1JLUE

Crystal structure of the catalytic subunit of camp-dependent protein kinase complexed with a phosphorylated substrate peptide and detergent
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
339
structure length
337
Chain Sequence
QESVKEFLAKAKEDFLKKWETPSQNTAQLDQFDRIKTLGTGSFGRVMLVKHKESGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVAGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFTEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC SUBUNIT
publication title cAMP-dependent protein kinase: crystallographic insights into substrate recognition and phosphotransfer.
pubmed rcsb
source organism Mus musculus
molecule tags Transferase/transferase inhibitor
total genus 104
structure length 337
sequence length 339
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2001-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1jluE01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1jluE02
5CEQA 2J0KA 3RJCA 2PZRA 2E9PA 3EB0A 3F3ZA 3ORIA 2PMOX 5I5ZA 4CLJA 5HTCA 4BTMA 1MQ4A 5IQEA 3GT8A 2OJFE 5BNJA 5J5TA 5CQWA 1PXLA 1Q62A 3V6SA 3NPCA 5LQFA 4Z16A 3QTXA 3SHEA 3DFAA 4RWLA 3VIDA 4HYHA 5T68A 2B9HA 2GNHA 4DH1A 1YDSE 4KKEA 4DE4A 4GU6A 1YDTE 3BYOA 4ZSEA 3DQXA 5HU3A 4YC3A 3CQUA 2OXDA 3ZONA 1H24A 3NW5A 4JOAA 3W18A 3I5NA 4EL9A 3FI3A 4O1PA 4B4LA 2QU5A 4GW8A 4DLJA 2X6EA 4R7IA 5IPJA 2CDZA 2VAGA 2O63A 4G3GA 4K77A 3PG1A 5CXHA 5M4FA 4TYJA 5TF9A 4E6QA 1OB3A 3GGFA 4AXAA 2WMXA 4FKLA 4TKSA 3KXNA 1R0EA 4UMPA 4N6ZA 1PMEA 2J0JA 3ZH8A 1ZY5A 3RK7A 4IADA 3ZEWA 5FEEA 4RA4A 4QTDA 4X21A 5CAUA 4S32A 3QYWA 5AUYA 1QPCA 2PVHA 4BCJA 2H9VA 4PPCA 1QPEA 4JDKA 2X81A 2VUWA 3W2QA 1R78A 4PUZA 5L4QA 1Q8TA 3GC7A 4U42A 4V0GB 4XG7A 3D0EA 1IG1A 2PVJA 2UW7A 3O17A 2KTYA 3QTUA 4FV3A 4RSSA 5EM8A 1K3AA 4AF3A 2R3RA 3LLTA 4JXFA 5ETIA 5CENA 3EKKA 3H9OA 3Q60A 5ANJA 3ZSGA 4QMXA 2PUNA 5FTGA 3PE2A 3HA8A 4ARKA 4FV6A 4TRLA 3F2NA 2XIKA 2IZUA 2DUVA 1Y57A 3FLNC 4KIKA 5AUVA 1UU9A 2HY0A 4GT3A 1R3CA 2YM5A 3LIJA 4O22A 4W8DA 3UMWA 2YIRA 4S34A 3SW7A 4ZTLA 4NL0A 2V55A 1CKPA 2C6LA 2ITXA 4IVBA 4NEUA 3R9HA 4EBVA 5HO7A 3Q9YA 3IW6A 4RRVA 4YGAA 4RJ3A 3HMMA 3VS1A 4IVCA 5EFQA 4TWCA 1FMOE 3QA8A 3S2PA 3R8PA 4EKLA 4BDFA 3F6XA 2VX0A 2W1EA 3ORLA 3UQCA 3TEIA 1KE7A 2Z02A 1M14A 4KB8A 4R3PA 4CYJA 1M17A 2VV9A 4FODA 4MXOA 5M09A 3TUBA 4AU8A 4PQNA 2OIQA 1J7UA 1X8BA 4B99A 2PULA 3R9DA 3DAJA 3MH1A 5KMJA 3JUHA 2BHEA 2BKKA 4WG4A 5EM6A 1WBWA 5FEDA 2CGVA 2QR7A 4D2SA 5CAPA 5KKRB 2BDWA 3LXKA 3QBNA 4FNYA 4GUBA 4Y73A 3RAKA 4O0WA 1WBTA 2VTRA 3DQWA 2BKZA 4UEUA 2PUPA 4KABA 5HCYA 2CSNA 3L9PA 4QMWA 1B39A 4BWKA 1T45A 2IVVA 5LVNA 3QQHA 2FSOX 4Q5EA 3REPA 4O7RA 4V01A 5F20A 4CCBA 2YERA 3QRTA 4UALA 1TQMA 3QZGA 2GNGA 4G3DA 2IW8A 4CZUA 5EKOA 5JEBA 1YHWA 5IQDA 3L8VA 3DDQA 1H1WA 1TQPA 3FLYA 4I0SA 3ROCA 4BI0A 4AE9A 3BYVA 4EHEA 1ZRZA 5F1ZA 4FG9A 4EQMA 4CKJA 5LMKC 3NMUF 4QRCA 2XK3A 3KMUA 3OVVA 3QWJA 4WT6A 2OKRA 3K3JA 3RPYA 4ACCA 2XM8A 2W4KA 3O2MA 4KUJA 1ZMWA 3BYUA 2WMWA 4IDTA 2UZUE 1CSNA 5HNIX 1SNUA 5AM6A 2PU8A 5AIRA 3OXTA 2FB8A 4W8EA 3MY1A 5EHOA 4ASEA 4K0YA 3GENA 1P4FA 3C5UA 2YABA 4OTGA 4X2JA 3LM0A 5AP7A 5K0KA 4HNIA 2C3KA 3RWPA 3RHXA 3TL8A 2BFYA 3ATTA 5CSWA 5DRDA 4DINA 5IQAA 3MBLA 2JBPA 4O0RA 3R9OA 5L6PA 4IBMA 1QCFA 4AGWA 3CD3A 4FV0A 3MYGA 2QVSE 5JK3A 2OZAB 4YZCA 2YITA 4NSTA 2HW6A 4RFZA 4Y72A 5JGBA 2YACA 2HY81 4USDA 4BKJA 5K4IA 5FXRA 5C26A 1U5QA 4PMMA 4AW1A 5M51A 4R7HA 2VWXA 5GINE 4I6FA 3BLRA 4O83A 4K11A 4YJUA 3VS3A 5IQHA 5EH0A 5M57A 2XKFA 1E1VA 5AP5A 4GU9A 3FQEA 2BPMA 5CF8A 4XRJA 4CYIA 2UZEA 3IDPA 3LFCA 4CQEA 3OUKA 1J91A 2JDSA 2BDJA 3GU8A 4QP9A 2GQSA 5HE3A 1ZY4A 4YC6A 3CPCA 1JVPP 5CAVA 1CKJA 4RWKA 3UTOA 2Q83A 4JDJA 5KHXA 3PA5A 2W1IA 4FIIA 4I6QA 4QMTA 3RTPA 5E91A 2E9UA 1JSVA 2RFSA 4IX6A 5FP6A 4FV1A 5K5NA 2BDFA 3KQ7A 4E7WA 3F69A 1FMKA 4GVJA 4U41A 3ULZA 2IJMA 1A48A 3UO5A 3VF9A 3C4WA 4FKSA 5CQUA 4JR7A 4DT9A 5AP0A 4PL3A 4J99A 4BWXA 2WNTA 3FMDA 3SXRA 3W16A 1VYWA 4WKQA 4S31A 4BZOA 3M42A 1H8FA 4I93A 4I5PA 4F1TA 5AX3A 4CZYB 3LW0A 4M14A 5L8KA 4I22A 3N4VA 4RIYB 4LFIA 2CN5A 3FZOA 4GJ2A 3MTFA 4WNKA 4C61A 2RFEA 4QD6A 1NY3A 4E1ZA 3ETAA 4MK0A 4ZJVA 1Q99A 3V8TA 4BYIA 3TV4A 2R3IA 4NIFB 4FZ7A 4OAVB 1L8TA 3AD5A 4M84A 5CVGA 3UYTA 4QP2A 5CVFA 4Q2AA 2ONLA 4Z55A 3CS9A 3UOKA 3QCXA 1HCKA 4BDJA 4OAUC 4FIFA 5IG1A 3BYSA 3UQFA 3O0GA 3MIYA 4O0VA 4PV0A 2PSQA 3SDJA 3CPBA 1W8CA 1PMNA 3HMNA 3LCSA 4N57A 4JAIA 3PSCA 3R00A 4RGJA 2G2HA 4YTHA 3DAKA 3HEGA 3MY5A 3E63A 3R04A 3NUXA 4IVAA 4YZ9A 2W1FA 4AS0A 1IAJA 3AXWA 4PTGA 2UVYA 3R63A 4DYMA 3P4KA 3P7CA 4O6LA 3LJ2A 1YWNA 4XH6A 1MP8A 4RVKA 3ZBXA 4EKKA 4XG6A 4AUAA 3MFTA 1A9UA 4BIEA 1OKZA 2DS1A 3DY7A 3D2IA 2R3HA 3ORMA 4JL9A 2WFYA 2XK7A 4IB0A 2X0GA 3DK3A 3CD8A 4HVSA 1RQQA 5EYKA 4CT1A 5JFVA 4TWOA 5JH6A 1R39A 2Q0BA 4RX7A 4YJRA 2YISA 1REJA 4RFMA 4EHVA 2O64A 5HVYA 3CBLA 4H58A 1CMKE 1J3HA 4JX7A 4C4HA 3GB2A 4IX3A 4DCEA 1WAKA 5IDPA 3PUPA 4BDEA 4IX4A 3FL4A 2QG5A 3B8QA 1H1SA 2X9EA 4YJTA 3GQIA 3OP5A 4CTCA 3H10A 4EUUA 5C03A 2OSCA 4CV8A 5IISA 4IFGA 4HVDA 2JKQA 3R2BA 3F66A 3MI9A 4KA3A 4WNOA 3VBQA 4XUFA 5DLSA 4G34A 5AR2A 4HVGA 3C51A 4X3FC 3I7CA 4A4OA 3IO7A 2VTHA 4CFUA 5M53A 2WEIA 3KXMA 