1CTPE 3G6HA 2XM9A 2GFCA 2BTSA 2YAKA 2B0QA 3MFRA 4IZYA 3HP5A 4GKIA 5CAOA 1I09A 1BYGA 4U0IA 4HJOA 1AGWA 4L45A 4QMSA 4IANA 3EQGA 4ZEGA 3O50A 4BDFA 4ALUA 2BIYA 5L2TA 4DCAA 4E73A 4EOMA 2FSMX 4I6BA 2OWBA 2X0GA 2VTMA 4CYIA 3ZS5A 3P0MA 4NFMA 2GPHA 4FNYA 4GIIA 3TDWA 1W2CA 2XK8A 3H9FA 3LAUA 3CE3A 4FIGA 4I22A 5IEVA 2UUEA 2PL0A 1R78A 3ORMA 4FIEA 1H01A 4Z3VA 3HAVA 1ZYLA 3ZM4A 3OS3A 4D2TA 3SXFA 4EZ7A 3QQLA 5LMAA 3DKCA 1J7UA 4ERWA 1W84A 3TV6A 1IG1A 3PRFA 4I3ZA 3DDPA 4QP1A 2VWWA 1JKLA 3MH2A 4CTBA 3KXGA 3MSSA 3TTIA 4C33A 2QKWB 2XM8A 4O6LA 3SOCA 5FLFA 3K5UA 3VUKA 4D5KA 2C68A 3C7QA 5IPJA 4AQKA 3LFNA 4EWHA 1YXVA 3Q32A 5A9UA 3RZBA 3FY2A 1OI9A 1H00A 4MX9A 3RAWA 3RZFA 3FKOA 3PY3A 2YCSA 4FT7A 4YJPA 5AR2A 5AR3A 3FLNC 4FKQA 1PJKA 4U3YA 2YZAA 3UG1A 2VTPA 1DI9A 3V51A 3ULZA 5AUXA 3VBTA 3WZUA 4D1ZA 3Q9ZA 4MYGA 2PULA 4S33A 1T46A 2VWZA 3ETAA 3HMMA 2XJ1A 5DH3A 2EB3A 5FP5A 4L7SA 4O7VA 2R3FA 4ASXA 3A7GA 3MW1A 3NIEA 5HO7A 4GMYA 4FKLA 1WVYA 2B9JA 2YISA 4O4EA 4BY9E 4RC3A 4MNFA 1FGKA 3R71A 4IZ7A 1PY5A 4W8EA 3ZMMA 2IEWA 3DLZA 3QTSA 3R9OA 1EH4A 2PK9A 2A4LA 4N70A 4EQCA 5CZIA 3GCUA 2B9IA 2CNVA 4APCA 3VUIA 3GCQA 4LRMA 4ZSLA 4H3BA 4E93A 5L4QA 4E4MA 4QP4A 4ZJJA 3DKFA 1MRUA 3GOKA 3WF6A 4AGDA 4E4NA 5BUJA 1W82A 2A19B 2FUMA 5GZ8A 5CEOA 2YM5A 1OKWA 3CCNA 3ORIA 4Q9SA 2G2HA 4F1MA 4PL5A 4V0GA 3D83A 3FAAA 3GB2A 3MA3A 5G6VA 4F78A 5M44A 4D9UA 5E1EA 3BEAA 3ORNA 4ACGA 3MV5A 3CP9A 4J8NA 2XJ2A 4EBWA 3FYJX 2R7IA 3W8LA 5C4KA 3EKKA 4WUAA 1DAYA 1URWA 3KN6A 4FKIA 4QTDA 4BCFA 3N4UA 4FSRA 2J2IB 3NCGA 1GY3A 3BL7A 1YOLA 2X8IA 4M14A 3WILA 4XLIA 3KULA 4YNEA 1ZOHA 3IS5A 5H2UA 3TV4A 3VRZA 2OFVA 2RIOA 