2EUFB

X-ray structure of human cdk6-vcyclin in complex with the inhibitor pd0332991
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
296
structure length
282
Chain Sequence
DQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIREVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTETIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVVVTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGEEDWPAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYSALSHPYFQDLER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Toward understanding the structural basis of cyclin-dependent kinase 6 specific inhibition.
pubmed doi rcsb
source organism Herpesvirus saimiri (strain 11)
molecule tags Cell cycle/transferase
molecule keywords viral Cyclin
total genus 69
structure length 282
sequence length 296
ec nomenclature ec 2.7.11.22: Cyclin-dependent kinase.
pdb deposition date 2005-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2eufB02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2eufB01
3IDPA 3GCSA 3FYKX 4ZY5A 4O83A 3KULB 1AQ1A 2F4JA 4G16A 4RSSA 4ALWA 2ITXA 3NW6A 4A9RA 3LQ8A 2W5AA 2Z2WA 3O8TA 3QRKA 3QFVA 2WXVA 4IB5A 2OF2A 5BVEA 4AF3A 5FP6A 4WBOA 2B1PA 3R0TA 2BFYA 3R2BA 5EHYA 3WF5A 3ZSGA 1OL7A 2CJMA 4ZS0A 2YN8A 4KKHA 2GQRA 4LFIA 4UMQA 3ZC5A 5DGZA 5IA0A 2NRUA 4FSYA 2XNPA 2X4ZA 2HWPA 3K3IA 4CYIA 3DXQA 2B9HA 2VTRA 3MESA 2P3GX 3WOWA 3UZPA 4C62A 5L2SA 2ZOQA 3U6HA 1IAHA 3DQWA 4I92A 5LARA 1YWNA 3DDPA 4PWNA 4RQVA 1OUYA 3HMPA 3PPJA 5DT0A 5A3XA 4S31A 4ACCA 5ETIA 2YZAA 3IG7A 1U4DA 1YRPA 3QKLA 3R22A 5FRIA 4C36A 1IAJA 3RJCA 2X0GA 4FSNA 5HO6A 5L2IA 4QMXA 3U4UA 2QKWB 4DEAA 2XKFA 4WG3A 2E9PA 4KAOA 4TYGA 2XUUA 4MK0A 2C5OA 5EOLA 3OC1A 4GRBA 5J1VA 2YITA 5G1XA 3AC4A 3QD4A 4LV5A 4QYFA 4RG0A 2WQOA 2XCKA 4ID7A 4D2WA 4ZMEA 4JOAA 1ZXEA 2QO7A 5ANEA 1H8FA 3D14A 4G3EA 4PMMA 3GU6A 3RI1A 3FEGA 4RWLA 1BMKA 2OIBA 4M97A 2GS7A 4TW9A 2C4GA 3PVWA 1V0OA 2ITNA 3KN5A 4O0WA 5J87A 4X0MA 3ZEWA 2X2MA 4Y85A 2YZLA 2YWPA 5HKMA 3G6GA 4P4CA 3SQQA 3HEGA 3LQ5A 3Q04A 4K8AA 3FC1X 2Z7RA 4MXOA 3FHRA 4AP7A 3PJCA 5CVFA 5AIRA 3FXZA 5CSVA 2IZSA 5FEEA 4K77A 4EQCA 2C6OA 4C61A 4NTSA 3PVUA 3VW6A 2VV9A 4ANOA 5FM3A 4EC9A 3PXYA 4U0IA 1H25A 3PXZA 3N51A 3ERKA 2QOFA 3OT8A 4A4OA 3UNKA 2EU9A 3TUBA 4C4EA 4FOCA 4RZVA 4O7VA 5DWRA 3MPAA 3Q9WA 1YDRE 3ZFXA 1H27A 2PUNA 3V8SA 4IIRA 3P86A 5HNBA 3HECA 5AP7A 4QPAA 3ZLXA 2QOBA 4AW5A 3E93A 2YAAA 5JRSA 2J51A 4O82A 3VAPA 1GAGA 2PVFA 4RX8A 3EQCA 4GV1A 1X8BA 2QQ7A 3PVGA 3QKMA 4DHFA 4FA2A 5GZAA 4I5MA 2FH9A 1PXOA 2BRMA 2C0OA 5HE3A 3KF4A 1YXVA 4KABA 5D10A 1BLXA 2PTKA 2WO6A 1REJA 3BI6A 3OTUA 2LGCA 4RWIA 4L3JA 4AXAA 3LMGA 3HRFA 5D11A 4DE4A 2XJ0A 1SNUA 4YZCA 4YPDA 4JRNA 5ICPA 5L4QA 4RJ4A 3MPMA 5J1WA 4JBQA 3NNXA 2XH5A 2C0TA 4R3RA 4ZSLA 3BHUA 3JY9A 3D7TA 3UMWA 4FZ7A 1M14A 5BUEA 3NIEA 4GL9A 3UOLA 5IQAA 3Q4ZA 5M06A 4C58A 4CTBA 3LJ2A 5CVGA 2YABA 2WTKC 5BVWA 1Y8GA 4ZTLA 3RK9A 4BC6A 5KKRB 3LJ0A 4QD6A 4D2VA 2IPXA 4DGLC 2Y4PA 3HUCA 1LPUA 2Y6OA 4NW5A 3ROYA 3C0HA 4KS8A 5CQUA 4NM0A 4BCFA 3DTWA 3PTGA 4IWPA 3VO3A 3T8OA 3TL8A 5J5SA 2YIXA 2UW4A 3AC8A 2O8YA 5IA3A 2WQNA 5AV1A 2CNUA 4CGAA 3UMXA 2VX3A 4RJ3A 2OBJA 3BGPA 4MBJA 4FX3A 2G9XA 1M2RA 4MXXA 3H0ZA 4FG8A 4CFFA 2BHHA 4X3JA 3R9RA 2QHMA 5B2KA 4FV4A 4MNFA 4AGDA 4BBFA 2J0LA 3QUDA 2P0CA 4MXAA 4FT5A 3SAYA 2W1FA 4DGNA 1SYKA 4PY1A 5HG9A 1RQQA 2QHNA 3AXWA 5AX3A 2ZVAA 1YXTA 4ZJJA 4FR4A 3Q6UA 4FSMA 3WZJA 5AUTA 3BPRA 3FMJA 4FSZA 4HW7A 4YUQA 3FZ1A 3TIYA 4ANBA 2BUJA 4O7YA 4KINA 2PVMA 4UWCA 4P5ZA 2BALA 2XKCA 4FVQA 2PVHA 4D4VA 2JEDA 4PL3A 4PX6A 1WMKA 3QRUA 4GU6A 3E7VA 4G3GA 4NUSA 4I6BA 4ZOGA 4UY9A 3NMUF 4IJ9A 4Q2AA 1LP4A 2OXYA 4QNAA 2ZV7A 3D15A 3T3UA 4EK6A 3Q4TA 4KIQA 3ZMMA 2GNIA 4U9AA 4A9SA 4LUDA 4CRSA 3FMLA 2Y4IC 4FIHA 4BY9E 5LCJA 4QMWA 4EQMA 3Q9ZA 4ACDA 3QWKA 1XBAA 3FMKA 5I9UA 3CY2A 4E26A 5CQWA 5L6PA 3DXPA 2A19B 3F66A 4XH6A 1OKWA 3MN3A 2I1MA 4UZDA 4K0YA 4C8BA 4FGBA 3OBJA 4IXPA 3ZM9A 4YPSA 3WE8A 4FEUA 4CCBA 4PDYA 2G15A 2YIYA 4Z16A 1MUOA 3DKCA 5HESA 3M2WA 4G6NA 5H2UA 4Y83A 4PL5A 2E9OA 3F7WA 4FSWA 4TNBA 4FSRA 3QUEA 1OIQA 1KE8A 4GT5A 3GU5A 4NCTC 3TTJA 2FSOX 4BTKA 2CCHA 4C4HA 1PXPA 2EWAA 4TY1A 4E4MA 5I9ZA 2IVUA 3NCGA 4MVFA 4KBAA 4QPMA 2OSCA 4TYHA 2WPAA 4ANQA 3BELA 4ONAA 2W05A 5BVDA 5EW9A 4CSVA 3GP0A 4IH8A 5CNOA 2BRBA 4MH7A 1WZYA 2XVDA 4G3CA 5A14A 2JDOA 3GQLA 4L3LA 2ZMCA 4KBKA 3ZEPA 1Q8TA 3E8DA 5HX6A 3AMYA 1OUKA 2ITQA 2A0CX 3Q60A 5H8BA 2YJSA 5CI6A 3FMEA 2IW8A 3LVPA 3OVVA 5AP5A 3R8VA 3FE3A 2X2KA 4F0IA 5AA8A 5KKRC 2HW7A 4WA9A 4WNPA 2BDWA 4JG7A 3MY1A 2ETRA 3SG8A 3RKBA 3OT3A 5TOZA 4W8DA 2AC3A 4O21A 4J96A 4GIIA 4GJ2A 4EORA 5CU6A 4I0RA 1JSVA 3ZOSA 5AR3A 2WNTA 4II5A 3SHEA 2HXQA 1SMHA 1UA2A 3TV4A 5LWNA 4PNKA 2BZIB 4BDGA 2W99B 3E8NA 2GCDA 3ZONA 2XIKA 4GFMA 3SG9A 2GNHA 4QP2A 4XCUA 4BBEA 4F65A 3P7CA 2PY3A 4FZFB 3UVQA 3FJQE 4EOPA 2W96B 4BBMA 4FZDB 4AA5A 5ANIA 3OCGA 5CSHA 3EB0A 2R3NA 5KMNA 5AP2A 4Z7GA 2F9GA 2JFLA 3MH1A 4BHNA 5BVOA 4A9YA 4QMMA 3TKUA 3FLNC 1Z9XA 5CF6A 3FBVA 3GC0A 2WOTA 4M13A 4Y8DA 3VHEA 3D83A 4EH2A 4C37A 5LVLA 3DKFA 4IAYA 3QZHA 4FIFA 3FZRA 3TNHA 3VBQA 3MFUA 4E4NA 5AUZA 4I4EA 5L8LA 3M11A 3LMIA 2QR8A 