1JLUE

Crystal structure of the catalytic subunit of camp-dependent protein kinase complexed with a phosphorylated substrate peptide and detergent
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
339
structure length
337
Chain Sequence
QESVKEFLAKAKEDFLKKWETPSQNTAQLDQFDRIKTLGTGSFGRVMLVKHKESGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVAGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFTEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords AMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC SUBUNIT
publication title cAMP-dependent protein kinase: crystallographic insights into substrate recognition and phosphotransfer.
pubmed rcsb
source organism Mus musculus
total genus 104
structure length 337
sequence length 339
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2001-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1jluE01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1jluE02
2IO6A 3OEFX 3TV6A 3UOLA 5HOAA 2XNNA 3G90X 5DVRA 5EQYA 4O0VA 4RFZA 5J8IA 2WQMA 4AZVA 4EUTA 5IPJA 3COMA 3E8EA 2HIWA 3NW7A 2RIOA 4NL0A 3HDNA 5L8KA 3DNDA 2VUWA 1J7IA 4G3EA 5EM7A 5H8GA 4LGHA 3LFNA 1K9AA 3R1YA 3DB8A 4A4XA 3V6RA 4I1ZA 2WQOA 3T3UA 4DA5A 3REPA 1PYEA 4KKHA 5ICPA 5CNOA 2X8DA 3FQHA 4HVGA 3ORTA 3N4UA 3CQWA 4JG7A 2H6DA 4FNXA 5JQ8A 4MK0A 3KRRA 3LJ2A 3OXZA 4AA5A 3ZEPA 5ANOA 2PUNA 3P7AA 3W2OA 1YHWA 3Q9WA 5AX9A 5TE0A 5BNJA 2BDJA 3UQFA 5TF9A 3HAMA 3E62A 5JEBA 4RMZA 4DH8A 3D5WA 4R77A 3PXRA 4M0ZA 3JY9A 4AZEA 4EONA 2QR7A 1PRYA 4FBXA 2X2KA 4UWYA 5BPYA 1V1KA 4XLVA 4XHKB 3Q4ZA 2HCKA 2XUUA 4G5PA 3QAME 3RMFA 5IA1A 4GT4A 3Q5ZA 4FZAB 3ZBFA 2GFSA 1HOWA 2C69A 3DBQA 3KXMA 4HOKA 4QTBA 1IEPA 5CXZA 5JGDA 3GU8A 3CKXA 3U6IA 1M2PA 3JXWA 4EQUA 1T45A 2C6TA 4M13A 5EYKA 2VGPA 4F6UA 5J7BA 4PNIA 3QZFA 4ZP5A 3KREA 3FYKX 2C1BA 3GBZA 1XJDA 2OICA 2VWZA 3BHVA 4BDBA 3UO4A 3SOAA 4G3FA 5JZJA 2X1NA 3GQLA 1RQQA 4JXFA 2BKKA 2C30A 3RNIA 3DKCA 4MBJA 3BWJA 2A0CX 3UE4A 3T8OA 3RINA 1Y91A 5H3QA 2BMCA 2OF4A 3NUUA 4C2VA 5IDNA 5FRIA 2YN8A 4RJ3A 3ROCA 4TYHB 4HCTA 4CFNA 2PMOX 3OTVA 3GGFA 4QPAA 2ZMDA 3TNWA 3RK5A 3E88A 3DBCA 4IEBA 4D2RA 5AUZA 4OTIA 1FVTA 2BAQA 3LIJA 2QG7A 4HVIA 3GXLA 2R0UA 4FIJA 4CV9A 3D5VA 3GI3A 3VN9A 4Z16A 5LMBA 1QPDA 4IAKA 2BHEA 5IH4A 1KOBA 3DB6A 4HNFA 4RLLA 3AC4A 3W2QA 4GSBA 3H9OA 3BBWA 4WNOA 4QP9A 4FA2A 3FI3A 2G9XA 4C61A 4CYIA 5A14A 2F9GA 3KRLA 4M15A 3MFUA 3KC3A 2F2UA 3PTGA 3S4QA 3L9MA 2JDOA 3IS5A 4EL9A 4MWIA 1OUYA 4YJUA 4EH3A 2OJFE 3U9NA 2JKOA 5CU3A 4YLJA 5KKRC 2YDKA 1VEBA 2QURA 3F5XA 4EZ5A 5EOBA 3HGKA 2FH9A 3ODZX 3RWQA 4UMRA 5BVFA 3DK7A 4FKLA 1U54A 4YLKA 5IDPA 2C5VA 2CLXA 3LM5A 4GW8A 4JAJA 5CEKA 3EOCA 4LMNA 2W9ZB 2YM6A 4IWPA 4MCVA 4EUUA 4F1TA 2QQ7A 1XH9A 4EQCA 4EYJA 3K5UA 2PU8A 4USEA 5EHLA 2ITWA 3W33A 4K0YA 4C3RA 2E9OA 4BN1A 4FTJA 4KIKB 2GNHA 3C4ZA 3GC7A 2XF0A 3DY7A 4RVLA 3OBGA 4IB3A 4TNDA 4F99A 2IVVA 4AT3A 1NA7A 4O84A 1R78A 2JC6A 3QZIA 1ZYLA 5H8EA 4R3CA 4EOIA 3UP7A 1TVOA 2RKUA 2W05A 4BKJA 4GVAA 4C0TA 4L3PA 4F7LA 4DCEA 3KXXA 3UOJA 3FUPA 3VHKA 2ZYBA 3SRVA 1YXXA 1RW8A 2RL5A 4GIIA 3DQWA 4RJ4A 4XV3A 4TN6A 2Y7JA 2BPMA 5E1SA 4FNWA 4Y5QA 3TUDA 4NJDA 4PUZA 5CU2A 2HW6A 5LCJA 2QHNA 4O6LA 2PTKA 2HWPA 3M2WA 5EG3A 4QTCA 3TNPC 2J0MB 3QC9A 3O17A 3LFAA 3EN5A 2E2BA 4JQEA 4GEOA 3ZC5A 1TKIA 3A4PA 3A60A 2C6OA 3MYGA 3R7YA 5DE2A 4FKQA 1BMKA 2WMXA 4O0SA 3Q3BA 3F3WA 3F7ZA 4O27B 2JFLA 3F3ZA 4C36A 4J52A 2CGUA 4HYHA 1OPLA 3GC8A 4R8QA 3QUDA 4DEHA 4IFCA 5CASA 2UUEA 2XS0A 4Y95A 4XV1A 4JIKA 2JKKA 4K1BA 3HA6A 4R5SA 4WNMA 2A4LA 3VO3A 4A4LA 5HIDA 2BILB 4BBFA 2ZM1A 4QTAA 3QA0A 1TQPA 2YAAA 5CI6A 5AIRA 3TM0A 4AOIA 2XVDA 4ZJJA 4ZTMA 4YC3A 5HU9A 4F70A 2X4FA 4HJOA 4DT8A 4LV8A 2YLEA 3O23A 5AR8A 2WIHA 3R1QA 4ASDA 3MY1A 3ATSA 3V5TA 3SC1A 5ANDA 2H96A 4I24A 4A4OA 3L8PA 2JEDA 4E4MA 3BV2A 4GG7A 4XJ0A 1CMKE 3BGPA 3OCSA 3TTIA 2WTVA 5JZNA 4ERWA 4XX9A 2HZ0A 5AAEA 3CCNA 2G1TA 3FSFA 2VWIA 3W10A 3ZUVA 3C0HA 3IDPA 3PG3A 1S9JA 2PE2A 4MBIA 1M2RA 1GIHA 4APPA 3LQ5A 3HUCA 4MKCA 3LMIA 3OCBA 5CEOA 4I5PA 4E73A 3LKMA 3H9RA 3PSCA 4EOQA 3CEKA 4D4RA 5HE2A 2WU7A 3C4EA 1DS5A 3C5IA 3UGCA 5LMKC 4RA4A 3F82A 4FGRA 3IW6A 1UWHA 2YISA 4PRJA 4MXZA 5HCYA 3HV6A 2W96B 1H07A 4O0TA 5CYIA 5K5XA 4RFMA 1I44A 3MW1A 2UZWE 3MSSA 3ZSIA 4O2PA 4D2VA 4PP7A 2XZSA 2WFYA 2YZLA 2WB8A 3AMAA 5EI2A 2PUUA 5H9BA 3A4OX 2J51A 3ITZA 3GCUA 3R9NA 5KKRB 4FVRA 4HNIA 3ZDIA 2Q83A 2ZOQA 3G15A 3M1SA 3MIAA 1PXJA 2W1FA 2YCSA 4H39A 5AR5A 3UPXA 5HTCA 3ROYA 3LFSA 3C9WA 2RFSA 3E5AA 4HPTE 3FMJA 4ASZA 4I5HA 2WQBA 2W17A 4IAIA 4WKQA 3L9PA 2XEZA 4ITHA 1H1PA 4AS0A 4JDJA 4JVGA 3NUAA 3U54A 4E1ZA 4YTFA 3EQGA 3Q32A 3QHWA 4I23A 3PVUA 5DN3A 5I9YA 3LCTA 1IAHA 1WBWA 5J9YA 2E9UA 4KIPA 2BRNA 3LXNA 3SXSA 2B7AA 4AN9A 3AC8A 5EKNA 2EUFB 5J87A 4BF2A 3ZUTA 3WF6A 4FEQA 4IQ6A 1RJBA 2R2PA 4ZSGA 5GJFA 2YJSA 3F88A 3FLWA 1XKKA 4X2FA 4CQEA 3GVUA 4OUCA 4CG9A 5M09A 2OWBA 3U4UA 5AM6A 5HVYA 3OY1A 1ZOEA 4XG9A 3Q60A 4I0TA 3ORLA 3AGMA 2OLCA 2YWPA 3OUKA 1NVQA 5D12A 3MB6A 4QPSA 5CF8A 3RM6A 1STCE 3D94A 4S2ZA 3I4BA 4FTNA 4YC8A 4IJPA 3JYAA 2QOQA 3VUHA 1UU7A 3OUNB 1K3AA 1WBNA 2R3JA 2C5NA 4KRDA 3W32A 2VX1A 4CT1A 4GFMA 3KB7A 1SNXA 4I6QA 4ITIA 