4BDDA 2GNGA 4FTOA 2PUIA 3KRJA 5BVNA 4WKQA 3FY0A 4X2KA 3ZUUA 3L8SA 1JSUA 3MB7A 2AC3A 4HGTA 4BB4A 4R7BA 5LWNA 1ST4A 3P5JC 4G9CA 4GG5A 4O21A 2WMXA 3UP7A 4Y83A 1OIRA 2EB2A 5F94A 3VS3A 3H9RA 4FKUA 3SRVB 4F09A 3KVWA 4BJJB 4D2WA 1K9AA 3VUTA 4D1SA 2X0OA 2C3KA 4XOZA 4RIXB 3VONA 3HMOA 4FTIA 3NAYA 2IVUA 4QT1A 4XRLA 4DHZA 4I6QA 4AU8A 1OIYA 3BBTB 2IO6A 3KRRA 4IB0A 5AP1A 1BUHA 3BRBA 4C57A 4BTFA 3QZFA 4Z9LA 2VTRA 3TYKA 4QO9A 3BYVA 2IW6A 2I1MA 3GC0A 4FVQA 2YIWA 4YSMA 3UVPA 3QKKA 2Z7QA 3V01A 4AZWA 1XH5A 3R21A 4CFWA 4CRSA 5KMOA 4IZ5A 4DA5A 2A0CX 3S0OA 4FT5A 3FI4A 2CJMA 2W9ZB 3ZSIA 5EYKA 2FH9A 4J7BA 3ML1A 4ALWA 2PVKA 2C5XA 1PRYA 3DJ5A 1MRYA 3R9DA 5GIPE 4X6QC 3W32A 2BRGA 3HMNA 5H8BA 1Q4LA 4FG8A 3TNQB 5HBJA 5HQ0A 5EHOA 4J8MA 4DG2E 1YXSA 4LOPA 5KMMA 2X39A 4ZJVA 2G15A 4FZ7A 4ZTLA 1TKIA 5FEEA 5GIOE 4CFNA 4F0GA 4RG0A 5BUEA 1MP8A 3IW8A 4O4BB 1H08A 3QBNA 3TNWA 4IWOA 5AFVA 5AP4A 5IDNA 1BMKA 3VHEA 4IX3A 4QYHA 2OFUA 5CAPA 4M13A 3OG7A 4S2ZA 4ANBA 4BTJA 3HV7A 4D5HA 4X2FA 4UX9A 4J99A 3RI1A 5LVLA 5CXHA 1Q8TA 5AV3A 3LIJA 3O96A 1PMEA 2XNGA 3A7HA 3RAHA 3Q9XA 4YZ9A 2PUNA 4R78A 2XK7A 3TDVA 4F0IA 4FKPA 3ACJA 2J0IA 4MF0A 2GMXA 3CY2A 3VUHA 4O82A 2W5AA 3E8EA 4I4FA 2YITA 5KMIA 4ZS4A 2WMRA 4D2VA 3CY3A 4WG5A 4A9RA 1XMMA 1NVRA 4FNZA 4ITJA 3COHA 1H1PA 2Z7RA 5KMJA 2AUHA 1NW1A 3D5VA 5L2WA 2UW7A 4FBXA 3OBJA 1KOAA 5E1SA 2ITNA 4HVIA 3MFUA 3NCZA 4FTAA 1URCA 2I6LA 3OC1A 4BDIA 3WIKA 3JUHA 1CKPA 5CQWA 4OBQA 4TY1A 5AM7A 5AP6A 4AFEA 4AW1A 4DDGA 4FF8A 4F6WA 5L3AA 2BHEA 4ARKA 2R3MA 3A8WA 3PWDA 4TYJA 1F3MC 4YJQA 3VN9A 3L8VA 3QTQA 3FHIA 1OKVA 4XS2A 5CVGA 3UODA 3QUPA 4QYGA 3BYOA 5KBQA 2QHNA 