4K1BA 4QMUA 3DK3A 1Y91A 2BVAA 1OPLA 2JAVA 5FLFA 3TNWA 1OECA 2VO6A 3BWFA 3DJ5A 3UNJA 5KMJA 3NW5A 5LVNA 1HCKA 2WMBA 5AR2A 4FKPA 1G5SA 3FQHA 2C6KA 3ANQA 4DFLA 4G3DA 4NK9A 2XNNA 3ACKA 4JLCA 4YSJA 4XLIA 4L01A 4UMUA 2C1BA 2PVNA 4UYNA 5IKWA 3GUBA 5C03A 3V6RA 4ASXA 3QALE 4FI1A 4C3RA 5CASA 3VUIA 5I0BA 3UPZA 5C27A 4UN0C 1YXSA 3FMDA 5BYLA 3RMFA 1JOWB 1ZMVA 2QOKA 3O7LB 4FV2A 3DB6A 4FODA 3QQFA 2YLEA 4E5WA 4XG7A 1F3MC 2Z7QA 3F2AA 4LOQA 5EYCA 2B54A 2IVTA 2YCSA 4L46A 4E7WA 3DB8A 2WQBA 4HVGA 2XJ1A 3V5JA 4AT4A 5LMBA 4FSUA 1KV2A 4D55A 4O22A 1OMWA 2P4IA 3S1HA 2X6DA 4OUCA 1YQJA 4ITHA 4UXQA 3JS2A 3N4VA 4DFYA 4F1MA 5A4TA 2UVYA 2JDTA 4AFJA 3GGFA 3HV7A 3IPHA 4FV9A 2R3KA 3LFNA 2VO7A 3MFSA 1M7QA 4DTKA 1ZWSA 4N4SA 4D2SA 4DH1A 3TJCA 3C0IA 5IUHA 4LL0A 1H1RA 2BZHB 3WIGA 3ZDUA 3HV3A 4A9UA 4FEXA 1ZAOA 3QX4A 3EN5A 5C4LA 4FC0A 4NU1A 1WBOA 3GT8A 5BMSA 3R21A 4BDKA 3TXOA 4E6DA 4XV3A 3H9FA 3LFCA 2HENA 4UXLA 5DVRA 3ZLWA 4GK4A 5IA1A 4B8LA 2ERZE 3RALA 2PYWA 4O0RA 4CZTA 5IF1A 1O6KA 3VS6A 3DFAA 3PXFA 4DEBA 3CE3A 3LCOA 4IDVA 3H0YA 4FT3A 5JZNA 3RAKA 3IW4A 3RZFA 4BF2A 5M4FA 1OIYA 3KMUA 4OTRA 3VQUA 3A62A 3ORLA 4C02A 1B38A 5CAUA 3ETAA 4ZTNA 5HU9A 1ZMUA 3UC4A 2GHGA 4L43A 5HGIA 1XO2B 3COHA 3PUPA 5D1JA 4FKGA 3EMGA 4EEVA 2CCIA 5LXMA 3HA8A 1ZOGA 3VVHA 4O84A 3DFCB 4L52A 4RIYB 3MTLA 3OY3A 3DCVA 3BBWA 3F5UA 4JDJA 3BYVA 3HUBA 4KIKA 4IM3A 3TZ7A 1CDKA 5HX8A 3IGGA 3LOKA 2RG5A 3ATTA 4KIKB 3LQ3A 2JKQA 5EYDA 5KMLA 4AZVA 3OXZA 4JIKA 2OJ9A 5E90A 1P2AA 5HNIX 2VWXA 5AMNA 2BR1A 4NFNA 3C4CA 5AUVA 1BL6A 4UALA 2IN6A 3I4BA 3EJ1A 1QMZA 2ZYBA 3LLTA 4QNYA 3DBDA 3WARA 4ZZMA 2V5QA 3MW1A 4MD9E 2OXXA 4O7RA 3B8QA 4ANSA 3CP9A 4YZBA 4C4JA 2I0YA 2WTVA 4ZS4A 4RIWA 4QQCA 2ZM3A 3OY1A 5AR4A 5GZ8A 2QONA 3UOKA 3PRIA 3QHWA 2R3HA 2RFEA 3NNUA 2PVJA 5L3AA 3KGAA 2FSLX 1IRKA 4G3FA 5ETFA 4G9RA 4IC8A 3RPYA 5K4JA 3R04A 3CBLA 3K5UA 4G1WA 4WRGA 1GZKA 3OCSA 2W1GA 3KXNA 4K11A 2XK3A 4GH2A 3HKOA 1EH4A 5HTBA 3NUXA 3MJ2A 5FD2A 2PWLA 5K4IA 2XK6A 1JWHA 3VULA 1RW8A 5HIDA 1XQZA 5HIEA 5FQDC 1CSNA 4RFYA 3P1AA 2QLQA 3MIAA 4W4VA 3I0OA 1JBPE 4AZFA 4BGGA 5EQYA 1KE9A 2HIWA 3F88A 3TDVA 1YOLA 4HOKA 5D9HA 4AQCA 4EH3A 2VTPA 2WTIA 1WVWA 2G01A 4M69B 2VNWA 1KOBA 3C4ZA 4ZJIA 4MXYA 2B7AA 1E9HA 4BCJA 4EH8A 3AGMA 5F9EA 1V0PA 2R3FA 2H6DA 4ZK5A 3MDYA 4FKQA 5BNJA 3BYMA 3MFRA 5IA4A 3C4FA 4Y46A 2OFUA 3F9NA 3JPVA 2WIPA 1VR2A 2BHEA 3W1FA 1WVYA 2QG5A 3D7ZA 3L9NA 3KCFA 3QLGA 3ZFMA 5HORA 2R7BA 1J7IA 2GQSA 3UO6A 4X2JA 3R1NA 3TCPA 2PVRA 4I4FA 3UQCA 5FDPA 5KMOA 1H1SA 4BKJA 4EK8A 3ET7A 2I0HA 1UWJA 3GFEA 4BDJA 1KWPA 2QOCA 4KRCA 4JS8A 1LR4A 4NW6A 4D4SA 3DNDA 1W0XC 5IH6A 4RWKA 2FSMX 5M53A 3ODZX 4CG8A 5CWZA 5M51A 3SOAA 1STCE 1QCFA 5HBEA 1I09A 3OCTA 4FUXA 4O2PA 3P7AA 4F0GA 4J8NA 5J9YA 3RGFA 1Q99A 3O0GA 3VS0A 3K54A 5AV0A 3L8SA 2IVVA 3K3JA 3G33A 4O27B 4EYMA 3N4UA 3EKNA 3G9LX 4Y73A 2ZM4A 4C2WA 1UU9A 5TO8A 4FTIA 3F5PA 2V0DA 3ZFYA 4CZUA 4D58A 5HU3A 4L45A 3OEFX 2W0JA 1JKSA 4F9WA 5CF5A 2C5XA 3JUHA 1XH9A 5IQHA 2JDSA 2BDFA 2HAKA 3PLAE 3JXWA 4XLVA 1FOTA 5HEZA 3Q2JA 2V7AA 4TYEA 3CPCA 5CLPA 2ACXA 2HWOA 1YW2A 3HRBA 1ZYSA 3O8PA 2CKEA 2VWIA 3BV3A 3F3WA 3NIZA 1F5QA 4P7EA 5JGBA 4AG8A 3H3CA 4OTDA 3R8ZA 2EVAA 4NEUA 4ZY4A 3UJGA 3QQHA 1PKDA 3P7BA 3W16A 2OJIA 4XV9A 2HY81 2G1TA 1BUHA 3BQCA 1H1QA 4JNWA 4MYGA 2F7ZE 3B2WA 3BHHA 2WZJA 2Z02A 2JD5A 2WMUA 3LFDA 2YM3A 4I5HA 1OBGA 4UEUA 4UWYA 3OW3A 5DN3A 3VS5A 5L2TA 3LXKA 3RK7A 2BTSA 2VTIA 1OVEA 4RC2A 5CU2A 3O2MA 3IW6A 4IX4A 4RX5A 2H34A 2WMWA 4E6QA 4ZSAA 4TWPA 2XKDA 3D7TB 4FT7A 4R7HA 2ITPA 5IA5A 3SGCA 4DTBA 1YXXA 2FVDA 2X8EA 2WAJA 3PZHA 4G6OA 5J9LA 3RM6A 2ITOA 2E9NA 2ITZA 4IEBA 2IG7A 3ID6C 3OXIA 1PF8A 5E8TA 2ETMA 3QRIA 1TVOA 5EM8A 4ANMA 2VGOA 3TACA 4R5YA 1NT2A 4I5CA 2C3IB 5HZNA 4EWQA 2HZIA 5CXZA 3RBWA 4CLIA 4ZZOA 4FKUA 1R39A 3EQIA 4ZP5A 5JFXA 5ANJA 1WBNA 3KVXA 3R8LA 4HGSA 5HO7A 1H1PA 3Q2MA 4L9IA 4QP6A 4B9DA 2PPQA 4K9YA 1H4LA 3AG9A 4HGLA 4OTWA 5E92A 4ZLOA 2PZRA 4I23A 5M08A 2JIVA 3BV2A 4BTFA 2UZEA 5BX0A 3KXHA 2VTLA 2WB8A 3RPOA 4AW1A 2R9SA 2OGVA 1OGUA 3TV7A 4GK2A 3KULA 4GFOA 2UW7A 3OW4A 1WBVA 2NPQA 1SNXA 3R2YA 4X2KA 2X81A 3EH9A 4A4LA 3RHXA 3V3VA 1Q8WA 1DM2A 5IH4A 1KE5A 4BIDA 2XNMA 3QC4A 4IVDA 5AR7A 2IZRA 4F1OA 3BLHA 5HCYA 1LUFA 2W1EA 3VNTA 4KUJA 2PZIA 3PSCA 1ZYDA 3WI6A 3NUYA 3DV3A 3EKKA 1Q8ZA 4JX3A 4H1MA 4MQ1A 1NVRA 2R3OA 4NH1A 5CTPA 4C4GA 1BKXA 2JIUA 2XM8A 4FKJA 3AMBA 4BB4A 2Z7LA 4NKAA 3GOKA 5E8SA 4CRLA 3FKNA 3DJ6A 4KS7A 3T9IA 4QMLA 4BFMA 3LIJA 4LGHA 4QTDA 4EHGA 3BRBA 2FUMA 4N57A 2UV2A 4KB8A 5CAOA 2ETKA 3BU6A 5F4NA 2GNGA 3PY0A 1JPAA 3CJFA 1ZRZA 4RQKA 3JYAA 5BQ0A 4E4LA 2VWYA 5AX9A 1WVXA 2F2CB 5EOBA 3QAME 3EN4A 4L42A 3W8QA 3OD6X 1CM8A 1DI8A 1XBCA 2UUEA 2XNGA 3A61A 4IAAA 4R7IA 3W55A 5C26A 4Z7HA 2R2PA 3F82A 4YHJA 3G90X 4CXAA 5A46A 2X8IA 2V55A 4EHVA 1Q62A 4FTNA 3JVRA 3D9VA 3A7JA 2OJFE 4O7NA 5AP3A 3IOPA 3QXOA 4RA5A 4TKSA 4O86A 3OEZA 3UGCA 1BX6A 2B9IA 3HNGA 2OIQA 3CQWA 3R28A 3KA0A 3M42A 3PXKA 4BZNA 3KKVA 2XIXA 5F95A 2CGWA 3FSKA 4XG9A 5EG3A 3VRZA 2R3QA 2KTYA 3WYXA 3PXQA 5EKNA 3F3VA 1H07A 4QMNA 3TG1A 1PKGA 3DLZA 3ZZEA 5DH3A 1W7HA 3AC3A 4TL0A 5CENA 1U59A 1NVQA 5HTCA 3Q4UA 4K33A 2P2HA 2PMLX 3UOHA 5FGKA 3R30A 2DUVA 3GBZA 