2EUFB

X-ray structure of human cdk6-vcyclin in complex with the inhibitor pd0332991
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
296
structure length
282
Chain Sequence
DQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIREVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTETIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVVVTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGEEDWPAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYSALSHPYFQDLER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle/transferase
molecule keywords viral Cyclin
publication title Toward understanding the structural basis of cyclin-dependent kinase 6 specific inhibition.
pubmed doi rcsb
source organism Herpesvirus saimiri (strain 11)
total genus 69
structure length 282
sequence length 296
ec nomenclature ec 2.7.11.22: Cyclin-dependent kinase.
pdb deposition date 2005-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2eufB02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2eufB01
4NEUA 2HW7A 3E7OA 2OKRA 3OCGA 4LI5A 5I5ZA 5EW8A 4IZ7A 3DKGA 3F9NA 5GHVA 4ANLA 5HX8A 3AXWA 4WBOA 4X3FC 4F7JA 3R6XA 2ZYBA 4MVFA 3RPOA 1XBCA 3BGQA 2JIVA 4HCUA 4Y5QA 4JX7A 2R3IA 3VW8A 3VWAA 2NP8A 4CXAA 2QKRA 5F94A 3V8TA 1YHVA 2Y4IB 1DAYA 3OEZA 5IQEA 4ONAA 4IEBA 3G51A 3MYGA 3MVMA 5EHOA 2UZUE 4PTEA 3BU5A 5IQFA 1PMUA 4FZFB 2XS0A 4OTHA 4CFWA 1LUFA 4NU1A 3RM6A 3GI3A 2QLQA 2VTMA 3V8SA 4Z7GA 3R1YA 3QUEA 2O0UA 3VJNA 3FHRA 5JGBA 2BTSA 2J0JA 3NCGA 4U3ZA 4DFYA 4H3PA 2ZDUA 1GJOA 2X2MA 1Q8WA 4C62A 4G16A 3QRTA 5IDNA 3Q9XA 2W96B 1BI8A 5AR8A 2OXDA 4U3YA 5HVJA 3BV2A 4KBAA 5JT2A 5E90A 4EH4A 4WKQA 4I92A 3ORIA 2PULA 4KWPA 4ZEGA 4F7SA 5AX3A 5CAUA 5KNJA 1XBBA 4L3PA 2ACXA 4MBIA 5HCZA 4MNFA 2C5NA 2PE1A 3LJ0A 3UZPA 5DRBA 3FMLA 2PMOX 4BWKA 4YTCA 1ERKA 3SW7A 4I0SA 3ALNA 4TW9A 2F7XE 4FTTA 4BBFA 3BU6A 4CFMA 5DGZA 4M14A 5I3OA 4GYGA 4AW5A 2E9NA 4I94A 5E8SA 3NVMB 4E93A 1FOTA 3FZ1A 5KMKA 4QP9A 4YMJA 3NUYA 3TIYA 4DBNA 3DBCA 3NCZA 2J9MA 4MQ2A 3VBTA 3U4WA 3WBLA 3ZRMA 4FT9A 3ZZEA 2YM7A 3ETAA 1ZLTA 4HGSA 4BCOA 4X7QA 2UVZA 4IVDA 2BTRA 4JQ8A 3ZC6A 4A9UA 3DXQA 4Y5HA 2PWLA 2UUEA 4FKIA 3LAUA 1S9JA 4A9TA 3LFFA 4O81A 4H05A 2C6EA 3D0EA 1PXNA 3JVSA 3I81A 4XYFA 3SG9A 2WO6A 4J71A 4E6CA 3FI2A 4RLLA 4QMMA 4DFNA 3OWLA 5L4QA 4R8QA 2WMQA 1PXOA 4JBQA 3MN3A 2BAJA 1YQJA 4FV2A 3FBVA 1FVRA 3VS7A 4DHFA 2YCSA 1UNHA 2FSLX 4OTDA 4R7IA 1WBSA 3FLZA 3DOGA 4ZP5A 4B8LA 4BCKA 4YU2A 3BYMA 5IZFA 3WIGA 2XCKA 4O0SA 1H01A 2WMBA 3QF9A 2WMAA 3LE6A 4EK6A 4TWPA 5A4TA 3UIUA 4DCAA 3DZOA 5DN3A 2Y6OA 2BROA 1IR3A 1NXKA 4I0RA 2NNWB 5EQYA 5FXQA 4BBEA 5TT7A 2B53A 3FMEA 1JKTA 4YJOA 5G6VA 4EH9A 3R21A 1HCLA 4APPA 3R7YA 2BALA 2PZYA 3O17A 3Q04A 4V04A 2HZNA 3KXHA 4ZXTA 2Y4PA 3NUPA 3Q9ZA 4O6EA 3H9FA 2Y7JA 4AA4A 1CKIA 4USFA 3FUPA 4D2TA 3QUPA 3UVRA 3ZEPA 3A4PA 3JY9A 1V1KA 1ZMUA 3Q3BA 3VS4A 5LMKA 3NX8A 4YJNA 2PMLX 5FRIA 4U9AA 5K0KA 5IH5A 4MD9E 4I5PA 2REIA 1BKXA 2J4ZA 3F3VA 4GS6A 2X2KA 5EHLA 4AOTA 2IN6A 1JKKA 2RFDA 4EK4A 1IA8A 3Q4ZA 2FO0A 4YZNA 2JAVA 2RG5A 3CS9A 3HUCA 4NM7A 5TOZA 2W05A 2PSQA 3BYVA 3K5UA 3DK6A 4RJ5A 4XLIA 5GNKA 3VUHA 3TIZA 3ZYAA 4OLIA 4XBRA 3NNVA 3IDCA 3W16A 5CALA 4RX8A 3ID6C 4W9WA 2QU5A 1QPCA 4C3FA 3F7ZA 4BCIA 4DYMA 4Z55A 3LFSA 2FA2A 5CEIA 2JD5A 5FEEA 3Q2JA 2C6DA 3GCQA 2QODA 3DGKA 3QZHA 2QC6A 5HE0A 3V5TA 5FEDA 4BKZA 2WHBA 2OK1A 3OUKA 4PF4A 3UP2A 2GFSA 3VUTA 4BDKA 3RTPA 4U97A 5LCJA 4M97A 2VTRA 2QCSA 3HL7A 3FZTA 4M13A 4IM2A 4FKWA 4C8BA 4H1MA 3EN9A 2WMWA 3I7BA 3PXRA 2V62A 3VS5A 2XBAA 4B9DA 4ZMEA 2BHEA 3QALE 5BVNA 2OJJA 3BEGA 1PXPA 1G3NA 2YCRA 4QPSA 4EQMA 3N4VA 1URCA 2XIKA 4UEUA 4CZYB 5BYYA 2X81A 3FI4A 4HYSA 3VN9A 2DUVA 4D5KA 5IA3A 1NA7A 4OBOA 3PJ2A 5TKDA 1MRYA 2UZTA 4GK4A 3FMMA 1CTPE 2HYYA 4W4VA 1FPUA 4BCQA 3HMMA 3CY3A 5AP6A 4KA3A 3BKBA 3GT8A 1H8FA 2R3JA 1OUYA 4P5QA 3PRIA 3W8QA 3H10A 3G6HA 3MPAA 5CAVA 4I24A 4L7FA 4K77A 4ASDA 3F61A 5AA9A 1KUTA 1U4DA 4TZRA 4A9RA 3WZDA 4JG7A 2UW5A 4ANOA 2H6DA 5HQ0A 4GK3A 4USEA 3ITZA 4DFUA 2GFCA 3RI1A 4GT3A 1OVEA 2FSOX 3ZEWA 4MCVA 3AC5A 2YLFA 4RG0A 5E92A 2R3LA 5F95A 2W99B 4E4LA 3HMPA 1YHSA 4DTBA 1Q99A 2VTAA 3RM7A 4HZRA 1E9HA 4N57A 2X2LA 2VGPA 5EW3A 4C59A 4ZTLA 2PU8A 2IW8A 5CF4A 2J7TA 3C1XA 3N4UA 3EYGA 1PXLA 3E88A 3MVJA 4RWJA 3V51A 4AZEA 5JGDA 3D7ZA 3AMAA 3BLRA 4P90A 2QVSE 5DR6A 4FV8A 2OLCA 1H07A 1UU9A 2O64A 2IVTA 2OZOA 5HGIA 3RAHA 1GY3A 1O6KA 2IVUA 5AIRA 1ZOGA 2WNTA 3U8WA 5AAGA 4PMPA 3KGAA 3VRYA 3LM5A 2QNJA 2VRXA 3EN4A 4EZ7A 3HVCA 2XP2A 1UNGA 2AC5A 5DE2A 3C51A 3IDBA 2XK9A 3QHRA 2WD1A 5J7HA 4P4CA 1CM8A 5LWNA 2HK5A 3QLGA 4QOXA 2XJ2A 3NEWA 4B4LA 4NUSA 5JRQA 1YXUA 5HO7A 3OCTA 4V01A 5IA5A 4FIJA 4O82A 5AP3A 4ACGA 5ANOA 1XH6A 3OVVA 4N70A 4PUZA 5E9EA 1M14A 1F5QA 4TNDA 1PYEA 3OOGA 5T3QA 4FOCA 4YP8A 3U6HA 3Q60A 4NIFB 2OFVA 3ZO4A 4F1OA 2UZEA 3ORMA 4WRSA 5AP1A 1OM1A 3MIYA 5AX9A 4TPTA 3PA4A 4K33A 3KB7A 3FQHA 2WQOA 2H9VA 4X2KA 4EOKA 3P4KA 3C50A 4U41A 4X2NA 2XNOA 2YDJA 4IAZA 5IUHA 3WF8A 4BTMA 3OC1A 2W4OA 5IA2A 1SVHA 3UIMA 2JEDA 2IO6A 2CGUA 4G6OA 5AP4A 3LQ5A 3BE2A 1O6LA 4J8MA 4HVSA 5KUPA 2V55A 5M57A 1SM2A 3QKMA 2QO9A 2W4JA 2NRUA 3NYOA 2X4FA 3QFVA 1JVPP 1AD5A 2ETMA 