4LGDA 3P1AA 4IWDA 4RIXA 3MIAA 1ZOGA 5GZ8A 3EIDA 3E3PA 3LCOA 4V05A 5KMOA 3QALE 3V5PA 3HP2A 4MHAA 5IEVA 2BIYA 3QHWA 3HUBA 4GH2A 1ZAOA 3E92A 4EK6A 4EOSA 2R3JA 5KKRC 5E4HA 4QNYA 5J95A 4YURA 5K5XA 1F0QA 1UU7A 3PJ1A 3KMMA 5ANEA 2HXQA 3GUBA 4FTNA 4QPMA 3ORTA 4ALUA 2J2IB 1JQHA 2X4FA 4ZOGA 4DH8A 3L8PA 4DA5A 5CU0A 3VUKA 4YSJA 1XH6A 3IGOA 4UWCA 1STCE 3FI4A 4XYFA 3N51A 3NWWA 2ZVAA 2C30A 2NRUA 3NRMA 4I5HA 4ZK5A 4AP7A 2XCKA 2QHMA 4FTLA 3HECA 1H00A 4ZJIA 1Q3WA 4TT7A 5TT7A 3VBVA 1WCCA 3O7LB 1YXUA 1OIRA 2NNWB 4EZ5A 5LMAA 3MPMA 4C37A 1XBCA 4ZS0A 4YNOA 5F95A 4P2KA 4FV7A 3BIZA 4QTAA 3AMAA 4FT9A 4FZAB 2WMBA 3KULA 4BI2A 3ZFYA 2RGPA 4G3CA 4QQJA 1E1XA 3D94A 5KBRA 1XH4A 4DEHA 3KXHA 4DGLC 5ACKA 2GFCA 5HESA 3ZEPA 1OM1A 2CJMA 4GIHA 4ENYA 2VO6A 3MWUA 4EC8A 4EH2A 4JRNA 2GNIA 4RC3A 2B4SB 4YZNA 4I92A 3TJDA 4IB5A 4AN9A 3R1NA 2J4ZA 3NSZA 4NJ3A 4KIKB 5T6KA 3RVGA 2GTMA 3TTJA 3HMOA 4IE9A 3FI2A 3W55A 5DE2A 4IWOA 4RG0A 5ACBC 3U4WA 3IW5A 4DFBA 3QUPA 4P4CA 3VC4A 4C36A 2BRBA 5EQPA 3A60A 4F9AA 3G33A 2Y4IB 3EN6A 4R6VA 1ZZLA 2WELA 1XBBA 1H0WA 4MD8E 3BE9A 5KO1A 5DR6A 4QMZA 2A27A 2XIYA 2FSTX 3I6WA 3KXZA 5CU4A 3U8WA 3WZUA 2PL0A 3LOKA 3MH0A 1J7LA 1JPAA 4LI5A 2R0IA 4DGNA 3SA0A 2PUIA 4DEGA 4NZWB 1SMHA 5LVMA 4CFNA 2UV2A 5I4NA 1AGWA 4FKUA 3RHKA 3KC3A 1QPJA 2JDRA 4IIRA 3ZDIA 3AC4A 5IUIA 4EOLA 4CXAA 5ANIA 2VO0A 3D7TA 2UZVA 4HCTA 3ANQA 3R6XA 4IJ9A 3S0OA 4FEXA 5HD7A 4JT3A 4ZSAA 3RWQA 4MXAA 3WI6A 4FZFB 3JPVA 4ONAA 1SVGA 4JJRA 4BN1A 3AOXA 4FV8A 4I0TA 3UOLA 4IM0A 4CMUA 4J8NA 3AG9A 5HNGA 3LPBA 1SVEA 4C35A 2PVKA 3W2OA 2ZV9A 5CEIA 1GZ8A 4YSMA 5IA5A 3A7IA 5BVOA 4U81A 5AA9A 4FTTA 4JIAA 3ACKA 2VX3A 3L8XA 1OZ1A 3E7OA 4JQ7A 2ITVA 2VWZA 4FNZA 3CY3A 5DMZA 5I9YA 4C4JA 1W0XC 4BTJA 4KSQA 4OW8A 4XP2A 4DH5A 4OTIA 2QOIA 3FLSA 5DH3A 4AN2A 2C6KA 4JBPA 3V3VA 3RP9A 2X8IA 3QD4A 1OIYA 3VUIA 4OTQA 3CJFA 2WB8A 5E1EA 3SVVA 4A07A 3SQQA 4ASDA 4BDIA 2W9ZB 5G6VA 5JSMA 2GCDA 2CNVA 3VBTA 2YHVA 2JDVA 2XIRA 4KNBA 3QD3A 4FTAA 5IA2A 2W7XA 4FSNA 2HENA 3KN5A 4FG7A 4F1MA 2WIPA 2CGWA 3IG7A 3W2CA 2VX1A 2XKCA 2EU9A 2J50A 2X6DA 4M69A 3LCTA 4FKIA 5BMMA 4PPAA 5E8TA 3IOPA 3B2WA 4RJ5A 4ZSGA 1GIJA 3DTWA 3OCBA 3QQKA 4U45A 4BGQA 4YJQA 3KMWA 1JKSA 2VWIA 5C01A 4DEAA 3TDWA 1BI8A 2QURA 3IK3A 4RX5A 1YXTA 1KOBA 3MPTA 4RFYA 3OS3A 2J9MA 4WSQA 5EDPA 3DXPA 4RC4A 4XG3A 3Q2JA 4LOOA 2I0YA 3TZ7A 2GSFA 1OL5A 1ZZ2A 3KEXA 3VF8A 1H08A 2XNPA 3VN9A 4DEDA 2PZIA 4AN3A 2SRCA 5CALA 3UIXA 3LXPA 3FMHA 3NNVA 5HVJA 4E5BA 3TDVA 4D1ZA 3FC2A 4D2TA 4EH3A 4TYHB 4GK4A 2GQGA 4JAJA 5BQ0A 4IXPA 3AMBA 3E8NA 4N0SA 4X3FA 3PXQA 3BX5A 4KSPA 3VJOA 4ANOA 4ASZA 2CKQA 5E9EA 3AD6A 2PVMA 4Z9LA 2WTKB 5HLNA 5BVKA 4AX8A 4P5QA 3UPXA 1XKKA 3O71A 5HG9A 2XRUA 4OLIA 2OW3A 1BMKA 3OWPA 4ZTQA 4QP1A 3R9NA 3SOAA 4GKHA 3MS9A 3BBWA 2WAJA 5M4CA 4LRMA 2C1BA 3HMPA 5AR4A 1O6LA 3Q9XA 4EOQA 5BUEA 4GRBA 4IWQA 2C5XA 5HBEA 2QC6A 4IFCA 5M44A 5EI8A 1TKIA 2ITQA 4IAAA 3EL8A 4ZS4A 3LM5A 3NYNA 3ORZA 4JBQA 3QHRA 4O6EA 4O91A 5K4JA 3BU5A 2BZJA 4QP6A 4YTCA 2B54A 5HTIA 5JGAA 2ETMA 3EQRA 3ZUUA 2WD1A 1UNHA 2J90A 1G5SA 5GZAA 5IA1A 2ZDTA 3DCVA 5GJDA 3UQGA 2GNJA 3QC4A 3ZFXA 4FKPA 5DNRA 1IASA 3I79A 5HO6A 4XCUA 4ANNA 4M15A 2I7QA 4ZMFA 1VEBA 1DI8A 4QPAA 3PE1A 4XV9A 3PXZA 3O50A 3EWHA 4YR8A 5JT2A 1JKLA 4EH6A 4Y5QA 1SM2A 1XR1A 4G5JA 1GZKA 1H1QA 5CNNA 3C9WA 3FMMA 4PNKA 2C1AA 4MH7A 4QMVA 4FTCA 4BB4A 4LL5A 2X2LA 3PP0A 3E64A 5FTQA 3QUDA 3DXNA 5HZNA 4RZVA 2G2IA 4I1ZA 3OBJA 2XBAA 4CG9A 3AMYA 4RJ4A 4RLKA 3G9LX 2OFVA 2F7EE 2Y4IC 3HX4A 2QNJA 4DG2E 4E26A 3ZOSA 4D4YA 4F4PA 3DJ5A 2V7OA 3UZRA 4IB1A 4YZBA 1PHKA 3D5XA 4L42A 4EI4A 4M8TA 4EZ7A 4BL1A 4F65A 1SNXA 3JS2A 3R9RA 2UW8A 4GYIA 3R01A 4NTTA 4I20A 1Q97A 3DBQA 3TIYA 3O51A 5L2WA 4CFMA 4O7YA 2VTJA 1PXNA 3Q4ZA 4FNXA 3TI1A 1CKIA 3QQGA 4WG3A 3A99A 4EK5A 3V01A 3HDMA 3N9XA 5FXQA 3ZYAA 3KREA 5IQCA 2R3MA 3RBWA 2W1DA 3U51A 3ID6C 4FSZA 2XJ2A 5IA3A 4XJ0A 5DA3A 4AW2A 3RI1A 4ZXTA 2I6LA 3UNKA 1UWHA 4M68A 4PMSA 1H27A 4UWBA 2J51A 3TACA 4EOIA 5GNKA 5LCJA 3ZM9A 5LXMA 3VS4A 3LVPA 4QOXA 4WO5A 4DFYA 4FTKA 3GC9A 4WG5A 5AUUA 4O7SA 1FVVA 1WBVA 3MGYA 3OY1A 4HPUE 5H8EA 5DR2A 3EN9A 3OCTA 1WBNA 2RG6A 3VBYA 5EKNA 3G15A 3NUPA 4MNEA 3ZO2A 4NKSA 5JGDA 1H1RA 4F70A 3PPKA 4D5HA 4BHZA 3V51A 3W32A 5HNBA 3HVCA 4QYYA 5BVFA 2GPHA 3ZXZA 2OH0E 2YFXA 3C5IA 4RIOA 5LARA 3JY9A 2RF9A 5KMNA 5FGKA 3FLQA 4FSMA 3F7ZA 2R0UA 3PWYA 3BKBA 3QYZA 2HXLA 3COHA 4EYMA 3WIKA 1Y8YA 4DLIA 4EWQA 3RCDA 4P7EA 5E92A 3ZLWA 1IEPA 4ALWA 3TUCA 1RJBA 3THBA 1G3NA 3NUUA 3NAYA 4E3CA 3DNEA 4CEGA 4ZP5A 3RZFA 4B8MA 2PYWA 3TZ8A 5IEXA 4HCUA 4AAAA 1B38A 2QO2A 2WOUA 1K2PA 4OTWA 1LP4A 1OITA 2R3GA 4UV0A 4D58A 4NW5A 5FWKK 4F7NA 3MFUA 3OT8A 3PZHA 2E2BA 2Z7LA 4UYAA 2R2PA 3GBZA 3QZHA 5TE0A 5AUTA 3S3IA 4C3PA 2YEXA 2HELA 1WBOA 4QPSA 5HQ0A 3RPSA 3CP9A 5CF5A 3WARA 2B1PA 2XEYA 1IAHA 4DFNA 3NNUA 4YBKA 1ZYDA 3O23A 3QTIA 4MWIA 3TZMA 4YJOA 2W1ZA 3RM7A 1LEZA 4L44A 4X3JA 4PNIA 4ZSJA 3S1HA 2OJGA 1FVTA 3F88A 3IQ7A 5HGIA 3VUHA 3NLBA 2C6DA 2XYNA 4BKZA 4F9WA 5TR6A 3A8WA 4HNFA 5CU3A 4U5JA 3TG1A 3E3BX 4O27B 3KN6A 3BELA 3NIEA 5DEWA 2H8HA 2F57A 3EFWA 2C5VA 3FWQA 4FF8A 4R8QA 3H9RA 5IEYA 5KMIA 3LKMA 5JFXA 3UNJA 4CFFA 3FXXA 2ETRA 3E62A 3DLZA 3OTVA 