4AUAA 4XH6A 2WMRA 1TQMA 2PWLA 1X8BA 1CSNA 4G6NA 5GHVA 3F3VA 4WNKA 4YZNA 4E5BA 2HXQA 4LRMA 3LFBA 3SV0A 2CHLA 1YWVA 4KB8A 5TKDA 3ZLWA 5KZIA 4BCQA 3VS6A 5HO7A 3QA8A 4DG3E 2NRYA 2Y6OA 2OFVA 4C59A 4DLIA 4FKGA 3AT3A 2R3QA 4ZAUA 4FTMA 3R63A 2PUIA 4QYYA 4NSTA 3QBNA 4FV1A 4XOYA 5E8UA 2XKCA 3D14A 4KIKA 4MXCA 4DEDA 1ZARA 2IG7A 1BL6A 2REIA 4Z55A 4NM7A 4U8ZA 5AV4A 4OLIA 2C3IB 1H1WA 3ZYAA 2BHHA 4RVMA 5JFVA 5FBNC 4KBKA 4NEUA 4BWPA 2WMUA 5TOZA 5KMIA 4PDYA 4FSRA 3PIZA 3SW7A 3TDVA 2C6LA 1CKPA 1U59A 2YM8A 5KMNA 4TXCA 4PY1A 4A06A 3CY2A 4XS2A 3H9FA 3AMYA 4RWKA 2O65A 2BZJA 4UEUA 1V0BA 4U0IA 4C4IA 5D11A 1FPUA 4L3JA 5EW3A 4ZSAA 1UVRA 1XQZA 3Q53A 4KKGA 4CYJA 2VTAA 4GUBA 3CSVA 4Y46A 2GPHA 4Q9SA 4JG6A 4FOCA 2HZNA 5CSXA 3MA6A 1G3NA 3ORXA 2IW8A 3M42A 2ZJWA 4L46A 4O6EA 5KHWA 3RI1A 2XP2A 1H1RA 3NNXA 4DH3A 2NO3A 3MA3A 1G5SA 3EN9A 4CG8A 4RPVA 4IDVA 4FODA 3PUPA 2W5BA 4BBMA 1OL7A 3GQIA 5AUYA 2GQRA 1WCCA 4TT7A 2RGPA 2XCHA 4WRGA 3C4WA 3VBWA 3DKOA 3NEWA 3FI2A 4PMSA 4CLJA 1UV5A 2W1DA 4K9YA 5B2MA 5BVDA 5IUIA 3QQUA 4DINA 3QQLA 5E8YA 4DTBA 2B54A 4CGAA 4BDKA 3R1NA 2BDWA 5M55A 4IX4A 3ORZA 2OBJA 1Q8UA 3NSZA 3QRJA 5GIOE 1W7HA 3R0TA 4G3GA 2WEVA 5ANJA 2ZDTA 4ZTSA 3S1HA 3R8PA 4UYAA 3EKKA 4G9RA 2CSNA 3FY2A 4I6BA 4S30A 3Q9YA 3ZSGA 4AE6A 3R00A 4WSQA 2VRXA 3S3IA 2V7AA 3F3TA 4PTCA 3QCQA 3QQHA 5C26A 5LCKA 4ID7A 1F3MC 5FXSA 1PKGA 1JSTA 3UODA 4FG8A 4PV0A 5AUXA 3WZEA 5KMOA 4CCBA 4C4EA 4FSNA 4UXQA 5E8WA 3DT1A 2B1PA 2I0EA 2X7FA 4FV6A 4YPDA 5AP6A 1J7UA 5AA9A 2X9EA 3FLNC 1QMZA 2VO0A 5DA3A 4QYFA 2VNWA 3KMMA 4XV2A 1YXTA 3U87A 5EM5A 1ND4A 5IA2A 3NGAA 3IW5A 4DG0E 3AC3A 4HCVA 3GUBA 3LXKA 2VTRA 4K18A 1Y57A 2VTNA 4F6WA 4ASXA 3TTJA 3D4QA 5AR3A 5DEWA 2XM9A 4JLCA 4IVBA 4D9TA 5AP7A 5DI1A 4KA3A 3HRCA 2XJ0A 2IZSA 5FTOA 5J95A 3D7TA 2H8HA 4M0YA 4C38A 3TUCA 2Q0NA 4IC8A 4M14A 4YGAA 4XMOA 3MI9A 1YOJA 4FKIA 4MF0A 3TZMA 1P5EA 2GTNA 3TEIA 3V5QA 4NM3A 5I9ZA 4Y73A 2QKRA 4RIYA 4GT5A 3AT2A 4S33A 3W2SA 1AD5A 4J8NA 2VWYA 4RA5A 2QKWB 4C4JA 5CTPA 2GNJA 1M17A 2X8EA 5E90A 3OFMA 3OOGA 5FGKA 1H27A 3R7OA 3PG1A 3VBTA 4FKSA 3CGFA 5D10A 1Y8GA 4FE2A 4D4SA 3CTJA 4F0FA 1XH7A 4QP2A 2E9VA 3KVXA 5E7RA 4LFIA 4F9CA 4YU2A 1KSWA 1IG1A 1J1CA 4DFNA 2EXCX 3BHYA 4BZOA 5G1XA 2GQGA 5CU4A 3DV3A 3TACA 4EWHA 4L9IA 3KKVA 4YO6A 1ZYCA 4EK5A 4QMOA 3WYYA 2R3IA 3NNVA 4U7ZA 1QPJA 2BZIB 4USDA 1Q8WA 2PL0A 3A8XA 4Y72A 3UVRA 4ALUA 5CQUA 4EEVA 3CLYA 3OT8A 2GNIA 4QMZA 3R30A 4OW8A 2O2UA 4IVDA 2OW3A 5EW9A 5FM2A 2CLQA 3VUMA 2R3NA 4OBOA 3U4WA 5GIPE 3NRMA 4QPMA 5FEQA 3CIKA 3KU2A 2GHGA 3A99A 3BHHA 4JDHA 3NDMA 1BUHA 3I0OA 4L45A 5FP5A 5C03A 4B7TA 2C47A 3LCKA 4ENXA 4RIOA 3HV7A 4OTPA 3HKOA 3KXZA 5EYMA 1ZAOA 3UTOA 2OZOA 3P7CA 2F7ZE 3QTRA 4KSPA 3IGOA 3L9LA 4WT6A 5ANEA 2VTLA 5DT3A 5LARA 4BCOA 5KX8A 1WBVA 4FT3A 2WPAA 3DCVA 2IN6A 3QFVA 2OF2A 4KIQA 4J98A 3OG7A 4CFVA 4FK6A 5HG7A 5JMSA 4AQCA 3BBTB 4DFZE 4NYEA 4BWXA 3E93A 3QC4A 3E7OA 4JBOA 3R1SA 4NIFB 4DITA 3LW0A 4F1OA 5CLPA 4RFYA 4F7JA 4FKUA 2R0IA 5IH5A 3PP0A 4FX3A 4A07A 4BCFA 2QVSE 4JG8A 5B2KA 4HCUA 2P3GX 3V8TA 4FZ6A 3KVWA 4NU1A 4YLLA 4PPAA 1LP4A 5JRSA 3TKHA 3VVHA 5BUIA 2R7IA 4S34A 4C4FA 3VS1A 2F7XE 3L1SA 4Q2AA 4WBBB 4BDJA 3EB0A 1U5RA 2XCKA 2PVFA 4ZZMA 4FUXA 5M53A 3BHUA 1Q8ZA 3ETAA 3ZRKA 4ZIMA 2UW6A 3ZLXA 1E9HA 2PVNA 5BQ0A 5HLNA 3K3IA 2QU6A 3WF9A 5C4KA 4J71A 3E87A 4QP1A 3PWYA 4RVTA 4JJRA 4IZ5A 3EN6A 2C6DA 3NIEA 1P4FA 1XH5A 4M3QA 4RC3A 4JIAA 4O38A 4QMYA 4EKLA 5HLWA 1WBOA 2W5HA 5EHYA 3P78A 4HYIA 1YW2A 3BQCA 3BELA 4EH2A 3TCPA 4M66A 2NRUA 4U45A 2O0UA 3P79A 4HGLA 1XWSA 4OTQA 3AD5A 5LMKA 4O7NA 2UVYA 1OL1A 2EU9A 1AQ1A 3I7BA 5CZIA 4B0GA 4EH5A 5KBRA 2F49A 5M51A 3FYJX 2VNYA 3LQ3A 1PMUA 3GU4A 2QG5A 4PL3A 4W4XA 4EOMA 3W2RA 3KULB 4KSQA 3FXXA 3KF7A 5JT2A 1XH6A 4G6OA 3NCZA 1ZYDA 4AAAA 1YWRA 3PJ2A 2CJMA 2WTDA 2YACA 3PIYA 2P55A 4E3CA 3HEGA 3PP1A 4G31A 5A4TA 4IX3A 4EK3A 4GT3A 4EYMA 3HYHA 3KXHA 4EJNA 3H0YA 3G0EA 2J90A 3RM7A 3VW6A 3K5VA 4L67A 4IB1A 4PDPA 1A06A 4C33A 2QLUA 3KN5A 4FIFA 3HP5A 3VBYA 3HMNA 3HRFA 4PDOA 2BIYA 4FSZA 2QOCA 4Z3VA 5HHWA 2RF9A 4BZNA 4IH8A 2J0KA 4O91A 3D5XA 3I81A 2OG8A 3TNIA 3FJQE 3HMPA 4YZCA 2JAVA 1F0QA 1MUOA 3PA5A 4LL5A 1BI7A 4B8MA 3MFTA 2IZUA 4PL4A 4AW0A 3ELJA 3IONA 1GZOA 4O7YA 3CQEA 5I0BA 3L8VA 4NH1A 4TWPA 3PPJA 4X3JA 3MVMA 5HG8A 3LFDA 5AAFA 3MY0A 4QP8A 5IQGA 4FKRA 4YNOA 2OH4A 3JVRA 4N6ZA 5EK7A 2JDRA 4TWOA 3ZLSA 4AZWA 1PXIA 5AR4A 3MBLA 5A4LA 3VBVA 4BI0A 4BIBA 3D15A 1J1BA 2OFUA 3PY3A 4FZDB 4EH7A 3RGFA 5FDPA 3E8DA 3FMNA 4MBLA 2XIKA 2R7BA 3MVJA 3OC1A 3W55A 3QRUA 4E7WA 1PY5A 1Y6BA 4MXXA 1FVVA 5EM6A 2GS7A 5AP4A 4YTIA 2PVMA 2WOTA 3KXNA 2GCDA 4IAFA 4X3FA 1LUFA 2A2AA 2O64A 2OXYA 5B7VA 3MH0A 1T46A 4CFXA 2RFEA 3H30A 3MFRA 3BYUA 1OKVA 2YIWA 3ORPA 3IK3A 4FV5A 2AC3A 4A7CA 3QD3A 4RJ8A 5G6VA 3ZUUA 3CKWA 4M8TA 5HIBA 3VJNA 5CF4A 3TIYA 3AXWA 2YERA 2G2HA 4YHJA 3IW4A 3VNTA 3QHRA 2O63A 3II5A 4FIEA 5AUWA 4WG3A 2XYNA 4QMSA 1VR2A 5HD4A 4XBRA 4BL1A 2O3PA 4XG2A 2CGVA 4FKWA 2VWBA 3PJCA 3OCGA 4G1WA 5E8ZA 3C1XA 4X7QA 2OU7A 2XK7A 4F7NA 4Z7GA 5L4QA 5HO8A 3BX5A 5HBHA 1WMKA 2C0OA 5CNNA 5CU6A 5IH6A 4R5YA 4FIGA 1Q8YA 3KL8A 4EK8A 4GU9A 4OTHA 1YOMA 2UZOA 2W0JA 3FC1X 3K54A 3NW6A 3RPRA 3B2TA 3FKNA 3I5ZA 