2YEXA 4AT5A 1P5EA 2YJRA 3I5ZA 5ANDA 4F7NA 3KRXA 2UZOA 2VRXA 3MVLA 3P79A 3HAVA 2HK5A 1GIHA 3FZSA 3LE6A 1E1VA 2GSFA 3PA5A 4OTGA 2JITA 3QGYA 1H08A 4DG0E 4O7LA 3F2NA 2QR7A 2CGVA 4DINA 4IX3A 3WF8A 4EONA 1ND4A 2W5HA 1JLUE 5DE2A 4BICA 1JQHA 3PP0A 2PE2A 3DJ7A 5B7VA 1ZYLA 4BI1A 5JFVA 3LHJA 5L6OA 1QPEA 4R77A 4FTOA 5IQDA 3CCNA 5K9IA 3AD6A 5A4QA 2X7GA 1Q24A 4M67A 3V5WA 3IQ7A 3G9NA 5C8KA 1GZNA 5HICA 1Q3WA 3VHKA 4G5JA 2AUHA 3DPKA 3E5AA 4V01A 3KB7A 1GOLA 2A2AA 3VBTA 3EZVA 2WMQA 2C3KA 2ZB1A 4IZAA 3ZYAA 3EFWA 4FF8A 3PJ8A 4AA4A 4B4LA 2CKQA 3UZRA 2C47A 3COKA 3FV8A 3BE9A 1YWRA 3GOPA 5HTIA 4F1TA 3MFTA 2P2IA 4DT9A 2UZUE 4HCTA 4PTCA 2GHMA 3RM7A 4AN3A 3DKOA 1OBDA 4J98A 4BCGA 4FTLA 1JVPP 4TYIA 3BLQA 3D5XA 4ZLYA 4MEDA 1Z57A 4LRJA 4GIHA 2CLXA 3P23A 3UIBA 3DBQA 3MY5A 5E9EA 1PYXA 4S34A 5EQPA 5IMEA 2GDOA 5EYKA 2WD1A 3TT0A 3PZEA 1H1WA 3D5WA 3WYYA 2DYLA 4BTJA 3CXWA 4AACA 4KKEA 4RJ6A 1UNHA 4TWNA 1Y57A 3I6WA 4IW0A 2OW3A 2NO3A 3C50A 1H00A 3LAUA 3QD2B 4JVGA 3QZFA 4C38A 1GIJA 5I4NA 3ZS5A 3VF8A 4XRLA 2GQGA 3QCXA 2WMXA 2C3LA 3Q53A 1YI6A 3POZA 5KE0A 1Q3DA 2YM4A 3E7OA 3TZMA 3VBYA 4ACMA 3NNVA 2W1ZA 5CYIA 4EK3A 1UKIA 4OTIA 4YO4A 4QYYA 4FG9A 4M15A 3QZIA 2EXEA 3FYJX 5DG5A 4C57A 4C2VA 3HRCA 3H9RA 3TNPC 1H0WA 4XRJA 3EWHA 3ZZWA 3LM0A 4EOIA 3HVCA 4QMTA 5J7BA 1WBWA 3CR0A 1ZZLA 3QA8A 4IE9A 4FT9A 4W4YA 1UNGA 2B53A 4I94A 4QP8A 4O7TA 4LGDA 3FAAA 3UP2A 4RBLA 3B8RA 5IEXA 1R1WA 3BIZA 4TRLA 2VAGA 5HOAA 5GJFA 5JZJA 4ZMFA 2WMVA 5D12A 1FVTA 2BPMA 5JK3A 2YDIA 3QD3A 3PWYA 4LMNA 3NLBA 5AAEA 3U4WA 1JNKA 3OOMA 1NXKA 2HYYA 4A07A 2C6TA 2FO0A 3QHRA 2RGPA 4JDHA 4YZDA 4C4IA 4H3PA 3BWJA 3C13A 4JR3A 4YNEA 4DGOA 4F6SA 4BDBA 4FL2A 4X6QC 4F09A 4G5PA 4RVLA 4WHZA 3F2RA 3PA3A 5B0XA 4PMTA 3G2FA 3ANRA 4BDCA 3NVKI 4FTJA 4L53A 3NW7A 4MX9A 3OBGA 3FQSA 1AGWA 4O7SA 5DFPA 3EHAA 4O1OA 1NW1A 1S9JA 2WEIA 3F6XA 3NGAA 4FNXA 4FTKA 3ITZA 2W06A 2H8HA 3GFWA 3DS6A 4BTMA 3TNQB 4IAZA 3HLLA 5DI1A 3C4WA 1O6YA 1CKPA 3AOXA 2B55A 5T68A 4FGRA 2YM7A 2ZV8A 3KY2A 4EOKA 1M2PA 5F1ZA 3UO4A 4BDEA 3ZLYA 4RIYA 3NYOA 5HG7A 1XBBA 5JMSA 2I7QA 4C3FA 3TV6A 3C5UA 4FL1A 4U79A 3KU2A 4WSQA 4BWPA 3A8WA 4MD8E 2C6IA 3UNZA 4R7BA 4RFMA 2ITUA 2DWBA 5HD7A 5IUIA 4ANNA 2HW6A 3LCSA 4LOPA 5H3QA 3VUKA 4IB3A 4IACA 3F3TA 4FIJA 3OOGA 5E1EA 2LAVA 3VBXA 4F9YA 4HCUA 5JKGA 3MBLA 4JXFA 5M4IA 5GIOE 4YJUA 1GZ8A 1U46A 4FEQA 1M7NA 1YHSA 4PMSA 4QTAA 3PA4A 4XBRA 5AP4A 2YM5A 4EL9A 3G15A 4AAAA 2VTOA 1T46A 4YR8A 2JKMA 3UVPA 4XNEA 4GJ3A 3W2SA 1QL6A 2HOGA 2HZ4A 5CF4A 5IU2A 2GTMA 3MB7A 3R7OA 4QP3A 2I0VA 5AV4A 4IZ5A 3DKGA 2FA2A 2R3PA 4J95A 3FLYA 3P78A 4IQ6A 4GS6A 4XV1A 3UO5A 2J0JA 4RRVA 2G2HA 4LQMA 3A60A 4YURA 4X3FA 3UG2A 4ZAUA 2W1IA 4MTAA 3IDCA 1OL6A 3EN7A 4YTIA 3F7ZA 4ITJA 4R78A 3PJ3A 5HD4A 3PG1A 1OL2A 4M14A 2CGXA 2X6EA 4U40A 4FKIA 2BZKB 2YIQA 1R3CA 3DAKA 3KN6A 5I9YA 2J4ZA 4S2ZA 3QL8A 4DGGA 4DEIA 3SW4A 4KNBA 1BL7A 4J52A 4D9TA 5EFQA 5J79A 1VEBA 4FTRA 5IEVA 5FBOA 4XV2A 4YJVA 1FGIA 2RSVA 3A99A 3VIDA 2QVSE 4WD5A 2QU6A 4GUBA 4QQTA 4ZTMA 4O38A 1TQIA 5IDNA 3ZLSA 3D2IA 4I6HA 3KRRA 3S3IA 3DT1A 5M4CA 2VTHA 4CQGA 3HV6A 4J1RA 4A06A 1Q4LA 4V05A 3CGOA 3FUPA 3BGZA 4DEGA 4DH5A 4DC2A 1NY3A 4WO5A 3FKOA 5L8JA 4FEWA 3W2QA 3UE4A 1PXKA 2GFSA 5L2QA 4DEDA 1SVHA 2WTKB 4RVKA 3DBEA 4LI5A 1XH5A 3FKLA 4ERWA 3KF7A 4LUEA 4WOVA 3QTIA 1GJOA 2Q0BA 3GC7A 3TIZA 1JKTA 1YOJA 1JAMA 1KE6A 4NSTA 5AUWA 1AD5A 3ENMA 3HMMA 4FUYA 1RJBA 1YOMA 4FKVA 5IH5A 1IA9A 1UU3A 2QURA 4XP3A 3V8WA 4F7JA 2VTNA 4MCVA 1ZYJA 3OWKA 4FSTA 2YCQA 2OJJA 2H96A 1YVJA 1U54B 4Y72A 4K18A 5EK7A 3HP5A 4U43A 4YTFA 5M4UA 3W18A 3MJ1A 4XMOA 1ZOHA 3VQHA 4GW8A 3A8XA 3ORKA 2YDJA 3CQEA 4XG3A 3THBA 4D2TA 4I6QA 4EKLA 3RINA 4N70A 3NNWA 1A9UA 4IWOA 4IWQA 4MWIA 5F94A 3VWAA 2I0EA 4D1SA 1J3HA 3PP1A 4QMYA 3U9CA 3COIA 1S9IA 3QWJA 3QTXA 4K6ZA 1U5QA 3MY0A 4FL3A 2PE0A 2QCSA 3ODYX 4JBOA 3R8PA 3TJDA 3UIMA 1SZMA 2XA4A 3BCEA 3L9LA 4M84A 4QP4A 2XYUA 4TTHB 4U8ZA 3VJOA 4AT3A 4QO9A 3PY1A 4LMUA 2BTRA 1FVVA 2NNWB 2XK8A 4B8MA 3A7GA 4E4XA 1K9AA 4AU8A 1QPCA 2GS2A 4IANA 3SDJA 2ZMDA 3G51A 4UV0A 4B99A 1KOAA 3QBNA 3JVSA 4ZXTA 3W10A 4BCMA 4PPCA 1TKIA 5LMKC 4BL1A 4CLJA 4BIBA 3E87A 4FIGA 4XYFA 1HOWA 5A9UA 3AC5A 4CVAA 2XYNA 3IW8A 4X2NA 5L2WA 4FZAB 4DF3A 2R5TA 1G8SA 3RTPA 1IASA 1WBSA 4EH9A 4JG6A 3FSFA 5E8UA 5KHXA 3Q5IA 2IWIA 2OK1A 3O23A 3S4QA 4PRJA 3B2TA 3OFMA 4QTEA 2CHLA 4AWIA 3TEIA 4EYJA 5IQGA 5BUJA 3MSSA 2J0IA 4M0ZA 4P90A 4AZWA 4YJPA 5CZIA 1YI4A 1Y6AA 4O0UA 3CSVA 2OKRA 4CNHA 4F70A 2YIRA 3BU3A 2J6MA 2F2UA 2OJGA 4UYAA 2OWBA 5DEYA 2YISA 4H39A 3RCJA 4UMPA 4NT4A 3LXLA 5KMKA 4ZTQA 2W1HA 4CQEA 1DAYA 4NIFA 2G2FA 4O0XA 2REIA 4EH4A 1P4FA 2XK4A 5GZ9A 4L00A 4WG4A 4I20A 3KVWA 2XNBA 2HXLA 4JI9A 4C7TA 3AT2A 1M52A 2IZUA 4RJ5A 4BI0A 1ZY5A 5T6KA 3C51A 3ZXTA 1JKKA 4O81A 2ITVA 3F3UA 1R0EA 2GNFA 3O17A 3L8PA 4PL4A 3SRVA 4G34A 2C3JA 3OWPA 4YHFA 4D0WA 1O6LA 4ITIA 4TZRA 2CDZA 3H4JA 4I0SA 2V62A 2JBOA 4YHTA 4M66A 1A48A 2PMNX 3OG7A 2GS6A 4OGRA 3G5DA 2CKPA 3U87A 1FVRA 1MRYA 3BHVA 5CNNA 4FV5A 5A54A 4MWHA 2XBAA 3IONA 2EB2A 4I6FA 5HNGA 1U5RA 4AZEA 3GCPA 5ANOA 1GIIA 4RC4A 2OF4A 3SXFA 4YC8A 3RPSA 4BWKA 4F64A 3NS9A 4X7QA 1H01A 3EFKA 1URCA 3BEGA 4GK3A 4QPSA 5EI8A 3FL4A 2EB3A 2Z8CA 