4UN0C 1AQ1A 3PSBA 4RX9A 5AV2A 4A9YA 3T3UA 1OBGA 3RKBA 4TYIA 4U79A 4FIJA 4C2WA 2ERZE 2WTKC 3Q9WA 3OHTA 1GJOA 1ATPE 4H3BA 2OF2A 2YJSA 4A9SA 5CEMA 4AZSA 3GFWA 5LCKA 3CTHA 2P4IA 4MD7E 3H30A 4XG8A 3PVGA 4BCNA 1BL7A 3RK9A 1MQBA 4BTFA 3W1FA 4EHZA 4FZ6A 4FL1A 3HV5A 3GU5A 4IMYA 5CT7A 3VS0A 4E5AX 5J9LA 3LLAA 2X8EA 3NVKI 3KVXA 5HD4A 1VJYA 4ZTSA 3QUEA 2ZDUA 3LJ1A 2XNEA 5C9CA 4L68A 2VNYA 5JN2A 2R3PA 1KSWA 4FUXA 3R1QA 3MSSA 2PY3A 5HKMA 4GK3A 4ZY5A 3BI6A 3HAMA 3EQFA 1YRPA 4WBOA 4GT4A 4UX9A 1REKA 5BVWA 5ETFA 4FKVA 4NM5A 1RDQE 3OEFX 3BRBA 4QMPA 2YM8A 4WHZA 4YPDA 5C27A 2BMCA 4R1VA 3TTIA 3EJ1A 2ITWA 5EW9A 4NCTA 4WOVA 3K3IA 4DHFA 3R21A 3SRVA 2F9GA 4JQ8A 5AR3A 1YWRA 4ZTNA 3UC3A 4RIWB 4R7BA 4ZZOA 4MNFA 3V6RA 1FQ1B 4IAIA 3G2FA 3OEZA 4UWYA 4JQEA 3PJCA 1OGUA 4II5A 1OL6A 5FG8A 1Z5MA 4IM2A 3TWJA 4S33A 3EMGA 4EHGA 3P9JA 4YBJA 2VWBA 2C47A 2H96A 2RL5A 2WTCA 3PFQA 3UZPA 2PTKA 2UZOA 3V04A 5CAQA 5EI6A 4FT3A 3C0IA 5EK7A 4AQCA 4FTQA 4KD1A 3AT2A 1PJKA 3T8OA 2WIHA 3EH9A 3G6HA 3LFQA 1UV5A 3RAIA 4MF0A 3BE2A 3FXWA 2XNBA 4L43A 3WF8A 4EORA 4TYGA 3NUYA 5FM3A 4YO6A 2AUHA 3SAYA 4O96A 4AZTA 2W5HA 1YOJA 3KK9A 2IN6A 4GG5A 1OL1A 3EN5A 4JRVA 4R3CA 3NCGA 5B2KA 3TIZA 2R3LA 3ZTXA 3VO3A 5IUGA 4HCVA 3QD2B 5A4QA 2VNWA 3ZRLA 1YHVA 3P08A 4HPTE 4DTAA 4MCVA 4D2WA 2UW6A 3AC1A 3D9VA 3R2YA 4OUCA 4I94A 2YCQA 2VTOA 2W5AA 2W9FB 5LVOA 1YHSA 2ZYBA 1LPUA 3QD0A 3MESA 2RG5A 1OECA 5DYJA 4JR3A 3AC5A 3EFLA 4L7FA 3V5QA 2FYSA 4I5CA 3FQSA 5AMNA 4USFA 3OWJA 4K8AA 4YHFA 3UVQA 5D11A 4BCFA 2F4JA 3EZRA 3P7BA 4NH1A 5DR9A 4F08A 2ZOQA 3OMVA 4U8ZA 4AT4A 4F6SA 3UOJA 2QCSA 4RBLA 1ZMVA 3G51A 1W98A 3GFEA 3VUGA 1PXPA 3FC1X 5D7VA 4C3RA 4Z7GA 2E9NA 4KIQA 2IVSA 3Q53A 2QKRA 3ZO4A 1PXOA 4C59A 4EOOA 5LVLA 4HVIA 2GNLA 3DZOA 3P79A 4YTFA 3RK5A 3EL7A 4AE6A 5IF1A 5BUIA 4XEYA 5A4LA 4LGHA 3FPMA 3GU4A 4JNWA 5AWMA 3AGLA 3PVUA 3PLAE 5FP5A 2IW9A 4B9DA 4NW6A 2YZLA 2BTRA 2JKOA 3ODZX 4QMNA 1OKVA 3NUNA 4F0IA 5L6OA 1U59A 5CI6A 5CAOA 2B55A 3JVRA 4G9RA 1GIIA 5BVEA 3TNWA 4BICA 1GAGA 4ZLYA 5LOHA 5L8JA 4LMNA 4LRJA 2PVLA 5EM5A 4R5YA 2PE1A 2QO7A 3Q6UA 4MBJA 5AAFA 1HOWA 3AT3A 4R78A 2EXMA 1UVRA 3C4ZA 4K1BA 1EH4A 3BHVA 4AZWA 1W82A 3JVSA 4LUEA 2CKOA 3KXXA 2GS7A 2C0TA 5IA0A 3ENMA 4QT1A 1XHAA 4Q9ZA 2UZTA 4C3FA 3D4QA 3NNXA 3EQBA 2JAVA 4QQ5A 2X8DA 5GZ9A 3U6IA 3R7IA 3W2RA 5HIBA 3WZJA 3PSDA 3C0HA 4EOJA 2WQMA 3A61A 2B9IA 3FKLA 1Q8WA 3HV4A 4L6QA 3G5DA 4I4FA 3B8RA 2ZV8A 2JDTA 4GCJA 4E4MA 2G1TA 5FQDC 3LAUA 4M13A 4DF3A 4WNMA 4L3LA 4EJNA 5IQIA 3NAXA 4FTJA 4PY1A 2B53A 1WMKA 2OWBA 2UZLA 2GMXA 4A9TA 1U46A 4L00A 3ZLSA 2HZ4A 4ANSA 2W1CA 3MA3A 4PL4A 4OBOA 4X0MA 2WPAA 5HOAA 2WQNA 1P5EA 1DS5A 5C4LA 5E8UA 3PIXA 5CI7A 4K6ZA 2EB3A 3M2WA 2YIWA 3BHYA 3OCSA 5H9BA 3PVWA 3QXPA 1W83A 3AC2A 3BHTA 3TCPA 3LFBA 3UVPA 4PDOA 2YWPA 4LUDA 1FGIA 2GFSA 2P55A 3QFVA 1Q8YA 1YVJA 1H1PA 2BRHA 4NJDA 4TY1A 1GIHA 5FLFA 1PY5A 2WMUA 5C1QB 5I0BA 4RC2A 4C4IA 5CLPA 4IQ6A 4BHNA 5IMXA 5IQGA 2NPQA 4QYEA 4ACGA 5C8KA 4NM0A 1OL7A 4BDHA 5M56A 2R3OA 3VBXA 4RLLA 2VWWA 4FTUA 1XQZA 5EW3A 3VHEA 1PMUA 3HRBA 3FYKX 5M08A 2XKDA 3MVMA 4IC8A 5ANKA 4NFNA 5F4NA 2XK8A 2EVAA 4YLJA 4D2PA 2YDKA 2UW9A 4FK6A 2PK9A 2R3FA 1OPLA 4AA5A 4HZSA 5L2SA 3DFCB 3RZBA 4F0GA 2VTLA 3F7WA 3SXSA 4FYNA 4HGLA 1KUTA 3NW7A 4FK3A 3COKA 5HG5A 4G6OA 3UBDA 4D55A 3UZTA 2GQRA 1OL2A 3HDNA 3CLYA 5DVRA 2GU8A 2R7IA 3TN8A 2ZV7A 5AV0A 5E90A 5I9WA 2F7ZE 3R22A 2XCHA 3PTGA 2W1HA 1S9IA 4LYNA 3PRIA 4FZDB 2UW4A 1OIUA 3O8TA 4IAZA 1HCLA 2XYUA 5K0XA 3I5ZA 5BYLA 5AUXA 2A19B 3LMGA 3RCJA 1ZYJA 1YXSA 3C4XA 5M06A 3TNPC 3L9MA 2NP8A 5DHJA 2CKPA 4FNWA 2KULA 2UW5A 3LQ5A 1QMZA 4MXYA 2CKEA 3DBFA 3R7EA 4DH7A 2OK1A 1H07A 1DAYA 4A9RA 5J7BA 2QOBA 4FVRA 4YJNA 2HZIA 1M7QA 1NT2A 4OR5A 5BPYA 3OCGA 5CZHA 4EEVA 3PY3A 4MYGA 1ZWSA 4U9AA 3I7BA 4FSYA 4XG4A 1UU8A 2R3NA 4YZDA 4B7TA 3Q6WA 2W4OA 3OTUA 4D9TA 3P0MA 3G9NA 2JITA 3KRLA 4KINA 3ZCLA 3GEQA 2O0UA 3S95A 3OC1A 4FG8A 5C8MA 1A06A 2FH9A 2UUEA 4XP3A 2C6IA 5LMKA 3TUDA 4AZEA 4DBNA 1YW2A 2Z7QA 3PXRA 5D9HA 1CDKA 2JBOA 5CS6A 5LJJA 2GS2A 2X7GA 5G1XA 5IZFA 3H3CA 4E6DA 5E8VA 4PP9A 5FD2A 5B0XA 3EKNA 4PDPA 3EOCA 1JWHA 3R7YA 3TZ9A 4AG8A 1Q8UA 2YIXA 2QOQA 1ZYLA 1SZMA 2WMSA 2JLDA 3MJ2A 3K2LA 2YAKA 2GHMA 2XIXA 4CKIA 4O0YA 4ZAUA 5I9VA 3CSVA 4XMOA 2C4GA 3OXIA 4FSQA 4KKHA 3D5UA 4FT5A 2P33A 4TYEA 2XS0A 4DG0E 5E8SA 3QKKA 4TNBA 4XP0A 1XH5A 4X7QA 4PF4A 4GMYA 1ND4A 3C0GA 4LG4A 4BCKA 4EH5A 3UG1A 1LEWA 2PVFA 3GCVA 3VS6A 3IW4A 4E5WA 3U6JA 2ZM1A 4BBFA 2IWIA 3EQIA 5C4KA 2QI8A 3KL8A 2FSLX 3R02A 4GVAA 4ZJJA 4O7LA 3QCSA 1S9JA 3KB7A 2XKEA 4WBBB 4D4RA 3CC6A 1WVYA 4FKRA 4YTIA 1CTPE 5EYCA 3GVUA 3ZSHA 1O6YA 5E8WA 2HOGA 2W06A 3RAHA 2YZAA 3UVRA 1H4LA 2IO6A 4I5MA 5DPVA 3HNGA 3KF7A 4TW9A 4IANA 2Z8CA 5FBNC 3FE3A 2OFUA 3CR0A 2JKKA 5D1JA 3ZMMA 2ZB1A 5J1WA 3TNHA 3DDPA 3DU8A 3C4FA 4RJ8A 4BTKA 4S2ZA 4F6UA 3BQCA 3CQWA 4HGTA 4AFJA 4RJ6A 1PMVA 2PZ5A 3DAEA 5CNOA 3VQHA 4PWNA 4RWIA 4RQKA 4DCAA 4HYSA 4ANMA 4FL2A 4G17A 2XA4A 3FMNA 3A4OX 3Q4TA 4I4EA 4BCIA 4CSVA 1Q24A 2V22A 4GS6A 4B6LA 2WMQA 3KF4A 3ZS5A 3QZFA 4HGEA 4BCOA 4LOPA 5T3QA 4CMTA 2C5NA 2YIQA 3AD4A 3FHIA 4FV2A 4N6YA 4O7NA 1ZXEA 3RMFA 4CGAA 3C50A 3ELJA 4ASXA 4O84A 3R8MA 3LFAA 3M1SA 