3WF7A 4IWDA 4PNIA 4YSJA 2VTAA 4L42A 5M56A 4YHJA 4AOJA 3PY0A 4KBCA 5EW8A 1IR3A 3PYYA 4PP9A 3W8QA 2CGXA 2LGCA 3LOKA 4GH2A 2JKOA 3AQVA 1MUOA 2P2IA 2Q0BA 2VO0A 3MTFA 5ANGA 5FQDC 4BDHA 2W1FA 4A07A 4DEBA 4ACHA 4EI4A 4QDEA 4NM7A 2VTSA 2HZ4A 5HCZA 1QCFA 5L2QA 1PKDA 3TIZA 4QMMA 2X8DA 1P14A 2YIXA 3P5KA 4OTGA 3KKVA 4WO5A 3O5AA 3SXSA 5FBNC 3OCSA 3ZO1A 1KE6A 4BCMA 2XEZA 2YERA 3GVUA 4JR7A 2ITUA 3OT8A 4O7YA 2IG7A 3IQ7A 4PPBA 3COMA 4U6RA 3W10A 3SW4A 2ESMA 3PWYA 3KA0A 3TKIA 1CSNA 2W99B 3UDZA 4AN3A 4IQ6A 4R7HA 1KE8A 3WOWA 1J7IA 4NH1A 2HENA 5AJQA 1YHSA 4BGHA 3LJ1A 1V1KA 3QQUA 5CTPA 5LWMA 4AGWA 2XALA 1H1SA 3R28A 1XWSA 4BZOA 5E8VA 3NDMA 2WTIA 4W4WA 5AUWA 3R04A 3E93A 2XIRA 5EOBA 4GW8A 2P33A 4QTBA 1CKIA 3AT3A 1H0VA 3QA0A 4XG3A 2C6IA 4XX9A 4EK3A 4MD8E 5CAQA 3QXPA 2XYUA 5GJGA 2C3IB 4YR8A 1W83A 2A2AA 2R3PA 4C4JA 3DXNA 3R2YA 3UIUA 5AAFA 4IM0A 4MXOA 2BDFA 4YZCA 3VC4A 1PMVA 4PV0A 1Y8YA 2XIXA 4XV9A 4UMUA 4KRCA 3CD3A 4Y72A 3SC1A 5C4LA 4M66A 4PTCA 4JDIA 3DV3A 1P5EA 3JR1A 4MH7A 4PDYA 5I9ZA 4G31A 2WAJA 4JAJA 4L9IA 1LPUA 4U42A 4LMUA 4C0TA 1U59A 2YDJA 3ZBFA 3C0GA 2GHGA 2ZM4A 3OUKA 4E20A 2BHHA 3JY9A 4MNEA 4EH6A 4NM5A 4O1OA 4CD0A 5CASA 3UZPA 5KHWA 4EOJA 3R00A 1V0PA 2RL5A 3C50A 4WSYA 5F9EA 1R1WA 4LL0A 3MY0A 3CIKA 2EWAA 2VWBA 3ORKA 4FSUA 4GUBA 3NNUA 3DDQA 4CVAA 1FOTA 2EVAA 3HDMA 2C0TA 1H07A 3OOGA 2W1IA 1R0PA 3FQSA 1H4LA 1UNLA 4NU1A 4ZIMA 1H1RA 3DOGA 4QMTA 4U40A 2QI8A 3RAIA 3DKOA 3R1QA 3O8PA 4O7SA 3OF0A 3BBWA 4ZY6A 3V5TA 1BL6A 2OZAA 2QOOA 3NZ0A 3UPXA 4F7LA 4QQJA 4AOIA 3PZHA 3EB0A 5EDQA 4RIYB 4GUEA 3IW4A 3QUDA 2YABA 4KSQA 1J7LA 1GZOA 2ITYA 3A61A 3D2KA 4O6EA 4USDA 3BU3A 