4FNZA 1H08A 4FTCA 3IKAA 3CTJA 4HVIA 4EOLA 4QMWA 3ORNA 2G15A 2ITQA 1APME 3U51A 4E1ZA 3L8SA 4YUQA 3FSFA 3C13A 3NYVA 4QP4A 4J1RA 4FKQA 4RJ3A 3LVPA 3DPKA 5CTPA 2GTMA 3OBGA 3LLAA 2W1HA 3BGPA 2BCJA 2C6KA 3OZ6A 1V0BA 4ZY6A 4FEWA 2WQMA 3MA6A 1QPDA 4ZY5A 5K5NA 3EFKA 2ZV2A 4A4OA 4D2SA 3LMHA 1R0PA 4QQTA 4CT2A 5E8XA 4DEAA 5DT0A 4JDHA 5CENA 3FC2A 5HX6A 1PMVA 2FSTX 5IQIA 4FT5A 1SNXA 2EXMA 3R9HA 4BTKA 3QQLA 4FV7A 4NWMA 4NT4A 3NRMA 4QTDA 3LPBA 3AC4A 5LXMA 4E4XA 3W32A 3LLTA 2VTSA 5DRDA 4JRVA 3REPA 3NUAA 4EOQA 3I6UA 3PZHA 3UMXA 4TT7A 5AUVA 3FKLA 2R3FA 4O27B 2XK8A 4L00A 2XKDA 3LXLA 3W18A 1M7QA 4EH5A 3W10A 2YIXA 4IC7A 4XOYA 4QP3A 2A2AA 3V5QA 3SLSA 5ICPA 4GMYA 1H1QA 4GFMA 4M66A 2WFYA 3NAYA 3TUDA 3O7LB 4AWIA 4QPAA 4XV9A 3VUGA 4O0RA 3FQSA 4O1OA 5AR7A 3SAYA 4ZK5A 1URWA 4YJRA 1CDKA 3BYSA 3VS0A 2VTTA 5AR3A 4GL9A 3VVHA 4ZLZA 3CR0A 4XP0A 1ZXEA 5CF5A 1I09A 5I9XA 2XM9A 3A7FA 2ESMA 2WIPA 2BDFA 4IMYA 4UV0A 4L42A 1W83A 2OZAB 4AT3A 4BHNA 4BIDA 5LMAA 4F0FA 3D83A 3V5LA 5L2IA 3C0IA 3MS9A 3LKMA 3R28A 2V7OA 4ANNA 1IAHA 5BVWA 2JDVA 4I3ZA 4J98A 5B2MA 4UYAA 5A54A 4QYGA 3ERKA 5AP2A 4ZZOA 4AGDA 3WF7A 4K18A 1YWNA 4C2WA 3ZO2A 3AMYA 3FMHA 4BHZA 1OUKA 3A8XA 3QTRA 4CKRA 4F63A 4WSYA 4O38A 4XV1A 3PJ8A 5IEXA 2QHNA 2ZAZA 3GFWA 2C6TA 3QD2B 4D9UA 1Q8ZA 2OZAA 3DTCA 3GUBA 4RZVA 2CDZA 3P5KA 5BYZA 4BYJA 2GS6A 5CLPA 3MPMA 3DU8A 2O63A 1PKGA 3WOWA 4E6QA 4DGLC 4BWXA 3D14A 4USDA 5K3YA 1H1RA 1FGIA 4O0UA 5I3RA 2QOBA 1Y57A 5DT3A 2WPAA 3TWJA 4O7VA 2CN8A 5JMSA 4UWCA 4H1JA 3UVQA 3F6XA 4TYEA 5HESA 3V6RA 4DGOA 2B0QA 4PPCA 4O1PA 2CN5A 2OIBA 2VTQA 3LFCA 4HCVA 4J52A 4JLCA 4C38A 2ITVA 4IBMA 3IO7A 1MRVA 4KIKA 3NAXA 4NTSA 4IZAA 4XS2A 4ZOGA 3RBWA 2V5QA 1J91A 3MW1A 4I22A 3UIXA 5IH6A 3BRBA 3FLNC 1K2PA 3UP7A 4IE9A 1OZ1A 5CVHA 5D41A 4FEQA 3GU8A 3PXYA 3D2IA 4K8AA 1FINA 3BE9A 5B0XA 4BTJA 4E26A 3MVLA 1GZOA 4FKLA 3ZMMA 5JQ5A 4E5AX 4RWKA 3W55A 2NRYA 1OMWA 2YERA 4EK3A 3OCSA 5EDRA 3C4FA 4ZY4A 4KAOA 4CNHA 1PMEA 2VO0A 4JIKA 4FIHA 4IANA 3ZSIA 3KF7A 4DFXE 4M68A 3PPKA 4MD7E 2CKQA 1YRPA 2UZBA 3BPRA 4FMQA 5DHJA 2VTOA 5EM5A 4AT5A 4PQNA 3TNPC 5CU2A 2PVJA 3QC9A 4M15A 5CASA 4FVPA 3A2CA 4AG8A 4C33A 5CWZA 4G1WA 4EH2A 5L8JA 4IB1A 1M2RA 3D7TB 4RIYB 4FSMA 5EHYA 4QP8A 1R3CA 4IAFA 4Q5EA 4EOIA 5BPYA 3ZHPC 2QO7A 3CQWA 5KBRA 3ZH8A 3V5WA 1KE7A 3LMIA 3A7JA 1Y91A 4TYJA 4L44A 4IXPA 4OBPA 1KWPA 3K3IA 4C02A 4C36A 5I9UA 3UQGA 3H0YA 3ORLA 4KIQA 2X7OA 4AFJA 2JC6A 4DLJA 4I4EA 3VBYA 5K5XA 2JKMA 3HV3A 4Z16A 4BGQA 3P7AA 3HZTA 2LGCA 4KKGA 3MJ1A 4NK9A 2XK6A 4C34A 5HORA 3CC6A 3SGCA 4ERWA 3FAAA 5EYMA 3D7TA 4FF8A 3BYUA 4RIYA 5EKOA 3TV4A 4ANQA 4DG0E 4K9YA 4D28A 1ZYCA 4HZSA 4J8NA 3NR9A 5M55A 2GQSA 2UW3A 2PTKA 3EQPA 5AR5A 2PE0A 5ACBC 4I5CA 3SA0A 5FXSA 1XO2B 3R8LA 5DMZA 4GKIA 2C6MA 5LCKA 3NPCA 3RKBA 4YLLA 4U0IA 1Q3DA 2WGJA 4PDOA 2CNQA 3E3PA 5L2TA 5J9LA 3ZUVA 5EKNA 2CPKE 2V0DA 3DDQA 3EB0A 4R5YA 4X3JA 5H9BA 4BR3A 4TWOA 3FXWA 5CU3A 4AZWA 1ZYJA 4YURA 2ITNA 3UOKA 2BRMA 2J5FA 3WZUA 1XWSA 1FVVA 3G5DA 4YNOA 2YISA 3E92A 4RX7A 5ACKA 4FI1A 3CTHA 3MFUA 2YJSA 2YIQA 4FTNA 4IVAA 5KCVA 2CCIA 3T3VA 2R64A 2F9GA 3B2WA 4EKKA 3OROA 3R8PA 4CT1A 3EQRA 4XHKB 4E4NA 3AGLA 3NUNA 1A48A 4LM5A 3ZSHA 2J0LA 4O0YA 2B55A 2HXLA 2J2IB 2ZV9A 3PVWA 2OF4A 4X2GA 3ANRA 3ENHA 4YJTA 4ZTRA 1HCKA 3NIZA 3QKLA 3RNYA 2Z02A 1XH8A 4CFVA 2WEVA 4BI0A 1MQBA 3Q4UA 4OTGA 3ULZA 3OCBA 3V3VA 3V01A 3UBDA 1YW2A 1YI4A 5L3AA 4XBUA 2BR1A 4U42A 4WT6A 4AE9A 1H4LA 3ZOSA 4CTCA 4MF1A 3KULB 4QMLA 2WKMA 4FTIA 1XH4A 4JIAA 4FTQA 2OJGA 5HTIA 4BZOA 1TKIA 4H58A 4NKSA 4K1BA 4ITIA 3P23A 5HI2A 1W7HA 1V0PA 4O0VA 4UXLA 4RIOA 2YDKA 2WTWA 3D5VA 3SW4A 3MB6A 3BIZA 3RMFA 4DEIA 4LOQA 2PPQA 4GEOA 4EH7A 3CTQA 3QQJA 4GG7A 4HPUE 4EH8A 2VTHA 4BZDA 3OWJA 4TN6A 1W0XC 3U87A 3GC8A 3QYZA 1OPKA 3MPTA 4M3QA 4Y85A 4I23A 4AN9A 5HVKA 3KULA 1K3AA 2W9FB 3RHKA 1ZZLA 3F5UA 4AP7A 4F1MA 3KKVA 1R1WA 3W2OA 5IF1A 1A9UA 5DYJA 5AR2A 1Q97A 2XIZA 4FTOA 2BILB 4GG5A 2YWPA 4I6BA 3L8XA 5HG7A 5AAEA 3OW4A 3ORKA 4JDIA 3EJ1A 3NIEA 2QLUA 2Y9QA 2J0IA 4V05A 3TKHA 1PJKA 2HXQA 4II5A 3RK9A 2X6EA 4AGCA 2R5TA 5JFVA 1OBGA 1PRYA 3EYHA 1JAMA 4L45A 5C03A 2JDSA 3PA5A 2WIHA 2BPMA 3R9OA 5I0BA 1Y8YA 4BIEA 1H1WA 3DBQA 2ITTA 3RJCA 3UG1A 3KCFA 4QT1A 3LHJA 3DAKA 3I7CA 2IZTA 2VNYA 3KK8A 3R7VA 3LFDA 4PNKA 3M1SA 4BKJA 4HJOA 5IA0A 4BI1A 1UVRA 4FV6A 2FSMX 2RSVA 2ZM4A 3LM0A 2RKUA 5HNBA 3L9PA 5DVRA 4IAYA 1WCCA 4EQCA 4UN0C 4FIIA 5DH3A 1OKZA 4HPTE 1K9AA 5AIKA 3R9DA 3D4QA 4WNPA 5HG9A 5CXHA 3EKNA 4IFCA 4R3CA 3BHHA 3HMNA 5KE0A 4E20A 4IJ9A 4PMMA 4EJNA 4L67A 5CSPA 3I5ZA 5M4IA 5FBOA 3UDBA 3ZZWA 3IW4A 4BCGA 3CBLA 3OP5A 3HRBA 2C3LA 3UZTA 5KKRC 2PVLA 3VHEA 3LZBA 1H25A 5HLNA 3O71A 2QOCA 4G3CA 4Q5HA 2J50A 3K54A 5ETCA 1DI9A 4CQEA 4EC8A 4HOKA 3PSDA 4WUNA 2R2PA 2GSFA 4AFEA 2Z60A 2GNFA 3ORTA 3KRJA 4Y8DA 3GXLA 3E87A 3FHIA 3PXQA 1WFCA 2BFYA 5EH0A 5HICA 1I44A 2PVKA 3W2PA 1PYXA 2BIKB 1MUOA 2UW6A 5C27A 1REJA 3EWHA 3F66A 2YACA 1OL1A 5HE1A 4WBBB 3NYNA 3PXZA 5DNRA 4YHJA 1P5EA 4UBAA 4WNOA 2R7IA 3PVGA 2RIOA 2IZSA 4C58A 4DAWA 3OHTA 4UZHA 1Z57A 3CE3A 4CCUA 4AN3A 4Q9ZA 2UZLA 5AFVA 1JSUA 2GTNA 4ZSJA 4FYOA 3HP2A 4YZBA 5ETFA 4MBLA 4CYJA 3F88A 4FSZA 4QMPA 2LAVA 3RAWA 3UODA 3I6WA 4FG9A 2VD5A 