4QMUA 3E93A 3I81A 3IOKA 2J6MA 1R1WA 3QTQA 4G5PA 4CG8A 1V0BA 5CZIA 4AWIA 2Q0NA 3ALNA 1PRYA 3CKWA 3LE6A 3VRZA 4DITA 5AIKA 4ZY6A 3BGQA 4E6AA 2QLQA 3BEGA 4BDCA 4FVQA 4FICA 4YJSA 4FX3A 3GC0A 4UZDA 2OH4A 3F5UA 5IQBA 1YOLA 4Y83A 2C6EA 3A7GA 3QGWA 1ZARA 5FUTA 5HG8A 4LRKA 1Q61A 2UW3A 3W2SA 3U6HA 2GHLA 5M4IA 2YJRA 3QAME 4OGRA 2BRGA 2VTIA 1FBNA 4I0RA 5EDRA 5IH6A 5BX0A 2JDOA 4U0IA 3UO6A 2F2UA 3VW6A 4GJ3A 4Q5HA 4J97A 5JQ5A 2A1AB 4KBKA 4YUQA 5DT4A 2OXYA 2V5QA 2ZMCA 2JEDA 3HV7A 3CTJA 4NM7A 1VYZA 1O9UA 3AC3A 3DKGA 3F3VA 3DTCA 3UODA 3NYOA 3BZ3A 3U4UA 4XX9A 2OLCA 3D5WA 2FUMA 3DNDA 2FA2A 3V8SA 2XBJA 4OTPA 1UKIA 3FKOA 1JNKA 5KNJA 4JG8A 5L3AA 3ZLXA 2VTPA 3VS2A 3HKOA 2XUUA 3IONA 2C5YA 4BRXA 3LJ0A 3SLSA 4FIEA 5HE0A 3L9LA 3MPAA 2ITYA 1U54A 3NIZA 3V8WA 4G31A 3NR9A 4M12A 4FKJA 2YDJA 5GIOE 4KS7A 3KVWA 4RA5A 4W4YA 2ITZA 1PYXA 3NYXA 3Q4CA 5J79A 3BGZA 4OT5A 2XB7A 3VBWA 2WQBA 4PPBA 4FV4A 3OWLA 3BBTB 3BGPA 3DV3A 3ZUVA 2IPXA 3ZO1A 4O7WA 2BZHB 5DFPA 1BKXA 2YN8A 3HA6A 4WUAA 3U9NA 2JFLA 4KKGA 4TPTA 3FJQE 4HYIA 2VD5A 3E5AA 3TT0A 3UGCA 2XJ1A 4OTFA 1WZYA 2ESMA 5AUWA 2OBJA 3TXOA 4D1XA 4DC2A 4E4NA 1KE9A 4GFGA 3TNIA 3TJCA 1IRKA 4C4GA 1UNLA 2IW6A 5DWRA 4BY9E 3BWFA 2H34A 4UZHA 4D4SA 4BI1A 3DA6A 4NT4A 1YXVA 2JD5A 3FLWA 4O81A 3OXZA 5KMLA 4EUTA 5L2TA 5AJQA 5CANA 3NDMA 5HTBA 4GFOA 2X2KA 5HICA 2FO0A 3E8CA 1FPUA 2E9VA 3IW8A 3Q5ZA 5I3RA 2BIKB 4F7LA 2I1MA 5A54A 5HU9A 3VUDA 2GTNA 5I9ZA 2ZM4A 2JGZA 3POOA 1MUOA 1G8SA 4F1OA 4KRCA 5AV4A 1SVHA 4ORKA 3Q04A 2GHGA 3HGKA 3CGOA 4X6QC 3D15A 4YJPA 4CFWA 4DN5A 4ZZNA 2QR8A 2YCSA 4U44A 4NK9A 3T3VA 4HOKA 2WMTA 4W4VA 3V5LA 4OBQA 5CU6A 5BUJA 5HG7A 5E8YA 3GOKA 2J0LA 2OU7A 3OFMA 5AP3A 2RKUA 4FBXA 4F7JA 4WIHA 4FSRA 4BBEA 2Y8OA 3R1YA 2NO3A 2VWVA 4UYNA 2IVUA 3LFSA 1OKYA 4C4FA 3PYYA 2QOFA 2R5TA 3CE3A 3C7QA 3NUSA 4I21A 4ERWA 5IQFA 4O38A 4LV5A 2WEVA 2B0QA 2W05A 4A7CA 3FDNA 1Y91A 3JXWA 2WU7A 2J0IA 3E88A 2HK5A 1RE8A 3JY0A 5JZJA 4USEA 3PJ8A 3WOWA 3F3UA 4I41A 2FSMX 1V0PA 2O65A 2UVZA 3MDYA 5IH5A 5L8LA 4YNEA 4C4EA 1M52A 4G6NA 4ZLZA 3OOGA 4DEBA 3DKCA 4HZRA 3OY3A 3DT1A 4UXQA 3GU6A 4RIXB 2PE2A 3ZLYA 3G0EA 3IPHA 3UYSA 5CXZA 4O7VA 5BYZA 3WF9A 3E7VA 3KRXA 2IZTA 3NYVA 4XOYA 5ANGA 4YHJA 1BUHA 1UU3A 4M0YA 3VS5A 4ACDA 5ETCA 4A4XA 4RVLA 3POZA 1P4OA 1OPKA 1VR2A 2OZOA 3F3TA 3P7AA 4C7TA 2P2HA 4C34A 2XEZA 3IECA 4Y8DA 5DI1A 3KCKA 4IHPA 3OW3A 3ZRKA 1WBSA 5HE2A 3AGMA 4UMRA 3KK8A 4YZMA 5GIPE 3VRYA 4DFXE 4L52A 5A6OA 1Q5KA 1URWA 1H26A 3LFEA 4QMYA 3BV3A 3VNTA 2WQEA 2A0CX 4DEIA 3FZRA 3CKXA 3TM0A 4FC0A 3GC8A 3QQLA 3DLSA 3S00A 5IA4A 5I9XA 2VTAA 2UZDA 1YQJA 3H9FA 3KFAA 3QRKA 3A7HA 4FI1A 4L67A 2W99B 4OTRA 1G8AA 4XG9A 3LXNA 1QL6A 2OGVA 3QKMA 4RIYA 4FA2A 5D7AA 2G9XA 3FYJX 5M4UA 3QTZA 5FM2A 1PXMA 5HE1A 2VO7A 3A7FA 3PPZA 3F2AA 4L3PA 5HIDA 4F6WA 2F7XE 3GCPA 2E9OA 3LQ8A 3QQUA 2QODA 1XWSA 4H3QA 4M3QA 5LWMA 3KULB 4O86A 5AX9A 3UG2A 3WE4A 2EWAA 3ET7A 3P5KA 4JIKA 3WBLA 5C8NA 2B7AA 4FSUA 3U87A 4ANLA 1OBDA 3FSKA 2ZV2A 2Z60A 1F5QA 1KE8A 1I44A 2QOHA 3NNWA 4L46A 2B9FA 4O0SA 3FMKA 3MN3A 3VS7A 2VU3A 2X7FA 1Q4LA 4X2FA 4ACMA 2Z7RA 4AFEA 3P23A 5CF6A 2QQ7A 3EYHA 4PTCA 3LFNA 2I40A 3CGFA 1UWJA 2C0OA 2PUUA 3IDBA 4HYUA 4ACHA 4TWNA 3WZEA 1ZLTA 4ZEGA 4D2VA 5I9UA 4F9CA 2Y6MA 3WF5A 1TQIA 2OICA 3II5A 4FIHA 4O2PA 3CQEA 3F3WA 2VTQA 3FZ1A 3O7LD 2BUJA 3OF0A 3R7OA 1YI3A 2WXVA 3P78A 3V5TA 5EG3A 5M07A 3GOPA 4I6BA 4PDSA 4HVHA 4L01A 2AC5A 3I6UA 1U4DA 3OG7A 3D7TB 5HLWA 2WGJA 4IAYA 4PMTA 4IB3A 3VUTA 5BYYA 4J71A 5KX8A 3ATSA 4JG7A 4O7TA 3QC9A 5JRSA 4PMPA 2GDOA 3CJGA 1F3MC 4FTRA 1V0OA 5AUZA 2WQOA 1XH9A 3QWKA 3SKCA 4PDYA 4GT5A 4ZZMA 2XK6A 3I0QA 3UDBA 3D14A 3R7GA 3IGGA 2YWVA 4O0UA 4TZRA 3DK6A 5KE0A 3DKOA 4JS8A 4YPSA 3QF9A 4H1JA 3F5XA 5CY3A 5ANDA 4PP7A 2PE0A 3OROA 1URCA 2PHKA 5AP1A 3GQLA 1NVRA 1TVOA 3UMXA 4QYHA 3Q96A 2XJ0A 3DPKA 3QX4A 1YI4A 5E8ZA 3WZDA 3PXKA 4TWPA 2X4ZA 4EC9A 4IWPA 5JZNA 3UIBA 2YCRA 4GSBA 5JQ8A 5LVPA 4YC8A 3EQGA 5D41A 4GEOA 3I0OA 3F2RA 4M67A 4R5SA 4MKCA 2WTVA 4DFZE 2Y0AA 3LXLA 1Y8GA 2CGUA 2PVYA 2DYLA 2BHHA 1MRVA 3FUPA 4H1MA 2ONLC 4QMMA 3PG3A 3SG9A 3ERKA 3PLSA 4BGHA 1GNGA 1H25A 4MBLA 4ERKA 4DTKA 4D1SA 1PF8A 1KOAA 2XM9A 3MA6A 2BRMA 1ZYCA 3C4CA 3LZBA 3R1SA 4G3FA 3SX9A 4L53A 3UNZA 3T9IA 3DKFA 2FVDA 1M2RA 5DN3A 2OF4A 3EZVA 3RAWA 4QTBA 4NYEA 2CN8A 3MB7A 4EK3A 4MXXA 2PMLX 4CQGA 4CFVA 4KIPA 4FSWA 3S4QA 3ZFMA 5CASA 4WUNA 1OUKA 3FY0A 2HZ0A 2QG7A 4M69B 1WFCA 1CM8A 3AT4A 5HHWA 3SXFA 3I1AA 2WTWA 4J95A 2JFMA 3L8SA 4FT7A 4I6HA 4ITJA 2GS6A 5KZIA 3TKIA 1Q41A 3R0TA 5F9EA 4OTHA 4MVFA 3JR1A 4QTCA 2WKMA 3N4UA 3UO4A 3UP2A 3MVLA 4F09A 5E1SA 5HI2A 4O2ZA 2W96B 4ZTMA 2YM7A 5CWZA 4QMLA 3ULIA 2CMWA 3FMLA 2IZSA 3C4EA 3SD0A 1MRYA 2V0DA 3FMJA 3KXGA 3QZIA 2YLFA 4JDIA 5AR7A 3TNQB 4K33A 3PA4A 4DGMA 4BWPA 3DJ7A 4EONA 3RNIA 2CCHA 3ACJA 3MFSA 4IEBA 4TL0A 4IJPA 4CRLA 2ZAZA 4O0TA 2XP2A 3L1SA 2HWOA 2X1NA 3ENHA 2EXCX 4X2KA 3WF6A 2OIDA 1OIQA 1U54B 5A46A 4DG3E 3QRJA 3AC8A 3MB6A 4GKIA 4QYGA 4Y46A 4XOZA 1KV2A 3R83A 3P86A 3G90X 3COIA 4KS8A 3PA3A 4X3FB 4AW0A 3FSFA 3QCQA 4IAFA 4BCMA 4CLIA 4CNHA 4XNEA 4R77A 4FT0A 4RT7A 4GIIA 3VW8A 3LMHA 4BCQA 4XRLA 3PWDA 3QL8A 1M7NA 1UA2A 2C0IA 5DT3A 2NRYA 1YI6A 4RJ7A 4JVGA 