5AWMA 3V5PA 3V01A 4FIIA 5GHVA 3UZTA 2YACA 3ORIA 4PPBA 4QQ5A 2ITTA 2OZAB 1TQMA 5A6OA 5HLNA 5JGDA 5IQEA 4MHAA 5I9WA 5AFVA 2W17A 2WOUA 2C5VA 4DFBA 4I41A 3E62A 4FNYA 2UZBA 3ROCA 2IVSA 3E3BX 3HDNA 3R01A 5E8XA 3R02A 4KD1A 2B52A 4L67A 2RFNA 3ZU7A 2VWZA 2HELA 3E63A 5DBXA 2YERA 4QMOA 4QYGA 4XP2A 3TNIA 1U54A 3IKAA 3MH3A 3UPXA 2VTMA 3I60A 5IQFA 3FQEA 3PIXA 3R1YA 4I0TA 3W2OA 3AC1A 3LW0A 1JSUA 4FZ6A 5CXHA 4XG6A 4NFMA 2OG8A 1OZ1A 2PSQA 3TKIA 4CKJA 4HZSA 2WKMA 2YCFA 2OZAA 1M17A 4OTFA 3FC2A 2XNOA 1ZOEA 2GPHA 3UOJA 2W9ZB 2B9JA 1WAKA 3BX5A 2PZYA 4DG3E 3AQVA 5HO8A 4O0VA 3DLSA 4YZ9A 4RX9A 2Y6MA 2QOHA 3OROA 3VC4A 1Y6BA 3QQLA 3L1SA 2VTQA 4BDHA 4DFUA 3SC1A 3EQHA 3ELJA 5HLPA 3NUPA 4F99A 5ITAA 4BWXA 4ZSJA 3UTOA 3R1QA 4DYMA 4AFEA 4IFCA 2WTJA 4WT6A 2Y8OA 2UZWE 4CMTA 2VNYA 4S33A 4NYEA 3MA6A 4Y5HA 4GYGA 3TN8A 4G2FA 1KSWA 3IK3A 4OTQA 2NP8A 2ERKA 4HGEA 5L8KA 4YLJA 4TXCA 2ONLA 4TWCA 5ACKA 4JR7A 3GB2A 2ZDTA 3BLRA 5DT3A 2J5EA 2PE1A 3QQJA 1YHVA 4EBVA 5KMMA 4BVUA 3TKHA 2EUFB 3IDBA 4U3YA 4HYHA 2O64A 1XHAA 2ITWA 4TWOA 4GT4A 1YDSE 4EHZA 4OAUC 5LVOA 1NA7A 3H9OA 5FDXA 3KK9A 5CSXA 2IJMA 2E2BA 1MRVA 4KA3A 4MD7E 4S30A 3SV0A 4DG2E 2PUIA 5DR2A 1CKJA 3ORTA 2E9UA 4YSMA 2OH4A 2WQMA 4WG5A 3UBDA 4EZ7A 4YC6A 5HG5A 2BDJA 3TZ9A 4GKIA 3NYNA 4X3FC 2JAMA 2F7EE 3CD3A 3NEWA 4IM0A 4YP8A 4ZY6A 3ACJA 2C1AA 4KWPA 2WGJA 5CT0A 2X39A 2WHBA 3E8CA 3UODA 3VBVA 1PXNA 3M1SA 4L44A 4DBXA 2W5BA 1FBNA 3EOCA 3CTQA 4L8MA 4H3BA 4AOJA 1WFCA 2UW6A 4D0XA 4BR3A 4CYJA 3NAXA 5AM6A 4Q9ZA 3O8UA 4BRXA 2AC5A 4CFNA 4JDKA 4TNDA 1FMKA 3BYSA 3DDQA 3W2PA 1Y8YA 3GVUA 1Q5KA 1PW2A 1MP8A 1H28A 2RG6A 3R63A 4GMYA 4CTCA 2XIZA 3ALNA 3LPBA 5DEWA 5HG8A 1VYZA 3CGFA 3E3PA 3NR9A 2XNEA 4FNWA 4RT7A 3BZ3A 5HQ0A 4DN5A 4O7ZA 5FEQA 2PUUA 3QQKA 3GENA 2YDKA 1PYEA 3R7GA 4QP7A 2OI4X 2X1NA 4ZSGA 4QMQA 5IG1A 2HY0A 1W82A 1OITA 3JY0A 3LXPA 1WBPA 1H0VA 1Z5MA 4Y5QA 3VS4A 4C59A 4C34A 5KHWA 3WZKA 1BI8A 5EW3A 4GG7A 3A4OX 4W9WA 3DQXA 3QX2A 2C30A 2VWVA 2ZJWA 3FXWA 2EXCX 5CZHA 4AE9A 2J2IB 4CMUA 3I1AA 5BMMA 3ZRKA 3BHTA 4ANLA 3KK8A 2QC6A 1PXJA 5CEMA 4IJPA 5EM7A 5M09A 4XP0A 2VD5A 4CFVA 4A4XA 2R7IA 5EDRA 4OBPA 2FB8A 1CTPE 1J91A 4RPVA 4AUAA 4FSQA 3LZBA 5D7VA 4ZTRA 2BRNA 4FT0A 4I5PA 4RIWB 4M68A 3POOA 1GNGA 4RIOA 1W98A 4HZRA 3PJ1A 3Q9YA 3FLSA 3RNYA 3KMWA 1Q41A 2UW9A 2PVYA 3QTWA 3QUPA 4ASEA 4FEVA 3CQUA 5DRBA 4EZ5A 4M69A 4DLJA 4E1ZA 4FV6A 3RPRA 4E73A 3D0EA 3DOGA 3TTIA 2XZSA 5JQ5A 2E9VA 4QOXA 4J7BA 4JAJA 2AYPA 4R8QA 1OKYA 5IPJA 4LG4A 3PDTA 5AV3A 2GNJA 3ULIA 5TT7A 2KULA 2OICA 5KNJA 3H10A 1L3RE 5CAQA 3QTQA 1IR3A 3IO7A 1OKVA 4RC3A 3DU8A 2XBJA 2CN5A 5J95A 4C33A 3R7EA 3P0MA 2JGZA 4BKZA 3RAWA 4EI4A 3LM5A 4U7ZA 2QO2A 5CU3A 4CFXA 4EZ3A 4AOTA 3LLAA 3LCKA 4D1XA 3U8WA 3QF9A 4O1PA 4E6CA 3Q32A 4BN1A 3PE2A 1BI7A 5CEQA 1OL1A 2PULA 4FE2A 3NPCA 4YBJA 3MV5A 4FYOA 4ZJVA 4DA5A 3D5UA 2PUPA 4NWMA 3R73A 4HYIA 4PMPA 1OPKA 1OI9A 3DTCA 3RWPA 2J50A 4RZWA 4F63A 2YA9A 3HMNA 4J8MA 3EZRA 4U3ZA 5FTQA 2BAQA 4EOQA 2PMOX 4AZSA 3ATSA 5FXQA 2WTWA 1IEPA 2F57A 4RVTA 4CT1A 2WFYA 3SXRA 5M56A 4N0SA 3OWLA 3OWJA 4TYJA 5IZFA 3PLSA 3WILA 2Y7JA 3O50A 1LEWA 5BUIA 4BHZA 4L6QA 4H36A 4QP9A 3ZM4A 3SA0A 2R4BA 3VS1A 4UMRA 4D5KA 4FVPA 2CSNA 4JRVA 4EK5A 4ENXA 3R6XA 4KIOA 3VN9A 4B0GA 1OKZA 2R3MA 2YFXA 3C4EA 5CEKA 4RA4A 2O5KA 5LMAA 5JEBA 5C01A 3AD4A 3NX8A 2JIIA 3CIKA 3R9DA 4AX8A 4BCNA 2J0KA 4FYNA 5M07A 5KX8A 3FI8A 3P4KA 5EW8A 4APPA 4JBPA 2UW8A 2QNJA 5C4KA 4O96A 1BYGA 5EDQA 1SVEA 3FL5A 4W9XA 5EI6A 5AAGA 4U44A 4GKHA 4M8TA 4J53A 3NVMB 1Q61A 2R0IA 5B2MA 4X2FA 4F7LA 3TDWA 2VN9A 5H8EA 1RDQE 3PXRA 3BEAA 4D4YA 4MF0A 5EM5A 4MXZA 4CV9A 5JN2A 2GNLA 3KQ7A 1REKA 3QYZA 5GIPE 2OXDA 4KRDA 4RLKA 5K5XA 2Y9QA 4U80A 5E1SA 4G17A 2XB7A 3V8TA 5EDPA 5FXRA 5ETCA 4L68A 2J90A 5H8GA 5FTOA 2NRYA 4IWDA 4OTHA 2XRWA 4HNIA 1OL5A 1TQPA 1IA8A 5HVYA 5BVNA 3Q5ZA 3FI4A 3GC8A 2VO3A 3O7LD 2F49A 1ZMWA 4AW2A 4YU2A 3NYVA 2V7OA 2A4LA 3KXGA 4E5AX 5KMIA 1E1XA 2VGPA 2VWBA 2ZM1A 4C4FA 5JFWA 1UU8A 3FLQA 3I7CA 4LYNA 2UZVA 3Q3BA 4OT6A 5K5NA 3BYOA 3LFAA 5DT4A 3GNIB 3R9NA 4ALVA 2WMTA 3ZO1A 1O9UA 4HJOA 4FKSA 4IB0A 2WU7A 4N6YA 5FM2A 5JH6A 3EL7A 4TPTA 3SOCA 3G0FA 4AA0A 3WZDA 5IUGA 4IX6A 3JR1A 3SD0A 5EYMA 3AMAA 4QMZA 4RMZA 5D7AA 2PVKA 3N4TA 3L8XA 2YLFA 2XIYA 3BHYA 3F5XA 1QPJA 3GXLA 4NZWB 4X2GA 5DNRA 3Q4CA 1FINA 4YLLA 3OUKA 4YJQA 5DRDA 3GCVA 4D2PA 5IQCA 2PHKA 4NTTA 5DMZA 5LVPA 3LXNA 1SVGA 2VWUA 5LJJA 2DQ7X 2R3RA 3CPBA 2P33A 3CC6A 3D94A 4YC3A 4U42A 2W1DA 1H24A 4O91A 3P08A 5T3QA 5HLWA 2BKKA 3U6IA 3ZRLA 4AGWA 4IVAA 2IW6A 2W4OA 4CMOA 4DFNA 1MQBA 4IC7A 2QOLA 4F08A 5AAFA 2ITYA 4E8AA 5JRQA 1NVSA 3CKWA 1OB3A 3BYUA 4NCTA 4PP7A 1XH6A 3ZXZA 4RX7A 5CY3A 5GJDA 2YHVA 3KEXA 5HCXA 4JAIA 4L3PA 2QOIA 2QOOA 3OUNB 4O6LA 4ORKA 4PQNA 4OBOA 4MF1A 5E91A 4BCOA 4XHKB 4RVMA 3KC3A 3MS9A 3CKXA 1XH8A 3F5GA 4RIXA 4X21A 3R7YA 3SKCA 1PXIA 3PRFA 1J7UA 3D5VA 3OF0A 1CMKE 4KKGA 4E20A 2ZDUA 3DK6A 3CS9A 4FV3A 3BKBA 4QTCA 2PZ5A 2RIOA 4EH7A 3ZHPC 4YBKA 2V22A 3F69A 3I0QA 5JT2A 3VS7A 5I9VA 5LOHA 4C35A 3VUDA 4F9AA 2CMWA 3ORZA 3V5LA 3ORMA 3RZBA 4IB1A 2OIDA 5ANGA 2A1AB 3W2RA 4FK3A 1K3AA 5LCKA 2OZOA 2JKOA 4YJTA 3R71A 4MBLA 1PRYA 2C0IA 3ORPA 4DT8A 5LVMA 4KBCA 3QKKA 4EHEA 4RIXB 3U54A 