4UWBA 4EHZA 5TR6A 2JDRA 2BRGA 3CCNA 2ZB1A 3PE2A 4RJ6A 2J90A 3I79A 4XEYA 4EC9A 2Z2WA 4I6QA 4MXOA 5CY3A 4AF3A 3R9NA 3PY3A 2YAAA 4WG3A 3NNWA 5KZ0A 2XRWA 3KXGA 3U4UA 2Q83A 4MX9A 3RPSA 5A9UA 5AJQA 3S3IA 1H0WA 1VEBA 4RC2A 5AP0A 4EH3A 3QA0A 1PXIA 2XEZA 1QMZA 3P79A 4U44A 2C0TA 4MXYA 2IJMA 5AP7A 4J97A 2Z7RA 3G9NA 2RGPA 4DTKA 3UYTA 2EWAA 4QTAA 5CQWA 1Q8YA 2E9OA 3KMMA 3MTFA 1STCE 1O9UA 4MQ1A 4F7LA 4XG4A 2XK4A 2HIWA 2W5AA 4PDSA 3MVHA 3BV3A 3MV5A 4MXAA 3UOJA 3JXWA 3RPYA 3FZRA 3POZA 3R9RA 3MTLA 3O2MA 3W8LA 5DWRA 1R78A 2JAMA 3LCDA 3TTIA 2WTKB 4QMTA 4RA5A 2VWXA 3IS5A 4RWLA 5K4IA 3M2WA 3KY2A 4G3GA 5AWMA 4BRXA 4ZS4A 3KN5A 4GVAA 3DJ5A 4FKJA 3E3BX 3NYXA 2ONLC 3MH0A 4A9SA 3R1NA 1KOBA 1BUHA 3VUKA 5JH6A 1WVYA 4LUDA 4XRLA 1G5SA 3CQEA 3ZXZA 2VWZA 2BZJA 2G2HA 2C3KA 2GDOA 1JLUE 4X2FA 4MHAA 2SRCA 3MI9A 1JPAA 5HIDA 2E9PA 1JBPE 4ANSA 5KMIA 5FP6A 2OGVA 3FY0A 3QKKA 4QQ5A 3UYSA 2NPQA 4UWYA 3P86A 5A6OA 3ZM9A 2XJ0A 4PX6A 3DV3A 2ZM3A 4H36A 3R7OA 3PY0A 3PVUA 1UWHA 3Q4CA 4RVTA 1S9IA 1Q24A 2IWIA 4FV0A 4XG9A 3R8VA 4FVRA 4CRSA 4EK8A 3QZIA 3HA8A 4AA5A 5AA8A 2CCHA 2JKOA 4TNBA 1RDQE 2FUMA 2P3GX 3HP5A 5DT4A 5I9YA 1ZY4A 4DCEA 3DAEA 3U54A 2VV9A 3DKFA 1IASA 3F5PA 4RLKA 2W9ZB 3BWFA 3U6IA 2VX1A 4ARKA 4Q2AA 3MBLA 4M12A 4O7LA 2XRUA 3PLSA 4F6SA 5JFSA 2G01A 4LL0A 5CX9A 2F2UA 4N6YA 2UZWE 4BN1A 2I0HA 3FL5A 4G9CA 4O2ZA 2R3NA 4YO6A 5T68A 3I5NA 5I4NA 3PLAE 3FZOA 3BHYA 5BMSA 2VO6A 3C4CA 4IW0A 3WIKA 2X8EA 2JBOA 2XK3A 3RK7A 2JLDA 3QRIA 4GUEA 2BKZA 5CU6A 5EOBA 4OR5A 3IW8A 5CI6A 2GNGA 2XNMA 4NM5A 2ITPA 2XA4A 4PPBA 4EOPA 2FGIA 2R3OA 4GCJA 5FDPA 3EH9A 4LOOA 4ASEA 2CKPA 3VAPA 5HD7A 3ZXTA 3G15A 3SOAA 5AP5A 4MTAA 1U5QA 2IZRA 4ZTMA 3MFRA 4R77A 2VU3A 3GP0A 4BDAA 1BX6A 2C5VA 4XUFA 4XNEA 2XB7A 3GQIA 3H30A 3ZFYA 1OITA 4JR7A 4EYJA 2UV2A 2RF9A 4RVMA 3VULA 5DEWA 2PUIA 3VC4A 4O83A 3DZQA 4JBPA 3FWQA 3FZSA 4JS8A 3DCVA 3BWJA 3CJGA 4AZFA 3QBNA 3PZEA 4QP6A 4CLIA 2I40A 4C37A 5FUTA 4I5MA 3S2PA 5E8YA 4IZ5A 4MWIA 4B0GA 3ZS5A 3DDPA 3R8MA 3KF4A 5LVOA 2YITA 2OF2A 5BUIA 2RFNA 2CGXA 2RL5A 3IQ7A 1XJDA 1M52A 1OL6A 1XH9A 5L6WL 4OAVB 4C4EA 1DAWA 2I1MA 5FLFA 5CU0A 4FBXA 3T3UA 5GJFA 1Y8GA 4YZCA 2YLEA 3UPXA 5B2KA 4PV0A 3OW3A 4L01A 4WG4A 3EL8A 4DG2E 4MD8E 4YPSA 5M07A 2QURA 5LJJA 2OBJA 2Z8CA 2GNJA 2OJFE 4XG3A 2YHVA 2YM6A 4I6HA 4DINA 2C4GA 3LXNA 3ALOA 5CU4A 5A4QA 5IA4A 2XKFA 3RINA 4L8MA 3E93A 2H96A 4KNBA 4DEHA 4CLJA 4X6QC 5M44A 3TZ9A 2PK9A 3QQHA 4DG3E 3E8EA 5HTCA 3PRFA 1OKYA 1QPJA 4M7IA 3T9TA 3LIJA 4G3EA 2UVXA 3DFAA 2J51A 4GU9A 5JEBA 3UQCA 5H3QA 3UPZA 3LXKA 1J3HA 4M69B 2W5BA 2OH0E 1J1CA 2WZJA 3D5XA 4OBQA 4OTFA 4JI9A 5HNGA 1G8SA 4IX3A 3TZMA 3CXWA 3PTGA 4O7RA 3VBWA 3R7EA 2HZ4A 4GJ3A 5E8VA 4C7TA 3NZ0A 2R3HA 4GYIA 4J95A 1B39A 3K3JA 2VUWA 3OOMA 4EOJA 5M56A 2YABA 2E9VA 3KRRA 4G2FA 4A06A 4EH6A 4QMXA 3E62A 3UO5A 1Q8TA 3M42A 3R00A 3DBFA 5KHWA 4M69A 4AXAA 4RRVA 3KCKA 4MNEB 3QQKA 5ANDA 4RQKA 4ALVA 5HG5A 3WE4A 1W82A 4K2RA 4QRCA 1ZYDA 3NLBA 4AOIA 3TL8A 2GQGA 3KMUA 2XVDA 3BELA 3RAKA 3QTSA 3GEQA 2IZUA 2JDOA 4G5JA 2YCFA 3QD3A 4RX9A 3RAIA 2YJRA 4B8MA 1VYZA 1W98A 2B9IA 2YM3A 3AG9A 4L3JA 5HO8A 1OKWA 4G6NA 3LOKA 2VWVA 5DEYA 5CANA 4MNEA 4L68A 3ZCLA 2ZB0A 4IFGA 5AV2A 5BVEA 2CKOA 3CKXA 2WMXA 1KE6A 4AZTA 5C8NA 1YDTE 3MWUA 5CEKA 3W2RA 3DLSA 2XNGA 3LCOA 4BTFA 1WAKA 3DKCA 4U6RA 3G6GA 3PPZA 4I21A 5KMOA 3PJ3A 2FH9A 3DTWA 1P4OA 3HGKA 3PY1A 4DT9A 4C35A 2ZM1A 3JPVA 3BX5A 4AX8A 5EM6A 5E7RA 3TI1A 4R78A 4NCTC 3CIKA 4W4WA 3AMBA 3CJFA 4QYEA 1P2AA 2BAKA 1PHKA 2HZIA 4PWNA 4OTQA 4F9CA 3WARA 4DGGA 5CNOA 3JUHA 3DS6A 4FL1A 3QZGA 3DK7A 4YZMA 2EU9A 3PIZA 2B52A 4Z3VA 4NW5A 3JY0A 3HV7A 4W8DA 2PL0A 3A60A 5A4EA 3TUBA 2W5HA 2IW6A 2B1PA 2X8IA 4I0TA 4KABA 5J5SA 4CCBA 3TG1A 5I9VA 4CKIA 4U7ZA 2DYLA 3EMGA 5FDXA 2IVVA 4ID7A 2XNNA 4A9YA 2ZV8A 4QP2A 3SVVA 3GGFA 3RNIA 4J7BA 3PYYA 2X7GA 4YC3A 2BKKA 4DC2A 4E73A 3AC8A 1E1XA 1JQHA 4KIPA 3I1AA 3PIYA 5JK3A 5AR4A 3TNHA 3RHXA 4YJQA 1H28A 3OEFX 3KEXA 5HBHA 4H3BA 3FXXA 1TVOA 5DOSA 3FI3A 4FR4A 3VW6A 4DEBA 5CAPA 3CD8A 4FYNA 4CZUA 3HAVA 3VBQA 4BGHA 3LQ8A 3SV0A 3F5GA 2XF0A 4X3FA 3ORPA 4XG8A 3WILA 5DR2A 3QRJA 3WI6A 2VTJA 4BC6A 2W17A 2YFXA 3E8NA 3GU6A 3ELJA 5EI2A 3A8WA 2WTVA 4FTAA 3W1FA 3QTWA 4RJ4A 3FEGA 3QTUA 2JFLA 4IB3A 5M06A 3EN5A 3HA6A 4GSBA 1GZKA 3OT3A 4FODA 4G6LA 5AMNA 2PE2A 4F0GA 3CPBA 1H24A 3NDMA 3WYYA 4EUTA 4ITHA 3ZLXA 5LMBA 3P1AA 4XP2A 4AGWA 4E3CA 2GPHA 5CSHA 1M2QA 2YDIA 3FSKA 3JVRA 3KC3A 4K0YA 3R7UA 5IEVA 4F9WA 4FIEA 3PFQA 4DF3A 4ZMFA 2ITYA 3ENMA 5IH4A 1Q4LA 5L6PA 4NM3A 2HAKA 4I1ZA 3VUIA 1YOJA 3VIDA 3VJOA 3QRKA 3FKNA 3AD5A 4FTUA 2QOIA 4OT6A 4ALWA 4X0MA 3SKCA 4DITA 4FUXA 4OT5A 2P2IA 5F4NA 1GIIA 2Y4IC 1CKPA 3DQXA 4L46A 3QQGA 4GW8A 2WQEA 3DT1A 4J99A 1JKSA 5CXZA 3B8QA 4QTBA 3GB2A 5E91A 4DH5A 3WE8A 4UZDA 4ZSGA 1FMKA 3PWDA 3VQHA 5AEPA 3AC1A 2YWVA 5J87A 4OGRA 3VBXA 4EZ3A 3UZRA 3QL8A 4NSTA 5J1WA 2P55A 4MAOA 4RC4A 4RVLA 5M09A 5CT7A 3PWYA 1SYKA 4PNIA 2GHGA 3ACKA 4ACDA 2PZ5A 1RJBA 3OWPA 4YJUA 1LEWA 2BRHA 3GC0A 4C2VA 4IDTA 4A4LA 5CQUA 2XIYA 2B7AA 2CNVA 3LMGA 3QTIA 3QCYA 5D7AA 4J96A 4O2PA 2W4KA 3JYAA 3DAJA 2Z7SA 2B9FA 4Y83A 3PG1A 4EOOA 3COKA 3LXPA 4MF0A 2GNLA 1OB3A 3TV6A 4IM3A 5AV3A 4U5JA 4NM0A 4KIKB 2HWOA 2JGZA 