1OKYA

Structure of human pdk1 kinase domain in complex with staurosporine
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
288
structure length
281
Chain Sequence
PQPRKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSPANFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEYLIFQKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTPPKLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Ucn-01 (7-Hydroxystaurosporine) Specificity and Pdk1 (3-Phosphoinositide-Dependent Protein Kinase-1) Inhibition
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords 3-PHOSPHOINOSITIDE DEPENDENT PROTEIN KINASE 1
total genus 84
structure length 281
sequence length 288
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2003-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1okyA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1okyA02
4YJTA 1FGKA 3PP0A 4F7NA 2CJMA 5IEXA 4FNYA 2Y9QA 5LVMA 4O7LA 4DGNA 3CS9A 4JBPA 5C03A 1JVPP 4BIEA 4Q5EA 2J0MB 5BYLA 3EWHA 1E1XA 5C4KA 3NAYA 4PMMA 2F49A 4DINA 2P2IA 2PL0A 4FG9A 2B4SB 3IG7A 4C2WA 4E93A 4S34A 4EK8A 4AWIA 3QZGA 5IQHA 4BBEA 2W1CA 4ZY6A 3R30A 3H30A 1Z5MA 2WTKB 3CBLA 3DTWA 3RZBA 2CNQA 4N57A 2XYUA 3SOCA 5CTPA 4XG6A 4ZTNA 5E91A 4GFOA 3Q4CA 3BLHA 1OZ1A 4KS7A 4W4WA 5LCJA 2GPHA 4R5SA 1WAKA 4XLIA 1WFCA 5E8VA 1LUFA 4BWKA 4EOIA 4GKIA 4FTLA 3DKGA 3CGOA 4MHAA 4RJ6A 2UW8A 2YCRA 2OH4A 4R8QA 3D5VA 5GZ8A 3TUBA 4DAWA 4J52A 4E5WA 2QOKA 3CIKA 3PPZA 4J8NA 3Q3BA 4LUEA 3IOKA 5HBJA 2QO9A 3UQCA 1KE8A 3NPCA 2P33A 3TEIA 4GRBA 2XYNA 1QCFA 4LYNA 2GNFA 4TL0A 1NA7A 5FXQA 4EH3A 1PXIA 4IAFA 3V8TA 3G15A 2DWBA 3TWJA 4X7QA 2UZNA 1F0QA 3UJGA 3BBWA 4BN1A 2ZDUA 4AUAA 4HNFA 3WYYA 4U8ZA 5DT0A 2WXVA 5DEYA 3W8QA 3FY2A 5EK7A 1SYKA 2P2HA 4I1ZA 5C8KA 2Z02A 2JKQA 2WMWA 2C3LA 3QXOA 4Y5QA 2VWUA 4F9WA 3Q6WA 3NS9A 1U4DA 4PF4A 4FKWA 4QTDA 4MNEB 5I4NA 4PPAA 3LMIA 2WMTA 3QTXA 3CSVA 3NNUA 2XIKA 5D1JA 4BF2A 5HIDA 5KBRA 1PYXA 3RHKA 5JFXA 3AXWA 5D41A 4TYHA 4FMQA 5BVDA 2X39A 2ONLA 4EZ3A 3K54A 2YM3A 5C01A 4CRLA 3LCTA 5IDPA 4KNBA 4Y95A 3RGFA 3VHEA 4O7ZA 