3GNIB 3ZZEA 3F61A 5AEPA 4NUSA 2R3QA 4JDHA 3QTSA 4G2FA 3H0ZA 4AT3A 4EZ3A 4CVAA 4XV1A 1DI9A 4U43A 4F7SA 3BCEA 4AOIA 4N70A 3R28A 3CIKA 3W33A 3EQDA 3HP5A 4EQUA 4BZNA 4IH8A 2XRWA 3KRJA 2O2UA 5FDXA 3HL7A 1ZOHA 4AOJA 4APPA 4AZFA 1LR4A 3UC4A 3U9CA 4JG6A 2R7BA 4LV8A 3DZQA 4U80A 3Q9ZA 4L45A 5HIEA 5JKGA 4MBIA 3OWKA 5AR5A 3HRCA 3PRFA 4J8MA 2A4LA 3U54A 5DT0A 4E6CA 3DJ6A 3W10A 5HORA 4F99A 4FL3A 3FKNA 4P90A 2CNUA 4A4LA 1AD5A 2VWUA 4EBWA 2RFNA 4ID7A 2BAJA 2C3IB 3R71A 4TN6A 5I3OA 2XK4A 3BV2A 4IM3A 2OG8A 3UP7A 5KCVA 4O82A 1T46A 1OUYA 4KBCA 4CCUA 1BX6A 2H6DA 3IS5A 4W9WA 5DIAA 5H3QA 3VUMA 4CKRA 4DGOA 5HBHA 2B9JA 4AZVA 5IH4A 3O8PA 4BCGA 3NS9A 2BROA 5CF4A 5A4EA 1FGKA 3OD6X 2QHNA 2FGIA 4M97A 3R7UA 5CSVA 5AAGA 5L2IA 2BALA 3ZBFA 2O5KA 2ZM3A 5A9UA 1JBPE 2VTTA 4FTOA 4H36A 2C69A 3D2KA 4ITIA 2P3GX 3MJ1A 4MQ2A 3ALOA 3KKVA 2R4BA 3ORKA 5HCZA 5ANOA 4C62A 5B2MA 1E9HA 1U5RA 1IA8A 2VRXA 4ANQA 1PXIA 3RINA 4E73A 4G3EA 4BCPA 1L3RE 2UZWE 5DBXA 2YIYA 3CEKA 5J9ZA 2G15A 1IA9A 4IAKA 3HLLA 1MRUA 3GP0A 4XS2A 3PJ3A 1FINA 2O3PA 3O96A 2V7AA 3I60A 4G16A 2YCFA 3EYGA 4RQVA 4E4LA 4CMOA 4TYHA 2WU6A 4OBPA 4EH9A 3WZKA 4IZAA 4Z7HA 3Q4UA 3RPRA 5K3YA 3DOGA 2OJIA 2HAKA 5CSPA 5KBQA 2G01A 2WHBA 3MY0A 4MNEB 2I0EA 4MQ1A 3BHHA 2PPQA 4APCA 4W4WA 3PY1A 5DEYA 1W7HA 3RM6A 4K9YA 3E87A 3PP1A 4NFMA 3MW1A 3G6GA 5BVNA 2F49A 2ITNA 2VGPA 3CCNA 3V5JA 2ITPA 3LCKA 2PMIA 4TTHB 4YJVA 4ZY4A 2BTSA 3ORNA 2ITTA 3QQFA 2RFDA 4FEUA 3OBGA 4D0XA 2DWBA 1Y6BA 4EOPA 2I0VA 1XH8A 3MTLA 5A4CA 4CV9A 5EW8A 2O8YA 3W2PA 5B2LA 3F9NA 5FRIA 3ZXTA 3LQ3A 3CXWA 5TKDA 4FVPA 2OJ9A 4IDVA 4FKQA 4MX9A 3NZ0A 3ROYA 3VQUA 3I4BA 5E8XA 4EH7A 3M11A 3QRUA 4J1RA 1DM2A 4M7IA 3QGYA 4D0WA 2XVDA 3KCFA 1Q8ZA 4DGGA 4IC7A 4QQCA 3EN7A 4UMQA 2Z7SA 4NKAA 5JMSA 1H01A 3DBDA 3WILA 3DBCA 4J53A 5CYIA 4FKWA 2WTDA 3ZDUA 2QU6A 3LHJA 4RX8A 2Y4PA 1V1KA 5TO8A 2PVNA 2BVAA 4XG2A 1P2AA 4L9IA 2J0MB 3BEAA 3EQHA 5AM7A 3V5WA 3DBEA 4GUEA 1XO2B 4B0GA 3FL5A 1WBPA 1K9AA 1UNGA 3BLQA 4J96A 2UZNA 4IW0A 3RPOA 3ZRMA 2C6OA 3E8DA 4LGGA 4E4XA 2XNNA 5EHLA 2R3KA 5CT0A 3UPZA 1KWPA 1M2QA 3ANRA 4ZIMA 1OKWA 2XZSA 5H8BA 5KZ0A 2R9SA 3EQCA 3HYHA 4DFLA 5L2QA 4RZWA 2VZ6A 2PWLA 3PY0A 4TXCA 3QX2A 4EOKA 3VWAA 3MH2A 5FDPA 3R8ZA 4D28A 5EHYA 1I09A 3FZTA 4BC6A 5AV3A 5EQEA 3BU3A 1Z57A 4E93A 3FEGA 5BVDA 2Y7JA 3NCZA 5GJGA 4FKGA 3GCUA 2ERKA 5EOBA 4XLIA 2HYYA 5D10A 1PXKA 4AGUA 1JKTA 3HV6A 3EHAA 5CTPA 5F94A 1R0PA 1LUFA 3GI3A 3QLGA 4KBAA 3ZO3A 4QMQA 3JYAA 3LCDA 5J8IA 3UIUA 4NWMA 3OT3A 4KWPA 1WVXA 2VTMA 3QA0A 4BDBA 3K5VA 4D5KA 1VZOA 2YLEA 3A62A 3K54A 4FTIA 3EFKA 3L9NA 4R3RA 4U40A 1UKHA 3KRRA 2CNQA 5HO8A 3GCQA 3R8VA 3R30A 1JOWB 4FEQA 2QKWB 1O6KA 4AACA 5A4TA 3ZM4A 3SRVB 4A06A 2X9FA 2XNGA 3MH3A 4BGGA 1JSUA 1GY3A 2J7TA 4C0TA 3EN4A 3CTQA 1FVRA 2BAQA 4C8BA 2JIVA 2X7OA 5KMMA 2QOKA 2WZJA 3D7ZA 4M0ZA 2JAMA 3E8EA 2YDIA 3KA0A 4BKYA 5A14A 1GZNA 3NEWA 4DAWA 3FHRA 2VGOA 4H05A 1SYKA 4PRJA 3UOHA 3LFFA 3GU7A 4WNPA 2BCJA 5CEKA 3MV5A 2WMAA 2UW0A 3T9TA 4FOBA 3FQHA 3PIYA 3Q2MA 4KRDA 4MXZA 3PVBA 4KAOA 2OXXA 4WRSA 1J7IA 3SOCA 1YWVA 2W4JA 3F5GA 4S30A 2GNFA 2G2FA 4BYJA 4JBOA 4QP4A 4AW5A 5FBOA 1APME 3DB6A 5DOSA 5IU2A 3R73A 4CT2A 4GK2A 4RMZA 3LFDA 2HW7A 5JFWA 4FR4A 5EM7A 1YOMA 4EYJA 4YMJA 4UMUA 4H3PA 5FEQA 1GOLA 3FZPA 2F2CB 4HJOA 4QTEA 3QTRA 5AR8A 3VULA 4D2RA 2QOOA 4BCHA 4IZYA 1FOTA 2ETKA 1OI9A 3HV3A 2V62A 1PW2A 4GL9A 2C68A 4OT6A 1IR3A 2RIOA 5ETAA 4E20A 2WTJA 4J7BA 4IACA 5A3XA 4CTBA 3ZZWA 5AA8A 3FY2A 2AC3A 4L3JA 4F9YA 4ZLOA 3Q3BA 1NA7A 3FMEA 4C58A 3HAVA 3A4PA 4LMUA 4OTDA 3BU6A 3MFRA 5GHVA 2CGXA 3IDCA 3ITZA 4QP7A 2P2IA 3A2CA 5E7RA 1Z9XA 4UB7A 4QMSA 3HMIA 4C02A 2OJJA 2XH5A 4GV1A 5AADA 2QLUA 4XHKB 3UE4A 3ZHPC 4JX3A 4TNDA 3BLHA 3FXZA 3ZUTA 5J87A 4FV9A 4CZTA 1Q3DA 3RALA 1KV1A 4O21A 1JKKA 4EWHA 2RSVA 5KHWA 4FIGA 1NXKA 5IKWA 2YA9A 4FKTA 3R7VA 4F0FA 2UVXA 2BZKB 3PXFA 4BDGA 4PX6A 3BYMA 3FLZA 4RVTA 2PZPA 4BBMA 4JI9A 3QKLA 4O1OA 5EDQA 3ZSIA 4PL5A 1XH7A 4V0GA 1XJDA 4AA4A 3TKUA 5IUHA 4HW7A 1WVWA 5HLPA 4EJ7A 2YM6A 4QO9A 2UZBA 3OW4A 4YO4A 2XF0A 2AYPA 3TV6A 4F9BA 3RPVA 1NVSA 4N4SA 2CPKE 2J5EA 3VVHA 3Q32A 1OPJA 1KE6A 4IZ5A 3PDTA 3WE8A 4BIBA 1J1CA 2XNMA 2YAAA 5IDNA 3AQVA 4U3YA 1H28A 4BDKA 5FTOA 4YLLA 5HBJA 4JLCA 5K9IA 3FI8A 4X6RA 2LAVA 5J1VA 4G9CA 2BRNA 3H4JA 5KMKA 3RNYA 4AGDA 4RIWA 4J52A 5AP4A 4BIDA 3FZSA 4GYGA 2LGCA 4KIOA 4PTEA 2VO3A 3ZU7A 2Z2WA 5CEOA 2BR1A 3G0FA 3FAAA 4C38A 2QD9A 4FGBA 3OUNB 4U3ZA 2ZJWA 3OZ6A 1JAMA 3KGAA 5AAEA 2ITUA 3MVHA 3HUCA 4ZTRA 4MF1A 1P14A 4FV5A 3VAPA 4BVUA 4WA9A 4EH8A 1BLXA 4Q9SA 4GFMA 4BF2A 4NM3A 5A6NA 3VJNA 2X39A 4ANBA 3MVJA 2YM4A 2W0JA 3BHUA 4FYOA 2ZMDA 2C3LA 2PZYA 2I0HA 4J98A 4XBRA 3D5VA 5J5SA 2WMVA 5LMBA 5KUPA 4UY9A 3WF7A 2P0CA 3DS6A 3PZEA 4IX5A 4WD5A 2J5FA 3H0YA 3W8LA 2XNOA 1JLUE 4CD0A 4L8MA 2XIZA 5J9YA 3BWJA 3C1XA 5CEPA 2BFXA 3DK7A 1W84A 4I23A 4LOQA 2W17A 4C2VA 3ZC5A 4U7ZA 3FV8A 2JC6A 3SV0A 5EQYA 4C33A 3COMA 2Y9QA 4K2RA 3B2TA 3FPQA 3GXLA 2OIBA 3CY2A 4W9XA 5CVHA 2VN9A 3QRIA 4DT8A 4EQCA 2CCIA 5IMEA 3OOMA 4LQMA 2HZNA 4MWHA 4FEWA 2HCKA 4ZMEA 5D12A 3QTWA 5HEZA 2OO8X 4EH4A 4EK8A 4MXCA 4XV3A 2EUFB 4EOMA 3IKAA 4G6LA 4O0XA 4Y5HA 4F64A 2WTIA 5CU2A 4C57A 4F63A 3DXQA 5B7VA 1PYEA 