3UNZA 4O7WA 4QTEA 4RZVA 3UVQA 4ZZNA 4GVJA 2VO3A 3MV5A 4TTHB 3KFAA 4RJ6A 4C7TA 3RK9A 3UZTA 2PK9A 2V22A 2Y9QA 5H2UA 4D28A 4MD9E 5HKMA 1ZRZA 5D9HA 2ZV9A 2WTWA 3EHAA 3R2BA 3E92A 1QL6A 2ITOA 3QKMA 2OI4X 2OZAB 4FTUA 4G5JA 3CXWA 2QR8A 4N0SA 3F7WA 3ORKA 3E63A 4QMNA 2XK4A 2EB2A 1Z5MA 1U5QA 4XG7A 4G17A 4KS8A 3BZ3A 3JS2A 4JOAA 2UW7A 5DR6A 4ASEA 4F0IA 3WZJA 3PZHA 3FXZA 3FI4A 4B99A 4PTGA 5I9XA 1JOWB 4XOZA 3DOGA 3E3PA 1OL5A 3F66A 4FYNA 2ITXA 4CKIA 4YP8A 4QQTA 4UXLA 3F6XA 3OWLA 3R22A 5ANIA 2OJJA 4FEVA 3NAXA 4JS8A 3LE6A 4Z7HA 2RSVA 3TV4A 3MPMA 3EYHA 3NUPA 4FT7A 1EH4A 3HNGA 3T3VA 5JKGA 3AOXA 5LJJA 3KCKA 3NYNA 3O7LB 2PULA 3UZPA 1M7NA 5LOHA 2XRUA 1OM1A 4DH7A 3CR0A 3MH1A 3OT3A 3EL7A 3KMWA 2G2FA 4GCJA 4LI5A 4V0GB 4AXAA 2CKEA 3F2AA 3KMUA 5CVHA 3QTIA 5FDXA 3RPOA 2LGCA 3VQHA 2A27A 1WZYA 1H0VA 1HCKA 2VX3A 3VS2A 4AA4A 3DBDA 2QONA 3D5UA 5JQ5A 1Q8TA 2OKRA 4FNYA 4DEGA 5JN2A 2QOOA 1OECA 4IWOA 3NS9A 4J96A 2JD5A 3BRBA 5AUTA 4DYMA 1L3RE 4FTTA 4A9RA 3F5GA 2V7OA 4QQJA 4FL2A 1YHSA 3O8PA 5I9WA 4LQMA 3FDNA 3P0MA 3EYGA 4I6HA 4RVKA 5L6PA 2UZBA 4G34A 5LVLA 4HYUA 4EORA 2R3GA 3Q04A 3MPTA 3QX2A 5HLPA 5BVNA 4WOVA 1E1XA 3FWQA 2BFXA 4F65A 2EXMA 4FTLA 2VGOA 4IB5A 5CEQA 4XG3A 5B2LA 2IJMA 4EOSA 3SHEA 4GJ3A 3A8WA 3Q9ZA 4XG6A 5K4JA 1NVRA 1YDTE 4IZ7A 2B9IA 2VTIA 2X8IA 3U9CA 4ZS4A 5CWZA 4IFGA 4QD6A 1WBTA 4YJTA 4C4HA 4IIRA 4U3YA 4EHEA 2C6MA 5HG5A 5C01A 4XP3A 4OTFA 3FZSA 2OJ9A 3GCSA 4FV9A 3CD3A 4WO5A 5AP3A 1YRPA 5FTQA 2FA2A 4XBUA 4WD5A 3G0FA 2Y0AA 2CCIA 3DKFA 3FMHA 4DH1A 3QWJA 2P0CA 1H4LA 3P9JA 4DH5A 4KS7A 2GMXA 3ZHPC 4IX6A 3R9RA 2W1CA 4AZSA 3KXGA 5EDPA 4AGCA 5M4CA 1H1SA 1W84A 4GFGA 2ITQA 4MH7A 4NWMA 4J8MA 4C4GA 2QOLA 2HY81 4QMPA 4CKRA 2P33A 4I93A 4NFNA 4E6DA 1IASA 4H3PA 3ACJA 3UMWA 4EC8A 4IANA 2WTJA 4BICA 5DYJA 5BMMA 4CLIA 1PHKA 4LM5A 4G6LA 4KWPA 5CSHA 4ALVA 5EI8A 5J5TA 3V01A 3U6HA 5AFVA 1VYWA 5DFPA 3W2PA 3UYTA 2JITA 1B39A 3QD2B 3UNJA 4QNAA 4CFFA 2WKMA 4O2ZA 5AP1A 4R7BA 3LFCA 2HZIA 3NPCA 3EL8A 4WG4A 1KE8A 2XIZA 3QRTA 2QU5A 3QD4A 4WNPA 4X21A 5DEYA 4EOKA 2YCFA 1R3CA 3R8LA 4E4NA 4BDEA 4HPUE 3EWHA 5JFWA 1ZOHA 1YQJA 5F95A 1JSVA 2B4SB 4WSYA 5CVGA 5FXQA 4EK6A 3ANQA 4MTAA 5FWKK 4P2KA 4TW9A 4E6QA 2VZ6A 2UZUE 4PP9A 1NY3A 5EQEA 4MAOA 1FBNA 3LAUA 5CT0A 2GTMA 3NZ0A 2ZMCA 1W82A 3H0ZA 4CFWA 5AV1A 3BU6A 3O71A 3FMDA 4IADA 4N4SA 4F1MA 4BCJA 4NKAA 4I92A 4R6VA 3MJ2A 2P4IA 4YJNA 4IBMA 4MYGA 4W8DA 1OGUA 3ZLYA 1XR1A 2UVXA 4FIIA 2I0VA 5J79A 5J9LA 3BLQA 3ORNA 3I79A 4I20A 4CVAA 4JNWA 4LYNA 1M14A 4U40A 4CCUA 2VV9A 4C57A 3VUIA 2CKPA 4WIHA 1REJA 3UO6A 1P2AA 2C1AA 1W8CA 3R01A 3CQUA 3QX4A 5HEZA 2G01A 2B9JA 1JKKA 3PLAE 4YUQA 3IW7A 4MX9A 4NTSA 2C4GA 5K5NA 2NPQA 2I1MA 5CEPA 3M11A 4CFUA 4UMUA 5GJDA 5EOLA 3LLAA 2OJGA 5AV0A 4GU6A 4EHVA 5IF1A 1V0PA 2DWBA 1H26A 3O7LD 4D55A 5CAPA 1R0PA 3LXLA 3O2MA 4XG4A 4X2NA 3FLSA 4PQNA 3OMVA 3ZO4A 4BTMA 1CKIA 4QNYA 4RWLA 2GHMA 3LM0A 3OZ6A 5DPVA 3BLRA 3Q4CA 3Q96A 3OW3A 3T9IA 1Y8YA 4TYHA 1O6LA 5F94A 2CMWA 5AP2A 2BRHA 4L7FA 4JRNA 2NNWB 1YKRA 4LRKA 3IOKA 4UV0A 2PE0A 5FEEA 5KO1A 4AGWA 3Q2JA 3NNUA 3BEAA 3O50A 3Q4UA 2XEYA 3VUTA 3ZO1A 4AG8A 4EOJA 5ANGA 3BWFA 4NKSA 1M52A 4IACA 4L3LA 1MQBA 3WE8A 3VF8A 1APME 3O96A 4F9WA 5A4CA 3A62A 5I3OA 4O7LA 5AR2A 5IQHA 5M06A 4DGNA 3C50A 3LXPA 3MGYA 4YSMA 2VTOA 3R28A 5K3YA 5J5SA 2PVRA 1LEWA 3FLZA 3N4TA 3UP2A 3P5KA 3ZTXA 3OHTA 4DEEA 3C13A 3UOHA 4BKYA 1DI9A 4BWKA 4CXAA 4UBAA 2JDTA 4ZLOA 2JKMA 3IECA 4XCUA 4DFYA 3BYVA 3WBLA 3D9VA 4ZTHA 3OWPA 4GYGA 5CF5A 3UO5A 2BROA 3SVVA 4OBQA 4V0GA 3FBVA 2YIRA 4FR4A 5GJGA 2OXXA 3QTSA 2I7QA 2ITPA 1CTPE 1GZ8A 4D2SA 4EJ7A 4CKJA 3ZEWA 3AD4A 4J7BA 2WMAA 1ZY4A 3MVLA 4CMOA 3G51A 2JFMA 5CALA 2B52A 1W98A 4TY1A 3UYSA 3C51A 4H3QA 3THBA 2YIQA 4JBQA 4D2WA 4NM5A 3MTFA 2WTKC 3FSKA 4N70A 3RHXA 4A9SA 5GNKA 3PXYA 2VTTA 2IZTA 5LVMA 3VUKA 3NWWA 3PXZA 3V5PA 4XV9A 1MRVA 3EN4A 3I60A 4PF4A 4JBVA 4KD1A 4YPSA 3LQ8A 3VUGA 3KRJA 4C62A 4TRLA 4DLJA 4V04A 4ZK5A 4BDAA 3QLFA 4BCPA 3OVVA 4D5HA 2XIYA 4BB4A 4G3DA 1DM2A 2PUPA 4ZEGA 3OCTA 4D1ZA 5LXMA 5A6OA 3QYZA 3EKNA 4EOOA 3S95A 4ANLA 5IU2A 3NVMB 4L52A 2XK9A 4H36A 5C9CA 4BYJA 1VJYA 3UIUA 4D0XA 2C68A 2YJRA 2X4ZA 3CE3A 1W83A 3ZU7A 3ID6C 3FKLA 4ZY4A 5CEIA 2PMIA 3GP0A 5ETFA 5HBEA 4QP3A 3IPHA 3EQIA 4HYSA 3TN8A 3A61A 3GOKA 3DK3A 5FM3A 4OT6A 2ONLC 3TI1A 3NYOA 5BYZA 5IMEA 4Q5EA 5HG9A 2G15A 3UOKA 4PPCA 4V05A 4BCHA 4UZHA 4BI1A 4PMTA 3NCGA 4KBCA 2XK3A 2WTIA 4FG7A 3DAEA 4GKHA 4O7ZA 2QD9A 3PJ1A 3EFKA 3NYVA 5CU0A 2UV2A 3F5UA 3PPZA 5DH3A 2ITVA 2XNMA 4ZTQA 5BVKA 4AW5A 4ANSA 3C5UA 3A7FA 1Q41A 2W7XA 2IVUA 3UZRA 4FIHA 3HDMA 1GOLA 2WELA 1PXMA 2XKEA 2YDIA 2Z60A 4QMXA 4QMLA 3U6JA 3QQGA 2CNUA 5C8MA 1FQ1B 2UW0A 3GFWA 2QOHA 4L68A 1OIYA 4ANBA 5FP6A 3RZFA 2DYLA 2JAMA 3RCJA 2CCHA 1TQIA 4O7TA 1URWA 1FMKA 2OIDA 4WBOA 5HCZA 4DF3A 3V8WA 5AP5A 5CAQA 2BUJA 2NP8A 2YCQA 5L8LA 2UZDA 4FKOA 3DA6A 3QALE 5HE1A 1UA2A 4WUAA 1ZY5A 5IEXA 3R71A 1Q3WA 4AFEA 2XKDA 4R78A 2IZRA 3NR9A 4DEBA 5HVJA 2GSFA 4O96A 1LPUA 1OMWA 2ETRA 3LHJA 3PSDA 2WO6A 4OTGA 4AF3A 3GENA 4E4LA 5L2IA 3DKGA 4TPTA 1JPAA 4FTIA 4YZMA 4FSQA 5AMNA 4XG8A 4PWNA 3PDTA 3IDBA 4D0WA 2HY0A 3R2YA 3E8NA 4KUJA 5BX0A 2FSOX 4WG5A 4UYNA 3PXKA 3RP9A 4DTKA 3TZ7A 