4Y8DA 4EH5A 2B1PA 3M2WA 4YBKA 1KWPA 1OL5A 4RWKA 4EOOA 4EH3A 5AUUA 3QYZA 4H36A 5EYCA 3PJ8A 5DBXA 4IXPA 3ROYA 3TEIA 2X9FA 3QYWA 4J1RA 4YTIA 4DDIA 4O4DA 3CTJA 4NCTA 4XOYA 4X2GA 4XRJA 2C3LA 4RSSA 4KUJA 4HVGA 2RG6A 4KIKA 4KS7A 3Q4TA 5IQAA 4DH5A 3JYAA 5IU2A 3NNXA 2FSTX 2W1GA 3CXWA 4ZZMA 4JQ8A 5BYZA 5K5XA 4FSNA 2GFSA 3VBWA 3A62A 4WNOA 2WIHA 3U6JA 4DYMA 3POOA 4NM3A 5AUZA 5B0XA 5CSXA 4PY1A 4ZSJA 3P23A 1M14A 4QYEA 5FM2A 3IONA 2Z2WA 3QGWA 5ETAA 5LVNA 4LG4A 3CR0A 4BDEA 2JBPA 3PPKA 4TWPA 5K3YA 1JLUE 3JVSA 2WTCA 4LFIA 3E64A 3MA6A 3BIZA 1J1CA 2H34A 3R02A 3TKHA 4JG6A 1QPEA 5FTQA 3FLYA 2VWXA 3UE4A 4UWYA 3QUEA 2VWVA 5HLNA 1WVWA 3F7WA 3BU5A 3DBCA 4RVMA 1BI7A 5EG3A 4O7RA 3OXZA 2EXEA 2YJRA 3G6GA 3LFFA 3PVUA 3D14A 3MIYA 4L3PA 2XIYA 2J6MA 3SG8A 4L6QA 3Q6WA 2Y4PA 2XRWA 4F63A 2B55A 1PMUA 3KF4A 1XH9A 4IWPA 5CANA 3QQFA 4RA4A 4C3RA 2W0JA 5E8SA 4KIQA 3SQQA 4OTWA 1Y8GA 2UZEA 2BVAA 4OTFA 5FM3A 5C03A 3MFSA 4CKJA 3NYXA 3I6UA 3AT4A 3IG7A 4M15A 4RC2A 2BMCA 3L9PA 4UWBA 3ZXZA 4AT4A 4BTKA 3DGKA 4DBNA 2BZJA 5CQUA 3S4QA 4WUNA 4CFXA 4YUQA 4X3FA 3REPA 4C62A 4YLKA 4YURA 5CU3A 3HEGA 5C8KA 4AOTA 1JKSA 3VS2A 1XR1A 2X2KA 5HNGA 4RWIA 4NCTC 3LCOA 4O0TA 5CI7A 3U9NA 3ZC5A 2YACA 4AFJA 5I9XA 3A60A 5KBRA 3ZO3A 1U4DA 2C6LA 3EQHA 4LRJA 1GZKA 4H05A 3I60A 4DTKA 4F64A 4S32A 2X81A 4WBBB 5HOAA 1Q3DA 3QTRA 1XJDA 5A3XA 3SD0A 2IZRA 4IDTA 4YBJA 4CLIA 4GYIA 2OJ9A 2BRNA 3Q5ZA 4F0FA 4FODA 4DF3A 5ANEA 4DINA 5CY3A 4FKGA 4GL9A 4YC3A 4E6AA 4BDGA 2UW8A 4RFYA 4BVUA 5J79A 3GEQA 3QD3A 4IH8A 1M7NA 4NW6A 5EM7A 2B9HA 2Z60A 4JXFA 4AWIA 1FBNA 2R3RA 2JEDA 3B8RA 2RF9A 3PPJA 5GHVA 3TJCA 4U41A 5EI2A 3R83A 