2PL0A 4PF4A 4M12A 4OW8A 1GZOA 3GU7A 2X2LA 3UDBA 3MH0A 2FSTX 2H9VA 3LCDA 4PDOA 2A27A 4DLIA 1FGKA 4BZOA 5CF8A 4I3ZA 2R0UA 5AJQA 2VTSA 3PE1A 4FTCA 4HVIA 4ZEGA 3W33A 3DAEA 3R7VA 1Q97A 4EOJA 2IO6A 3DNEA 5HVKA 2P55A 5E7RA 1A06A 2XEZA 3EQBA 5TR6A 3HDMA 5AP1A 3Q6WA 3GEQA 2O3PA 4WSYA 3OZ6A 2UVXA 4FBXA 2QG7A 3FLZA 1WCCA 1R78A 3W8LA 5FEDA 4D4RA 3EYGA 3FLWA 4DBNA 5C8NA 3DBCA 3QU0A 2CGUA 5J5TA 5KBQA 1J7LA 5EM6A 4F6WA 2B0QA 5DOSA 3VS2A 3CEKA 4YNOA 4WKQA 5GINE 5BYYA 5K0XA 4PTGA 4XG8A 4MNEB 4FK6A 2PVLA 4XOZA 3OXTA 4HVSA 1DAWA 5K3YA 4AGUA 4M0YA 4M7IA 4A9TA 3KXMA 1JSTA 5TKDA 4CFWA 4EC8A 4JDIA 2QODA 4FNZA 3ZUVA 4HPUE 4FG7A 4RWJA 3VF9A 4QT1A 5DA3A 4E3CA 3FMHA 2J5FA 4M3QA 3FDNA 3QXPA 3ZSIA 5JGAA 2I40A 4AW0A 5IISA 4EKKA 1URWA 3A2CA 2B4SB 4QYHA 4GT3A 3ZBXA 5D41A 2OO8X 1V0BA 4O0YA 3E8EA 5HE1A 3CTJA 4U41A 5DHJA 1G3NA 4CKIA 3A7HA 3BE2A 4JJRA 1YWVA 2HZ0A 3U6JA 4BYIA 3TUDA 4Q5HA 2BAJA 4MXCA 5GNKA 4QRCA 3UQFA 3DY7A 2PK9A 4R3PA 3ULZA 4F4PA 2O0UA 3FWQA 3I79A 3V6SA 3SXSA 3EYHA 3AD5A 2GU8A 3U55A 3MTFA 1P14A 4YGAA 1YHWA 4IZ7A 4DCAA 3FHIA 3P5KA 4Z9LA 3R8MA 3R7IA 5HE0A 5CSPA 3C5IA 3FI3A 2VTJA 3Q52A 2X4FA 2W1CA 3UP7A 3IW7A 4QQJA 3LFQA 4XG2A 5J9ZA 3VJNA 3CJGA 4ZIMA 2CPKE 4ZSEA 4YZNA 3PVBA 3A7FA 4MBIA 2EXMA 4BCHA 3QTSA 2J9MA 3QRJA 1ZZ2A 4KSPA 4QMVA 2Q83A 4HGTA 2XCHA 1I44A 1VJYA 4HYSA 4I93A 2VX1A 5AP0A 2RFSA 2WTCA 5DPVA 4RGJA 5E8YA 3RVGA 2X9FA 3TI1A 2BIKB 4I1ZA 3FZPA 4WUAA 4XJ0A 3VUHA 3GCQA 4F0FA 3QRTA 5EKOA 4ACGA 4ZZNA 1J1BA 2X7FA 4QMSA 5GJGA 2ZV2A 3WZUA 3ZSHA 2GMXA 4ZTSA 5A4CA 4W8EA 3WF6A 5BVFA 4DITA 4EWHA 4RJ7A 1QPDA 3HP2A 2YIWA 3R1SA 4AZTA 5AEPA 3I7BA 2ESMA 3RAHA 2IW9A 4WNMA 4GUEA 4J97A 3MWUA 3QZGA 3GU4A 4FMQA 2WMSA 4USFA 4UMTA 1DI9A 3S00A 2XK9A 3HX4A 4JX7A 5FXSA 2O63A 5JQ8A 4OR5A 3NUUA 4JT3A 4YJOA 5HCZA 1XH7A 4PNIA 4DH3A 4HCVA 3CY3A 3H30A 4ENYA 3W32A 3PIZA 2FGIA 2WMAA 3Q9XA 1APME 2BILB 3NYXA 5G6VA 5BPYA 2UZTA 4U81A 5I5ZA 1Q8YA 2VU3A 3EQRA 1LEZA 1ZYCA 2X9EA 3E64A 2C5YA 3QA0A 4ACHA 2R3IA 4GSBA 4G31A 4XBUA 3NDMA 4EOSA 4XG4A 3LJ1A 2JDVA 3HMIA 4MAOA 4MQ2A 3RHKA 3C9WA 2C6MA 3NZ0A 4AGCA 3R83A 5M44A 5IA2A 3SRVB 4AN2A 2XM9A 3DA6A 3I81A 3MB6A 1ERKA 2X7OA 2XF0A 2BRHA 3COMA 4V0GA 4X3FB 5BVKA 4GG5A 3RWQA 2UW0A 3QTZA 3CD8A 4NIFB 4CD0A 4EH6A 4QYEA 4QP1A 3AGLA 2JDRA 3FPMA 4WNOA 5FUTA 3KXZA 3II5A 3KRLA 1B6CB 2VWWA 3HZTA 4CFMA 3MYGA 2QOQA 3ZCLA 3FI2A 3QTRA 2QKRA 4TT7A 2WU6A 3MVHA 4LGGA 5CEIA 3NUNA 3PG3A 1PMUA 1F0QA 1VYWA 2WEVA 3NCZA 5DYJA 2QU5A 3MH2A 4UB7A 2O2UA 4BI2A 4CFUA 5LQFA 4ZTHA 4DEEA 3ZC6A 4GFGA 4D1ZA 4H3QA 5AIKA 3VUMA 4J71A 1OPJA 5AA9A 5TF9A 2QI8A 3NAYA 3MI9A 5DIAA 5ANKA 5KO1A 3HL7A 4FTQA 3UQGA 4LM5A 3DZQA 3BQRA 4O0TA 2VO0A 3ZRMA 5KUPA 3LMHA 5F20A 4BGQA 3EQDA 3C4XA 5H9BA 4HVDA 1MQ4A 3QQGA 2R64A 4Z55A 2OU7A 4HYUA 3RK5A 3EQGA 2WTDA 3RNIA 4FVRA 4R6VA 4RJ8A 5E8VA 2I6LA 4EOLA 4UBAA 1GY3A 2VTTA 2ZAZA 2R3JA 4BDDA 3KFAA 3MVMA 4JIAA 4LV8A 3O51A 5I3RA 2SRCA 3IOKA 4A7CA 2DS1A 4AE6A 4DH8A 5AUXA 2BRGA 3FPQA 5L6WL 3ZUTA 4BCIA 3OP5A 4OBQA 3UYTA 3GQIA 2QLUA 4R1YA 3S2PA 4CCUA 3VBWA 2CKOA 4IMYA 4F7SA 4OLIA 5IMXA 4NM5A 4XS2A 5I3OA 3VW8A 4DH7A 2F7XE 3GU8A 3QLFA 4GCJA 1OIRA 1J1CA 3FY0A 4FV0A 5IQIA 2Z7SA 2YCRA 2ZB0A 4W4WA 3UYSA 5CU0A 2XKEA 5HI2A 3TM0A 3ZTXA 4OTPA 3DZOA 2W9FB 5CEPA 3SVVA 3F61A 3KRWA 4K2RA 4DEHA 3EN6A 3UG1A 4IHPA 4QTBA 4WRSA 4HVHA 4U5JA 1UWHA 3V51A 2XEYA 2W4JA 4KSQA 4F9CA 3GC9A 1M2QA 4W4XA 4R3CA 5CANA 5KBRA 3FMMA 4TN6A 2PMIA 4FKTA 3ORXA 1DS5A 3IW5A 5M57A 3QD0A 2W4KA 4EQUA 1JKLA 4NM3A 3HGKA 1XKKA 3QC9A 2RKUA 4Q5EA 2CNVA 3PIYA 4DFXE 4YJRA 3WF7A 4BCKA 4JG8A 3LCTA 4USDA 4EJNA 2RFDA 4WUNA 3GCUA 1XH4A 4CKRA 4EJ7A 1V1KA 4ASDA 5HBHA 3MA3A 3SX9A 5LMKA 2CNQA 4JQ8A 3PSBA 2WELA 2YM6A 4LRMA 4APCA 3EQFA 4IAFA 5AM7A 2HCKA 4FTMA 5EH0A 4CV8A 4H58A 5AUYA 1FMOE 4J99A 4R1VA 1K2PA 1UNLA 3ALOA 4E93A 5AR8A 4H05A 3R9OA 3KREA 3REPA 2JLDA 5J8IA 4YTHA 3ZO3A 3AT4A 3AT3A 3W2CA 4F6UA 3U9NA 5A4EA 5A4LA 5AUUA 3HA6A 3R7UA 3PSDA 4P5QA 4BDAA 3V5TA 3PFQA 3QQUA 3UIXA 3PJ2A 3ENHA 3MPTA 4G6LA 4YO6A 4G9CA 4JQEA 1KUTA 2WMRA 3U51A 2VTAA 4I21A 2XRUA 4IVCA 2BROA 3MIYA 5DLSA 2OH0E 5CAPA 1MRUA 5FP5A 5B2LA 4PP9A 5FTGA 3GI3A 3R8UA 5C8MA 1L8TA 4V0GB 2J0MB 3SW7A 5ETAA 4O7WA 3FY2A 4BCPA 5KZ0A 3LFBA 4IBMA 3I6UA 4LL5A 4RFZA 1G8AA 3V5QA 4C0TA 4D9UA 2XS0A 2JC6A 3AC2A 2O65A 5EHLA 4FKRA 4PV0A 4XOYA 4DGMA 3KXXA 5C9CA 3UC3A 4BDFA 4LRKA 3OHTA 5CEOA 1CKIA 4IX5A 2VX0A 3DXNA 4UWBA 1KE7A 5KZIA 4I24A 4HNFA 3WBLA 2WIHA 2IZTA 3LFEA 4EK4A 5J7HA 4ERKA 2ZV9A 4GYIA 4IADA 2XK7A 4YZMA 3OCBA 4Y95A 4O2ZA 5FWKK 3LKMA 5IDPA 3CLYA 3NRMA 1FQ1B 3Q96A 1P4OA 3O96A 3FXXA 3G6HA 4OAVB 4FV1A 3A7IA 3QCQA 5LWMA 4U6RA 4B7TA 4DFZE 4FTUA 4AS0A 1IG1A 4D28A 1KV1A 2QD9A 4YJSA 1HCLA 2JKKA 3VS3A 3C1XA 5AADA 3IS5A 2C6EA 4PDPA 4O6EA 3RCDA 5IEYA 3PWDA 1UVRA 4V04A 4GEOA 4IDTA 3C7QA 5FBNC 4AOIA 1FPUA 5AR5A 4EOMA 3E88A 5C1QB 5HE2A 3WIKA 2C6DA 2RF9A 2XIRA 3C0GA 1XWSA 5EHOA 3LFSA 5CVHA 3NUAA 1PMEA 5E8WA 4FOBA 4WIHA 1XJDA 5CT7A 5JSMA 4DCEA 2PU8A 3EQPA 3N9XA 3R9HA 5I9XA 3NUSA 5IQBA 1Q8UA 5M55A 4JQ7A 4NM7A 5EQEA 3O71A 3BU5A 4KIPA 4E5BA 5HHWA 4YLKA 5TE0A 3PYYA 4NKSA 1ZY4A 2BAKA 5DR9A 3MVJA 4IAKA 4EH5A 1PMNA 2OFVA 2VZ6A 4EUTA 3OS3A 3QGWA 