2HK5A 4ORKA 4FNZA 2YCRA 3OBJA 3TIZA 2X39A 2BR1A 2R3KA 2F57A 3RCDA 3TG1A 3WARA 3RWPA 3ZO3A 5AADA 1IAJA 3HMMA 3LMHA 3QTXA 3ZM9A 4TL0A 2W06A 2X6EA 3QRIA 3POOA 4ZY5A 3CD8A 5E92A 3ZC6A 4AOTA 3BHTA 5D7VA 2VO6A 2OK1A 2YM7A 3PXFA 3Q52A 2ZV7A 4M68A 1NXKA 2KTYA 5LMAA 5AA8A 1JWHA 3TJCA 5HO6A 4EZ7A 2HW7A 2Z2WA 4M12A 4TNBA 3KK9A 4FOBA 4RQKA 2XB7A 4L42A 3UJGA 4ACDA 4C58A 4TZRA 4M7IA 4RG0A 2WZJA 1DAWA 4D2PA 2VU3A 4HVDA 3WI6A 4A9UA 3ZS5A 4J95A 2YDJA 3QYWA 4M69B 1KV2A 4RIXB 3R8MA 3I7CA 4HGSA 1RDQE 4BCMA 1I09A 1QCFA 3CGOA 3KGAA 3VAPA 4H05A 4FKPA 2OIBA 4CMTA 5IUGA 2B0QA 1URCA 3KY2A 2E9NA 4FT0A 4LUDA 5E8SA 5KBQA 1HCLA 2WTKB 4ARKA 4P90A 3BYOA 3EQDA 2HYYA 3NYXA 3E3BX 4A9TA 2CKOA 4TYJA 4ZJVA 3TV7A 3IQ7A 3NUSA 3ULIA 2VTQA 4S32A 1OBDA 3FMLA 3LFEA 4DEIA 3CTQA 5EM8A 1K2PA 4F6SA 4ZLYA 4JRVA 5HU3A 1CKJA 3K3JA 3HV3A 1R0EA 3KQ7A 3PVGA 4MQ1A 4ZLZA 2W4OA 5CF6A 4Y83A 4YJPA 3ZDUA 2XJ1A 3QXOA 5EI6A 5HE0A 1JNKA 2QOIA 3OXIA 3N51A 3FLYA 3H4JA 5IEVA 3RAHA 1OBGA 4PX6A 1XHAA 4BDFA 4EOLA 2J50A 5M57A 3DU8A 2YM5A 3W8LA 3CC6A 4DBXA 5AR7A 1IRKA 1V0OA 5L2WA 3ZXZA 3COIA 4IVCA 3AMBA 2PHKA 2YIXA 2B53A 3LOKA 4GK4A 5EFQA 3VS3A 3MESA 4QYEA 4RIWB 4W8EA 2QODA 5HNBA 4NFMA 5K4IA 2J5FA 2ZB1A 5EKOA 5KMMA 2X81A 1JAMA 1P4OA 2J9MA 3PRFA 4C37A 1Q62A 3GU5A 3DZOA 3UIXA 5DLSA 5HBJA 5JFSA 3NAYA 4O0WA 4YBKA 4FYOA 4FGBA 4IXPA 2Z7QA 5C8NA 3K2LA 3U8WA 5M07A 4MNFA 3O8TA 4QQ5A 3MY5A 2XA4A 3I6UA 4I0SA 1ZOGA 2ITTA 4IVAA 1H8FA 5L2SA 2GU8A 4PDSA 3U51A 4I4EA 4OTDA 3F2RA 4IWDA 4X0MA 2J2IB 2FB8A 2XBJA 4R1YA 1Q3DA 4L01A 3HMOA 4K11A 3RNYA 5M4UA 4ACGA 4FSYA 5DGZA 5ANKA 4FTAA 5BVOA 4O7SA 5AUUA 3UIBA 1WBPA 2F2CB 3UC4A 4Y5HA 1FGKA 3DPKA 4ONAA 2QI8A 4H3BA 4GG5A 2JIUA 2R9SA 4NW5A 1S9IA 1YVJA 5D1JA 4QP7A 4RJ7A 5CAOA 1O6YA 3WF8A 4B9DA 3PA3A 3LPBA 4RBLA 2WAJA 5EHOA 3RKBA 3V8SA 3ZZWA 4B8LA 3HL7A 4F63A 3FMEA 4O1OA 3WF7A 4ZTNA 1OIQA 3TZ8A 5GINE 3KA0A 3BEGA 3PYYA 4KNBA 4C35A 5CX9A 4YTHA 3JR1A 1GIJA 4QYGA 2WMWA 2PZPA 4RX8A 1P14A 4QMWA 2C5YA 2OO8X 4LGDA 3FE3A 4NCTC 4U81A 1J91A 2Z7SA 4FSTA 5C1QB 4CSVA 2HXLA 1KUTA 5JRQA 4O7VA 1E1VA 5D7AA 5T3QA 3N4VA 2BTSA 4P5QA 4YTCA 3E64A 3HECA 4IHPA 4CNHA 1KV1A 1U54B 2C3KA 3IOPA 3WILA 4HGEA 3UBDA 3RZBA 1SVHA 2JLDA 5HX8A 2PMNX 4FICA 3TJDA 2I0HA 2V0DA 2GS2A 2ZAZA 5D41A 4FSUA 2VTSA 4ANMA 5KMJA 1NW1A 3R7IA 1BLXA 5IQFA 3PZEA 5JGAA 3EMGA 1GNGA 5E91A 3NW5A 3SXFA 5CT7A 3O0GA 3W18A 4OTWA 5BMSA 2Z8CA 2X2LA 3NUYA 5DIAA 4FL1A 5C27A 3RK7A 3TDWA 1JKSA 4BI2A 4DCAA 5IA0A 4L43A 2XNGA 1MP8A 3DNEA 4APCA 3KRXA 2Y4PA 1Z57A 2J4ZA 3QTQA 1H00A 5DRBA 2XKFA 2CPKE 4LMUA 5T6KA 1YHVA 2W5AA 4BY9E 4U80A 3DXNA 2ZV2A 3ZFMA 2ERZE 2ZM3A 1OITA 1FMOE 1PMEA 2UZLA 3KF4A 4UMQA 5HZNA 3U55A 3D7ZA 1PKDA 4WRSA 4CTCA 2R3MA 4TYGA 3BYMA 4CD0A 3BGQA 5AWMA 3R7GA 3BU5A 2XH5A 5IZFA 4BTJA 4J97A 3VHEA 4AT5A 4C3FA 4YO4A 3OP5A 5LWNA 5M56A 1OKZA 3EH9A 5FEDA 4YMJA 3CJGA 5E8VA 1Q99A 1RE8A 2OGVA 3DJ5A 4HZRA 4GK3A 4NTTA 3UG2A 2ZDUA 4YHTA 2ZVAA 3NVKI 3PVBA 4XRLA 2GS6A 3QU0A 5IQBA 3V5LA 2R3HA 1MQ4A 3G9NA 1WVYA 1OPKA 4FTCA 2X7GA 4D2TA 4LOQA 1PXOA 4K6ZA 5K0KA 2JIIA 4W4YA 4XRJA 2XJ2A 3I5NA 4H58A 2PZIA 3D83A 3F5PA 2W1HA 4EH6A 3L9NA 4ZOGA 1OI9A 1LR4A 4PL5A 3H3CA 3CS9A 5HI2A 4AOJA 3Q2MA 2B55A 4ZSJA 3R9DA 4KRCA 4GL9A 3PIXA 4XLIA 4EWQA 4H1JA 5H8BA 1J7LA 4IZYA 2IW6A 3BE9A 4O83A 4F4PA 2BCJA 4MF1A 2UW4A 1F5QA 4M69A 3AGLA 4DFLA 3EQBA 4RIXA 3S00A 3ZOSA 3DJ7A 5IUHA 5KMLA 1VZOA 2FUMA 4FC0A 4EZ3A 3KCFA 4L53A 5CS6A 5BVWA 4JDIA 3ZMMA 1ZWSA 3BI6A 3QLGA 4A9YA 2UZTA 4AW1A 2XYUA 4BFMA 2C6IA 4PPBA 2ITNA 2YM3A 3ENMA 4OBPA 1FINA 4J1RA 4O0RA 4M67A 5HNIX 4RWJA 1ZZ2A 1M7QA 2PVYA 2WMVA 2XIXA 5L6OA 3DJ6A 2XK8A 1J3HA 1ZZLA 3FL4A 3I6WA 2VAGA 2HENA 4BTKA 1YDRE 4DFUA 4ZJIA 5EQPA 2VTMA 4QTDA 4AP7A 1PW2A 1G8SA 3V04A 3PJ8A 3WE4A 1ZMUA 3EQCA 4LGGA 2O8YA 2WQNA 3R7UA 3AT4A 3SD0A 3LVPA 4U3ZA 3IDCA 1OL6A 1BI8A 3FMMA 5IA5A 4RT7A 4WA9A 5L6WL 4N57A 4F9YA 5IA3A 1OIUA 2SRCA 2WOUA 3QGYA 1PXNA 4FV2A 3RVGA 3ZSHA 3PLSA 4K77A 3CP9A 4FUYA 3D2KA 4I3ZA 3F9NA 3G2FA 4DFXE 3DXQA 2ONLA 2CGWA 3NUXA 2QC6A 4D1XA 1H08A 3EQRA 4EBWA 4EH8A 2VTPA 1H01A 2JDVA 2KULA 3QD0A 2EVAA 3AC1A 3AC5A 4RIWA 4M84A 4YZDA 5HORA 4GKIA 4AN3A 2PVKA 5GZAA 3QUEA 4C8BA 2WEIA 3GB2A 5HQ0A 4RZWA 5A4QA 2CNVA 4KIOA 5TT7A 3R04A 2GNLA 2Y6MA 2BFYA 4XEYA 3DS6A 5LQFA 4EQMA 5M08A 3DZQA 3L8XA 5IA4A 3F61A 2YEXA 4QMVA 4S31A 3ZRMA 2A19B 3QGWA 4CFMA 2YZAA 4NIFA 4QP6A 5DR9A 1PMVA 4AE9A 4EH4A 3BKBA 3GFEA 1YI3A 4DGGA 3TUBA 3MJ1A 3A7HA 3DAJA 4IM3A 4P7EA 3VBQA 4CQGA 3PY0A 4KKEA 2ERKA 3WZKA 1JSUA 4DGLC 4BTFA 2Y8OA 3GOPA 3EZVA 2C0IA 1H1QA 3MDYA 1SMHA 4AN2A 2EB3A 2XMYA 1U4DA 5ETCA 3FL5A 4BDDA 4FV8A 2ITUA 3FLQA 3QTWA 5BUEA 5A46A 2CN8A 5J1WA 1NT2A 2BAJA 4X2JA 4F7SA 4FEUA 3MB7A 2JKQA 4CTBA 1OKWA 3FPMA 4CZUA 4NUSA 2C6EA 3DBEA 1XO2B 4CZYB 2WQEA 3ORIA 2YA9A 4RJ5A 4UWBA 3SX9A 2XNPA 1KE9A 3GCVA 3VS0A 3V5WA 5CI7A 3C4CA 3QQKA 1IR3A 3ALNA 3EFWA 3PVWA 3RJCA 4D5KA 4HZSA 4JR7A 4X6RA 3T9TA 4NK9A 2XRWA 2AC5A 4IW0A 5AIKA 4QQCA 5BYLA 2UW9A 4O81A 4MWHA 3TNQB 4FTKA 3UMXA 3UQGA 3HV5A 4DGOA 1JKTA 4ZMFA 1OL2A 4GUEA 4RSSA 4C2WA 3G9LX 3R6XA 2AYPA 2VN9A 2I40A 3E8CA 5EDRA 3FI8A 3EJ1A 4LL0A 3EFLA 3TKUA 2W1IA 4DHFA 3R8VA 5IQAA 3KULA 