4D1SA 1LP4A 2J5EA 2F49A 4RA4A 5TF9A 2YIRA 2YZAA 5E8UA 4XJ0A 3SRVB 4CYIA 5J5TA 3Q5IA 4QYHA 4C57A 3ZM4A 4R6VA 5C01A 3KL8A 1RW8A 3DXPA 4K6ZA 2YM4A 3MDYA 1YOLA 3NW6A 3JS2A 1XKKA 4F1TA 1GOLA 4O7NA 4UYNA 2XBJA 1WZYA 1WBTA 4ZTNA 4BVUA 3R8UA 4EONA 3N4TA 4BDDA 4LV8A 3NGAA 4FG8A 3LFQA 1PXKA 4R7BA 5AV4A 5HCXA 2W1IA 3SRVA 1OL7A 1U5RA 1ZYSA 4PPAA 4ENXA 4ZZNA 2OFUA 3PVBA 5IU2A 5M4UA 4KD1A 1JSVA 3VUDA 5F20A 3L9NA 4K11A 2B9HA 2R7BA 5AUTA 5B7VA 3KVWA 3CGFA 4WUAA 3F2RA 4NW6A 4A7CA 2WTDA 1SNUA 4GK2A 3TN8A 3QX4A 3GC7A 5A3XA 3UTOA 3LCKA 3FPMA 4FSWA 2BUJA 3TDWA 4CZTA 4XLVA 2O5KA 2OU7A 4KKHA 5KBQA 5D1JA 2CGVA 2CLXA 3I4BA 5KZIA 3DQWA 4A4XA 5LMKC 4FKPA 4IX5A 3R1SA 2GMXA 4Z7HA 3O8TA 3S1HA 1KE9A 4YTIA 4XP3A 3H4JA 3QRUA 3ZONA 4ACHA 2BAQA 5FTQA 2BIYA 5HIEA 3LCTA 4DBXA 4R1YA 3LW0A 4LGGA 5K9IA 3IOPA 4LL5A 3SXSA 3C4EA 2PUUA 2OO8X 3D9VA 3R2BA 1U54B 4QYFA 3UC4A 3VQUA 2QKWB 3EZRA 4IWOA 4PMSA 5KO1A 4F6WA 3L9LA 3TACA 5L8KA 2BZKB 3ZTXA 3TZ7A 2AC3A 4XV2A 2E9UA 3FMNA 1ZZ2A 5JN2A 5KMJA 4GUBA 4XRJA 4YZDA 1W84A 1BL6A 3FMDA 3Q9YA 3G2FA 1OIQA 4FTKA 4O91A 1V0OA 3R7IA 2JBPA 4LUEA 4CD0A 1CMKE 1IAJA 4FSYA 1U54A 1OECA 3SD0A 1GIHA 4ZIMA 4D0WA 2EXCX 3BQRA 4F0IA 3NW5A 4MXXA 2BDJA 2OW3A 2YM5A 3R71A 4FKRA 5EOLA 4U80A 3OT8A 4M0YA 3DBDA 1PXMA 4GFOA 5JQ8A 5GIPE 5AUZA 5GJDA 3IOKA 4LRJA 3LFBA 4X6RA 1XH7A 2ITZA 2UZDA 2R3QA 3COMA 4EJ7A 4DH8A 2WMTA 4AOJA 5LVNA 3QTXA 1ZWSA 3VS2A 2GS2A 2PMNX 3FV8A 4YO4A 5F9EA 2XNEA 2YEXA 1YI6A 4OAUC 3VS1A 4UY9A 4PTGA 5FM3A 4AS0A 3BLQA 5K4JA 5BVKA 4CMOA 5H2UA 4IVBA 2EB2A 5ANIA 4JBOA 5EQEA 3P9JA 4IWQA 4P7EA 4GKHA 4DT8A 1OIYA 4YLKA 1YWRA 5DPVA 5HE3A 3QA8A 4M84A 5EDPA 4XG6A 1H26A 2AUHA 1YOMA 2CKEA 3L1SA 3FPQA 4BCJA 2VGOA 4OUCA 4B6LA 2HOGA 3TCPA 5JZJA 5FGKA 1FBNA 1U59A 4YTFA 4EI4A 1VYWA 3HMIA 1UU3A 2E2BA 2ITUA 3IGGA 3GENA 5BYLA 1DS5A 3QCSA 4C4GA 3AD4A 1H1SA 4QD6A 4DFLA 5I9WA 5LVPA 1L8TA 4MBJA 1UU7A 4F99A 1OIRA 4GVJA 3ZU7A 4HGLA 3K5VA 3CSVA 1WBPA 3F3WA 4W4YA 4YBJA 2QOFA 3RZBA 2CNUA 3O0GA 3IK3A 3P0MA 1KV1A 3FYJX 1Q41A 3NS9A 3PP0A 4M67A 4ZSAA 2A27A 4WHZA 4BDHA 4MXCA 5T6KA 4NZWB 3R01A 3D2KA 5DA3A 2R3GA 4DH7A 3BBWA 2VO7A 1G8AA 4JRNA 1IG1A 2WQBA 2I0EA 3Q52A 3VHKA 2GQRA 3U9CA 2QG7A 2PY3A 5B2LA 5H8GA 5HKMA 4PL4A 1B6CB 4CFUA 3IPHA 1YXXA 1X8BA 1UNLA 2Q0BA 3GOKA 1ZMVA 1GZNA 1UV5A 4WNMA 4LYNA 4TYGA 4X2JA 4X21A 3KXXA 5DG5A 3S0OA 3KQ7A 5GIOE 1M2PA 5D11A 3UNZA 3B2TA 4FKSA 5DI1A 4EBWA 1EH4A 3EHAA 3POOA 2BZIB 2W1GA 2XJ1A 4UB7A 1ZAOA 5CNNA 3ZLSA 5A46A 2P0CA 1Y6AA 2HZ0A 5LQFA 5H8EA 3SDJA 4F08A 3QWKA 5EG3A 2PVHA 3PSBA 1WBOA 3TJDA 4R7HA 4C3PA 3PXKA 4FT3A 2VWBA 3OMVA 5HG8A 2UZVA 4IIRA 4AT4A 5CF8A 2R4BA 4FNWA 4ORKA 3IECA 4L7SA 4FOBA 4IDVA 4O0XA 4QO9A 4QNAA 5D7VA 5AV1A 4D0XA 2X1NA 3MFSA 1MQ4A 3QZFA 4BWPA 5LOHA 2OXYA 2X0GA 3KRLA 3QX2A 3ATSA 1ZMWA 5GZ9A 2XNPA 4A07A 4BDEA 3FMJA 4E4MA 2R3PA 3VF9A 2WTIA 4YJPA 3R02A 5IQHA 4IJPA 3C4WA 4KINA 5C8MA 3RALA 3QLFA 2XIXA 4I93A 3C9WA 1WMKA 5AADA 1ZYLA 3S00A 2QD9A 3FDNA 4AW1A 1Q8UA 4IACA 3LCSA 3MY1A 4CFFA 2EXEA 2YM8A 4ZSEA 4DN5A 3ATTA 3PIXA 4FZ7A 3EQHA 2QR8A 3QQUA 3QUDA 4G3FA 4FGRA 4RMZA 2F57A 4EHEA 3PXFA 5IUGA 2QOOA 4FV5A 2C5YA 3KREA 1OL5A 5CS6A 4JNWA 3UG2A 1TQIA 4AGUA 3GQLA 3GCSA 2ETKA 3GVUA 4IHPA 2PZRA 3G0FA 5IQCA 3TNWA 1OPLA 2B4SB 5DLSA 5ANEA 5LWMA 5IMXA 2KULA 1ND4A 3C5IA 2B54A 4LGDA 3QXOA 3IONA 4P2KA 4B7TA 3G90X 3OF0A 4D2PA 3GCUA 4BDBA 4IAKA 2PZIA 3LFNA 5GZ8A 1T45A 2VX3A 4IZYA 5HLWA 1AQ1A 3EQGA 3ANQA 3D5WA 3C4ZA 3MGYA 4TYIA 1HOWA 2QG5A 3CY2A 1KE5A 2YIWA 5DFPA 2ZMDA 4QYYA 4WOVA 5JGAA 2W0JA 5HBEA 4RWIA 1PKDA 4C3RA 3FYKX 1Z9XA 4ALUA 4XH6A 3W2QA 4S34A 5BX0A 4RPVA 4O84A 1LEZA 2R3KA 4E6DA 4RX5A 5AM6A 5IDPA 5CAQA 4RIWB 4CSVA 4FZAB 4G17A 4D2RA 1QCFA 2R0IA 4OTWA 5IQBA 4NFNA 2A19B 2VWYA 5J9YA 3I0QA 3IW6A 4N4SA 3ZRLA 3Q6UA 4ZSLA 1J7IA 4IWDA 4FKGA 2R9SA 4YR8A 4YC6A 4JOAA 4RFZA 3P78A 4S32A 4C61A 3MESA 3HMOA 5FEQA 2WTJA 1UU8A 4IX6A 4Z9LA 5JZNA 3IDPA 4L43A 2Y0AA 3MY5A 3OTVA 4RFMA 3Q6WA 4RIWA 4WSQA 5FBNC 4W9XA 2Q0NA 5EI8A 4F09A 4TWCA 4E5WA 1JNKA 3O23A 2QU6A 4O0WA 4QMYA 4ZTQA 2JIIA 3V5PA 4EK5A 3ZUUA 5GINE 2ZV7A 3EL7A 1YKRA 2DWBA 1ZY5A 2UVYA 4EHGA 3DLZA 4I4FA 1J7UA 4BDIA 2QOQA 2XEYA 3PDTA 4ASXA 2WEIA 4QMSA 5L2SA 4ZLOA 3FLQA 3EQFA 3HLLA 4BDGA 4E6AA 4ZS0A 3HAMA 3A62A 5E4HA 1TQPA 4BDJA 4F9YA 4GH2A 4ZAUA 5L2WA 2C1BA 4D5HA 2YZLA 4MK0A 4RT7A 4FL3A 4ZLYA 4U40A 2ITOA 1J1BA 4HGTA 3AT2A 4EL9A 2EVAA 4FEXA 4D2VA 5FP5A 4D4YA 4FG7A 3L9MA 4CVAA 4TL0A 4S30A 4O0TA 1H27A 5KX8A 4CV8A 4IQ6A 4RZWA 3CD3A 2G1TA 2VTPA 3HDMA 5ANGA 1NVRA 4F4PA 4PP7A 2ITWA 3A7GA 2H8HA 1UWJA 2YA9A 3QCXA 5A14A 3WF5A 3AGMA 3MH2A 3WF9A 3ZUTA 4BIBA 3BBTB 5A6NA 4G31A 2Y8OA 4AA0A 2HCKA 2VWUA 3F3UA 2EUFB 4NH1A 4Y73A 5ETIA 1P14A 3ZDIA 4AW0A 2C0IA 2JDTA 3UGCA 3TKUA 4BICA 4WIHA 3GNIB 4U45A 3BYOA 4CG9A 4W4XA 4RVKA 4IAAA 4CFXA 4KBCA 2CLQA 3SXFA 4JR3A 1Q3WA 2WELA 3E63A 5TE0A 1J7LA 4JX3A 4UMQA 4KS8A 3ZBFA 3TUCA 5EYKA 2Y6MA 4OTPA 5EK7A 3R8ZA 1BMKA 4FKVA 3A7IA 1QL6A 3F3TA 4FT7A 3TKIA 3ULIA 2R3RA 4TRLA 3IGOA 1JOWB 4Y46A 2V22A 3QD0A 5IPJA 1NVQA 3FLYA 3G33A 2I0VA 4YLJA 5EM8A 2VTIA 4FSTA 5CVGA 4YSMA 2IW9A 2ZVAA 4IM0A 2QI8A 1P4FA 3HNGA 2JIUA 2UZNA 5AUUA 5C9CA 3FJQE 5L8LA 4APCA 3PJCA 