4USEA 5CU4A 3PPKA 3RAIA 3ZO2A 4GVJA 4WBBB 4NJ3A 4ZLZA 2BZJA 1R0PA 2ONLC 1T45A 2UZDA 2WQEA 3A4PA 3NWWA 3VUGA 3ORNA 4FTAA 4CZYB 3BBTB 3EFLA 4PDSA 3QCYA 4Q9SA 1ZLTA 3FZOA 5HIBA 4NL0A 3EIDA 3PPZA 4FTTA 4E6AA 1PHKA 3K5VA 4CEGA 1OM1A 4I22A 3SLSA 2VUWA 4F9BA 2OLCA 2R3GA 1ZARA 2BMCA 4CG9A 4FV8A 5A6NA 2C69A 3DGKA 2XP2A 3VRYA 3WF9A 5CALA 1PXLA 2FYSA 4FIEA 3HV4A 2XJ2A 3KRJA 2YM8A 4JBVA 3OTVA 2Y0AA 5E8ZA 2CLQA 5HVJA 2UZLA 5AV2A 1YDTE 3D4QA 2YAKA 4U97A 2J7TA 4IVBA 5CX9A 3ZDIA 4P2KA 4Z3VA 4HPTE 2R3LA 3PY3A 2XMYA 5HBJA 4YJNA 2Z60A 3KL8A 3RPVA 4EUUA 3L8VA 4B6LA 4N6ZA 3EL8A 5BYZA 2JBPA 4MKCA 5CI7A 5EI2A 3V04A 4BZDA 3IGOA 2G2IA 1PJKA 3CTHA 2C68A 4XX9A 5JFSA 4IZYA 5DR6A 2RL5A 4S32A 4BIEA 3R00A 3S95A 3L9MA 4IFGA 3HMOA 5FG8A 2BIYA 4YTCA 3D2KA 4PUZA 2BKZA 4TYHB 1YI3A 2Q0NA 3K2LA 4BKYA 4LOOA 1PY5A 2UVZA 3HAMA 3VUTA 1XR1A 3DK7A 3TUCA 5E4HA 2B9FA 3MGYA 4YMJA 5CSWA 3KCKA 4UZHA 2GTNA 4XEYA 4O0SA 2YWVA 1WBTA 3DAJA 1UU7A 3HV5A 3HYHA 3G0EA 4WNKA 4DAWA 4EOOA 2C5NA 3T9TA 4BGHA 4XUFA 3S0OA 4FKOA 3ZBFA 1RE8A 3P9JA 4IM2A 4UX9A 2UW5A 1W83A 4R5SA 3ZO4A 3I5NA 4C3PA 3QTUA 3QYWA 3FZTA 2Y4IB 1PXMA 4OT5A 2UZNA 3KMMA 5AP6A 3WZEA 2BCJA 4EBWA 1OIUA 4D2RA 1PMVA 3FMNA 3QCSA 3UVRA 2C6LA 4ARKA 3L9PA 1ATPE 4X6RA 3BGQA 5CS6A 3T3VA 2GFCA 4IAIA 3UIUA 3TWJA 3WE4A 3NSZA 4AN9A 4U45A 5K0KA 3TZ8A 3RP9A 1W84A 4FICA 4RLLA 2HZNA 2UW3A 4FV7A 2PZPA 3LFFA 4L7SA 3E92A 1YKRA 4H1JA 4PPAA 4BCQA 2X8DA 4QMPA 3ZH8A 4BYJA 2JFMA 3F3ZA 3ZUUA 1H26A 4PTEA 4ALUA 3EFJA 4FKWA 1YXUA 1SM2A 4NJDA 1UV5A 4DTAA 2W7XA 5ACBC 1VZOA 4L7FA 1B39A 4FKLA 3EN9A 1W8CA 2QO9A 2BFXA 5CAVA 2GHLA 3IECA 4CT2A 4GU9A 4D5HA 3DBFA 4ASZA 4BDIA 5KCVA 2CN8A 4JL9A 4MNEA 1UKHA 3OMVA 4GVAA
chains in the Genus database with same CATH superfamily
3IDPA 3GCSA 3FYKX 4ZY5A 4O83A 3KULB 1AQ1A 2F4JA 4G16A 4RSSA 4ALWA 2ITXA 3NW6A 4A9RA 3LQ8A 2W5AA 2Z2WA 3O8TA 4QDEA 3QRKA 3QFVA 2WXVA 4IB5A 2OF2A 5BVEA 4AF3A 5FP6A 4WBOA 2B1PA 3R0TA 2BFYA 3R2BA 5EHYA 3WF5A 3ZSGA 1OL7A 2CJMA 4ZS0A 2YN8A 4KKHA 2GQRA 4LFIA 4UMQA 3ZC5A 5DGZA 5IA0A 2NRUA 4FSYA 2XNPA 2X4ZA 2HWPA 3K3IA 4CYIA 3DXQA 2B9HA 2VTRA 3MESA 2P3GX 3WOWA 3UZPA 4C62A 5L2SA 2ZOQA 3U6HA 1IAHA 3DQWA 4I92A 5LARA 1YWNA 3DDPA 4PWNA 4RQVA 1OUYA 3HMPA 3PPJA 5DT0A 5A3XA 4S31A 4ACCA 5ETIA 2YZAA 3IG7A 1U4DA 1YRPA 2AQXA 3QKLA 3R22A 5FRIA 4C36A 1IAJA 1W2FA 3RJCA 2X0GA 4FSNA 5HO6A 5L2IA 4QMXA 3U4UA 2QKWB 4DEAA 2XKFA 4WG3A 2E9PA 4KAOA 4TYGA 2XUUA 4MK0A 2C5OA 5EOLA 3OC1A 4GRBA 5J1VA 2YITA 5G1XA 3AC4A 3QD4A 4LV5A 4QYFA 4RG0A 2WQOA 2XCKA 4ID7A 4D2WA 4ZMEA 4JOAA 1ZXEA 2QO7A 5ANEA 1H8FA 3D14A 4G3EA 4PMMA 3GU6A 3RI1A 3FEGA 4RWLA 1BMKA 2OIBA 4M97A 2GS7A 4TW9A 2C4GA 3PVWA 1V0OA 2ITNA 3KN5A 4O0WA 5J87A 4X0MA 3ZEWA 2X2MA 4Y85A 2YZLA 2YWPA 5HKMA 3G6GA 4P4CA 3SQQA 3HEGA 3LQ5A 3Q04A 4K8AA 3FC1X 2Z7RA 4MXOA 3FHRA 4AP7A 3PJCA 5CVFA 5AIRA 3FXZA 5CSVA 2IZSA 4FJVA 5FEEA 4K77A 4EQCA 2C6OA 4C61A 4NTSA 3PVUA 3VW6A 2VV9A 4ANOA 5FM3A 4EC9A 3PXYA 4U0IA 1H25A 3PXZA 3N51A 3ERKA 2QOFA 3OT8A 4A4OA 3UNKA 2EU9A 1TFFA 3TUBA 4C4EA 4FOCA 4RZVA 4O7VA 5DWRA 3MPAA 3Q9WA 1YDRE 3ZFXA 1H27A 2PUNA 3V8SA 4IIRA 3P86A 5HNBA 3HECA 5AP7A 4QPAA 3ZLXA 2QOBA 4AW5A 3E93A 2YAAA 5JRSA 2J51A 4O82A 3VAPA 1GAGA 2PVFA 4RX8A 3EQCA 4GV1A 1X8BA 2QQ7A 3PVGA 3QKMA 4DHFA 4FA2A 5GZAA 4I5MA 2FH9A 1PXOA 2BRMA 2C0OA 5HE3A 3KF4A 1YXVA 4KABA 5D10A 1BLXA 2PTKA 2WO6A 1REJA 3BI6A 3OTUA 2LGCA 4RWIA 4L3JA 4AXAA 3LMGA 3HRFA 5D11A 4DE4A 2XJ0A 1SNUA 4YZCA 4YPDA 4JRNA 5ICPA 5L4QA 4RJ4A 4QEBA 3MPMA 5J1WA 4JBQA 2XAOA 3NNXA 2XH5A 2C0TA 4R3RA 4ZSLA 3BHUA 3JY9A 3D7TA 3UMWA 4FZ7A 1M14A 5BUEA 3NIEA 4GL9A 3UOLA 5IQAA 3Q4ZA 5M06A 4C58A 4CTBA 3LJ2A 5CVGA 2YABA 2WTKC 5BVWA 1Y8GA 4ZTLA 3RK9A 4BC6A 5KKRB 3LJ0A 4QD6A 3W0PA 4D2VA 2IPXA 4DGLC 2Y4PA 3HUCA 1LPUA 2Y6OA 4NW5A 3ROYA 3C0HA 4KS8A 5CQUA 4NM0A 4BCFA 3DTWA 3PTGA 4IWPA 3VO3A 3T8OA 3TL8A 5J5SA 2YIXA 2UW4A 3AC8A 2O8YA 5IA3A 2WQNA 5AV1A 2CNUA 4CGAA 3UMXA 2VX3A 4RJ3A 2OBJA 3BGPA 4MBJA 4FX3A 2G9XA 1M2RA 4MXXA 3H0ZA 4FG8A 4CFFA 2BHHA 4X3JA 3R9RA 2QHMA 5B2KA 4FV4A 4MNFA 4AGDA 4BBFA 2J0LA 3QUDA 2P0CA 4MXAA 4FT5A 3SAYA 2W1FA 4DGNA 1SYKA 4PY1A 5HG9A 1RQQA 2QHNA 3AXWA 5AX3A 2ZVAA 1YXTA 4ZJJA 4FR4A 3Q6UA 4FSMA 3WZJA 5AUTA 4F78A 3BPRA 3FMJA 4FSZA 4HW7A 4YUQA 3FZ1A 3TIYA 4ANBA 2BUJA 4O7YA 4KINA 2PVMA 4UWCA 4P5ZA 2BALA 2XKCA 4FVQA 2PVHA 4D4VA 2JEDA 4PL3A 4PX6A 1WMKA 3QRUA 4GU6A 3E7VA 4G3GA 4NUSA 4I6BA 4ZOGA 4UY9A 3NMUF 4IJ9A 4Q2AA 1LP4A 2OXYA 4QNAA 2ZV7A 3D15A 3T3UA 4EK6A 3Q4TA 4KIQA 3ZMMA 2GNIA 4U9AA 4A9SA 4LUDA 4CRSA 3FMLA 2Y4IC 4FIHA 4BY9E 5LCJA 4QMWA 4EQMA 3Q9ZA 4ACDA 3QWKA 1XBAA 3FMKA 5I9UA 3CY2A 4E26A 5CQWA 5L6PA 3DXPA 2A19B 3F66A 4XH6A 1OKWA 3MN3A 2I1MA 4UZDA 4K0YA 4C8BA 4FGBA 3OBJA 4IXPA 3ZM9A 4YPSA 3WE8A 4FEUA 2A98A 4CCBA 4PDYA 2G15A 2YIYA 4Z16A 1MUOA 3DKCA 5HESA 3M2WA 4G6NA 5H2UA 4LDTA 4Y83A 4PL5A 2E9OA 3F7WA 4FSWA 4TNBA 4FSRA 3QUEA 1OIQA 1KE8A 4GT5A 3GU5A 4NCTC 3TTJA 2FSOX 4BTKA 2CCHA 4C4HA 3W0NA 1PXPA 2EWAA 4TY1A 4E4MA 5I9ZA 2IVUA 3NCGA 4MVFA 4KBAA 4QPMA 2OSCA 4TYHA 2WPAA 4ANQA 3BELA 4ONAA 2W05A 5BVDA 5EW9A 4CSVA 3GP0A 4IH8A 5CNOA 2BRBA 4MH7A 1WZYA 2XVDA 4G3CA 5A14A 2JDOA 3GQLA 4L3LA 2ZMCA 4KBKA 3ZEPA 1Q8TA 