4MXXA 2XK3A 3KQ7A 4C4EA 4DH8A 2QD9A 4CXAA 2W1DA 3DT1A 1OECA 3MVJA 4OBPA 4R3CA 3TTJA 3P86A 5HTIA 4TNBA 5F1ZA 2R3HA 3P7CA 1OPLA 3E8CA 4F9CA 5CEIA 3BE9A 4GSBA 4F1OA 5GNKA 2BR1A 3T3VA 5BVEA 5A4QA 5CF5A 5CT7A 1O6LA 4DGOA 1YHWA 2C6OA 5E8XA 2C5NA 2Y7JA 3K3IA 2W96B 3QCYA 4HYUA 4BCHA 2C1AA 2QOIA 5EM8A 5LCKA 1PXIA 3UDSA 3BHUA 4O0SA 1G3NA 2BALA 4ONAA 3WYYA 2CGUA 4GFOA 1OUYA 2O63A 4FMQA 2PMOX 2ZAZA 3FPMA 3RHXA 2YCQA 3OWJA 4IAKA 4ZY5A 3R30A 3CLYA 3UJGA 4R3RA 2J90A 3BPRA 5T3QA 4CQEA 4XJ0A 4X3FC 4CV8A 3D15A 4LOQA 4RT7A 1LR4A 5E7RA 3ZFXA 3PXFA 3ODZX 4ITIA 4YC6A 2NYAA 2XS0A 3PJ3A 4I5PA 1YRPA 4MF1A 3NUXA 3ORTA 3FEGA 3OD6X 2SRCA 5BVFA 4YP8A 2Y6MA 3UP2A 3PG1A 4ZZNA 4QQTA 4IX6A 4Q5HA 3MB6A 3DBDA 1QPDA 3KB7A 3UNZA 3IDBA 3M1SA 5GJFA 3PTGA 1P4OA 1FVTA 4UALA 3VNTA 1B6CB 4BCGA 3DK6A 3QHWA 5FEDA 5E8UA 4GK2A 4EONA 4RJ5A 3L1SA 2G01A 3HA8A 5AP0A 5M4UA 3LFCA 2B52A 3C4EA 3DTWA 2CKOA 3CGFA 1U54A 3MN3A 4LUEA 4Y85A 3ZLXA 4USEA 1UU3A 2FSOX 2HZ0A 2NNWB 4P5ZA 5FRIA 4CT2A 3DA6A 2PVYA 4FI1A 3PP1A 2ZDTA 4ZP5A 5JRSA 2OXXA 3EMGA 5M4FA 3U4UA 3BL9A 4PMTA 3UMWA 3RM6A 1KE9A 4RQVA 4YO4A 3GC7A 4RJ4A 4QNYA 4DGLC 3GFEA 5EHYA 3C4XA 3DNEA 3BHHA 4NFNA 1WCCA 1E1VA 4EK6A 3EN5A 4GK4A 3FJQE 5DOSA 3RK7A 2NO3A 5AUVA 3AGLA 3VS0A 4RLKA 3ZEPA 4EHVA 4D2PA 1W2DA 3V5WA 5IEXA 3F6XA 3MVHA 1XH7A 3VW6A 1ZMVA 2XKFA 2YM4A 2PVNA 3EL7A 3W2PA 4DH1A 2Y8OA 3NR9A 4FYNA 2WQEA 2CNUA 3PXRA 2FYSA 5IQEA 5FTGA 1H1WA 2OSCA 2VAGA 5EM6A 1R3CA 4YGAA 4L67A 3C51A 1PXJA 4NKSA 3LE6A 4RJ6A 5IKWA 3MI9A 4M84A 5M57A 1WBWA 4PNKA 3HUCA 4UEUA 3OWKA 5EH0A 4KINA 1YWNA 2WMUA 3LCSA 3NUYA 4ENXA 4UYAA 2ZV7A 3QRUA 4CZTA 4QMYA 4A9YA 