1PY5A 3LJ1A 3THBA 4QMUA 2DQ7X 2XH5A 4HNIA 4FTMA 3C7QA 4DE4A 3RZFA 3NW7A 3BZ3A 4TY1A 4NYEA 4D1XA 4XCUA 4O22A 4F70A 2W1DA 2JKQA 2P2HA 4FKTA 2G2FA 4FGBA 5E8TA 3PP1A 4KKEA 3VS6A 5FTGA 4DFBA 4CFNA 3OD6X 3M11A 4QP7A 3H0ZA 1Q61A 3DY7A 4IB5A 1FQ1B 3NUSA 2XMYA 4IC8A 3SQQA 3R7GA 4FSNA 4HYUA 5HD4A 4KIOA 1CKJA 4FV4A 3HV6A 4FNXA 4IADA 5E1EA 4CEGA 5CEMA 1WVWA 2QR7A 4NKAA 3QHWA 5J79A 2UW7A 3KMWA 1SVEA 3EFLA 1FMOE 5HU9A 4BDFA 2JFMA 2WOUA 4UXQA 4TWNA 4CQGA 3TM0A 2J6MA 2A0CX 2ITXA 3PA3A 4HYIA 2GNHA 2UW9A 4D55A 3F2NA 3A61A 3GU7A 2V7AA 3FE3A 4W8EA 3T8OA 5CZIA 4WNKA 4WA9A 3MA3A 4MH7A 2PUNA 2G2IA 4KSPA 3NMUF 5EM7A 5TO8A 4IAIA 5D9HA 4FE2A 3F82A 2QQ7A 5ITAA 4MKCA 3NNXA 5CSWA 1R39A 5CEOA 4O86A 3OXZA 5HZNA 4DEEA 4Y95A 5CVFA 1NY3A 4EORA 3S4QA 3EQDA 3QWJA 4FV1A 3BI6A 5FTOA 3V6SA 5C4LA 2CSNA 3Q2MA 2X9EA 1WBWA 1TQMA 4S31A 5EW9A 3VUMA 5HNIX 5HU3A 3ROCA 4GT4A 2UW0A 3V5JA 4BCPA 2G9XA 2C5OA 4TYHB 5EQPA 2BFXA 3A4OX 3LFEA 5D12A 2BDWA 1YXSA 5M08A 1YDSE 3A7HA 4RGJA 1WVXA 4RJ7A 3MJ2A 4D4SA 3LJ2A 3VRZA 3E5AA 4P5ZA 4EEVA 4MWHA 3TJCA 1T46A 2W7XA 3ODZX 1XBAA 3HX4A 3VF8A 5JFXA 2XYUA 3MH3A 5BMMA 4CV9A 3CLYA 2C1AA 4TYHA 4C0TA 3GC9A 1SMHA 3KU2A 3R1QA 4AUAA 3UE4A 1MRUA 3P08A 1SZMA 3AQVA 1ZRZA 4I6FA 4JQEA 4DEDA 1RQQA 2GS7A 3K2LA 4RFYA 2XM8A 2O2UA 4NJDA 3F5XA 4Y72A 3UVPA 3OXTA 3DJ6A 2QONA 4KRCA 3OG7A 4ZJJA 4LRMA 4XV3A 5BNJA 3N51A 3U55A 2PZPA 4FK3A 1YI3A 2ERZE 3PE1A 5FD2A 3TT0A 2YN8A 2YAKA 3QQFA 4QQJA 5IG1A 2ETRA 2XUUA 4PDPA 3RVGA 4QTEA 4UMPA 5L2QA 3CQUA 1QPEA 3FKOA 4DTAA 2ZDTA 2CGWA 4WRGA 3ZLWA 5HVYA 4LFIA 2JKKA 4CRLA 4UX9A 2XKCA 4ZJVA 3WYXA 3U9NA 3RGFA 2I0YA 4R1VA 4QNYA 4YHTA 3W33A 4JL9A 1M17A 1UKHA 4UMUA 4BCMA 3MB7A 1W8CA 3KXZA 1JWHA 4E7WA 3L8VA 2J0KA 3BU3A 3ZDUA 4WG5A 4EOSA 4IWPA 3E8CA 5AUXA 4EOMA 5M51A 4JJRA 3COHA 5CSXA 4EKLA 3EFJA 4J53A 5HTBA 5CEPA 3HEGA 3UNJA 3CP9A 3L8PA 5HCYA 5G1XA 3FZPA 4CTBA 1REKA 1O6YA 5KKRB 3O8PA 4X3FB 4FK6A 4KBKA 5C1QB 3QGYA 5A4LA 1GNGA 4GU6A 4M0ZA 3LFAA 3Q9WA 4FVQA 1VJYA 2C6IA 2P4IA 3FXZA 4D4RA 4JXFA 4TTHB 5AUYA 3OXIA 4QQCA 3JR1A 4AZSA 5M4CA 2HWPA 2HY81 2O3PA 3MIAA 1JKLA 3NUUA 4Q9SA 2I7QA 2XK7A 4NIFA 1L3RE 2R0UA 3EN7A 5CYIA 3OY3A 4RJ8A 2PVMA 4L52A 4O21A 4XG2A 2NO3A 4BCFA 4PMTA 1CSNA 2QOKA 5KMMA 1KSWA 1XHAA 3PJ1A 4FIFA 4C4FA 3UOHA 2GU8A 4BDCA 2C3JA 4QTCA 3BHUA 3R22A 4F64A 4JAJA 3ZO1A 3OWKA 4FEUA 4ZJIA 3DJ7A 3SX9A 1NT2A 2WU7A 4DLIA 4QMQA 2Z7LA 5GJGA 4DFZE 2X8DA 1VR2A 2B9JA 4JVGA 5E8WA 5FQDC 3ET7A 5BUEA 4AZVA 4D58A 2X39A 1H0VA 2VO3A 5IUIA 4IX4A 5CF6A 5C8KA 3BLHA 2WMVA 1Y6BA 3AD6A 4KS7A 4UALA 4XMOA 3IW5A 4HYHA 1B38A 2OICA 4LRKA 5HIBA 4EWQA 3F69A 3UO4A 4F9AA 4KSQA 2C30A 3CPCA 2FB8A 1OL2A 4RIXB 2PVNA 2VTNA 3GFEA 4E5BA 4FKUA 1BLXA 3W2CA 2W1CA 4WO5A 4PL3A 4EYMA 2XIRA 3AT4A 5M53A 4L9IA 5IQDA 1E1VA 1ZOEA 3C4XA 2J0MB 4GFGA 1OGUA 3SHEA 4FUYA 4FKOA 3DA6A 4JT3A 4YTHA 5EYCA 3UNKA 4DH3A 2WOTA 3VBVA 5EFQA 3BQCA 3GU5A 4YZ9A 1Q5KA 2QOHA 3RWQA 5FXRA 3QD4A 3ORXA 4RIXA 4RC3A 3SXRA 4BFMA 4CGAA 4BI2A 3N9XA 4CMUA 4D9TA 1FGKA 2KTYA 4R5SA 5CT0A 3DKOA 4R3RA 3UMWA 1BYGA 2PMIA 3D15A 5C26A 3P7BA 5FM2A 3FLWA 5BQ0A 3SOCA 4FC0A 4JAIA 4C4IA 3HRFA 1UA2A 2WMUA 4FICA 3WF6A 3P7CA 2VAGA 4AAAA 1F0QA 1XH5A 5F1ZA 4ACCA 4ANBA 3KN6A 4EBVA 1BI7A 5J8IA 3HV5A 2FYSA 2XCHA 4OW8A 3COIA 4B99A 4DA5A 2BVAA 2GCDA 4GT5A 4D1ZA 1ZARA 3KRWA 2UW4A 2OJ9A 4BCNA 1ZOHA 3G9LX 1OPJA 3GBZA 4H39A 4L3LA 2ONLA 1GZ8A 2HELA 2C68A 4U81A 2ZOQA 3GOPA 3NVKI 2P33A 3OS3A 3RPVA 3G0EA 3UC3A 3DB6A 2BZHB 1OBDA 2YCQA 4G9RA 2X4ZA 4ZTHA 3DXNA 4IB0A 5CZHA 5IISA 3C0GA 1MP8A 2DS1A 4FEVA 4UMRA 3EKKA 5FG8A 3DFCB 2BRNA 3EFWA 3ZBXA 4O7ZA 4LV5A 1H1PA 2ZMCA 3O51A 3EIDA 2VWWA 3KRXA 2ERKA 4PRJA 4KUJA 3TDVA 1Q62A 2WTKC 5M4FA 4DEGA 3I60A 3PUPA 3FI8A 4PTCA 1R0EA 4I20A 3RCJA 4EHVA 3SG8A 3R73A 3QTZA 4CMTA 2HENA 2PVFA 5EI6A 5EYDA 4FTJA 2RFSA 5HO6A 4YJVA 4MYGA 1IA9A 4G34A 3Q4TA 3ODYX 4ZTSA 4D2WA 4O96A 4OTIA 2BMCA 3OFMA 4ACMA 4YPDA 2IPXA 3ZLYA 2H34A 3PSCA 4NJ3A 3OY1A 5J9ZA 2C0OA 3OUNB 4G3DA 3UJGA 3CEKA 4AQCA 4RQVA 1YDRE 4L53A 4U79A 3UOLA 3WZKA 3HYHA 3ORZA 3QYWA 5KMLA 1YXVA 3GCVA 1NW1A 1DI8A 3DB8A 3TNIA 2GHMA 2XNBA 3EZVA 4S33A 5LVLA 4LMUA 5KHXA 3F7WA 2FVDA 4FNYA 2OXXA 2GHLA 4YC8A 3EQCA 3QTQA 3O8UA 2HY0A 4ANMA 4FA2A 2WTCA 3E7VA 1OIUA 5HE2A 2RFEA 4BKYA 3FL4A 1YXTA 3EQIA 4F6UA 5J7BA 1PXJA 3CKWA 4HVHA 4EWHA 1JSTA 3NWWA 4GV1A 3KVXA 4JQ7A 4M8TA 3FMKA 4WD5A 3FLSA 3B8RA 1H00A 4FV9A 4LOPA 4MXZA 2W06A 4YGAA 3IG7A 5J95A 4EQUA 5K0XA 1YVJA 1PF8A 2C5XA 4FZDB 3II5A 3R2YA 4C4HA 5CAOA 1XR1A 2A4LA 4BBMA 2A1AB 3Q96A 4O7WA 1PMNA 1VZOA 2F7ZE 2O8YA 5BVDA 3DNDA 5HHWA 3HDNA 5CEQA 4F65A 1RE8A 3WZEA 3H9RA 4XX9A 5ANJA 4GJ2A 3MSSA 4G5PA 3OBJA 2OJIA 5AV0A 4BF2A 3O7LD 2C69A 2OH4A 2OSCA 4FIGA 4N6ZA 4YBKA 3AC2A 1DM2A 4FSRA 3ZRKA 3C5UA 3KK9A 3UIBA 3VNTA 4O7YA 1KOAA 4GIHA 5LVMA 4QP1A 3HV4A 2OWBA 2WQNA 2ZJWA 3ACJA 4R3PA 3BEAA 3GU4A 3SC1A 5EDQA 3QGWA 5JFWA 1YWVA 3KFAA 3Q32A 5LARA 5FWKK 3D94A 2VX0A 4BGGA 3V04A 3ZO3A 5IQAA 4DGMA 2OIQA 5JKGA 4IH8A 4BY9E 2X9FA 2X6DA 3ZSGA 3O50A 3KXNA 3OTUA 1AGWA 2C6OA 5L6OA 5HEZA 3EN6A 2PVRA 4DH1A 4HGEA 2EB3A 3UO6A 4FT0A 4BL1A 5JSMA 1Z5MA 3FY2A 3Q5ZA 2CMWA 3RP9A 2CHLA 3WZJA 4FSUA 3BCEA 4FZ6A 2RG6A 4ITJA 5IKWA 