3E8DA 5HX6A 3AMYA 1OUKA 2ITQA 2A0CX 3Q60A 5H8BA 2YJSA 5CI6A 3FMEA 2IW8A 3LVPA 3OVVA 5AP5A 3R8VA 3FE3A 2X2KA 4F0IA 5AA8A 5KKRC 2HW7A 4WA9A 4WNPA 2BDWA 4JG7A 3MY1A 2ETRA 3SG8A 3RKBA 3OT3A 5TOZA 4W8DA 2AC3A 4O21A 4J96A 4GIIA 4GJ2A 4EORA 5CU6A 4I0RA 1JSVA 3ZOSA 5AR3A 2WNTA 4II5A 3SHEA 2HXQA 1SMHA 1UA2A 3TV4A 5LWNA 4PNKA 2BZIB 4BDGA 2W99B 3E8NA 2GCDA 3ZONA 2XIKA 4GFMA 3SG9A 2GNHA 4QP2A 4XCUA 4BBEA 4F65A 3P7CA 2PY3A 4FZFB 3UVQA 3FJQE 4EOPA 2W96B 4BBMA 4FZDB 4AA5A 5ANIA 3OCGA 5CSHA 3EB0A 2R3NA 5KMNA 5AP2A 4Z7GA 2F9GA 2JFLA 3MH1A 4BHNA 5BVOA 4A9YA 4QMMA 3TKUA 3FLNC 1Z9XA 5CF6A 3FBVA 3GC0A 2WOTA 4M13A 4Y8DA 3VHEA 3D83A 4EH2A 4C37A 5LVLA 3DKFA 4IAYA 3QZHA 4FIFA 3FZRA 3TNHA 3VBQA 3MFUA 4E4NA 5AUZA 4I4EA 5L8LA 3M11A 3LMIA 2QR8A 4K1BA 4QMUA 3DK3A 1Y91A 2BVAA 1OPLA 2JAVA 5FLFA 3TNWA 1OECA 2VO6A 3BWFA 3DJ5A 3UNJA 5KMJA 3NW5A 5LVNA 1HCKA 2WMBA 4DHZA 5AR2A 4FKPA 1G5SA 3FQHA 2C6KA 3ANQA 4DFLA 4G3DA 4NK9A 2XNNA 3ACKA 4JLCA 4YSJA 4XLIA 4L01A 4UMUA 2C1BA 2PVNA 4UYNA 5IKWA 3GUBA 5C03A 3V6RA 4ASXA 3QALE 4FI1A 4C3RA 5CASA 3VUIA 5I0BA 3UPZA 5C27A 4UN0C 1YXSA 3FMDA 5BYLA 3RMFA 1JOWB 1ZMVA 2QOKA 3O7LB 4FV2A 3DB6A 4FODA 3QQFA 2YLEA 4E5WA 4XG7A 1F3MC 2Z7QA 3F2AA 4LOQA 5EYCA 2B54A 2IVTA 2YCSA 4L46A 4E7WA 3DB8A 2WQBA 4HVGA 2XJ1A 3V5JA 4AT4A 5LMBA 4FSUA 1KV2A 4D55A 4O22A 1OMWA 2P4IA 3S1HA 2X6DA 4OUCA 1YQJA 4ITHA 4UXQA 3JS2A 3N4VA 4DFYA 4F1MA 5A4TA 2UVYA 2JDTA 4AFJA 3GGFA 3HV7A 3IPHA 4FV9A 2R3KA 3LFNA 2VO7A 3MFSA 1M7QA 4DTKA 1ZWSA 3BLAA 4N4SA 4D2SA 4DH1A 3TJCA 3C0IA 5IUHA 4LL0A 1H1RA 2BZHB 3WIGA 3ZDUA 3HV3A 4A9UA 4FEXA 1ZAOA 3QX4A 3EN5A 5C4LA 4FC0A 4NU1A 1WBOA 3GT8A 5BMSA 3R21A 4BDKA 3TXOA 4E6DA 4XV3A 3H9FA 3LFCA 2HENA 4UXLA 5DVRA 3ZLWA 4GK4A 5IA1A 4B8LA 2ERZE 3RALA 2PYWA 4O0RA 4CZTA 5IF1A 1O6KA 3VS6A 3DFAA 3PXFA 4DEBA 3CE3A 3LCOA 4IDVA 3H0YA 4FT3A 5JZNA 3RAKA 3IW4A 3RZFA 4BF2A 5M4FA 1OIYA 3KMUA 4OTRA 3VQUA 3A62A 3ORLA 4C02A 1B38A 5CAUA 3ETAA 4ZTNA 5HU9A 1ZMUA 3UC4A 2GHGA 4L43A 5HGIA 1XO2B 3COHA 3PUPA 5D1JA 4FKGA 3EMGA 4EEVA 2CCIA 3BL9A 5LXMA 3HA8A 1ZOGA 3VVHA 4O84A 3DFCB 4L52A 4RIYB 3MTLA 3OY3A 3DCVA 3BBWA 3F5UA 4JDJA 3BYVA 3HUBA 4KIKA 4IM3A 3TZ7A 1CDKA 5HX8A 3IGGA 3LOKA 2RG5A 3ATTA 4KIKB 3LQ3A 2JKQA 5EYDA 5KMLA 4O4FA 4AZVA 3OXZA 4JIKA 2OJ9A 5E90A 1P2AA 5HNIX 2VWXA 5AMNA 2BR1A 4NFNA 3C4CA 5AUVA 1BL6A 4UALA 2IN6A 3I4BA 3EJ1A 1QMZA 2ZYBA 3LLTA 4QNYA 3DBDA 3WARA 4ZZMA 2V5QA 3MW1A 4MD9E 2OXXA 4O7RA 3B8QA 4ANSA 3CP9A 4YZBA 4C4JA 2I0YA 2WTVA 1W2CA 4ZS4A 4RIWA 4QQCA 2ZM3A 3OY1A 5AR4A 5GZ8A 2QONA 3UOKA 3PRIA 3QHWA 2R3HA 2RFEA 3NNUA 2PVJA 5L3AA 3KGAA 2FSLX 1IRKA 4G3FA 5ETFA 4G9RA 4IC8A 3RPYA 5K4JA 3R04A 3CBLA 3K5UA 4G1WA 4WRGA 1GZKA 3OCSA 2W1GA 3KXNA 4K11A 2XK3A 4GH2A 3HKOA 1EH4A 5HTBA 3NUXA 3MJ2A 5FD2A 2PWLA 5K4IA 2XK6A 1JWHA 3VULA 1RW8A 5HIDA 1XQZA 5HIEA 5FQDC 1CSNA 4RFYA 3P1AA 2QLQA 3MIAA 4W4VA 3I0OA 1JBPE 4AZFA 4BGGA 5EQYA 1KE9A 2HIWA 3F88A 3TDVA 1YOLA 4HOKA 5D9HA 4AQCA 4EH3A 4AXCA 2VTPA 2WTIA 1WVWA 2G01A 4M69B 2VNWA 1KOBA 3C4ZA 4ZJIA 4MXYA 2B7AA 1E9HA 4BCJA 4EH8A 3AGMA 5F9EA 1V0PA 2R3FA 2H6DA 4ZK5A 3MDYA 4FKQA 5BNJA 3BYMA 3MFRA 5IA4A 3C4FA 4Y46A 2OFUA 3F9NA 3JPVA 2WIPA 1VR2A 2BHEA 3W1FA 1WVYA 2QG5A 3D7ZA 3L9NA 3KCFA 3QLGA 3ZFMA 5HORA 2R7BA 1J7IA 2GQSA 3UO6A 4X2JA 3R1NA 3TCPA 2PVRA 4I4FA 3UQCA 5FDPA 5KMOA 3AKJA 1H1SA 4BKJA 4EK8A 3ET7A 2I0HA 1UWJA 3GFEA 4BDJA 1KWPA 2QOCA 4KRCA 4JS8A 1LR4A 4NW6A 4D4SA 3DNDA 1W0XC 5IH6A 4RWKA 2FSMX 5M53A 3ODZX 4CG8A 5CWZA 5M51A 3SOAA 1STCE 1QCFA 5HBEA 1I09A 3NFFB 3OCTA 4FUXA 4O2PA 3P7AA 4F0GA 4J8NA 5J9YA 3RGFA 1Q99A 3O0GA 3VS0A 3K54A 5AV0A 3L8SA 2IVVA 3K3JA 3G33A 4O27B 4EYMA 3N4UA 3EKNA 3G9LX 4Y73A 2ZM4A 4C2WA 1UU9A 5TO8A 4FTIA 3F5PA 2V0DA 3ZFYA 4CZUA 4D58A 5HU3A 4L45A 3OEFX 2W0JA 1JKSA 4F9WA 5CF5A 2C5XA 3JUHA 1XH9A 5IQHA 2JDSA 2BDFA 2HAKA 3PLAE 3JXWA 4XLVA 1FOTA 5HEZA 1ST0A 2V7AA 4TYEA 3CPCA 5CLPA 3Q2JA 2ACXA 2HWOA 1YW2A 3HRBA 1ZYSA 3O8PA 2CKEA 2VWIA 3BV3A 3F3WA 3NIZA 1F5QA 4P7EA 5JGBA 4AG8A 3H3CA 4OTDA 3R8ZA 2EVAA 4NEUA 4ZY4A 3UJGA 3QQHA 1PKDA 3P7BA 3W16A 2OJIA 4XV9A 2HY81 2G1TA 1BUHA 3BQCA 1H1QA 4JNWA 4MYGA 2F7ZE 3B2WA 3BHHA 2WZJA 2Z02A 2JD5A 2WMUA 3LFDA 2YM3A 4I5HA 1OBGA 4UEUA 4UWYA 3OW3A 5DN3A 3VS5A 5L2TA 3LXKA 3RK7A 2BTSA 2VTIA 1OVEA 4RC2A 5CU2A 3O2MA 3IW6A 4IX4A 4RX5A 2H34A 2WMWA 4E6QA 4ZSAA 4TWPA 2XKDA 3D7TB 4FT7A 4R7HA 2ITPA 5IA5A 3SGCA 4DTBA 1YXXA 2FVDA 2X8EA 2WAJA 3PZHA 4G6OA 5J9LA 3RM6A 2ITOA 1ST4A 2E9NA 2ITZA 4IEBA 2IG7A 3ID6C 3OXIA 1PF8A 5E8TA 2ETMA 3QRIA 1TVOA 5EM8A 4ANMA 2VGOA 3TACA 4R5YA 1NT2A 4I5CA 2C3IB 5HZNA 4EWQA 2HZIA 5CXZA 3RBWA 4CLIA 4ZZOA 4FKUA 1R39A 3EQIA 4ZP5A 5JFXA 5ANJA 1W2DA 1WBNA 3KVXA 3R8LA 4HGSA 5HO7A 1H1PA 3Q2MA 4L9IA 4QP6A 4B9DA 2PPQA 4K9YA 1H4LA 3AG9A 4HGLA 4OTWA 5E92A 4ZLOA 2PZRA 4I23A 5M08A 2JIVA 3BV2A 4BTFA 2UZEA 5BX0A 3KXHA 2VTLA 2WB8A 3RPOA 4AW1A 2R9SA 2OGVA 1OGUA 3TV7A 4GK2A 3NFGB 3KULA 4GFOA 2UW7A 3OW4A 1WBVA 2NPQA 1SNXA 3R2YA 4X2KA 2X81A 3EH9A 4A4LA 3RHXA 3V3VA 1Q8WA 1DM2A 5IH4A 1KE5A 4BIDA 2XNMA 3QC4A 4IVDA 5AR7A 2IZRA 4F1OA 3BLHA 5HCYA 1LUFA 2W1EA 3VNTA 4KUJA 2PZIA 4O4BB 3PSCA 1ZYDA 3WI6A 3NUYA 3DV3A 3EKKA 1Q8ZA 4JX3A 4H1MA 4MQ1A 1NVRA 2R3OA 