1WVXA 3MN3A 3Q9XA 1SVEA 4W9XA 4QMQA 4R3RA 4FTOA 4O0UA 3QCXA 2CN5A 2R3RA 5IQCA 4G3CA 4GH2A 3BPRA 5F20A 2UW8A 3HV4A 3UVPA 2YABA 4R1VA 4LOPA 4EHZA 2HZ4A 2JDSA 4YZ9A 1XBAA 2Z7LA 3OTUA 1KE7A 2WU6A 4UY9A 3RAKA 1GZKA 4U5JA 1ZXEA 3QCYA 2H34A 3EFJA 3VS5A 5KHXA 4FEXA 2QO7A 2GHLA 3BLHA 4IC7A 4HGTA 3LCDA 4MNEB 3UDBA 5HVKA 3HVCA 3F2NA 3GCPA 4HVHA 2ZM4A 5HIEA 2UZVA 3PXQA 4AGUA 3HRBA 4CEGA 5I5ZA 4J53A 4JBPA 4NM0A 2FVDA 3MIYA 5T68A 3FV8A 2GQSA 5J9ZA 1L8TA 4BC6A 3OWKA 3FHIA 1NVSA 3SXRA 3RALA 5DT0A 3DFAA 3LCSA 3OW4A 4ZY6A 2WMSA 4ZS0A 1H25A 1GAGA 4AZTA 2QOBA 4MD8E 1KE6A 2W4JA 2PE1A 2J0LA 2V5QA 2Y4IC 1UNLA 4IE9A 4AWIA 2JBOA 2X0GA 4E8AA 1DI8A 5L2TA 4K8AA 4U9AA 2OH0E 3HMIA 4AZFA 3FAAA 4FG9A 1KWPA 4LG4A 3DXPA 2QHMA 1SNUA 4JQ7A 4QOXA 3GCQA 5FUTA 4DBNA 2UW5A 3ULZA 3PWDA 1ZMWA 2BAKA 1Y6AA 4EOPA 5CENA 3UNKA 2RFNA 3DTWA 4PTEA 4JR3A 3W8QA 3MH3A 2PZ5A 3HUBA 4QMTA 2FSLX 3JPVA 1BKXA 3G33A 5F4NA 4DGMA 4F9AA 5IQEA 3O8UA 1PMNA 3VBXA 1OZ1A 4O82A 4XP0A 2J0IA 4JQ8A 2PVJA 4RRVA 5I9VA 3RPVA 3RAIA 4MQ2A 3V3VA 4YJVA 1UNGA 4X6QC 3SKCA 3KN6A 3ZM4A 2IWIA 5HGIA 4DG2E 3SG8A 3EN7A 4ZSLA 2JBPA 2HWOA 1ERKA 4D9UA 1QPCA 5CANA 3HP2A 4I5MA 3RBWA 3Q5IA 5AX3A 4YHFA 4V01A 4GV1A 4L00A 2ITZA 3ODYX 2W9FB 3FY0A 3LMGA 3R83A 2YM4A 5KMKA 4ZMEA 4PMPA 3IW8A 1W0XC 2UW3A 4IDTA 2C5OA 3RHKA 2R3OA 3LCOA 2ZV8A 3OD6X 2XM8A 4IX5A 5AV2A 4ACCA 2BZHB 1XH4A 2JIVA 2XNBA 3FMKA 3KRWA 4FTRA 5DRDA 4NT4A 2XNOA 5FG8A 5AEPA 3LZBA 2PZYA 3EQFA 3WIKA 4AFJA 1H28A 3CY3A 4CRSA 4MHAA 1FVRA 3OOMA 2GFCA 3POZA 2C5XA 3A7IA 3A2CA 5CY3A 3WOWA 4GK2A 4F0GA 1OKYA 4ANOA 3OXTA 3W1FA 4BDCA 2ITYA 3QTUA 1WVWA 4EH9A 4EI4A 1SZMA 2O5KA 4I94A 2Z02A 3JUHA 1SM2A 2OZAA 3SQQA 3V51A 3FZTA 4ZSEA 2OIQA 4NCTA 4U41A 4FVPA 3VRZA 2X7OA 1MRYA 2J6MA 3D7TB 3P7BA 3G6GA 4K33A 5DWRA 4KBAA 3MVHA 4FT5A 1PJKA 3DDPA 1CM8A 4ZXTA 2P2HA 3QXPA 2GNFA 3C4XA 4UB7A 5CSPA 1O6KA 5C4LA 3FC2A 5ACKA 4RIYB 3WIGA 1XBBA 4NZWB 2UZNA 2V55A 3EZRA 4YURA 5ETIA 4Y8DA 4FT9A 2QLQA 3SGCA 4XNEA 2VTJA 3G6HA 3W2CA 5HTBA 5LVOA 4EK4A 3TT0A 3MPAA 2R5TA 1OVEA 5CZHA 5HCXA 4IAYA 3SDJA 3P08A 4RWIA 2YITA 3TKIA 3OEZA 5J1VA 4W9WA 4BIDA 2WIPA 2QO2A 4FZ7A 4EHGA 4GYIA 2B9HA 4O1PA 2WMBA 1VYZA 4MVFA 3VWAA 3HZTA 3OS3A 2F4JA 1O9UA 3ZBXA 4BCGA 1BL7A 3PE2A 2DQ7X 3ANRA 5CQWA 5CSVA 4H1MA 5DHJA 4ANNA 2W1GA 2PZRA 1PYXA 3NX8A 5CVFA 4ZZOA 4NW6A 4I0RA 5I3RA 4RX5A 4RX7A 3ZH8A 2YHVA 4JDKA 1YOLA 4GIHA 4L8MA 4X3FC 3R9HA 4IZAA 3NUNA 4R7IA 3NLBA 4DT9A 4RC4A 2Y4IB 4YBJA 1Z9XA 5M4IA 3W16A 3EQPA 3QKLA 4OGRA 5HTIA 1OPJA 5EW8A 4IJ9A 4JAIA 4USFA 3FZPA 2YIYA 1PF8A 3LJ0A 3R73A 3GC9A 2JGZA 2OJIA 4JX7A 3VS7A 4DE4A 3FHRA 5ETAA 1GZNA 2X6DA 3ZZEA 5FQDC 4FK3A 2ETMA 3TZ9A 4R7HA 4BR3A 4TYEA 2PMLX 3D2IA 4GMYA 2B9FA 4BKZA 5DOSA 5FBOA 2IVTA 4DC2A 5L8JA 1GJOA 2QOKA 3PJ3A 4BYIA 3KK8A 4LUEA 5JH6A 4O0YA 2HAKA 1UKIA 1UWJA 2QOFA 3P1AA 4B6LA 3D0EA 1PXKA 3BGZA 3ENHA 4MNEA 2FSMX 3B8RA 3FXWA 3H10A 4YJOA 2WHBA 3P86A 1H24A 4IM2A 3RTPA 3BCEA 3JY0A 4BIEA 2ESMA 5I4NA 5CSWA 5M44A 3A7GA 3BIZA 3IGGA 2R4BA 3F69A 3LFQA 4U97A 5ACBC 5K9IA 1GY3A 3QQJA 4PMMA 3CJFA 1GIIA 3VQUA 4YSJA 5AAGA 3HLLA 4J99A 5B0XA 5KE0A 1B6CB 2ACXA 4ZTRA 3GU7A 3R21A 4G16A 4UMPA 4Q5HA 4ACHA 2PYWA 2E9PA 5HX6A 2XNEA 2QCSA 5F9EA 2CKQA 3P23A 4XUFA 4BCKA 4E26A 4CRLA 3OF0A 4RQVA 3Q6UA 1KE5A 4F9BA 4CT2A 5A9UA 2UVZA 2CGXA 4YC6A 3OWJA 1JLUE 4HVSA 4LOOA 4OTRA 5AV3A 5IMXA 3UQCA 4P5ZA 4E6AA 3AG9A 3DLZA 2BALA 3N9XA 4UALA 3TWJA 3CPCA 2VWVA 2VWXA 4XP2A 3FQSA 5IQIA 1MRUA 3IG7A 3LLTA 4FMQA 3UPZA 4AU8A 3DAKA 3UG1A 1R39A 3FPQA 3SW4A 4GRBA 3R8UA 2BDFA 3C0GA 3GT8A 3V6SA 3S0OA 2PPQA 3L8SA 4JT3A 4KINA 1UKHA 5LVPA 3QF9A 1Q5KA 4YJQA 5EDQA 4EKKA 3R9OA 3HAVA 2QNJA 3QZHA 5E8TA 1ZYJA 1ZMVA 5CAVA 4UMTA 5L3AA 5HNGA 1BX6A 2R3FA 4AA0A 3CPBA 2R64A 4E6CA 5I9UA 4OAUC 3BE2A 4U43A 4KABA 4LRJA 2ZB0A 4I41A 3VRYA 5JK3A 4DFBA 5FXRA 4W4WA 1IA8A 4MEDA 2PVLA 1OB3A 3VUDA 1JKLA 5CEMA 4EBVA 2FYSA 5IEYA 4U6RA 5EYDA 1G8AA 1DAYA 2VWUA 5DT4A 2G2IA 3PY1A 2FGIA 2V62A 3ZFXA 3UIMA 3FKOA 3B8QA 1Q24A 1YI4A 2IVSA 4RC2A 1QPEA 3GNIB 4O21A 4E20A 4QYHA 4GS6A 4E5AX 3MH2A 3NIZA 3IO7A 5GZ9A 5AJQA 5M4FA 3QZGA 1LEZA 2ETKA 4MXOA 2BTRA 3ERKA 5DNRA 3ZO2A 3DTCA 1XH8A 4RGJA 3MS9A 3DK6A 4F64A 4OR5A 4QMUA 4YNEA 3R7EA 3ATTA 3SG9A 2C3JA 2R3PA 3ORMA 2YLFA 1SVGA 5A3XA 3PRIA 5IKWA 4P4CA 5AM7A 3SA0A 4IM0A 3MWUA 3QCSA 3CTHA 3R7VA 2FSTX 2GNGA 2Q0BA 2QO9A 4FI1A 2YFXA 5KCVA 4X3FB 2VWWA 3C4FA 4IAAA 1UU3A 4TWCA 4UZDA 3PSBA 4G9CA 1H0WA 3CBLA 3ACKA 4WUNA 3WZUA 3R8ZA 3QQFA 4TKSA 2J0JA 2LAVA 4QRCA 5E9EA 2X2MA 4ERKA 4MD7E 4O7RA 4X2GA 4Z9LA 3IKAA 5IISA 4QO9A 2VD5A 5ITAA 3BV3A 4I22A 5L2QA 5KNJA 3S2PA 3UC3A 4BDIA 4B4LA 3OY3A 3WYXA 5GZ8A 4CMUA 4YZBA 5AP0A 1PXLA 4E93A 4FV7A 3NNWA 4FZFB 3COKA 5HE3A 3GC0A 2GDOA 2WMTA 4ANQA 3BYSA 5K0XA 1WAKA 2WXVA 4D1SA 4UX9A 1YWNA 2AUHA 2F7EE 5EH0A 3Q6WA 4JL9A 1JBPE 3JVSA 4TYIA 4FVQA 5BYYA 1YI6A 2IPXA 2Z7RA 1OUKA 2W4KA 3A7JA 4ALWA 2W99B 3FZOA 4FF8A 5TR6A 4BGHA 4WHZA 5CXHA 3PA4A 4I21A 4I4FA 4RX9A 3DBFA 4C02A 3EQHA 4E5WA 3VS4A 4BRXA 5J7HA 5HD7A 4N6YA 4BVUA 2XK6A 4CZTA 3DLSA 1U46A 4X2KA 3O51A 5JFXA 1FOTA 3PPKA 2A1AB 4XYFA 3PE1A 2FO0A 4OAVB 4BDGA 3SLSA 4D4YA 1Q97A 4IWQA 2OSCA 2W1ZA 2WD1A 3R02A 4O86A 