5E90A 3R7UA 3EN6A 4KBAA 4UZDA 4QP2A 3BLRA 1AD5A 3P7AA 3T8OA 1YI6A 3VIDA 2WTWA 2B54A 3NWWA 4OUCA 5K4JA 3DBFA 5AA9A 5EI8A 2GNFA 3HNGA 5AMNA 3ZLWA 2GTNA 4BI0A 2E9PA 3AC5A 5IQFA 2ZV8A 1OPKA 3VHKA 3F82A 1TZDA 1KE7A 3GNIB 4FNXA 1E1XA 4TPTA 2P3GX 3UQCA 4GYGA 3KRXA 5I3RA 2IZTA 4PDPA 4ZS0A 4HW7A 3R9RA 1YDSE 3OBGA 3JY0A 5TF9A 5DWRA 4D4YA 1S9JA 1Z9XA 3BLQA 4XMOA 2YHVA 2BCJA 1Q24A 2P0CA 4CZYB 3R1YA 3Q9YA 3NSZA 3A7FA 4CQGA 2QCSA 5T68A 2XNBA 4FGRA 2XIZA 3OZ6A 4YZBA 3KXZA 2VTQA 2GHMA 4ZZOA 4IHPA 5BPYA 4BDAA 5HEZA 5B2LA 1TFFA 2HCKA 4E5WA 5A4TA 5CAUA 4FTJA 1XO2B 3N9XA 5CSWA 2ERZE 3PSBA 3BLHA 5J87A 3KFAA 1JOWB 2UZVA 5CAVA 3OHTA 3QRJA 4HNIA 1WFCA 2ZDUA 4FTLA 4L46A 4HVHA 5TR6A 3HAMA 4X3FB 4OW8A 3DAJA 4JX3A 5EKOA 2JC6A 4H58A 3KN5A 3KF7A 4QTAA 4BKZA 1V0OA 4XHKB 4XV2A 2JKMA 2WMAA 3AKJA 4D4SA 1OL7A 3FMNA 2YN8A 1IA9A 4CGAA 3EJ1A 4UMPA 5IG1A 4Y5HA 3CBLA 4GS6A 4K2RA 3HV6A 4D28A 4KBKA 2PVMA 1Q8ZA 5D1JA 4BBEA 4RRVA 5L6OA 2W4OA 3DFAA 3F3WA 2R3KA 2BRMA 4TZRA 3EFLA 3E63A 4RA5A 2VV9A 3SA0A 4ZAUA 3BQRA 4XG2A 4C37A 2XRUA 3FDNA 4FKJA 2YCRA 3I1AA 4J95A 5AP5A 5AV2A 4ENYA 3FZSA 4JLCA 4WSQA 2QHMA 2YDKA 4YJRA 5A6OA 2DUVA 2H8HA 3VBVA 5C27A 4J98A 2ZOQA 3UO6A 3HV3A 5BQ0A 2X0PA 3R73A 4X6RA 4AN2A 4ACMA 3G15A 4TYEA 3MY5A 1K2PA 3OCBA 4IM2A 5HBEA 2GU8A 1Z5MA 2QOFA 4ACDA 3QGYA 5CVHA 2YA9A 3AXWA 2UVZA 2VO7A 3ZSHA 2HWOA 4EOSA 5AWMA 5EYDA 3MPMA 2ZM3A 3W0PA 1JAMA 4BFMA 5E92A 3W0NA 5TO8A 2C6MA 2QONA 3FL5A 5IEYA 4AG8A 3QAME 1G8SA 4ZOGA 2X1NA 3MH1A 4Y5QA 1DI8A 4ZTNA 4K77A 5LMKA 2V7OA 5DFPA 3IPHA 3QRIA 3ZHPC 2UZLA 4GK3A 4RMZA 5CF8A 2YCFA 2E9OA 5I9UA 4CKIA 4FA2A 3LKMA 1FGIA 1SVHA 4JDKA 