3PXZA 4WG3A 2IZTA 2JIIA 3NW6A 2UVXA 2OIBA 4QYGA 2YM5A 3F7WA 4D1ZA 4HVDA 4Z7GA 4D4YA 3CTHA 2ITVA 5KNJA 4QO9A 5EM6A 3ZSGA 3F82A 4UMPA 2NNWB 5AR3A 1XH7A 2ERZE 3C4EA 2PZIA 3FL4A 3I5NA 3O8TA 5AR7A 1OI9A 2W7XA 3D5XA 4LOOA 4IACA 4U9AA 3LMHA 1JKLA 3EN5A 3F7ZA 4FIHA 4I24A 5HLPA 4BCPA 5L2IA 3W2PA 3Q6UA 4J53A 1J1CA 2DUVA 3A7FA 4QP7A 4DT9A 4FE2A 4BDGA 4RLKA 5C27A 5A54A 5BUJA 4DCAA 5AP3A 4Z9LA 3OCSA 4P5QA 1ZMVA 4KB8A 4QYHA 4IDVA 4K11A 4RWJA 3RK7A 3P86A 4EJ7A 5A4QA 4QP4A 2PZPA 3B8RA 5D9HA 5E7RA 2BRNA 3KL8A 3RCJA 4S2ZA 2GHMA 2OZOA 3OT8A 2ITZA 5ETFA 4YURA 3HZTA 2NP8A 4IHPA 4X2NA 3KXMA 4N70A 3QD2B 4NZWB 2JAVA 5HCXA 3DDPA 2E9OA 5F1ZA 5A46A 5CEMA 2B7AA 1W84A 4FK6A 5B2LA 4YJSA 2YAKA 2H96A 3KU2A 2XB7A 4FBXA 5AUWA 4F08A 2CKOA 1K3AA 2ETKA 3ZLXA 2PPQA 5GJFA 4RJ4A 5I9ZA 5CXHA 4PPCA 1H26A 3L9MA 3PJ8A 4GEOA 1MRVA 2UW9A 3RWQA 3F5GA 3I7BA 4J1RA 3DLZA 3QTSA 4JIKA 5E8XA 4RWLA 3KF7A 3R8MA 3AD6A 3K3IA 4F1TA 1A06A 5JGDA 3QZIA 5G6VA 4RGJA 2C47A 3UNKA 2YFXA 2X0GA 2EXCX 3LXLA 5HI2A 2F9GA 4XBRA 4DEBA 4B6LA 1JOWB 4C4EA 4S32A 4FC0A 3PVUA 1W83A 5H8GA 3PY0A 4F4PA 1YXVA 2J9MA 4FKJA 4RA4A 2R3RA 1L8TA 3P5KA 3ALOA 3FEGA 1Q97A 4M7IA 5FWKK 2PVMA 4FSNA 5FQDC 2QOHA 3ANRA 5CVGA 3GENA 4B99A 5IUIA 5J9ZA 4KIKB 3ZRKA 1M52A 4WUAA 5IKWA 4BDCA 4NTSA 1J91A 2OU7A 5K5XA 3W10A 3PE2A 2RG6A 4FG7A 3MY1A 1U5RA 3BYOA 3SW7A 4YLKA 4CFXA 1OKVA 2AC3A 4G3CA 1R3CA 2C6IA 5EW9A 5I3RA 3FDNA 3EKNA 3MFUA 3R1NA 3H9OA 2BDJA 1QPEA 3P78A 3R2BA 2I7QA 1JKTA 2UV2A 3MPAA 3OF0A 4FYNA 5HZNA 1PKGA 2CLXA 4EWHA 3NX8A 1VZOA 3BYUA 5ANKA 4R7BA 4QMTA 3ZLSA 4O1PA 4AW1A 3MGYA 3DK3A 4AOJA 4C4JA 2ZDTA 4HPTE 2ZVAA 3NIZA 2FB8A 2R0UA 5AUYA 3CQEA 5CVFA 4BVUA 4BYIA 4YSMA 1XHAA 4K1BA 4A9SA 3LE6A 4MVFA 1Q8UA 3ANQA 3UC4A 5IQIA 4RWIA 3QQKA 5CT7A 3G0FA 2GCDA 4FSQA 5CEQA 1ZXEA 5CEIA 3U54A 2YISA 4E5AX 1G5SA 4NTTA 3F3TA 3HA8A 4HPUE 4NL0A 4JR3A 4I93A 4F9YA 2Z60A 5AFVA 1ATPE 3ERKA 4FZAB 3I60A 3BU3A 4QQJA 5A4CA 3VS7A 5JN2A 1WVWA 4KWPA 4L43A 4QMUA 3TZ9A 4USDA 5M4CA 4FKQA 5I9WA 2YACA 1FVRA 3G9NA 3GI3A 3O7LD 4PTGA 2I0HA 3GQIA 2H6DA 2WQBA 3QTWA 4IE9A 4X2KA 2QC6A 