5A6NA 1KOAA 4Q9ZA 5IQDA 4YR8A 4MXAA 4BBEA 1JVPP 5BUJA 3AQVA 3AC2A 4AACA 2X9FA 2W1EA 5A54A 1M2QA 3F3UA 2HELA 2P2IA 3BU3A 2J7TA 4BZDA 3C0IA 2RG5A 2WNTA 1ATPE 1YXUA 3EIDA 1SYKA 4I6FA 4LV5A 3ZONA 2PSQA 3ZCLA 4FTQA 3QUPA 2VX0A 3RPYA 3ET7A 4K2RA 3B2WA 3E7VA 4IB0A 3DDQA 2PY3A 3TXOA 4I5CA 2EWAA 3ZFYA 3SAYA 4C34A 2XIRA 3GEQA 4IMYA 2WMQA 5JGBA 3ZXTA 3QWKA 5BVEA 4DAWA 3HX4A 5DBXA 4BCIA 4DEAA 4ITJA 5IG1A 4AW2A 5E1EA 5FLFA 3WZDA 3RPSA 4NJ3A 3PFQA 3V5JA 2R3LA 4F08A 4TWNA 1UU8A 1FGIA 2UZEA 5DG5A 4FSWA 4AGDA 3GU6A 3AD6A 3VW8A 4BGGA 1WBSA 3FZ1A 4IAZA 4M97A 4ACMA 4PNKA 4UWCA 5HESA 4FEWA 1UU9A 5JSMA 3P4KA 4F09A 3FEGA 2RFDA 5E4HA 2BIKB 5LVNA 3G5DA 1IA9A 3WF5A 1CDKA 3ALOA 1JQHA 3MFSA 2HOGA 1PXPA 2PVHA 4BDHA 3NMUF 1A48A 4ZTLA 2VO7A 5DMZA 2BZKB 1Q4LA 4O0XA 3VC4A 4DTAA 4HW7A 4BHNA 1UNHA 3QKKA 2I0YA 4RLKA 4DN5A 1XBCA 5EYCA 4O22A 2RG6A 4GJ2A 4II5A 3VJOA 2BRBA 4FV0A 2BKZA 2C0TA 4FKJA 4W4VA 2VTHA 5C8KA 4AT4A 1B38A 1YXVA 2WGJA 3TL8A 5DR2A 3COHA 3ZRLA 4L44A 4AX8A 4L6QA 3FQEA 5FD2A 3SRVB 3VULA 4YJRA 2WTCA 4FKTA 1A9UA 2J5EA 3Q4TA 4FSMA 3RAWA 4BGQA 2YWVA 4D4VA 3C7QA 4EC9A 5FTGA 4GFOA 3QRKA 3HA8A 2BVAA 4D58A 2YAKA 4FV4A 3I0QA 1ZLTA 3VF9A 3BQRA 4YJSA 2EXEA 2IW9A 1Q61A 3VIDA 4BHZA 1AGWA 2C6KA 2DS1A 4G2FA 3SOCA 4FV3A 4CV8A 3FZRA 4Y85A 2H9VA 2OXDA 5TO8A 3MTLA 1BYGA 3LJ1A 4QMMA 1R1WA 5KUPA 5F1ZA 4L7SA 3OROA 5CAUA 4MXYA 5E8XA 2CNQA 1WFCA 3QL8A 1REKA 5KZ0A 3DQXA 3LFFA 3TNHA 4JI9A 3KEXA 4QP4A 4U42A 4BCNA 4UN0C 4JX3A 4U44A 4E4XA 2XBAA 2I6LA 3I1AA 2BRGA 4KAOA 4R3PA 4ENYA 1YXSA 2C3LA 3DFCB 5A4EA 4C3PA 4QT1A 2BRMA 5HICA 5AUVA 4FL3A 4U79A 4FKVA 1YDSE 2CDZA 2DUVA 3QTZA 5LWMA 1ZYSA 1OIRA 3DGKA 4OT5A
chains in the Genus database with same CATH superfamily
2IO6A 3OEFX 3TV6A 3UOLA 5HOAA 2XNNA 3G90X 5DVRA 5EQYA 4O0VA 4RFZA 5J8IA 2WQMA 4AZVA 4EUTA 5IPJA 3COMA 3E8EA 2HIWA 3NW7A 2RIOA 4NL0A 3HDNA 5L8KA 3DNDA 2VUWA 1J7IA 4G3EA 5EM7A 5H8GA 4LGHA 4QEBA 3LFNA 1K9AA 3R1YA 3DB8A 4A4XA 3V6RA 4I1ZA 2WQOA 3T3UA 4DA5A 3REPA 1PYEA 4KKHA 5ICPA 5CNOA 2X8DA 3FQHA 4HVGA 3ORTA 3N4UA 3CQWA 4JG7A 2H6DA 4FNXA 1TFFA 5JQ8A 4MK0A 3KRRA 3LJ2A 3OXZA 4AA5A 3ZEPA 5ANOA 2PUNA 3P7AA 3W2OA 1YHWA 3Q9WA 5AX9A 5TE0A 5BNJA 2BDJA 3UQFA 5TF9A 3HAMA 3E62A 5JEBA 4RMZA 4DH8A 3D5WA 4R77A 3PXRA 4M0ZA 3JY9A 4AZEA 4EONA 2QR7A 1PRYA 4FBXA 2X2KA 4UWYA 5BPYA 1V1KA 4XLVA 4XHKB 3Q4ZA 2HCKA 2XUUA 4G5PA 3QAME 3RMFA 5IA1A 4GT4A 3Q5ZA 4FZAB 3ZBFA 3W0OA 2GFSA 1HOWA 2C69A 3DBQA 3KXMA 4HOKA 4QTBA 1IEPA 5CXZA 5JGDA 3GU8A 3CKXA 3U6IA 1M2PA 3JXWA 4EQUA 1T45A 2C6TA 4M13A 5EYKA 2VGPA 4F6UA 5J7BA 4JMQA 4PNIA 3QZFA 4FRFA 4ZP5A 3KREA 3FYKX 2C1BA 3GBZA 1XJDA 2OICA 2VWZA 3BHVA 4BDBA 3UO4A 3SOAA 4G3FA 5JZJA 2X1NA 3TYKA 3GQLA 1RQQA 4JXFA 2BKKA 2C30A 3RNIA 3DKCA 4MBJA 3BWJA 2A0CX 3UE4A 3T8OA 3RINA 1Y91A 5H3QA 2BMCA 2OF4A 3NUUA 4C2VA 5IDNA 5FRIA 2YN8A 4RJ3A 3ROCA 4TYHB 4HCTA 4CFNA 2PMOX 3OTVA 3GGFA 4QPAA 2ZMDA 3TNWA 3RK5A 4AAYA 3E88A 3DBCA 4IEBA 4D2RA 5AUZA 4OTIA 1FVTA 2BAQA 3LIJA 2QG7A 4HVIA 3GXLA 2R0UA 2A98A 4FIJA 4CV9A 3D5VA 3GI3A 3VN9A 4Z16A 5LMBA 1QPDA 4IAKA 2BHEA 5IH4A 1KOBA 3DB6A 4HNFA 4RLLA 3AC4A 3W2QA 4GSBA 3H9OA 3BBWA 4WNOA 4QP9A 4FA2A 3FI3A 2G9XA 4C61A 4CYIA 5A14A 2F9GA 3KRLA 4M15A 3MFUA 3KC3A 2F2UA 3PTGA 3S4QA 3L9MA 2JDOA 3IS5A 4EL9A 4MWIA 1OUYA 4YJUA 4EH3A 2OJFE 3U9NA 2JKOA 5CU3A 4YLJA 5KKRC 2YDKA 1VEBA 2QURA 3F5XA 4EZ5A 5EOBA 3HGKA 2FH9A 3ODZX 3RWQA 4UMRA 5BVFA 3DK7A 4FKLA 1U54A 4YLKA 5IDPA 2C5VA 2CLXA 3LM5A 4GW8A 4JAJA 5CEKA 3EOCA 4LMNA 2W9ZB 2YM6A 4IWPA 4MCVA 4EUUA 4F1TA 2QQ7A 1XH9A 4EQCA 4EYJA 3K5UA 2PU8A 4USEA 5EHLA 2ITWA 3W33A 4K0YA 4C3RA 2E9OA 4BN1A 4FTJA 4KIKB 2GNHA 3C4ZA 3GC7A 2XF0A 3DY7A 4RVLA 3OBGA 4IB3A 4TNDA 4F99A 2IVVA 4AT3A 3AKKA 1NA7A 4O84A 1R78A 2JC6A 3QZIA 1ZYLA 5H8EA 4R3CA 4EOIA 3UP7A 1TVOA 2RKUA 2W05A 4BKJA 4GVAA 4C0TA 4L3PA 4F7LA 4DCEA 3KXXA 3UOJA 3FUPA 3VHKA 2ZYBA 3SRVA 1YXXA 1RW8A 2RL5A 4GIIA 3DQWA 4RJ4A 4XV3A 4TN6A 2Y7JA 2BPMA 5E1SA 4FNWA 4Y5QA 3TUDA 4NJDA 4PUZA 5CU2A 2HW6A 5LCJA 2QHNA 4O6LA 2PTKA 2HWPA 3M2WA 5EG3A 4QTCA 3TNPC 2J0MB 3QC9A 3O17A 3LFAA 3EN5A 2E2BA 4JQEA 4GEOA 3ZC5A 1TKIA 3A4PA 3A60A 2C6OA 3MYGA 3R7YA 5DE2A 4FKQA 1BMKA 2WMXA 4O0SA 3Q3BA 3F3WA 3F7ZA 4O27B 2JFLA 3F3ZA 4C36A 4J52A 2CGUA 4HYHA 1OPLA 3GC8A 4R8QA 3QUDA 4DEHA 4IFCA 5CASA 2UUEA 2XS0A 4Y95A 4XV1A 4JIKA 2JKKA 4K1BA 3HA6A 4R5SA 4WNMA 2A4LA 3VO3A 4A4LA 4AQKA 5HIDA 2BILB 4BBFA 2ZM1A 4QTAA 3QA0A 1TQPA 2YAAA 5CI6A 5AIRA 3TM0A 4AOIA 2XVDA 4ZJJA 4ZTMA 4YC3A 5HU9A 4F70A 2X4FA 4HJOA 4MUQA 4DT8A 4LV8A 2YLEA 3O23A 5AR8A 2WIHA 3R1QA 4ASDA 3MY1A 3ATSA 3V5TA 3SC1A 5ANDA 2H96A 4I24A 4A4OA 3L8PA 2JEDA 4E4MA 3BV2A 4GG7A 4XJ0A 4AXEA 1CMKE 3BGPA 3OCSA 3TTIA 2WTVA 5JZNA 4ERWA 4XX9A 2HZ0A 5AAEA 3CCNA 2G1TA 3FSFA 2VWIA 3W10A 2IEWA 3C0HA 3IDPA 3PG3A 3ZUVA 1S9JA 2PE2A 4MBIA 1M2RA 1GIHA 4APPA 3LQ5A 3HUCA 4MKCA 3LMIA 3OCBA 5CEOA 4I5PA 4E73A 3LKMA 3H9RA 3PSCA 4EOQA 3CEKA 4D4RA 5HE2A 2WU7A 3C4EA 1DS5A 3C5IA 3UGCA 5LMKC 4RA4A 3F82A 4FGRA 3IW6A 1UWHA 2YISA 4PRJA 4MXZA 5HCYA 3W0PA 3HV6A 2IF8A 2W96B 1H07A 4O0TA 5CYIA 5K5XA 4RFMA 1I44A 3MW1A 2UZWE 3MSSA 3ZSIA 4O2PA 4D2VA 4PP7A 2XZSA 2WFYA 2YZLA 2WB8A 3AMAA 5EI2A 2PUUA 