4NH1A 5CTPA 4C4GA 1BKXA 2JIUA 2XM8A 4FKJA 3AMBA 4BB4A 2Z7LA 4NKAA 3GOKA 5E8SA 4CRLA 3FKNA 3DJ6A 4KS7A 3T9IA 4QMLA 4BFMA 3LIJA 4LGHA 4QTDA 4EHGA 3BRBA 2FUMA 4N57A 2UV2A 4KB8A 5CAOA 2ETKA 3BU6A 5F4NA 2GNGA 3PY0A 1JPAA 3CJFA 3PFYA 1ZRZA 4RQKA 3JYAA 5BQ0A 4E4LA 2VWYA 5AX9A 1WVXA 2F2CB 5EOBA 3QAME 3EN4A 4L42A 3W8QA 3OD6X 4BJJA 1CM8A 1DI8A 1XBCA 2UUEA 2XNGA 3A61A 4IAAA 4R7IA 3W55A 5C26A 4Z7HA 2R2PA 3F82A 4YHJA 3G90X 4CXAA 5A46A 4DDGA 2X8IA 2V55A 4EHVA 1Q62A 4FTNA 3JVRA 3D9VA 3A7JA 2OJFE 4O7NA 5AP3A 3IOPA 3QXOA 4RA5A 4TKSA 4O86A 3OEZA 3UGCA 1BX6A 2B9IA 3HNGA 2OIQA 3CQWA 3R28A 3KA0A 3M42A 3PXKA 4BZNA 3KKVA 2XIXA 5F95A 2CGWA 3FSKA 4XG9A 5EG3A 3VRZA 2R3QA 2KTYA 3WYXA 3PXQA 5EKNA 3F3VA 1H07A 4QMNA 3TG1A 1PKGA 3DLZA 3ZZEA 5DH3A 1W7HA 3AC3A 4TL0A 5CENA 1U59A 1NVQA 5HTCA 3Q4UA 4K33A 2P2HA 2PMLX 3UOHA 5FGKA 3R30A 2DUVA 3GBZA 2YEXA 4AT5A 1P5EA 2YJRA 3I5ZA 5ANDA 4F7NA 3KRXA 2UZOA 2VRXA 3MVLA 3P79A 3HAVA 2HK5A 1GIHA 3FZSA 3LE6A 1E1VA 2GSFA 3PA5A 4OTGA 2JITA 1G8JA 3QGYA 1H08A 4DG0E 4O7LA 3F2NA 2QR7A 2CGVA 4DINA 4IX3A 3WF8A 4EONA 1ND4A 3KIOC 2W5HA 1JLUE 5DE2A 4BICA 1JQHA 3PP0A 2PE2A 3DJ7A 5B7VA 1ZYLA 4BI1A 5JFVA 3LHJA 5L6OA 1QPEA 4R77A 4FTOA 5IQDA 3CCNA 5K9IA 3AD6A 5A4QA 4QDVA 2X7GA 1Q24A 4M67A 3V5WA 3IQ7A 3G9NA 5C8KA 1GZNA 5HICA 1Q3WA 3VHKA 4G5JA 2AUHA 3DPKA 3E5AA 4V01A 3KB7A 1GOLA 2A2AA 3VBTA 3EZVA 2WMQA 2C3KA 2ZB1A 4IZAA 3ZYAA 3EFWA 4FF8A 3PJ8A 4AA4A 4B4LA 2CKQA 3UZRA 2C47A 3COKA 3FV8A 3BE9A 1YWRA 3GOPA 5HTIA 4F1TA 3MFTA 2P2IA 4DT9A 2UZUE 4HCTA 4PTCA 2GHMA 3RM7A 4AN3A 3DKOA 1OBDA 4J98A 4BCGA 4FTLA 1JVPP 4TYIA 3BLQA 3D5XA 4ZLYA 4MEDA 1Z57A 4LRJA 4GIHA 2CLXA 3P23A 3UIBA 3DBQA 3MY5A 5E9EA 1PYXA 4S34A 5EQPA 5IMEA 2GDOA 5EYKA 2WD1A 3TT0A 4AQKA 3PZEA 1H1WA 3D5WA 3WYYA 2DYLA 4BTJA 3CXWA 4AACA 4KKEA 4RJ6A 1UNHA 4TWNA 1Y57A 3I6WA 4IW0A 2OW3A 2NO3A 3C50A 1H00A 3LAUA 3QD2B 4JVGA 3QZFA 4C38A 1GIJA 5I4NA 3ZS5A 3VF8A 4XRLA 2GQGA 3QCXA 2WMXA 2C3LA 3Q53A 1YI6A 3POZA 5KE0A 1Q3DA 2YM4A 3E7OA 3TZMA 3VBYA 4ACMA 3NNVA 2W1ZA 5CYIA 4EK3A 1UKIA 4OTIA 4YO4A 4QYYA 4FG9A 4M15A 3QZIA 2EXEA 3FYJX 5DG5A 4C57A 4C2VA 3HRCA 3H9RA 3TNPC 1H0WA 4XRJA 3EWHA 3ZZWA 3LM0A 4EOIA 3HVCA 4QMTA 5J7BA 1WBWA 3CR0A 1ZZLA 3QA8A 4IE9A 4FT9A 4W4YA 1UNGA 2B53A 4I94A 1XMMA 4QP8A 4O7TA 4LGDA 3FAAA 3UP2A 4RBLA 3B8RA 5IEXA 1R1WA 3BIZA 4TRLA 2VAGA 5HOAA 5GJFA 5JZJA 4ZMFA 2WMVA 5D12A 1FVTA 2BPMA 5JK3A 2YDIA 3QD3A 3PWYA 4LMNA 3NLBA 5AAEA 3U4WA 1JNKA 3OOMA 1NXKA 2HYYA 4A07A 2C6TA 2FO0A 3QHRA 2RGPA 4JDHA 4YZDA 4C4IA 4H3PA 3BWJA 3C13A 4JR3A 4YNEA 4DGOA 4F6SA 4BDBA 4FL2A 4X6QC 4F09A 4G5PA 4RVLA 4WHZA 3F2RA 3PA3A 5B0XA 4PMTA 3G2FA 3ANRA 4BDCA 3NVKI 4FTJA 4L53A 3NW7A 4MX9A 3O5AA 3OBGA 3FQSA 1AGWA 4O7SA 5DFPA 3EHAA 4O1OA 1NW1A 1S9JA 2WEIA 3F6XA 3NGAA 4FNXA 4FTKA 3ITZA 2W06A 2H8HA 3GFWA 3DS6A 4BTMA 3TNQB 4IAZA 3HLLA 5DI1A 3C4WA 1O6YA 1CKPA 3AOXA 2B55A 5T68A 4FGRA 2YM7A 2ZV8A 3KY2A 4EOKA 1M2PA 5F1ZA 3UO4A 4BDEA 3ZLYA 4RIYA 3NYOA 5HG7A 1XBBA 5JMSA 2I7QA 4C3FA 3TV6A 3C5UA 4FL1A 4U79A 3KU2A 4WSQA 4BWPA 3A8WA 4MD8E 2C6IA 3UNZA 4R7BA 4RFMA 2ITUA 2DWBA 5HD7A 5IUIA 4ANNA 2HW6A 3LCSA 4LOPA 5H3QA 3VUKA 4IB3A 4IACA 3F3TA 4FIJA 3OOGA 5E1EA 2LAVA 3VBXA 4F9YA 4HCUA 5JKGA 3MBLA 4JXFA 5M4IA 5GIOE 4YJUA 1GZ8A 1U46A 4FEQA 1M7NA 1YHSA 2IEWA 4PMSA 3PA4A 4QTAA 4XBRA 2YM5A 4FRFA 5AP4A 4EL9A 3G15A 4AAAA 2VTOA 1T46A 4YR8A 2JKMA 3UVPA 4XNEA 4GJ3A 3W2SA 1QL6A 2HOGA 2HZ4A 5CF4A 5IU2A 2GTMA 3MB7A 3R7OA 4QP3A 2I0VA 5AV4A 4IZ5A 3DKGA 2FA2A 2R3PA 4J95A 3FLYA 3P78A 4IQ6A 4GS6A 4XV1A 2XALA 3UO5A 2J0JA 4RRVA 2G2HA 4LQMA 3A60A 4YURA 4X3FA 3TYKA 3UG2A 4ZAUA 2W1IA 4MTAA 3IDCA 1OL6A 3EN7A 4YTIA 3F7ZA 4ITJA 4R78A 3PJ3A 5HD4A 3PG1A 1OL2A 4M14A 2CGXA 2X6EA 4U40A 4FKIA 2BZKB 2YIQA 1R3CA 3DAKA 3KN6A 5I9YA 2J4ZA 4S2ZA 3QL8A 4DGGA 4DEIA 3SW4A 4KNBA 1BL7A 2ZFYA 4DDIA 4J52A 4D9TA 5EFQA 2XAMA 5J79A 1VEBA 4FTRA 5IEVA 5FBOA 4XV2A 4YJVA 1FGIA 2RSVA 3A99A 3VIDA 2QVSE 4WD5A 2QU6A 4GUBA 4QQTA 4ZTMA 4O38A 1TQIA 5IDNA 3ZLSA 3D2IA 4I6HA 3KRRA 3S3IA 3DT1A 5M4CA 2VTHA 4CQGA 3HV6A 4J1RA 4A06A 1Q4LA 4V05A 3CGOA 3FUPA 3BGZA 4DEGA 4DH5A 4DC2A 1NY3A 4WO5A 3FKOA 5L8JA 4FEWA 3W2QA 3UE4A 1PXKA 2GFSA 5L2QA 4DEDA 1SVHA 2WTKB 4RVKA 3DBEA 4LI5A 1XH5A 3FKLA 4ERWA 3KF7A 4LUEA 4WOVA 3QTIA 1GJOA 2Q0BA 3GC7A 3TIZA 1JKTA 1YOJA 1JAMA 4LV7A 1KE6A 4NSTA 5AUWA 1AD5A 3ENMA 3HMMA 4FUYA 1RJBA 1YOMA 4FKVA 5IH5A 1IA9A 1UU3A 2QURA 4XP3A 3V8WA 4F7JA 2VTNA 4MCVA 1ZYJA 3OWKA 4FSTA 4BJJB 2YCQA 2OJJA 2H96A 1YVJA 1U54B 4Y72A 4K18A 5EK7A 3HP5A 4U43A 4YTFA 5M4UA 3W18A 3MJ1A 4XMOA 1ZOHA 3VQHA 4GW8A 3A8XA 3ORKA 2YDJA 3CQEA 4XG3A 3THBA 4D2TA 4I6QA 4EKLA 3RINA 4N70A 3NNWA 1A9UA 4IWOA 4IWQA 4MWIA 5F94A 3VWAA 2I0EA 4D1SA 1J3HA 3PP1A 4QMYA 3U9CA 3COIA 1S9IA 3QWJA 3QTXA 4K6ZA 1U5QA 3MY0A 4FL3A 2PE0A 2QCSA 3ODYX 4JBOA 3R8PA 3TJDA 3UIMA 1SZMA 2XA4A 3BCEA 3L9LA 4M84A 4QP4A 2XYUA 4TTHB 2NYAA 4U8ZA 3VJOA 4AT3A 4QO9A 3PY1A 4LMUA 2BTRA 1FVVA 2NNWB 2XK8A 4B8MA 3A7GA 4E4XA 1K9AA 4AU8A 1QPCA 2GS2A 4IANA 3SDJA 2ZMDA 3G51A 4UV0A 4B99A 1KOAA 3QBNA 3JVSA 4ZXTA 3W10A 4BCMA 4PPCA 1TKIA 5LMKC 4BL1A 4CLJA 4BIBA 3E87A 4FIGA 4XYFA 1HOWA 5A9UA 3AC5A 4CVAA 2XYNA 3IW8A 4X2NA 5L2WA 4FZAB 4DF3A