4NJDA 4AN9A 2OXYA 5EQPA 3C9WA 4G1WA 1NT2A 5H8EA 5JGDA 4I4EA 4RVKA 3U6IA 4F65A 2C0IA 3G5DA 3UTOA 3VS6A 4EC9A 1SMHA 1FVVA 3F69A 3Q2MA 5FWKK 4OT5A 4BWKA 4FYOA 1FVRA 1VJYA 3PRIA 4IIRA 4FKWA 5JT2A 3OW4A 4B8MA 1YOJA 4JS8A 4FKTA 5FD2A 5B2MA 5FG8A 4DT8A 4IE9A 2C6EA 2ITVA 4FVRA 3W16A 4CFUA 3NPCA 4FTTA 2CHLA 2E2BA 3D7ZA 2C0OA 1H27A 5DPVA 4JBVA 2ETRA 5M53A 2WMVA 1G8AA 5HI2A 5B7VA 4AA0A 1ST0A 4LRKA 5C01A 4D2SA 4RJ8A 5IH5A 4JR3A 5FDPA 4M0ZA 4G16A 4IC8A 3WE8A 4U9AA 3UBDA 4KKHA 5HU3A 2BFXA 2VTJA 2XH5A 3DU8A 2RGPA 3F5GA 3QU0A 4JQEA 4OTRA 4AW0A 3QTXA 4D0WA 3COKA 4OTQA 5M55A 1ZAOA 2ACXA 4E26A 2V7AA 4F6UA 5CF6A 1Q62A 4EK5A 3EH9A 3O7LB 3UIBA 2OZOA 2EXMA 2PTKA 2Z02A 5DR6A 4NL0A 2IW9A 4BI2A 4BIDA 3SLSA 2WHBA 4E3CA 2BAJA 4YO6A 3G2FA 4L68A 4G3DA 1H26A 2XMYA 5ANKA 3PVWA 4ZTRA 2YWVA 2BAKA 2HXLA 1NY3A 1PXOA 3LPBA 4C3PA 3M11A 4O4CA 3TIYA 2QG7A 3DCVA 3L8PA 3IW6A 3UOJA 4II5A 5CVFA 4M69A 4EOPA 1H0WA 2R7BA 3DK3A 4FT0A 2JFMA 4GVJA 2XEYA 3IECA 4ZSAA 2UW4A 3MH3A 2R2PA 2W5HA 1JSVA 2RG5A 3D5UA 4FKSA 4G2FA 1YVJA 1IASA 4IVBA 3VF9A 4M97A 2JKQA 3BX5A 2X0QA 3VUGA 3WF9A 1ND4A 4IACA 2Y4IC 4ACCA 1KSWA 4O0WA 4C2VA 4DFYA 3TACA 3NUUA 3E92A 3PVBA 1E9HA 2RFDA 2VZ6A 1ZY5A 3OCTA 2E9UA 2Q0NA 2Z7LA 3ALOA 3RPSA 3DJ7A 3C4FA 4MQ1A 4HGSA 4RIWA 3UYTA 2QG5A 3H3CA 3ORZA 4LL5A 1CKJA 1GOLA 3QALE 4DFLA 4EOKA 5F20A 4QTCA 3PP0A 4IBMA 1CM8A 4FOCA 5E9EA 4FSZA 3VS5A 1XBBA 4AXAA 4CFVA 4F99A 4U8ZA 3FXXA 4PDOA 2IF8A 5I5ZA 2RFSA 5AA8A 3I7CA 4WIHA 4LOOA 2F2CB 4HCTA 4YTCA 5DYJA 3PA5A 3NUNA 5HE3A 2PUPA 1OIUA 2YJSA 5ACKA 1IRKA 4QOXA 4HGEA 5DT0A 4EH8A 3W0QA 5DN3A 4C34A 3AKKA 4YC8A 3LZBA 2YLEA 4R8QA 1UV5A 