5H9BA 3A4OX 2J51A 3ITZA 3GCUA 3R9NA 5KKRB 4FVRA 4HNIA 3ZDIA 2Q83A 2ZOQA 3G15A 3M1SA 3MIAA 1PXJA 2W1FA 2YCSA 4H39A 5AR5A 3UPXA 5HTCA 3ROYA 3LFSA 3C9WA 2RFSA 3E5AA 4HPTE 3FMJA 4ASZA 4I5HA 2WQBA 2W17A 4IAIA 4WKQA 3L9PA 2XEZA 4ITHA 1H1PA 4AS0A 4JDJA 4JVGA 3NUAA 3U54A 4E1ZA 4YTFA 3EQGA 3Q32A 3QHWA 4I23A 3PVUA 5DN3A 5I9YA 3LCTA 1IAHA 1WBWA 5J9YA 2E9UA 4KIPA 2BRNA 3LXNA 3SXSA 2B7AA 4AN9A 3AC8A 5EKNA 2EUFB 5J87A 4BF2A 3ZUTA 3WF6A 4FEQA 4IQ6A 1RJBA 2R2PA 4ZSGA 5GJFA 2YJSA 3F88A 3FLWA 1XKKA 4X2FA 4CQEA 3GVUA 4OUCA 1VLRA 5M09A 2OWBA 3U4UA 5AM6A 5HVYA 3OY1A 1ZOEA 4XG9A 3Q60A 4I0TA 3ORLA 3AGMA 2OLCA 2YWPA 3OUKA 1NVQA 5D12A 3MB6A 4QPSA 5CF8A 3RM6A 1STCE 3D94A 4S2ZA 3I4BA 4FTNA 4YC8A 4IJPA 3JYAA 2QOQA 3VUHA 1UU7A 3OUNB 1K3AA 1WBNA 2R3JA 2C5NA 4KRDA 3W32A 2VX1A 4CT1A 4GFMA 3KB7A 1SNXA 4I6QA 4ITIA 4AUAA 4XH6A 2WMRA 1TQMA 2PWLA 1X8BA 1CSNA 4G6NA 5GHVA 3F3VA 4WNKA 4YZNA 4E5BA 2HXQA 4LRMA 3LFBA 3AKJA 3SV0A 2CHLA 1YWVA 4KB8A 5TKDA 3ZLWA 5KZIA 4BCQA 3VS6A 5HO7A 3QA8A 4DG3E 2NRYA 2Y6OA 2OFVA 4C59A 4DLIA 4FKGA 3AT3A 2R3QA 4ZAUA 4FTMA 3R63A 2PUIA 4QYYA 4NSTA 3QBNA 4FV1A 4XOYA 5E8UA 2XKCA 3D14A 4KIKA 4MXCA 4DEDA 1ZARA 2IG7A 1BL6A 2REIA 4Z55A 4NM7A 4U8ZA 5AV4A 4OLIA 2C3IB 1H1WA 3ZYAA 2BHHA 4RVMA 5JFVA 5FBNC 4KBKA 4NEUA 4BWPA 2WMUA 5TOZA 5KMIA 4PDYA 4FSRA 3PIZA 3SW7A 3TDVA 2C6LA 1CKPA 1U59A 2YM8A 5KMNA 4TXCA 4PY1A 4A06A 3CY2A 4XS2A 3H9FA 3AMYA 4BJJB 4RWKA 2O65A 2BZJA 4UEUA 1V0BA 4U0IA 4C4IA 5D11A 1FPUA 4L3JA 5EW3A 4ZSAA 1UVRA 1XQZA 3Q53A 4KKGA 4CYJA 2VTAA 4GUBA 3CSVA 4Y46A 2GPHA 4Q9SA 4JG6A 4FOCA 2HZNA 5CSXA 3MA6A 1G3NA 3ORXA 2IW8A 3M42A 2ZJWA 4L46A 4O6EA 5KHWA 3RI1A 2XP2A 1H1RA 3NNXA 4DH3A 2NO3A 3MA3A 1G5SA 3EN9A 4CG8A 4RPVA 4IDVA 4FODA 3PUPA 2W5BA 4BBMA 1OL7A 3GQIA 5AUYA 2GQRA 1WCCA 4TT7A 2RGPA 2XCHA 4WRGA 3C4WA 3VBWA 3DKOA 3NEWA 3FI2A 4PMSA 4CLJA 1UV5A 2W1DA 4K9YA 5B2MA 5BVDA 5IUIA 3QQUA 4DINA 3QQLA 2AQXA 5E8YA 4DTBA 2B54A 4CGAA 4BDKA 3R1NA 2BDWA 5M55A 4IX4A 3ORZA 3ML1A 2OBJA 1Q8UA 3NSZA 3QRJA 5GIOE 1W7HA 3R0TA 4G3GA 2WEVA 5ANJA 2ZDTA 4ZTSA 3S1HA 3R8PA 4UYAA 3EKKA 4G9RA 2CSNA 3FY2A 4I6BA 4S30A 3Q9YA 3ZSGA 4AE6A 3R00A 4WSQA 2VRXA 3S3IA 2V7AA 3F3TA 4PTCA 3QCQA 3QQHA 5C26A 5LCKA 4ID7A 1F3MC 5FXSA 1PKGA 1JSTA 3UODA 4FG8A 4PV0A 5AUXA 3WZEA 5KMOA 4CCBA 4C4EA 4FSNA 4UXQA 5E8WA 3DT1A 2B1PA 2I0EA 2X7FA 4FV6A 4YPDA 5AP6A 1J7UA 5AA9A 2X9EA 3FLNC 1QMZA 2VO0A 5DA3A 4QYFA 2VNWA 3KMMA 4XV2A 1YXTA 3U87A 4LV7A 5EM5A 1ND4A 5IA2A 3NGAA 3IW5A 4DG0E 3AC3A 4HCVA 3GUBA 3LXKA 2VTRA 4K18A 1Y57A 2VTNA 4F6WA 4ASXA 3TTJA 3D4QA 5AR3A 5DEWA 2XM9A 4JLCA 4IVBA 4D9TA 5AP7A 5DI1A 4KA3A 3HRCA 2XJ0A 2IZSA 5FTOA 5J95A 3D7TA 2H8HA 4M0YA 4C38A 3TUCA 2Q0NA 4IC8A 4M14A 4YGAA 4XMOA 3MI9A 1YOJA 4FKIA 4MF0A 3TZMA 1P5EA 2GTNA 3TEIA 3V5QA 4NM3A 5I9ZA 4Y73A 2QKRA 4RIYA 4GT5A 3AT2A 4O4DA 2NYAA 4S33A 3W2SA 1AD5A 4J8NA 2VWYA 4RA5A 2QKWB 4C4JA 5CTPA 2GNJA 1M17A 2X8EA 5E90A 3OFMA 3OOGA 5FGKA 1H27A 3R7OA 3PG1A 3VBTA 4FKSA 3CGFA 5D10A 1Y8GA 4FE2A 4D4SA 3CTJA 4F0FA 1XH7A 4QP2A 2E9VA 3KVXA 5E7RA 4LFIA 4F9CA 4YU2A 1KSWA 1IG1A 1J1CA 4DFNA 2EXCX 3BHYA 4BZOA 5G1XA 2GQGA 5CU4A 3DV3A 3TACA 4EWHA 4L9IA 3KKVA 4YO6A 1ZYCA 4EK5A 4QMOA 3WYYA 2R3IA 3NNVA 4U7ZA 1QPJA 2BZIB 4USDA 1Q8WA 2PL0A 3A8XA 4Y72A 3UVRA 4ALUA 5CQUA 4EEVA 3CLYA 3OT8A 2GNIA 4QMZA 3R30A 4OW8A 2O2UA 4IVDA 2OW3A 5EW9A 5FM2A 2CLQA 3VUMA 2R3NA 4OBOA 3U4WA 5GIPE 3NRMA 4QPMA 5FEQA 3CIKA 3KU2A 2GHGA 3A99A 3BHHA 4JDHA 3NDMA 1BUHA 3I0OA 4L45A 5FP5A 5C03A 4B7TA 2C47A 3LCKA 4ENXA 4RIOA 3HV7A 4OTPA 3HKOA 3KXZA 5EYMA 1ZAOA 3UTOA 2OZOA 3P7CA 2F7ZE 3QTRA 4KSPA 3IGOA 3L9LA 4WT6A 5ANEA 2VTLA 5DT3A 5LARA 4BCOA 5KX8A 1WBVA 4FT3A 2WPAA 3DCVA 2IN6A 3QFVA 2OF2A 4KIQA 4J98A 3OG7A 4CFVA 4FK6A 5HG7A 5JMSA 4AQCA 3BBTB 4DFZE 4NYEA 4BWXA 3E93A 3QC4A 3E7OA 4JBOA 1W2DA 3R1SA 4NIFB 4DITA 3LW0A 4F1OA 5CLPA 4RFYA 4F7JA 4FKUA 2R0IA 5IH5A 3PP0A 4FX3A 4A07A 4BCFA 2QVSE 4JG8A 5B2KA 4HCUA 2P3GX 3V8TA 4FZ6A 3KVWA 4NU1A 4YLLA 4PPAA 1LP4A 5JRSA 3TKHA 3VVHA 5BUIA 2R7IA 4S34A 4C4FA 3VS1A 2F7XE 3L1SA 4Q2AA 4WBBB 4BDJA 3EB0A 1U5RA 2XCKA 2PVFA 4ZZMA 4FUXA 5M53A 3BHUA 1Q8ZA 3ETAA 3ZRKA 4ZIMA 2UW6A 3ZLXA 1E9HA 2PVNA 5BQ0A 5HLNA 3K3IA 2QU6A 3WF9A 5C4KA 4J71A 3E87A 4QP1A 3PWYA 4RVTA 4JJRA 4IZ5A 3EN6A 2C6DA 3NIEA 1P4FA 1XH5A 4M3QA 4RC3A 4JIAA 4O38A 4QMYA 4EKLA 5HLWA 1WBOA 2W5HA 5EHYA 3P78A 4HYIA 1YW2A 3BQCA 3BELA 4EH2A 3TCPA 4M66A 2NRUA 4U45A 2O0UA 3P79A 4HGLA 1XWSA 4OTQA 3AD5A 5LMKA 4O7NA 2UVYA 1OL1A 2EU9A 1AQ1A 3I7BA 5CZIA 4B0GA 4EH5A 5KBRA 2F49A 5M51A 3FYJX 2VNYA 3LQ3A 1PMUA 3GU4A 2QG5A 4PL3A 4W4XA 4EOMA 3W2RA 3KULB 4KSQA 3FXXA 3KF7A 5JT2A 1XH6A 4G6OA 3NCZA 1ZYDA 4AAAA 1YWRA 3PJ2A 2CJMA 2WTDA 4QDEA 2YACA 3PIYA 2P55A 4E3CA 3HEGA 3PP1A 4G31A 5A4TA 4IX3A 4EK3A 4GT3A 4EYMA 3HYHA 3W0RA 3KXHA 4EJNA 3H0YA 3PUFC 3G0EA 2J90A 3RM7A 3VW6A 3K5VA 4L67A 4IB1A 4PDPA 1A06A 4C33A 2QLUA 3KN5A 4FIFA 3HP5A 3VBYA 3HMNA 3HRFA 4PDOA 2BIYA 4FSZA 2QOCA 4Z3VA 5HHWA 2RF9A 4BZNA 4IH8A 2J0KA 4O91A 3D5XA 3I81A 2OG8A 3TNIA 3FJQE 3HMPA 4YZCA 2JAVA 1F0QA 1MUOA 3PA5A 4LL5A 1BI7A 4B8MA 3MFTA 2IZUA 4PL4A 4AW0A 3ELJA 3IONA 1GZOA 4O7YA 3CQEA 5I0BA 3L8VA 4NH1A 4TWPA 3PPJA 4X3JA 3MVMA 