5L6WL 4YU2A 4ENXA 4QNAA 4UBAA 1YDRE 4K18A 3NW6A 4QP3A 4MAOA 3EQPA 3KU2A 3BQRA 4G1WA 4QQTA 4DFUA 4NU1A 2IZRA 4ALVA 3C13A 4FKOA 4NCTC 3PPJA 2OZAA 1Y6AA 4P5ZA 5AFVA 2XMYA 5TOZA 5J7HA 4DBXA 4QP8A 1DAWA 5AV1A 3BPRA 3NGAA 4LL0A 2BZIB 3QCYA 4RWJA 5GJFA 1ZMUA 1PXJA 3F5PA 5EYDA 2C6MA 2QONA 3HRFA 4Y85A 3QXOA 4BDAA 4H39A 2PVRA 2X2MA 4XV2A 4WRGA 4U97A 3U55A 1ERKA 1PKGA 4XBUA 3NVMB 3A8XA 1H0VA 4B8LA 1KE5A 2ZB0A 4CRSA 4V04A 2REIA 4M66A 3NX8A 4W4XA 5JRQA 4I3ZA 3ODYX 4QYFA 4MD9E 3ZC6A 1ZYSA 5BMSA 5HVKA 4X2GA 3LMIA 5EOLA 4BR3A 1OVEA 2QOLA 4YP8A 2HWPA 2JIIA 3A7JA 3F82A 3FBVA 2WO6A 3KY2A 3PJ2A 4HGSA 5DG5A 2VTNA 2CLXA 3PXYA 4FGRA 4MEDA 4QMOA 5DRBA 2PMNX 4BZDA 2C3JA 4IZ7A 3O8UA 3ORPA 4AGCA 5HX6A 2Y6OA 4JBVA 4BDDA 1RW8A 4WSYA 2VWYA 4D9UA 2EXEA 3Q52A 1YXXA 4LM5A 4YHTA 5AP2A 2WOTA 2IG7A 3EFJA 4UMTA 4RVMA 3VHKA 4FE2A 1BYGA 3QU0A 4E8AA 1BI7A 4MTAA 2VTSA 1PKDA 5CSHA 4XLVA 1BL6A 3TKHA 3QQJA 2ITOA 4ZTHA 5EI2A 3R8UA 2C5OA 4A9UA 4IVDA 4FTMA 2DQ7X 1XBAA 2EB2A 3QLFA 5H8GA 1M2PA 3UJGA 2QO9A 4Y95A 1QPDA 4RPVA 4ZSLA 5HCXA 1J1BA 3W8QA 4YLKA 2BAKA 4NIFA 1OMWA 2JKMA 4CFXA 5H2UA 3R8LA 4GG7A 2CLQA 3D83A 3SGCA 1JSTA 3SC1A 4NTSA 5AP6A 2OI4X 5CSXA 5M55A 3ORXA 2JIUA 5EYMA 3NUAA 5FXSA 4U6RA 1GZOA 4FUYA 2B52A 4I24A 1ZOEA 5ITAA 2A2AA 2HIWA 2C6TA 4FOCA 1YKRA 3GCSA 5HX8A 2CHLA 4FSTA 4AT5A 2R64A 3HZTA 3Q5IA 3DB8A 4AA0A 2BILB 5CX9A 1NW1A 4ITHA 2IVTA 1NVQA 2XK9A 4FMQA 4L7SA 4D4VA 3TV7A 3WYYA 5ICPA 3UIMA 5JFSA 4EK4A 4DH3A 3SW4A 4R1YA 4X2NA 5DGZA 2ACXA 5LWNA 4DTBA 1B6CB 4BFMA 3DGKA 3IW7A 2W5BA 3KRWA 3PIZA 2W1GA 4UXLA 3WIGA 4O7ZA 3WYXA 4FEVA 3N4TA 2WMRA 3RGFA 4Z3VA 4AOTA 3SG8A 4DEEA 3K5UA 2YM3A 2QOCA
chains in the Genus database with same CATH superfamily
5CEQA 2J0KA 4FRFA 2PZRA 3RJCA 2E9PA 3EB0A 3F3ZA 3ORIA 2PMOX 5I5ZA 4CLJA 5HTCA 4BTMA 1MQ4A 5IQEA 3GT8A 2OJFE 5BNJA 5J5TA 5CQWA 1PXLA 1Q62A 3V6SA 3NPCA 5LQFA 4Z16A 3QTXA 3SHEA 3DFAA 4RWLA 3VIDA 4HYHA 5T68A 2B9HA 2GNHA 4DH1A 1YDSE 4KKEA 4DE4A 4GU6A 1YDTE 3BYOA 4ZSEA 3DQXA 5HU3A 4YC3A 3CQUA 2OXDA 3ZONA 1H24A 3NW5A 4JOAA 3W18A 3I5NA 4EL9A 3FI3A 4O1PA 4B4LA 2QU5A 4GW8A 4DLJA 2X6EA 4R7IA 5IPJA 2CDZA 2VAGA 2O63A 4G3GA 4K77A 3PG1A 4QEBA 5CXHA 5M4FA 4TYJA 5TF9A 3P5JC 4E6QA 1OB3A 3GGFA 4AXAA 2WMXA 4FKLA 4TKSA 3KXNA 1R0EA 4UMPA 4N6ZA 1PMEA 2J0JA 3ZH8A 1ZY5A 3RK7A 4IADA 3ZEWA 5FEEA 4RA4A 4QTDA 4X21A 5CAUA 4S32A 3QYWA 5AUYA 1QPCA 2PVHA 3W0MA 4BCJA 2H9VA 4PPCA 1QPEA 4JDKA 2X81A 2VUWA 3W2QA 1R78A 4PUZA 5L4QA 1Q8TA 3GC7A 4U42A 4V0GB 4XG7A 3D0EA 1IG1A 2PVJA 2UW7A 3O17A 2KTYA 3QTUA 4FV3A 4RSSA 5EM8A 1K3AA 4AF3A 2R3RA 3LLTA 4JXFA 5ETIA 5CENA 3EKKA 3H9OA 3Q60A 5ANJA 3ZSGA 4QMXA 2PUNA 5FTGA 3PE2A 3HA8A 4ARKA 4FV6A 4TRLA 3F2NA 2XIKA 2IZUA 2DUVA 1Y57A 3FLNC 4KIKA 5AUVA 1UU9A 2HY0A 4GT3A 1R3CA 2YM5A 3LIJA 4O22A 4W8DA 3UMWA 2YIRA 4S34A 3SW7A 4ZTLA 4NL0A 2V55A 1CKPA 2C6LA 2ITXA 4IVBA 4NEUA 3R9HA 4EBVA 5HO7A 3Q9YA 3IW6A 4RRVA 4YGAA 4RJ3A 3HMMA 3VS1A 4IVCA 5EFQA 4TWCA 1FMOE 3QA8A 3S2PA 3R8PA 4EKLA 4BDFA 3F6XA 2VX0A 2W1EA 3ORLA 3UQCA 3TEIA 1KE7A 2Z02A 1M14A 4KB8A 4R3PA 4CYJA 1M17A 2VV9A 4FODA 4MXOA 5M09A 3TUBA 4AU8A 4PQNA 2OIQA 1J7UA 1X8BA 4B99A 2PULA 3R9DA 3DAJA 3MH1A 5KMJA 3JUHA 2BHEA 2BKKA 4WG4A 5EM6A 1WBWA 5FEDA 2CGVA 2QR7A 4D2SA 5CAPA 5KKRB 2BDWA 3LXKA 3QBNA 4FNYA 4GUBA 4Y73A 3RAKA 4O0WA 1WBTA 2VTRA 3DQWA 3W0QA 2BKZA 4UEUA 1TFFA 4KABA 2PUPA 5HCYA 2CSNA 3L9PA 4QMWA 1B39A 4BWKA 1T45A 2IVVA 5LVNA 3QQHA 2FSOX 4Q5EA 3REPA 4O7RA 4V01A 5F20A 4CCBA 2YERA 3QRTA 4UALA 1TQMA 3QZGA 2GNGA 4G3DA 2IW8A 4CZUA 5EKOA 5JEBA 1YHWA 5IQDA 3L8VA 3DDQA 1H1WA 1TQPA 3FLYA 4I0SA 3ROCA 4BI0A 4AE9A 3BYVA 4EHEA 1ZRZA 5F1ZA 4FG9A 4EQMA 4CKJA 5LMKC 3NMUF 4QRCA 2XK3A 3KMUA 3OVVA 3QWJA 4WT6A 2OKRA 3K3JA 3RPYA 4ACCA 2XM8A 2W4KA 3O2MA 4KUJA 1ZMWA 3BYUA 2WMWA 4IDTA 2UZUE 1CSNA 5HNIX 1SNUA 5AM6A 2PU8A 5AIRA 3OXTA 2FB8A 4W8EA 3MY1A 5EHOA 4ASEA 4K0YA 3GENA 1P4FA 3C5UA 2YABA 4OTGA 4X2JA 3LM0A 5AP7A 5K0KA 4HNIA 2C3KA 3RWPA 3RHXA 3TL8A 2BFYA 3ATTA 5CSWA 5DRDA 4DINA 5IQAA 3MBLA 2JBPA 4O0RA 3R9OA 4O4EA 5L6PA 3W0PA 4IBMA 1QCFA 4AGWA 3CD3A 4FV0A 3MYGA 2QVSE 5JK3A 2OZAB 4YZCA 2YITA 4NSTA 2HW6A 4RFZA 4Y72A 5JGBA 2YACA 2HY81 4USDA 4BKJA 5K4IA 5FXRA 5C26A 1U5QA 4PMMA 4AW1A 5M51A 4R7HA 2VWXA 5GINE 4I6FA 3BLRA 4O83A 4K11A 4YJUA 3VS3A 5IQHA 5EH0A 5M57A 2XKFA 1E1VA 5AP5A 4GU9A 3FQEA 2BPMA 5CF8A 4XRJA 4CYIA 2UZEA 3IDPA 3LFCA 4CQEA 3OUKA 1J91A 2JDSA 2BDJA 3GU8A 4QP9A 2GQSA 5HE3A 1ZY4A 4YC6A 3CPCA 1JVPP 5CAVA 1CKJA 4RWKA 3UTOA 2Q83A 4JDJA 5KHXA 3PA5A 2W1IA 4FIIA 4I6QA 4QMTA 3RTPA 5E91A 2E9UA 1JSVA 2RFSA 4IX6A 5FP6A 4FV1A 5K5NA 1W2FA 2BDFA 3KQ7A 4E7WA 3F69A 1FMKA 4GVJA 4U41A 3ULZA 2IJMA 1A48A 3UO5A 3VF9A 3C4WA 4FKSA 5CQUA 4JR7A 4DT9A 5AP0A 4PL3A 4J99A 4BWXA 2WNTA 3FMDA 3SXRA 3W16A 1VYWA 4WKQA 4S31A 4BZOA 3M42A 1H8FA 4I93A 4I5PA 4F1TA 5AX3A 4CZYB 3LW0A 4M14A 3TMOA 5L8KA 4I22A 3N4VA 4RIYB 4LFIA 2CN5A 3FZOA 4GJ2A 3MTFA 4WNKA 4C61A 2RFEA 4QD6A 1NY3A 4E1ZA 3ETAA 4MK0A 4ZJVA 1Q99A 3V8TA 4BYIA 3TV4A 2R3IA 4NIFB 4FZ7A 4OAVB 1L8TA 3AD5A 4M84A 5CVGA 3UYTA 4QP2A 5CVFA 4Q2AA 2ONLA 4Z55A 3CS9A 3UOKA 3QCXA 1HCKA 4BDJA 4OAUC 4FIFA 5IG1A 3BYSA 3UQFA 3O0GA 3MIYA 4O0VA 4PV0A 