3VO3A 4BCHA 4JBVA 5E1SA 4IVCA 5E8ZA 4BYIA 4U43A 3RWPA 2BHHA 2IG7A 4FV3A 3RPRA 4PP9A 4E8AA 1YHWA 2WMRA 3BHVA 3D5UA 2XZSA 3E64A 2VNWA 5IEYA 1GIJA 1BL7A 3U6JA 3VS3A 2XYNA 3R04A 2OIDA 4H3QA 2UW8A 1WBNA 4FTRA 2WMSA 5AAFA 4O7TA 2VN9A 3HUBA 3LQ3A 4OTRA 2O65A 5AUWA 2R3MA 3NUXA 2X7FA 4N0SA 3MY0A 3V8WA 2WXVA 3O96A 4QMZA 2IVSA 3GCPA 4DGNA 4AACA 2AYPA 4F7NA 3KA0A 4PL5A 5JRSA 4FX3A 3HKOA 4GRBA 4L6QA 4TKSA 3ZFXA 3H3CA 4QMNA 2F2CB 5CI7A 5CSVA 2OI4X 2W1ZA 3HRCA 4RSSA 4C4JA 4NTTA 2OG8A 2VWIA 5AM7A 3TNQB 3R30A 4I5HA 1U46A 4JDJA 2F7EE 3DK3A 5ANKA 3W2SA 4D4VA 2JITA 4CKJA 2GNIA 4YHFA 3PPJA 1FVTA 3RCDA 4YSJA 3QC4A 3ZC5A 2BRBA 2YIYA 4ZZMA 3ZFMA 3A99A 4BZNA 4JDKA 4YJSA 4UMTA 2UZOA 2I6LA 3HECA 4HNFA 5A4CA 4FL2A 2C3IB 5C4KA 3NSZA 4JG8A 3H9OA 4AW2A 4QPMA 3T9IA 3TZ8A 3TXOA 5DIAA 1NVSA 2QHMA 3F3ZA 4TXCA 3QAME 4HVGA 5BVOA 4PY1A 3AC3A 4S2ZA 4NL0A 1LPUA 2F4JA 4FSQA 4MEDA 5IA1A 2PUPA 5DBXA 2C6LA 1SVGA 1XQZA 3F2AA 3I0OA 4EZ5A 3EQBA 4I41A 4CG8A 5H8BA 3R63A 3PG3A 1IEPA 4AE6A 1A06A 4NCTA 4NFMA 4GIIA 1LR4A 5IMEA 2VTLA 1OKVA 1KE8A 1UKIA 2QOLA 3KXMA 4AU8A 4V0GB 3UQFA 3CGOA 1ATPE 2HW6A 4FTLA 4LMNA 4RBLA 3QXPA 5ETAA 2PHKA 2CJMA 2PVYA 4JG6A 1GAGA 4QMVA 4LQMA 4QMOA 4HCTA 3BGZA 5J1VA 1KV2A 3S95A 2VZ6A 4LGHA 3RK5A 3QU0A 4F9BA 3DBEA 5IQGA 5HBJA 3E8DA 2WAJA 4BB4A 1F3MC 2C47A 3MH1A 3TTJA 5BVFA 5DR9A 4O7SA 1M7NA 4ERKA 2QO2A 3BHTA 3DNEA 4V0GA 3R0TA 4YNEA 3ROYA 5GZAA 4O6LA 3MFTA 5D10A 4KRDA 3TEIA 3FC1X 2W1FA 3QCQA 3FQEA 5I9ZA 5KMNA 3NNUA 4XOZA 2Z7QA 4EUUA 4AN2A 1WBVA 4HW7A 5BUJA 3AOXA 1OI9A 4KB8A 2W1EA 1PW2A 3TV7A 2PYWA 3IW7A 2WU6A 3Q53A 3R83A 4XG7A 5HLPA 4HVDA 3C0HA 4PDYA 2XKEA 5HOAA 4U8ZA 4ENYA 3AT3A 1IRKA 3EOCA 2WB8A 4LG4A 4ASZA
chains in the Genus database with same CATH superfamily
4NEUA 2HW7A 3E7OA 2OKRA 3OCGA 4LI5A 5I5ZA 5EW8A 4IZ7A 3DKGA 3F9NA 5GHVA 4ANLA 5HX8A 3AXWA 4WBOA 4X3FC 4F7JA 3R6XA 2ZYBA 4MVFA 3RPOA 1XBCA 3BGQA 2JIVA 4HCUA 4Y5QA 4JX7A 2R3IA 3VW8A 3VWAA 2NP8A 4CXAA 2QKRA 5F94A 3V8TA 1YHVA 2Y4IB 1DAYA 3OEZA 5IQEA 4ONAA 4IEBA 3G51A 3MYGA 3MVMA 5EHOA 2UZUE 4PTEA 3BU5A 3ML1A 5IQFA 1PMUA 4FZFB 2XS0A 4OTHA 4CFWA 1LUFA 4NU1A 3RM6A 3GI3A 2QLQA 2VTMA 3V8SA 4Z7GA 3R1YA 3QUEA 2O0UA 3VJNA 3FHRA 5JGBA 2BTSA 2J0JA 3NCGA 4U3ZA 4DFYA 4H3PA 2ZDUA 1GJOA 2X2MA 1Q8WA 4C62A 4G16A 3QRTA 5IDNA 3Q9XA 2W96B 1BI8A 5AR8A 2OXDA 4U3YA 5HVJA 3BV2A 4KBAA 5JT2A 5E90A 4EH4A 4WKQA 4I92A 3ORIA 2PULA 4KWPA 4ZEGA 4F7SA 5AX3A 5CAUA 5KNJA 3W0MA 1XBBA 4L3PA 2ACXA 4MBIA 5HCZA 4MNFA 2C5NA 2PE1A 3LJ0A 3UZPA 5DRBA 3FMLA 2PMOX 4BWKA 4YTCA 1ERKA 3SW7A 4I0SA 3ALNA 4TW9A 2F7XE 4FTTA 4BBFA 3BU6A 4CFMA 5DGZA 4M14A 5I3OA 4GYGA 4AW5A 2E9NA 4I94A 5E8SA 3NVMB 4E93A 1FOTA 3FZ1A 5KMKA 4QP9A 4YMJA 3NUYA 3TIYA 4DBNA 3DBCA 3NCZA 4BJJB 2J9MA 4MQ2A 3VBTA 3U4WA 3WBLA 3ZRMA 4FT9A 3ZZEA 2YM7A 3ETAA 1ZLTA 4HGSA 4BCOA 4X7QA 2UVZA 4IVDA 2BTRA 4JQ8A 3ZC6A 4A9UA 3DXQA 3TMOA 4Y5HA 2PWLA 2UUEA 4FKIA 3LAUA 1S9JA 4A9TA 3LFFA 4O81A 4H05A 2C6EA 3D0EA 1PXNA 3JVSA 3I81A 4XYFA 3SG9A 2WO6A 4J71A 4E6CA 3FI2A 4RLLA 4BJJA 4QMMA 4DFNA 3OWLA 5L4QA 4R8QA 2WMQA 1PXOA 4JBQA 3MN3A 2BAJA 1YQJA 4FV2A 2ZFYA 3FBVA 1FVRA 3VS7A 4DHFA 2YCSA 1UNHA 2FSLX 4OTDA 4R7IA 1WBSA 3FLZA 3DOGA 4ZP5A 4B8LA 4BCKA 4YU2A 3BYMA 5IZFA 3WIGA 2XCKA 4O0SA 1H01A 2WMBA 3QF9A 2WMAA 3LE6A 4EK6A 4TWPA 5A4TA 3UIUA 4DCAA 3DZOA 5DN3A 2Y6OA 2BROA 1IR3A 1NXKA 4I0RA 2NNWB 5EQYA 5FXQA 4BBEA 5TT7A 2B53A 3FMEA 1JKTA 4YJOA 5G6VA 4EH9A 3R21A 1HCLA 4APPA 3R7YA 2BALA 2PZYA 3O17A 3Q04A 4V04A 2HZNA 3KXHA 4ZXTA 2Y4PA 3NUPA 3Q9ZA 4O6EA 3H9FA 2Y7JA 4AA4A 1CKIA 4USFA 3FUPA 4D2TA 3QUPA 3UVRA 3ZEPA 3A4PA 3JY9A 1V1KA 1ZMUA 3Q3BA 4FRFA 3VS4A 5LMKA 3NX8A 4YJNA 2PMLX 5FRIA 4U9AA 5K0KA 5IH5A 4MD9E 4I5PA 2REIA 1BKXA 2J4ZA 3F3VA 4GS6A 2X2KA 5EHLA 4AOTA 2IN6A 1JKKA 2RFDA 4EK4A 1IA8A 3Q4ZA 2FO0A 4YZNA 2JAVA 2RG5A 3CS9A 3HUCA 4NM7A 5TOZA 2W05A 2PSQA 3BYVA 3K5UA 3DK6A 4RJ5A 4XLIA 5GNKA 3VUHA 3TIZA 3ZYAA 4OLIA 4XBRA 3NNVA 3IDCA 3W16A 5CALA 4RX8A 3ID6C 4W9WA 2QU5A 1QPCA 4C3FA 3F7ZA 4BCIA 4DYMA 4Z55A 3LFSA 2FA2A 5CEIA 2JD5A 5FEEA 3Q2JA 2C6DA 3GCQA 2QODA 3DGKA 3QZHA 2QC6A 5HE0A 3V5TA 4AXCA 5FEDA 4BKZA 2WHBA 2OK1A 3OUKA 4PF4A 3UP2A 2GFSA 3VUTA 4BDKA 3RTPA 4U97A 5LCJA 4M97A 2VTRA 2QCSA 3HL7A 3FZTA 4M13A 4IM2A 4FKWA 4C8BA 4H1MA 3EN9A 2WMWA 3I7BA 3PXRA 2V62A 3VS5A 2XBAA 4B9DA 4ZMEA 2BHEA 3QALE 5BVNA 2OJJA 3BEGA 1PXPA 1G3NA 2YCRA 4QPSA 4EQMA 3N4VA 1URCA 2XIKA 4UEUA 4CZYB 5BYYA 2X81A 3FI4A 4HYSA 3VN9A 2DUVA 4D5KA 5IA3A 1NA7A 4OBOA 3PJ2A 5TKDA 1MRYA 2UZTA 4GK4A 3FMMA 1CTPE 2HYYA 4W4VA 1FPUA 4BCQA 3HMMA 3CY3A 5AP6A 4KA3A 3BKBA 3GT8A 1H8FA 2R3JA 1OUYA 4P5QA 3PRIA 3W8QA 3H10A 3G6HA 3MPAA 5CAVA 4I24A 4L7FA 4K77A 4ASDA 3F61A 5AA9A 1KUTA 1U4DA 4TZRA 4A9RA 3WZDA 4JG7A 2UW5A 4ANOA 2H6DA 5HQ0A 4GK3A 4USEA 3ITZA 4DFUA 2GFCA 3RI1A 4GT3A 1OVEA 2FSOX 3ZEWA 4MCVA 3AC5A 2YLFA 4RG0A 5E92A 2R3LA 5F95A 2W99B 4E4LA 3HMPA 1YHSA 4DTBA 1Q99A 2VTAA 3RM7A 4HZRA 1E9HA 4N57A 2X2LA 2VGPA 5EW3A 4C59A 4ZTLA 2PU8A 2IW8A 5CF4A 2J7TA 3C1XA 3N4UA 3EYGA 1PXLA 3E88A 3MVJA 4RWJA 3V51A 4AZEA 5JGDA 3D7ZA 3AMAA 3BLRA 4P90A 2QVSE 5DR6A 4FV8A 2OLCA 1H07A 1UU9A 2O64A 2IVTA 2OZOA 5HGIA 3BL9A 3RAHA 1GY3A 1O6KA 2IVUA 5AIRA 