5HG8A 3LFDA 5AAFA 3MY0A 4QP8A 5IQGA 4FKRA 4YNOA 2OH4A 3JVRA 4N6ZA 5EK7A 2JDRA 4TWOA 3ZLSA 4AZWA 1PXIA 5AR4A 3MBLA 5A4LA 3VBVA 4BI0A 4BIBA 3D15A 1J1BA 2OFUA 3PY3A 4FZDB 4EH7A 3RGFA 5FDPA 3E8DA 3FMNA 4MBLA 2XIKA 2R7BA 3MVJA 3OC1A 3W55A 3QRUA 4E7WA 1PY5A 1Y6BA 4MXXA 1FVVA 5EM6A 2GS7A 5AP4A 4YTIA 2PVMA 2WOTA 3KXNA 2GCDA 4IAFA 4X3FA 1LUFA 2A2AA 2O64A 2OXYA 5B7VA 3MH0A 1T46A 4CFXA 4O4BB 2RFEA 3H30A 3MFRA 3BYUA 1OKVA 2YIWA 3ORPA 3IK3A 4FV5A 2AC3A 4A7CA 3QD3A 4RJ8A 5G6VA 3ZUUA 3CKWA 4M8TA 5HIBA 3VJNA 5CF4A 3TIYA 3AXWA 2YERA 2G2HA 4YHJA 3IW4A 3VNTA 3QHRA 2O63A 3II5A 4FIEA 5AUWA 4WG3A 2XYNA 4QMSA 1VR2A 5HD4A 4XBRA 4BL1A 2O3PA 4XG2A 2CGVA 4FKWA 2VWBA 3PJCA 3OCGA 4G1WA 5E8ZA 3C1XA 3UDSA 4X7QA 2OU7A 2XK7A 4F7NA 4Z7GA 5L4QA 5HO8A 3BX5A 5HBHA 1WMKA 2C0OA 5CNNA 5CU6A 5IH6A 4R5YA 4FIGA 1Q8YA 3KL8A 4EK8A 4GU9A 4OTHA 1YOMA 2UZOA 2W0JA 3FC1X 3K54A 3NW6A 4AXCA 3RPRA 3NFFB 3B2TA 3FKNA 3I5ZA 3UNZA 4O7WA 4QTEA 4RZVA 3UVQA 4ZZNA 4GVJA 2VO3A 3MV5A 4TTHB 3UDTA 3KFAA 4RJ6A 4C7TA 3RK9A 3UZTA 2PK9A 2V22A 2Y9QA 5H2UA 4D28A 4MD9E 5HKMA 1ZRZA 5D9HA 2ZV9A 2WTWA 3EHAA 3R2BA 3E92A 1QL6A 2ITOA 3QKMA 2OI4X 2OZAB 4FTUA 4G5JA 3CXWA 2QR8A 4N0SA 3F7WA 3ORKA 3E63A 4QMNA 2XK4A 2EB2A 1Z5MA 1U5QA 4XG7A 4G17A 4KS8A 3BZ3A 3JS2A 4JOAA 2UW7A 5DR6A 4ASEA 4F0IA 3WZJA 3PZHA 3FXZA 3FI4A 4B99A 4PTGA 5I9XA 1JOWB 4XOZA 3DOGA 3E3PA 1OL5A 3F66A 4FYNA 2ITXA 4CKIA 4YP8A 4QQTA 4UXLA 3F6XA 3OWLA 3R22A 5ANIA 2OJJA 4FEVA 3NAXA 4JS8A 3LE6A 4Z7HA 2RSVA 3TV4A 3MPMA 3EYHA 3NUPA 4FT7A 1EH4A 3HNGA 1ST4A 3T3VA 5JKGA 3AOXA 5LJJA 3KCKA 3NYNA 3O7LB 2PULA 3UZPA 1M7NA 5LOHA 2XRUA 1OM1A 4DH7A 3CR0A 3MH1A 3OT3A 3EL7A 3KMWA 2G2FA 4GCJA 4LI5A 4V0GB 4AXAA 2CKEA 3F2AA 3BLAA 3KMUA 5CVHA 3QTIA 5FDXA 3RPOA 2LGCA 3VQHA 2A27A 1WZYA 1H0VA 1HCKA 2VX3A 3VS2A 4AA4A 3DBDA 2QONA 3D5UA 5JQ5A 1Q8TA 2OKRA 4FNYA 4DEGA 5JN2A 2QOOA 1OECA 4IWOA 3NS9A 4J96A 2JD5A 3BRBA 5AUTA 4DYMA 1L3RE 4FTTA 4A9RA 3F5GA 2XAMA 2V7OA 4QQJA 4FL2A 1YHSA 3O8PA 5I9WA 4LQMA 3FDNA 3P0MA 3EYGA 4I6HA 4RVKA 5L6PA 2UZBA 4G34A 5LVLA 4HYUA 4EORA 2R3GA 3Q04A 3MPTA 3QX2A 5HLPA 5BVNA 4WOVA 1E1XA 3FWQA 2BFXA 4F65A 2EXMA 4FTLA 2VGOA 4IB5A 5CEQA 4XG3A 5B2LA 2IJMA 4EOSA 3SHEA 4GJ3A 3A8WA 3Q9ZA 4XG6A 5K4JA 1NVRA 1YDTE 4IZ7A 2B9IA 2VTIA 2X8IA 3U9CA 4ZS4A 5CWZA 4IFGA 4QD6A 1WBTA 4YJTA 4C4HA 4IIRA 4U3YA 4EHEA 2C6MA 5HG5A 5C01A 4XP3A 4OTFA 3FZSA 2OJ9A 3GCSA 4FV9A 3CD3A 4WO5A 5AP3A 1YRPA 5FTQA 2FA2A 4XBUA 4WD5A 3G0FA 2Y0AA 2CCIA 3DKFA 3FMHA 4DH1A 3QWJA 2P0CA 1H4LA 3P9JA 4DH5A 4KS7A 2GMXA 3ZHPC 4IX6A 3R9RA 2W1CA 4AZSA 3KXGA 5EDPA 4AGCA 5M4CA 1H1SA 4QDVA 1W84A 4GFGA 2ITQA 4MH7A 4NWMA 4J8MA 4C4GA 2QOLA 2HY81 1W2CA 4QMPA 4CKRA 2P33A 4I93A 4NFNA 4E6DA 1IASA 4H3PA 3ACJA 3UMWA 4EC8A 4IANA 2WTJA 4BICA 5DYJA 5BMMA 4CLIA 1PHKA 4LM5A 4G6LA 4KWPA 5CSHA 4ALVA 5EI8A 5J5TA 3V01A 3U6HA 5AFVA 1VYWA 5DFPA 3W2PA 3UYTA 2JITA 1B39A 3QD2B 3UNJA 4QNAA 4CFFA 2WKMA 4O2ZA 5AP1A 4R7BA 3LFCA 2HZIA 3NPCA 3EL8A 4WG4A 1KE8A 2XIZA 3QRTA 2QU5A 3QD4A 4WNPA 4X21A 5DEYA 4EOKA 2YCFA 1R3CA 3R8LA 4E4NA 4BDEA 4HPUE 3EWHA 5JFWA 1ZOHA 1YQJA 5F95A 1JSVA 2B4SB 4WSYA 5CVGA 5FXQA 4EK6A 3ANQA 4MTAA 5FWKK 4P2KA 4TW9A 4E6QA 2VZ6A 2UZUE 4PP9A 1NY3A 5EQEA 4MAOA 1FBNA 3LAUA 5CT0A 2GTMA 3NZ0A 2ZMCA 1W82A 4CG9A 3H0ZA 4CFWA 1OGYA 5AV1A 3BU6A 3O71A 3FMDA 4IADA 4N4SA 4F1MA 4BCJA 4NKAA 4I92A 4R6VA 3MJ2A 2P4IA 4YJNA 4IBMA 4MYGA 4W8DA 1OGUA 3ZLYA 1XR1A 2UVXA 4FIIA 2I0VA 5J79A 5J9LA 3BLQA 3ORNA 3I79A 4I20A 4CVAA 4JNWA 4LYNA 1M14A 4U40A 4CCUA 2VV9A 4C57A 3VUIA 2CKPA 4WIHA 1REJA 3UO6A 1P2AA 2C1AA 1W8CA 2AEGA 3R01A 3CQUA 3QX4A 5HEZA 2G01A 2B9JA 1JKKA 3PLAE 4YUQA 3IW7A 4MX9A 4NTSA 2C4GA 5K5NA 2NPQA 2I1MA 5CEPA 3M11A 4CFUA 4UMUA 5GJDA 5EOLA 3LLAA 2OJGA 5AV0A 4GU6A 4EHVA 5IF1A 1V0PA 2DWBA 1H26A 3O7LD 4D55A 5CAPA 1R0PA 3LXLA 3O2MA 4XG4A 4X2NA 3FLSA 4PQNA 3OMVA 3ZO4A 4BTMA 1CKIA 4QNYA 4RWLA 2GHMA 3LM0A 3OZ6A 5DPVA 3BLRA 3Q4CA 3Q96A 3OW3A 3T9IA 1Y8YA 4TYHA 1O6LA 5F94A 2CMWA 5AP2A 2BRHA 4L7FA 4JRNA 2NNWB 1YKRA 4LRKA 3IOKA 4UV0A 2PE0A 5FEEA 5KO1A 4AGWA 2XALA 3Q2JA 3NNUA 3BEAA 3O50A 3Q4UA 2XEYA 3VUTA 3ZO1A 4AG8A 4EOJA 5ANGA 3BWFA 4NKSA 1M52A 4IACA 4L3LA 1MQBA 3WE8A 3VF8A 1APME 3O96A 4F9WA 5A4CA 3A62A 5I3OA 4O7LA 5AR2A 5IQHA 5M06A 4DGNA 3C50A 3LXPA 3MGYA 4YSMA 2VTOA 3R28A 5K3YA 5J5SA 2PVRA 1LEWA 3FLZA 3N4TA 3UP2A 3P5KA 3ZTXA 3OHTA 4DEEA 3C13A 3UOHA 4BKYA 1DI9A 4BWKA 4CXAA 4UBAA 2JDTA 4ZLOA 2JKMA 3IECA 4XCUA 4DFYA 3BYVA 3WBLA 3D9VA 4ZTHA 3OWPA 4GYGA 5CF5A 3UO5A 2BROA 3SVVA 4OBQA 4V0GA 3FBVA 2YIRA 4FR4A 5GJGA 2OXXA 3QTSA 2I7QA 2ITPA 1CTPE 1GZ8A 4D2SA 4EJ7A 4CKJA 3ZEWA 3AD4A 4J7BA 2WMAA 1ZY4A 3MVLA 4CMOA 3G51A 2JFMA 5CALA 2B52A 1W98A 4TY1A 3UYSA 3C51A 4H3QA 3THBA 2YIQA 4JBQA 4D2WA 4NM5A 3MTFA 2WTKC 3FSKA 4N70A 3RHXA 4A9SA 5GNKA 3PXYA 2VTTA 2IZTA 5LVMA 3VUKA 3NWWA 3PXZA 3V5PA 4XV9A 1MRVA 3EN4A 3I60A 4PF4A 4JBVA 4KD1A 4YPSA 3LQ8A 3VUGA 3KRJA 4C62A 4TRLA 4DLJA 4V04A 4ZK5A 4BDAA 3QLFA 4BCPA 3NFGB 3OVVA 4D5HA 2XIYA 4BB4A 4G3DA 1DM2A 2PUPA 4ZEGA 3OCTA 4D1ZA 5LXMA 5A6OA 3QYZA 3EKNA 4EOOA 3S95A 4ANLA 5IU2A 3NVMB 4L52A 2XK9A 4H36A 5C9CA 4BYJA 1VJYA 3UIUA 4D0XA 2C68A 2YJRA 2X4ZA 3CE3A 1W83A 3ZU7A 3ID6C