2PSQA 3SDJA 3CPBA 1W8CA 1PMNA 3HMNA 3LCSA 4N57A 4JAIA 3PSCA 3R00A 4RGJA 2G2HA 4YTHA 3DAKA 3HEGA 3MY5A 3E63A 3R04A 3NUXA 4IVAA 4YZ9A 2W1FA 4AS0A 1IAJA 3AXWA 4PTGA 2UVYA 3R63A 4DYMA 3P4KA 3P7CA 4O6LA 3LJ2A 1YWNA 4XH6A 1MP8A 4RVKA 3ZBXA 4EKKA 4XG6A 4AUAA 3MFTA 1A9UA 4BIEA 1OKZA 2DS1A 3DY7A 3D2IA 2R3HA 3ORMA 4JL9A 2WFYA 2XK7A 4IB0A 2X0GA 3DK3A 3CD8A 4HVSA 1RQQA 2XAMA 5EYKA 4CT1A 5JFVA 4TWOA 5JH6A 3W0OA 1R39A 2Q0BA 4RX7A 4YJRA 2YISA 1REJA 4RFMA 4EHVA 2O64A 5HVYA 3CBLA 4H58A 1CMKE 1J3HA 4JX7A 4C4HA 3GB2A 4IX3A 4DCEA 1WAKA 5IDPA 3PUPA 4BDEA 4IX4A 3FL4A 2QG5A 3B8QA 1H1SA 2X9EA 4YJTA 3GQIA 3OP5A 4CTCA 3H10A 4EUUA 5C03A 2OSCA 4CV8A 5IISA 4IFGA 4HVDA 2JKQA 3R2BA 3F66A 3MI9A 4KA3A 4WNOA 3VBQA 4XUFA 5DLSA 4G34A 5AR2A 4HVGA 3C51A 4X3FC 3I7CA 4A4OA 3IO7A 2VTHA 4CFUA 5M53A 2WEIA 3KXMA 4LGDA 3P1AA 4IWDA 4RIXA 3MIAA 2NYAA 1ZOGA 5GZ8A 3EIDA 3E3PA 3LCOA 4V05A 5KMOA 3QALE 3V5PA 3HP2A 4MHAA 5IEVA 2BIYA 3QHWA 3HUBA 4GH2A 1ZAOA 3E92A 4EK6A 4EOSA 2R3JA 4JMQA 5KKRC 5E4HA 4QNYA 5J95A 4YURA 5K5XA 1F0QA 1UU7A 3PJ1A 3KMMA 5ANEA 2HXQA 3GUBA 4FTNA 4QPMA 3ORTA 4ALUA 2J2IB 1JQHA 2X4FA 4ZOGA 4DH8A 3L8PA 4DA5A 5CU0A 3VUKA 4YSJA 1XH6A 3IGOA 4UWCA 1STCE 3FI4A 4XYFA 3N51A 3NWWA 2ZVAA 2C30A 2NRUA 3NRMA 4I5HA 4ZK5A 4AP7A 2XCKA 2QHMA 4FTLA 3HECA 1H00A 4ZJIA 1Q3WA 4TT7A 5TT7A 3VBVA 1WCCA 3O7LB 1YXUA 1OIRA 2NNWB 4EZ5A 5LMAA 3MPMA 4C37A 1XBCA 4ZS0A 4YNOA 5F95A 4P2KA 4FV7A 3BIZA 4QTAA 3AMAA 4FT9A 4FZAB 2WMBA 3KULA 4BI2A 3ZFYA 2RGPA 4G3CA 4QQJA 1E1XA 3D94A 5KBRA 1XH4A 4DEHA 3KXHA 4DGLC 5ACKA 2GFCA 4QDVA 5HESA 3ZEPA 1OM1A 2CJMA 4GIHA 4ENYA 2VO6A 3MWUA 4EC8A 4EH2A 4JRNA 2GNIA 4RC3A 2B4SB 4YZNA 4I92A 3TJDA 4IB5A 4AN9A 3R1NA 2J4ZA 3NSZA 4NJ3A 4KIKB 5T6KA 3RVGA 2GTMA 3TTJA 3HMOA 4IE9A 3FI2A 3W55A 5DE2A 4IWOA 4RG0A 5ACBC 3U4WA 3IW5A 4DFBA 3QUPA 4P4CA 3VC4A 4C36A 2BRBA 5EQPA 3A60A 4F9AA 3G33A 2Y4IB 3EN6A 4R6VA 1ZZLA 2WELA 1XBBA 1H0WA 4MD8E 3BE9A 5KO1A 5DR6A 4QMZA 2A27A 2XIYA 2FSTX 3I6WA 3KXZA 5CU4A 3U8WA 3WZUA 2PL0A 3LOKA 3MH0A 1J7LA 1JPAA 4LI5A 2R0IA 4DGNA 3SA0A 2PUIA 4DEGA 4NZWB 1SMHA 5LVMA 4CFNA 2UV2A 5I4NA 1AGWA 4FKUA 3RHKA 3KC3A 1QPJA 2JDRA 4IIRA 3ZDIA 3AC4A 5IUIA 4EOLA 4CXAA 5ANIA 2VO0A 3D7TA 2UZVA 4HCTA 3ANQA 3R6XA 4IJ9A 1W2CA 3S0OA 4FEXA 5HD7A 4JT3A 4ZSAA 3RWQA 4MXAA 3WI6A 4FZFB 3JPVA 4ONAA 1SVGA 4JJRA 4BN1A 3AOXA 4FV8A 4I0TA 3UOLA 4IM0A 4CMUA 4J8NA 3AG9A 5HNGA 2XANA 3LPBA 1SVEA 4C35A 2PVKA 3W2OA 2ZV9A 5CEIA 1GZ8A 4YSMA 5IA5A 3A7IA 5BVOA 4U81A 5AA9A 4FTTA 4JIAA 3ACKA 2VX3A 3L8XA 1OZ1A 3E7OA 4JQ7A 3O5AA 2ITVA 2VWZA 4FNZA 3CY3A 5DMZA 5I9YA 4C4JA 1W0XC 4BTJA 4KSQA 4OW8A 4XP2A 4DH5A 4OTIA 2QOIA 3FLSA 5DH3A 4AN2A 2C6KA 4JBPA 3V3VA 3RP9A 2X8IA 3QD4A 1OIYA 3VUIA 4OTQA 3CJFA 2WB8A 5E1EA 3SVVA 4A07A 3SQQA 4ASDA 4BDIA 2W9ZB 5G6VA 5JSMA 2GCDA 2CNVA 3VBTA 2YHVA 2JDVA 2XIRA 4KNBA 3QD3A 4FTAA 5IA2A 2W7XA 4FSNA 2HENA 3KN5A 4FG7A 4F1MA 2WIPA 2CGWA 3IG7A 3W2CA 2VX1A 2XKCA 2EU9A 2J50A 2X6DA 4M69A 3LCTA 4FKIA 5BMMA 4PPAA 5E8TA 3IOPA 3B2WA 4RJ5A 4ZSGA 1GIJA 3DTWA 3OCBA 3QQKA 4U45A 4BGQA 4YJQA 3KMWA 1JKSA 2VWIA 5C01A 4DEAA 3TDWA 1BI8A 2QURA 3IK3A 4RX5A 1YXTA 1KOBA 3MPTA 4RFYA 3OS3A 2J9MA 4WSQA 5EDPA 3DXPA 4RC4A 4XG3A 3Q2JA 4LOOA 2I0YA 3TZ7A 2GSFA 1OL5A 1ZZ2A 3KEXA 3VF8A 1H08A 2XNPA 3VN9A 4DEDA 2PZIA 4AN3A 2SRCA 5CALA 3UIXA 3LXPA 3FMHA 3NNVA 5HVJA 4E5BA 3TDVA 1G8KA 4D1ZA 3FC2A 4D2TA 4EH3A 4TYHB 4GK4A 2GQGA 4JAJA 5BQ0A 4IXPA 3AMBA 3E8NA 4N0SA 4X3FA 3PXQA 3BX5A 4KSPA 3VJOA 4ANOA 4ASZA 2CKQA 5E9EA 3AD6A 2PVMA 4Z9LA 2WTKB 5HLNA 5BVKA 4AX8A 4P5QA 3UPXA 1XKKA 3O71A 5HG9A 2XRUA 4OLIA 3BLAA 2OW3A 1BMKA 3OWPA 4ZTQA 4QP1A 3R9NA 3SOAA 4GKHA 3MS9A 3BBWA 2WAJA 5M4CA 4DHJA 4LRMA 2C1BA 3HMPA 5AR4A 1O6LA 3Q9XA 4EOQA 5BUEA 4GRBA 4IWQA 2C5XA 5HBEA 2QC6A 4IFCA 5M44A 5EI8A 1TKIA 2ITQA 4IAAA 3EL8A 4ZS4A 3LM5A 3NYNA 3ORZA 4JBQA 3QHRA 4O6EA 4O91A 5K4JA 3BU5A 2BZJA 4QP6A 4YTCA 2B54A 5HTIA 5JGAA 2ETMA 3EQRA 3ZUUA 2WD1A 1UNHA 2J90A 1G5SA 5GZAA 5IA1A 2ZDTA 3DCVA 5GJDA 3UQGA 2GNJA 3QC4A 3ZFXA 4FKPA 4FJVA 5DNRA 1IASA 3I79A 5HO6A 4XCUA 4ANNA 4M15A 2I7QA 4ZMFA 1VEBA 1DI8A 4QPAA 3PE1A 4XV9A 3PXZA 3O50A 3EWHA 4YR8A 5JT2A 1JKLA 4EH6A 4Y5QA 1SM2A 1XR1A 4G5JA 1GZKA 1H1QA 5CNNA 3C9WA 3FMMA 4PNKA 2C1AA 4MH7A 4QMVA 4FTCA 4BB4A 4LL5A 2X2LA 3PP0A 3E64A 5FTQA 3QUDA 3DXNA 5HZNA 4RZVA 2G2IA 4I1ZA 3OBJA 2XBAA 4CG9A 3AMYA 4RJ4A 4RLKA 3G9LX 2OFVA 2F7EE 2Y4IC 3HX4A 2QNJA 4DG2E 4E26A 3ZOSA 4D4YA 4F4PA 3DJ5A 2V7OA 3UZRA 4IB1A 4YZBA 1PHKA 3D5XA 4L42A 4EI4A 4M8TA 4EZ7A 4BL1A 4F65A 1SNXA 3JS2A 3R9RA 2UW8A 4GYIA 4QDEA 3R01A 4NTTA 4I20A 1Q97A 3DBQA 3TIYA 3O51A 5L2WA 4CFMA 4O7YA 2VTJA 1PXNA 3Q4ZA 4FNXA 4BJJA 3TI1A 1CKIA 3QQGA 4WG3A 3A99A 4EK5A 3V01A 3HDMA 3N9XA 5FXQA 3ZYAA 3KREA 5IQCA 2R3MA 3RBWA 2W1DA 3U51A 3ID6C 4FSZA 3UDTA 3NFFB 2XJ2A 5IA3A 4XJ0A 5DA3A 4AW2A 3RI1A 4ZXTA 2I6LA 3UNKA 1UWHA 4M68A 4PMSA 1H27A 4UWBA 2J51A 3TACA 4EOIA 5GNKA 5LCJA 3ZM9A 5LXMA 3VS4A 3LVPA 4QOXA 4WO5A 4DFYA 4FTKA 3GC9A 4WG5A 5AUUA 4O7SA 1FVVA 1WBVA 3MGYA 3OY1A 4HPUE 5H8EA 5DR2A 3EN9A 3OCTA 1WBNA 2RG6A 3VBYA 5EKNA 3G15A 3NUPA 4MNEA 3ZO2A 4NKSA 5JGDA 1H1RA 4F70A 3PPKA 4D5HA 4BHZA 3V51A 3W32A 5HNBA 3HVCA 4QYYA 5BVFA 