1ZOGA 2WNTA 3U8WA 5AAGA 4PMPA 3KGAA 3VRYA 3LM5A 2QNJA 2VRXA 3EN4A 4EZ7A 3HVCA 2XP2A 1UNGA 2AC5A 5DE2A 3C51A 3IDBA 2XK9A 3QHRA 2WD1A 5J7HA 4P4CA 1CM8A 5LWNA 2HK5A 3QLGA 3NFFB 4QOXA 2XJ2A 3NEWA 4B4LA 4NUSA 5JRQA 1YXUA 5HO7A 3OCTA 4V01A 5IA5A 4FIJA 4O82A 5AP3A 4ACGA 5ANOA 1XH6A 3OVVA 4N70A 4PUZA 5E9EA 1M14A 1F5QA 4TNDA 1PYEA 3OOGA 5T3QA 3AKKA 4O4FA 4FOCA 4YP8A 3U6HA 3Q60A 4NIFB 2OFVA 3ZO4A 4F1OA 2UZEA 3ORMA 4WRSA 5AP1A 1OM1A 3MIYA 5AX9A 4TPTA 3PA4A 4K33A 3KB7A 3FQHA 2WQOA 2H9VA 4X2KA 1XMMA 4EOKA 3P4KA 3C50A 4U41A 4AXDA 4X2NA 2XNOA 2YDJA 4IAZA 5IUHA 3WF8A 4BTMA 3OC1A 2W4OA 5IA2A 1SVHA 3UIMA 2JEDA 2IO6A 2CGUA 4G6OA 5AP4A 3LQ5A 3BE2A 1O6LA 4J8MA 4HVSA 5KUPA 2V55A 5M57A 1SM2A 3QKMA 2QO9A 2W4JA 2NRUA 3NYOA 2X4FA 3QFVA 1JVPP 1AD5A 2ETMA 4FNZA 1H08A 4FTCA 3IKAA 3CTJA 4HVIA 4EOLA 4QMWA 3ORNA 2G15A 2ITQA 1APME 3U51A 4E1ZA 3L8SA 4YUQA 1G8JA 3FSFA 3C13A 3NYVA 4JMQA 4QP4A 4J1RA 4FKQA 4RJ3A 1TZDA 3LVPA 3DPKA 5CTPA 2GTMA 3OBGA 3LLAA 2W1HA 3BGPA 2BCJA 2C6KA 3OZ6A 1V0BA 4ZY6A 4FEWA 2WQMA 3MA6A 1QPDA 4ZY5A 5K5NA 3EFKA 2ZV2A 4A4OA 4D2SA 3LMHA 1R0PA 4QQTA 4CT2A 5E8XA 4DEAA 5DT0A 4JDHA 5CENA 3FC2A 5HX6A 1PMVA 2FSTX 5IQIA 3TYKA 4FT5A 1SNXA 2EXMA 3R9HA 4BTKA 3QQLA 4FV7A 4NWMA 4NT4A 3NRMA 2XANA 4QTDA 3LPBA 3AC4A 5LXMA 4E4XA 3W32A 3LLTA 2VTSA 5DRDA 4JRVA 3REPA 3NUAA 4EOQA 3VONA 3I6UA 3PZHA 4QDEA 3UMXA 4TT7A 5AUVA 3FKLA 2R3FA 4O27B 2XK8A 4L00A 2XKDA 3LXLA 3W18A 1M7QA 4EH5A 3W10A 2YIXA 4IC7A 4XOYA 4QP3A 2A2AA 3V5QA 3SLSA 5ICPA 4GMYA 1H1QA 4GFMA 4M66A 2WFYA 3NAYA 3TUDA 3O7LB 4AWIA 4QPAA 4XV9A 3VUGA 4O0RA 3FQSA 4LV7A 4O1OA 5AR7A 3SAYA 4ZK5A 1URWA 4YJRA 1CDKA 3BYSA 3VS0A 2VTTA 5AR3A 4GL9A 3VVHA 4ZLZA 3CR0A 4XP0A 1ZXEA 5CF5A 1I09A 5I9XA 4ZS4A 2XM9A 3A7FA 2ESMA 2WIPA 2BDFA 4IMYA 4UV0A 4L42A 1W83A 2OZAB 4AT3A 4BHNA 4BIDA 5LMAA 4F0FA 3D83A 3V5LA 5L2IA 3C0IA 3MS9A 3LKMA 3R28A 2V7OA 4ANNA 1IAHA 5BVWA 2JDVA 4I3ZA 4J98A 5B2MA 4UYAA 5A54A 4QYGA 3ERKA 5AP2A 4ZZOA 4AGDA 3WF7A 4K18A 1YWNA 4C2WA 3ZO2A 3AMYA 3FMHA 4BHZA 1OUKA 3A8XA 3QTRA 4CKRA 4F63A 4WSYA 4O38A 4XV1A 3PJ8A 5IEXA 2QHNA 2ZAZA 3GFWA 2C6TA 3QD2B 4D9UA 1Q8ZA 2OZAA 2AQXA 3DTCA 3GUBA 4RZVA 2CDZA 3P5KA 5BYZA 4BYJA 2GS6A 5CLPA 3MPMA 3DU8A 2O63A 1PKGA 3WOWA 4E6QA 4DGLC 4BWXA 3D14A 4USDA 5K3YA 1H1RA 1FGIA 4O0UA 5I3RA 2QOBA 1Y57A 5DT3A 2WPAA 3TWJA 4O7VA 2CN8A 5JMSA 4UWCA 4H1JA 3UVQA 3F6XA 4TYEA 5HESA 3V6RA 4DGOA 2B0QA 4PPCA 4O1PA 2CN5A 2OIBA 2VTQA 3LFCA 4HCVA 4J52A 4JLCA 4C38A 2ITVA 4IBMA 3IO7A 1MRVA 4KIKA 3NAXA 4NTSA 4IZAA 4XS2A 4ZOGA 3RBWA 2V5QA 1J91A 3MW1A 4I22A 3UIXA 5IH6A 3BRBA 3FLNC 1K2PA 3UP7A 4IE9A 1OZ1A 5CVHA 5D41A 4FEQA 3GU8A 3PXYA 3D2IA 4K8AA 1FINA 3BE9A 5B0XA 4BTJA 4E26A 3MVLA 1GZOA 4FKLA 3ZMMA 5JQ5A 4E5AX 4RWKA 3W55A 2NRYA 1OMWA 2YERA 4EK3A 3OCSA 5EDRA 3C4FA 4ZY4A 4KAOA 4CNHA 1PMEA 2VO0A 4JIKA 4FIHA 3O5AA 4IANA 3ZSIA 3KF7A 4DFXE 4M68A 3PPKA 4MD7E 2CKQA 1YRPA 2UZBA 3BPRA 4FMQA 5DHJA 2VTOA 5EM5A 4AT5A 4PQNA 3TNPC 5CU2A 2PVJA 3QC9A 4M15A 5CASA 4FVPA 3A2CA 4AG8A 4C33A 5CWZA 4G1WA 4EH2A 5L8JA 4IB1A 1M2RA 3D7TB 4RIYB 4FSMA 5EHYA 1G8KA 4QP8A 1R3CA 4IAFA 4Q5EA 4EOIA 5BPYA 3ZHPC 4LDTA 2QO7A 3CQWA 5KBRA 3ZH8A 3V5WA 1KE7A 3LMIA 3A7JA 1Y91A 4TYJA 4L44A 4IXPA 4OBPA 1KWPA 3K3IA 4C02A 4C36A 5I9UA 3UQGA 3H0YA 3ORLA 4KIQA 2X7OA 4AFJA 2JC6A 4DLJA 4I4EA 3VBYA 5K5XA 2JKMA 3HV3A 1ST4A 4Z16A 4BGQA 3P7AA 3HZTA 2LGCA 4KKGA 3MJ1A 4NK9A 2XK6A 4C34A 5HORA 3CC6A 3SGCA 4ERWA 3FAAA 5EYMA 3D7TA 4FF8A 3BYUA 4RIYA 5EKOA 3TV4A 4ANQA 4DG0E 4K9YA 4D28A 1ZYCA 4HZSA 4J8NA 3NR9A 5M55A 2GQSA 2UW3A 2PTKA 3EQPA 5AR5A 2PE0A 5ACBC 4I5CA 3SA0A 5FXSA 1XO2B 3R8LA 5DMZA 4GKIA 2C6MA 5LCKA 3NPCA 3RKBA 4YLLA 4U0IA 1Q3DA 2WGJA 4PDOA 2CNQA 3E3PA 5L2TA 5J9LA 3ZUVA 5EKNA 2CPKE 2V0DA 3DDQA 3EB0A 4R5YA 4X3JA 5H9BA 4BR3A 4TWOA 3FXWA 5CU3A 4AZWA 1ZYJA 4YURA 2ITNA 3UOKA 2BRMA 2J5FA 3WZUA 1XWSA 1FVVA 3G5DA 4YNOA 2YISA 3E92A 4RX7A 5ACKA 4FI1A 3CTHA 3MFUA 2YJSA 2YIQA 4FTNA 4IVAA 5KCVA 1OGYA 2CCIA 3T3VA 2R64A 2F9GA 3B2WA 4EKKA 3OROA 3R8PA 4CT1A 3EQRA 4XHKB 4E4NA 3AGLA 3NUNA 1A48A 4LM5A 3ZSHA 2J0LA 4O0YA 2B55A 2HXLA 2J2IB 2ZV9A 3PVWA 2OF4A 4X2GA 3ANRA 1XMLA 3ENHA 4YJTA 4ZTRA 1HCKA 3NIZA 3QKLA 3RNYA 2Z02A 1XH8A 4CFVA 2WEVA 4BI0A 1MQBA 3Q4UA 4OTGA 3ULZA 3OCBA 3V3VA 3V01A 3UBDA 1YW2A 1YI4A 5L3AA 4XBUA 2BR1A 4U42A 4WT6A 4AE9A 1H4LA 3ZOSA 4CTCA 4MF1A 3KULB 4QMLA 2WKMA 4FTIA 1XH4A 4JIAA 4FTQA 2OJGA 5HTIA 4BZOA 1TKIA 4H58A 4NKSA 4K1BA 4ITIA 3P23A 5HI2A 1W7HA 1V0PA 4O0VA 4UXLA 4RIOA 2YDKA 2WTWA 3D5VA 3SW4A 3MB6A 3BIZA 3RMFA 4DEIA 4LOQA 2PPQA 4GEOA 4EH7A 3CTQA 3QQJA 4GG7A 4HPUE 4EH8A 2VTHA 4BZDA 3OWJA 4TN6A 1W0XC 3U87A 3GC8A 3QYZA 1OPKA 3MPTA 4M3QA 4Y85A 4I23A 4AN9A 5HVKA 3KULA 1K3AA 2W9FB 3RHKA 1ZZLA 3F5UA 4AP7A 4F1MA 3KKVA 1R1WA 3W2OA 5IF1A 1A9UA 5DYJA 5AR2A 1Q97A 2XIZA 4FTOA 2BILB 4GG5A 2YWPA 4I6BA 3L8XA 5HG7A 3W0OA 5AAEA 3OW4A 3ORKA 4JDIA 3EJ1A 3NIEA 2QLUA 2Y9QA 2J0IA 4V05A 3TKHA 1PJKA 2HXQA 3PUFC 4II5A 3RK9A 2X6EA 4DHJA 4AGCA 2R5TA 5JFVA 1OBGA 1PRYA 3EYHA 1JAMA 4L45A 5C03A 2JDSA 3PA5A 2WIHA 2BPMA 3R9OA 5I0BA 1Y8YA 4BIEA 1H1WA 3DBQA 2ITTA 3RJCA 3UG1A 3KCFA 4QT1A 3LHJA 3DAKA 3I7CA 2IZTA 2VNYA 3KK8A 3R7VA 3LFDA 4PNKA 3M1SA 4BKJA 4HJOA 