1OMWA 1WBNA 2R5TA 4DEDA 5CSVA 2UZUE 3KRLA 5L8KA 4BGGA 2V5QA 4O22A 4RVTA 4PL3A 3SDJA 2C6KA 1YXTA 4JG8A 3SKCA 3W2OA 2I40A 3ZO2A 3Q96A 3CEKA 5D11A 5D10A 3MPAA 2BZHB 2J0KA 1WBPA 4PTEA 1VYWA 4P5QA 2PUUA 2PVLA 3VS1A 3BYUA 5CU4A 5HORA 1XHAA 2PVHA 3QF9A 2GQGA 4QDVA 4FIIA 2W7XA 3UGCA 4R5YA 2IZUA 5M08A 3E62A 2BIKB 4NEUA 4E5AX 4YTFA 3VAPA 2QOBA 5AX9A 3SGCA 3F7ZA 4W4VA 1ZOEA 3PUFC 3WZKA 4O7NA 1I44A 4DFNA 4JT3A 3O8TA 4TW9A 3CQEA 4BR3A 3QQJA 3BHVA 4CSVA 4TYGA 1FINA 5ANJA 3GCVA 4EH9A 2DS1A 4FT3A 4O83A 3R0TA 5LVPA 3UZRA 1UA2A 4MAOA 4OAUC 5J5TA 4DEGA 3VS4A 4ZSEA 4AA4A 4WOVA 4L52A 3F3VA 5H3QA 3MESA 4FG7A 3AC1A 3AG9A 2WOUA 3ELJA 1VLRA 4RQKA 1A48A 2C1BA 3R9NA 2WNTA 4MD7E 2CN8A 4WNKA 4OR5A 3Q3BA 2OJGA 3K3JA 4DEEA 3OY1A 4IZAA 3MWUA 2QOHA 3QA8A 3O7LD 2RFNA 5I9WA 3A4OX 1PHKA 3V5JA 2XCKA 3NYNA 1ZYSA 4GJ2A 2QC6A 4IAAA 2J9MA 2JDSA 2XZSA 3EQPA 2RSVA 4H3QA 4J52A 4JVGA 3VBQA 4YNOA 4PL4A 2OJFE 3UQGA 4BWPA 4F9AA 3S00A 1UU9A 2YIQA 3ZZEA 1UU8A 4XBUA 2JAVA 4FOBA 4QP6A 4UZHA 1TQPA 4XUFA 4I93A 4KWPA 5L8LA 3W0MA 3H0ZA 3D2IA 4AXEA 3R2BA 3I0QA 2XNNA 4I5HA 4EH2A 2X2MA 3HP2A 5KZ0A 5JH6A 3N4TA 4JL9A 3ZTXA 1LUFA 4M3QA 4A06A 5CLPA 4M8TA 5DEYA 3H0YA 4RPVA 5EK7A 1RQQA 4I5CA 3AT2A 4FRFA 3ZUVA 1VEBA 4RFZA 2PSQA 3R8VA 2YIYA 1YXUA 2ITXA 2J50A 5JFXA 3D5XA 4BL1A 3RK5A 3NFFB 3E87A 5JEBA 2BKZA 5E4HA 3FMEA 1UWJA 2BPMA 5LQFA 4DFUA 1JNKA 2HOGA 4ORKA 3EN7A 5ANIA 2BZKB 2PVJA 3L9NA 4O38A 2BILB 4QEBA 4XBRA 5AR5A 3ORPA 1JKKA 5C9CA 2V0DA 5HG9A 4WG4A 3UO4A 3EQBA 5LJJA 3PPZA 4JNWA 4R1YA 4JBOA 3R8MA 5HESA 4JBQA 3KIOC 5C8NA 4PMPA 3T3UA 2VRXA 5DE2A 4ANMA 4FTMA 3DB8A 4FL1A 1YDTE 2FSLX 5BVOA 3P79A