2GPHA 3ZXZA 2OH0E 2YFXA 3C5IA 4RIOA 5LARA 3JY9A 2RF9A 5KMNA 5FGKA 3FLQA 4FSMA 3F7ZA 2R0UA 3PWYA 3BKBA 3QYZA 2HXLA 3COHA 4EYMA 3WIKA 1Y8YA 4DLIA 4EWQA 3RCDA 4P7EA 5E92A 3ZLWA 1IEPA 4ALWA 3TUCA 1RJBA 3THBA 1G3NA 3NUUA 3NAYA 4E3CA 3DNEA 4CEGA 4ZP5A 3RZFA 4B8MA 2PYWA 3TZ8A 5IEXA 4HCUA 4AAAA 1B38A 2QO2A 2WOUA 1K2PA 4OTWA 1LP4A 1OITA 2R3GA 4UV0A 4D58A 4NW5A 5FWKK 4F7NA 3MFUA 3OT8A 3PZHA 2E2BA 2Z7LA 4UYAA 2R2PA 3GBZA 3QZHA 5TE0A 5AUTA 3S3IA 4C3PA 2YEXA 2HELA 1WBOA 4QPSA 5HQ0A 3RPSA 3CP9A 5CF5A 3WARA 2B1PA 2XEYA 1IAHA 4DFNA 3NNUA 4YBKA 1ZYDA 3O23A 3QTIA 4MWIA 3TZMA 4YJOA 2W1ZA 3RM7A 1LEZA 4L44A 4X3JA 4PNIA 4ZSJA 3S1HA 2OJGA 1FVTA 3F88A 3IQ7A 5HGIA 3VUHA 3NLBA 2C6DA 2XYNA 4BKZA 4F9WA 5TR6A 3A8WA 4HNFA 5CU3A 4U5JA 3TG1A 3E3BX 4O27B 3KN6A 3BELA 3NIEA 5DEWA 2H8HA 2F57A 3EFWA 2C5VA 3FWQA 4FF8A 4R8QA 3H9RA 5IEYA 5KMIA 3LKMA 5JFXA 3UNJA 4CFFA 3FXXA 2ETRA 3E62A 3DLZA 3OTVA 4UN0C 1AQ1A 3PSBA 4RX9A 5AV2A 4A9YA 3T3UA 1OBGA 1ST4A 3RKBA 4TYIA 4U79A 4FIJA 4C2WA 2ERZE 2WTKC 3Q9WA 3OHTA 1GJOA 1ST0A 1ATPE 4H3BA 2OF2A 2YJSA 4A9SA 5CEMA 4AZSA 3GFWA 5LCKA 3CTHA 2P4IA 4MD7E 3H30A 4XG8A 3PVGA 4BCNA 1BL7A 3RK9A 1MQBA 4BTFA 3W1FA 4EHZA 4FZ6A 4FL1A 3HV5A 3GU5A 4IMYA 5CT7A 3VS0A 4E5AX 5J9LA 3LLAA 2X8EA 3NVKI 3KVXA 5HD4A 1VJYA 4ZTSA 3QUEA 2ZDUA 3LJ1A 2XNEA 1W2DA 5C9CA 4L68A 2VNYA 5JN2A 2R3PA 1KSWA 4FUXA 3R1QA 3MSSA 2PY3A 5HKMA 4GK3A 2XALA 4ZY5A 3BI6A 3HAMA 3EQFA 1YRPA 4WBOA 4GT4A 4UX9A 1REKA 5BVWA 5ETFA 4FKVA 1VLRA 4NM5A 1RDQE 3OEFX 3BRBA 4QMPA 2YM8A 4WHZA 4YPDA 5C27A 2BMCA 4R1VA 3TTIA 3EJ1A 2ITWA 5EW9A 4NCTA 4WOVA 3K3IA 4DHFA 3R21A 3SRVA 2F9GA 4JQ8A 2X0QA 5AR3A 1YWRA 4ZTNA 3UC3A 4RIWB 4R7BA 3UDSA 4ZZOA 4MNFA 3V6RA 1FQ1B 4IAIA 3G2FA 3OEZA 4UWYA 4JQEA 3PJCA 1OGUA 4II5A 1OL6A 5FG8A 1Z5MA 4IM2A 3TWJA 4S33A 3EMGA 4EHGA 3P9JA 4YBJA 2VWBA 2C47A 2H96A 2RL5A 2WTCA 3PFQA 3UZPA 2PTKA 3BL7A 2UZOA 3V04A 5CAQA 5EI6A 4FT3A 3C0IA 5EK7A 4AQCA 4FTQA 4KD1A 3AT2A 1PJKA 3T8OA 2WIHA 3EH9A 3G6HA 3LFQA 1UV5A 3RAIA 4MF0A 3BE2A 3FXWA 2XNBA 4L43A 3WF8A 4EORA 4TYGA 3NUYA 5FM3A 3VONA 4YO6A 2AUHA 3SAYA 4O96A 4AZTA 2W5HA 1YOJA 3KK9A 2IN6A 4GG5A 1OL1A 3EN5A 4JRVA 4R3CA 3NCGA 5B2KA 3TIZA 2R3LA 3ZTXA 3VO3A 5IUGA 4HCVA 3QD2B 5A4QA 2VNWA 3ZRLA 1YHVA 3P08A 4HPTE 2AEGA 2ZFYA 4MCVA 4DTAA 4D2WA 2UW6A 3AC1A 3D9VA 3R2YA 4OUCA 4I94A 2YCQA 2VTOA 2W5AA 2W9FB 5LVOA 4DHIB 1YHSA 2ZYBA 1LPUA 3QD0A 3MESA 2RG5A 1OECA 5DYJA 2X0PA 4JR3A 3AC5A 3EFLA 4L7FA 3V5QA 2FYSA 4I5CA 3FQSA 5AMNA 4USFA 3OWJA 4K8AA 4YHFA 3UVQA 5D11A 4BCFA 2F4JA 3EZRA 3P7BA 4NH1A 5DR9A 4F08A 2ZOQA 3OMVA 4U8ZA 4AT4A 4F6SA 3UOJA 2QCSA 4RBLA 1ZMVA 3G51A 1W98A 3GFEA 3VUGA 1PXPA 3FC1X 5D7VA 4C3RA 4Z7GA 2E9NA 4KIQA 2IVSA 3Q53A 2QKRA 3ZO4A 1PXOA 4C59A 4EOOA 5LVLA 4HVIA 2GNLA 3DZOA 3P79A 4YTFA 3RK5A 3EL7A 4AE6A 5IF1A 5BUIA 4XEYA 5A4LA 4LGHA 3FPMA 3GU4A 4JNWA 5AWMA 3AGLA 3PVUA 3PLAE 5FP5A 2IW9A 4B9DA 4NW6A 2YZLA 2BTRA 2JKOA 3ODZX 2IEWA 4QMNA 1OKVA 3NUNA 4F0IA 5L6OA 1U59A 5CI6A 5CAOA 2B55A 3JVRA 4G9RA 1GIIA 5BVEA 3TNWA 4BICA 1GAGA 4ZLYA 5LOHA 5L8JA 4LMNA 4LRJA 2PVLA 5EM5A 4R5YA 2PE1A 2QO7A 3Q6UA 4MBJA 5AAFA 1HOWA 3AT3A 4R78A 2EXMA 1UVRA 3C4ZA 4K1BA 1EH4A 3BHVA 4AZWA 1W82A 3JVSA 4LUEA 2CKOA 3KXXA 2GS7A 2C0TA 5IA0A 3ENMA 4QT1A 1XHAA 4Q9ZA 2UZTA 4C3FA 3D4QA 3NNXA 3EQBA 2JAVA 4QQ5A 2X8DA 5GZ9A 3U6IA 3R7IA 3W2RA 5HIBA 3WZJA 3PSDA 3C0HA 4EOJA 1G8JA 2WQMA 3A61A 2B9IA 3FKLA 1Q8WA 3HV4A 4L6QA 3G5DA 4I4FA 3B8RA 2ZV8A 2JDTA 4GCJA 4E4MA 2G1TA 5FQDC 3LAUA 4M13A 4DF3A 4WNMA 3TYKA 4L3LA 4EJNA 5IQIA 3NAXA 4FTJA 4PY1A 2B53A 4DDIA 1WMKA 2OWBA 2UZLA 2GMXA 4A9TA 1U46A 4L00A 3ZLSA 2HZ4A 4ANSA 2W1CA 3MA3A 4PL4A 4OBOA 4X0MA 2WPAA 5HOAA 2WQNA 1P5EA 1DS5A 5C4LA 5E8UA 3PIXA 5CI7A 4K6ZA 2EB3A 3M2WA 2YIWA 3BHYA 3OCSA 5H9BA 3PVWA 3QXPA 1W83A 3AC2A 3BHTA 3TCPA 3LFBA 3UVPA 4PDOA 2YWPA 4LUDA 1FGIA 2GFSA 2P55A 3QFVA 1Q8YA 1YVJA 1H1PA 2BRHA 4NJDA 4TY1A 1GIHA 5FLFA 1PY5A 2WMUA 5C1QB 5I0BA 4RC2A 4C4IA 5CLPA 4IQ6A 4BHNA 5IMXA 5IQGA 2NPQA 4QYEA 4ACGA 5C8KA 4NM0A 1OL7A 4BDHA 5M56A 2R3OA 3VBXA 4RLLA 2VWWA 4FTUA 1XQZA 5EW3A 3VHEA 1PMUA 3HRBA 3FYKX 5M08A 2XKDA 3MVMA 4IC8A 5ANKA 4NFNA 5F4NA 2XK8A 2EVAA 4YLJA 4D2PA 2YDKA 2UW9A 4FK6A 3W0NA 2PK9A 2R3FA 1OPLA 4AA5A 4HZSA 5L2SA 3DFCB 5BV3A 3RZBA 4F0GA 2VTLA 3F7WA 3SXSA 4FYNA 4HGLA 1KUTA 3NW7A 4FK3A 3COKA 5HG5A 4G6OA 3UBDA 4D55A 3UZTA 2GQRA 1OL2A 3HDNA 3CLYA 5DVRA 2GU8A 2R7IA 3TN8A 2ZV7A 5AV0A 5E90A 5I9WA 2F7ZE 3R22A 2XCHA 3PTGA 2W1HA 1S9IA 4LYNA 3PRIA 4FZDB 2UW4A 1OIUA 3O8TA 4IAZA 1HCLA 2XYUA 5K0XA 3I5ZA 4LV7A 5BYLA 5AUXA 2A19B 3LMGA 3RCJA 1ZYJA 1YXSA 3C4XA 5M06A 3TNPC 3L9MA 2NP8A 5DHJA 2CKPA 4FNWA 2KULA 2UW5A 3LQ5A 1QMZA 4MXYA 2CKEA 3DBFA 3R7EA 4DH7A 2OK1A 1H07A 1DAYA 4A9RA 5J7BA 2QOBA 4FVRA 4YJNA 2HZIA 1M7QA 1NT2A 4OR5A 5BPYA 3OCGA 5CZHA 3W0SA 4EEVA 3PY3A 4MYGA 1ZWSA 4U9AA 3I7BA 4FSYA 4XG4A 1UU8A 2R3NA 4YZDA 4B7TA 3AKLA 3Q6WA 2W4OA 3OTUA 4D9TA 3P0MA 3G9NA 2JITA 3KRLA 4KINA 3ZCLA 3GEQA 2O0UA 3S95A 3OC1A 4FG8A 5C8MA 1A06A 2FH9A 2UUEA 4XP3A 2C6IA 5LMKA 3TUDA 4AZEA 4DBNA 1YW2A 2Z7QA 3PXRA 5D9HA 1CDKA 2JBOA 5CS6A 5LJJA 2GS2A 2X7GA 5G1XA 5IZFA 3H3CA 4E6DA 5E8VA 4PP9A 5FD2A 5B0XA 3EKNA 4PDPA 3EOCA 1JWHA