5IA0A 4BI1A 1UVRA 4FV6A 2FSMX 2RSVA 2ZM4A 3LM0A 2RKUA 5HNBA 3L9PA 5DVRA 4IAYA 1WCCA 4EQCA 4UN0C 4FIIA 5DH3A 1OKZA 4HPTE 1K9AA 5AIKA 3R9DA 3D4QA 4WNPA 5HG9A 5CXHA 3EKNA 4IFCA 4R3CA 3BHHA 3HMNA 5KE0A 4E20A 4IJ9A 4PMMA 4EJNA 4L67A 5CSPA 3I5ZA 5M4IA 5FBOA 3UDBA 3ZZWA 3IW4A 4BCGA 3CBLA 3OP5A 3HRBA 2C3LA 3UZTA 5KKRC 2PVLA 3VHEA 3LZBA 1H25A 5HLNA 3O71A 2QOCA 4G3CA 4Q5HA 2J50A 3K54A 5ETCA 1DI9A 4CQEA 4EC8A 4HOKA 3PSDA 4WUNA 2R2PA 2GSFA 4AFEA 2Z60A 2GNFA 3ORTA 3KRJA 4Y8DA 3GXLA 3E87A 3FHIA 3PXQA 1WFCA 2BFYA 5EH0A 5HICA 1I44A 2PVKA 3W2PA 1PYXA 2BIKB 1MUOA 2UW6A 5C27A 1REJA 3EWHA 3F66A 2YACA 1OL1A 5HE1A 4WBBB 3NYNA 3PXZA 5DNRA 4YHJA 1P5EA 4UBAA 4WNOA 2R7IA 3PVGA 2RIOA 2IZSA 4C58A 4DAWA 3OHTA 4UZHA 1Z57A 3CE3A 4CCUA 4AN3A 4Q9ZA 2UZLA 5AFVA 1JSUA 2GTNA 4ZSJA 4FYOA 3HP2A 4YZBA 5ETFA 4MBLA 4CYJA 3F88A 4FSZA 4QMPA 2LAVA 3RAWA 3UODA 3I6WA 4FG9A 2VD5A 4UWBA 4EHZA 3UDTA 5TR6A 2JDRA 2BRGA 3CCNA 2ZB1A 3PE2A 4RJ6A 2J90A 3I79A 4XEYA 4EC9A 2Z2WA 4I6QA 4MXOA 5CY3A 4AF3A 3R9NA 3PY3A 2YAAA 4WG3A 3NNWA 5KZ0A 2XRWA 3KXGA 3U4UA 2Q83A 4MX9A 3RPSA 5A9UA 5AJQA 3S3IA 1H0WA 1VEBA 4RC2A 5AP0A 4EH3A 3QA0A 1PXIA 2XEZA 1QMZA 3P79A 4U44A 2C0TA 4MXYA 2IJMA 5AP7A 4J97A 2Z7RA 3G9NA 2RGPA 4DTKA 3UYTA 2EWAA 4QTAA 5CQWA 1Q8YA 2E9OA 3KMMA 3MTFA 1STCE 3BL7A 1O9UA 4MQ1A 4F7LA 4XG4A 2XK4A 2HIWA 2W5AA 4PDSA 3MVHA 3BV3A 3MV5A 4MXAA 3UOJA 3JXWA 3RPYA 3FZRA 3POZA 3R9RA 3MTLA 3O2MA 3W8LA 5DWRA 1R78A 2JAMA 3LCDA 3TTIA 2WTKB 4QMTA 4RA5A 2VWXA 3IS5A 4RWLA 5K4IA 3M2WA 3KY2A 4G3GA 5AWMA 4BRXA 4AAYA 3KN5A 4GVAA 3DJ5A 4FKJA 3E3BX 3NYXA 2ONLC 3MH0A 4A9SA 3R1NA 1KOBA 1BUHA 3VUKA 5JH6A 1WVYA 4LUDA 4XRLA 1G5SA 3CQEA 3ZXZA 2VWZA 2BZJA 2G2HA 2C3KA 2GDOA 1JLUE 4X2FA 4MHAA 2SRCA 3MI9A 1JPAA 5HIDA 2E9PA 1JBPE 4ANSA 5KMIA 5FP6A 2OGVA 3FY0A 3QKKA 4QQ5A 3UYSA 2NPQA 4UWYA 3P86A 5A6OA 3ZM9A 2XJ0A 4PX6A 3DV3A 2ZM3A 4H36A 3R7OA 3PY0A 3PVUA 1UWHA 3Q4CA 4RVTA 1S9IA 1Q24A 2IWIA 4FV0A 4XG9A 3R8VA 4FVRA 4CRSA 4EK8A 3QZIA 3HA8A 4AA5A 5AA8A 2CCHA 2JKOA 4TNBA 1RDQE 2FUMA 2P3GX 3HP5A 5DT4A 5I9YA 1ZY4A 4DCEA 3DAEA 3U54A 2VV9A 3DKFA 1IASA 3F5PA 4RLKA 2W9ZB 3BWFA 3U6IA 2VX1A 4ARKA 4Q2AA 3MBLA 4M12A 4O7LA 2XRUA 3PLSA 4F6SA 5JFSA 2G01A 4LL0A 5CX9A 2F2UA 4N6YA 2UZWE 4BN1A 2I0HA 3FL5A 4G9CA 4O2ZA 2R3NA 4YO6A 5T68A 3I5NA 5I4NA 3PLAE 3FZOA 3BHYA 5BMSA 2VO6A 3C4CA 4IW0A 3WIKA 4QEBA 2X8EA 2JBOA 2XK3A 3RK7A 2JLDA 3QRIA 4GUEA 2BKZA 5CU6A 5EOBA 4OR5A 3IW8A 5CI6A 2GNGA 2XNMA 4NM5A 2ITPA 2XA4A 4PPBA 4EOPA 2FGIA 2R3OA 4GCJA 5FDPA 3EH9A 4LOOA 4ASEA 2CKPA 3VAPA 5HD7A 3ZXTA 3G15A 3SOAA 5AP5A 4MTAA 1U5QA 2IZRA 4ZTMA 3MFRA 4R77A 2VU3A 3GP0A 4BDAA 1BX6A 2C5VA 4XUFA 4XNEA 2XB7A 3GQIA 3H30A 3ZFYA 1OITA 4JR7A 4EYJA 2UV2A 2RF9A 4RVMA 3VULA 5DEWA 2PUIA 3VC4A 4O83A 3DZQA 4JBPA 3FWQA 3FZSA 4JS8A 3DCVA 3BWJA 3CJGA 4AZFA 3QBNA 3PZEA 4QP6A 4CLIA 2I40A 4C37A 5FUTA 4I5MA 3S2PA 5E8YA 4IZ5A 4MWIA 4B0GA 3ZS5A 3DDPA 3R8MA 3KF4A 5LVOA 2YITA 2OF2A 5BUIA 2RFNA 2CGXA 2RL5A 3IQ7A 1XJDA 1M52A 1OL6A 1XH9A 5L6WL 4OAVB 4C4EA 1DAWA 2I1MA 5FLFA 5CU0A 4FBXA 3T3UA 5GJFA 1Y8GA 4YZCA 2YLEA 3UPXA 5B2KA 4PV0A 3OW3A 4L01A 4WG4A 3EL8A 4DG2E 4MD8E 4YPSA 5M07A 2QURA 5LJJA 2OBJA 2Z8CA 2GNJA 2OJFE 4XG3A 2YHVA 2YM6A 4I6HA 4DINA 2C4GA 3LXNA 3ALOA 5CU4A 5A4QA 5IA4A 2XKFA 3RINA 4L8MA 3E93A 2H96A 4KNBA 4DEHA 4CLJA 4X6QC 5M44A 3TZ9A 2PK9A 3QQHA 4DG3E 3E8EA 4EOSA 5HTCA 3PRFA 1OKYA 1QPJA 4M7IA 3T9TA 3LIJA 4G3EA 2UVXA 3DFAA 2J51A 4GU9A 5JEBA 3UQCA 5H3QA 3UPZA 3LXKA 1J3HA 4M69B 2W5BA 2OH0E 1J1CA 2WZJA 3D5XA 4OBQA 4OTFA 4JI9A 5HNGA 1G8SA 4IX3A 3TZMA 3CXWA 3PTGA 4O7RA 3VBWA 3R7EA 2HZ4A 4GJ3A 5E8VA 4C7TA 3NZ0A 2R3HA 4GYIA 4J95A 1B39A 3K3JA 2VUWA 3OOMA 4EOJA 5M56A 2YABA 2E9VA 3KRRA 4G2FA 4A06A 4EH6A 4QMXA 3E62A 3UO5A 1Q8TA 3M42A 3R00A 3DBFA 5KHWA 4M69A 4AXAA 4RRVA 3KCKA 4MNEB 3QQKA 5ANDA 4RQKA 4ALVA 5HG5A 3WE4A 1W82A 4K2RA 4QRCA 1ZYDA 3NLBA 4AOIA 3TL8A 2GQGA 3KMUA 2XVDA 3BELA 3RAKA 3QTSA 3GEQA 2IZUA 2JDOA 4G5JA 2YCFA 3QD3A 4RX9A 3RAIA 2YJRA 4B8MA 1VYZA 1W98A 2B9IA 2YM3A 3AG9A 4L3JA 5HO8A 1OKWA 4G6NA 3LOKA 2VWVA 5DEYA 5CANA 4MNEA 4L68A 3ZCLA 1TFFA 2ZB0A 4IFGA 5AV2A 5BVEA 2CKOA 3CKXA 2WMXA 1KE6A 4AZTA 5C8NA 1YDTE 3MWUA 5CEKA 3W2RA 3DLSA 2XNGA 3LCOA 4BTFA 1WAKA 3DKCA 4U6RA 3G6GA 3PPZA 4I21A 5KMOA 3PJ3A 2FH9A 3DTWA 1P4OA 3HGKA 3PY1A 4DT9A 4C35A 2ZM1A 3JPVA 3BX5A 4AX8A 5EM6A 5E7RA 3TI1A 4R78A 4NCTC 3CIKA 4W4WA 3AMBA 3CJFA 4QYEA 1P2AA 2BAKA 1PHKA 2HZIA 4PWNA 4OTQA 4F9CA 3WARA 4DGGA 5CNOA 3JUHA 3DS6A 4FL1A 3QZGA 3DK7A 4YZMA 2EU9A 3PIZA 2B52A 4Z3VA 4NW5A 3JY0A 3HV7A 4W8DA 2PL0A 3A60A 5A4EA 3TUBA 4DDIA 2W5HA 2IW6A 2B1PA 2X8IA 4I0TA 4KABA 5J5SA 4CCBA 3TG1A 5I9VA 4CKIA 4U7ZA 2DYLA 3EMGA 5FDXA 2IVVA 4ID7A 2XNNA 4A9YA 2ZV8A 4QP2A 3SVVA 3GGFA 3RNIA 4J7BA 3PYYA 2X7GA 4YC3A 2BKKA 4DC2A 4E73A 3AC8A 1E1XA 1JQHA 4KIPA 3I1AA 3PIYA 5JK3A 5AR4A 3TNHA 3RHXA 4YJQA 1H28A 3OEFX 3KEXA 5HBHA 4H3BA 3FXXA 1TVOA 5DOSA 3FI3A 4FR4A 3VW6A 4DEBA 5CAPA 3CD8A 4FYNA 4CZUA 3HAVA 3VBQA 4BGHA 3LQ8A 3SV0A 3F5GA 2XF0A 4X3FA 3ORPA 4XG8A 3WILA 5DR2A 3QRJA 3WI6A 2VTJA 4BC6A 2W17A 2YFXA 3E8NA 3GU6A 3ELJA 5EI2A 3A8WA 2WTVA 4FTAA 3W1FA 3QTWA 2A98A 4RJ4A 3FEGA 3QTUA 2JFLA 4IB3A 5M06A 3EN5A</