3ZOSA 4C37A 1WBVA 1ZZLA 1IAJA 3MW1A 2ZB0A 5AX3A 3TNQB 2X1NA 5A4TA 1UKIA 3Q9XA 5FRIA 3ZBFA 4FV6A 3M42A 4U43A 2R3MA 3GBZA 3II5A 4OTIA 4RC4A 5LVPA 3UODA 1IA8A 5HO8A 4GT4A 2B52A 4EK4A 4AA0A 1IASA 4O6LA 5JT2A 2PVYA 3G2FA 4YU2A 1BI7A 1JAMA 3JR1A 5FP5A 3UG2A 3EMGA 2O0UA 5AP5A 5JGAA 3VWAA 3EFWA 4IB3A 4Z3VA 3VS6A 1XH6A 4RBLA 4NH1A 1BMKA 4O0SA 3LFNA 3WF8A 2KTYA 3UOJA 3RPVA 1XBBA 2ETRA 4CNHA 4ZXTA 5JFWA 3ZUVA 5LMKC 2W1EA 1ZYLA 1JKSA 4WNKA 5A14A 4QNYA 2I40A 4CQGA 2IW6A 3QQGA 4XNEA 3KMUA 3PWYA 4D2TA 4I6QA 5HG7A 3QQHA 3AD4A 4L3JA 5M07A 3WZJA 5LWMA 2PUNA 3FKOA 2IZRA 4ENXA 1YI4A 1V0BA 2C3IB 3H9RA 4FV5A 5GZ9A 5HLNA 5EI6A 3SA0A 3ODZX 4DLIA 3REPA 3MA3A 2VGPA 2Q0NA 4FX3A 4WBOA 3UBDA 4ZZOA 2FGIA 3DQWA 4FTKA 2QOFA 3HNGA 3OCBA 2OXYA 3QZHA 1R0EA 4AN2A 3RK5A 3Q9YA 4AE9A 2VO6A 5KHWA 2JLDA 3NZ0A 4HCVA 3KMWA 3OY1A 3PTGA 3UIBA 4YTHA 3UZTA 4YZDA 4MXXA 3N9XA 4YHTA 3VC4A 1M17A 3D7TA 3ZO3A 4YJPA 3IDPA 3NUPA 3Q04A 4QP8A 4TYGA 5JRQA 4CMUA 2KULA 1STCE 5HE1A 5CF4A 2B9FA 4WOVA 2UZLA 3W2QA 1MRYA 1DAWA 5CZHA 4ZSLA 3GU8A 4YZCA 4D28A 3BZ3A 2J4ZA 5IUGA 2Y6MA 3HV7A 3FZPA 4D4VA 4HYUA 5CI6A 2W0JA 5AV1A 1S9JA 4MD8E 2C5YA 3FWQA 4F6WA 4FK3A 3GCQA 4QQCA 3FC1X 1KWPA 3TV6A 1Y6AA 3NSZA 3DKOA 5AP7A 2O3PA 3U87A 3Q4TA 3R1YA 3FMMA 5HX6A 3ZFMA 4UYNA 4AZFA 4ZZMA 4F65A 3L9PA 4D4SA 3OTUA 1TQPA 3AC4A 2VD5A 2W06A 2JDSA 3A62A 4NT4A 3RAKA 4BRXA 4R3PA 1OKZA 2WB8A 2X4FA 5IH5A 1SVEA 4AZSA 1FMOE 2B54A 1XH9A 4E4NA 3SG9A 2BIKB 2OKRA 3LIJA 2GNGA 3PUPA 2RL5A 1H1PA 4FTCA 5E92A 3V6SA 3KXHA 1NVQA 5D7AA 3BEAA 2YZAA 2QODA 2UW4A 3W16A 3QTZA 2F7ZE 3BU5A 5KMOA 4HNIA 2WTVA 4P2KA 5T6KA 2GMXA 3HV3A 3O17A 5JK3A 2QG7A 5CY3A 5HEZA 5J5SA 4X6QC 3CCNA 2RFNA 1UU8A 1OKWA 3MFSA 2FSMX 4KIPA 3UQFA 3B2TA 4CLJA 3FLZA 3C4WA 4BDAA 3DT1A 2GNLA 3C9WA 1JSTA 1VR2A 3BHVA 3EL7A 4FTQA 4CTBA 5BX0A 4KAOA 4RFYA 4F7JA 2PMOX 3LXKA 4O81A 2HXQA 4OBQA 4BYJA 4ALUA 2O2UA 1Q3DA 3VBVA 4RIYB 5BPYA 2EB2A 3VUDA 3WZKA 4IEBA 4AOIA 1TVOA 3H3CA 3FKNA 1ZAOA 1YW2A 5DVRA 5HESA 3FPQA 3VRZA 1SVHA 5IMXA 4M8TA 3VS0A 3PVWA 3PXYA 4E3CA 4IX5A 2FA2A 4U41A 4M68A 3ORPA 4DITA 1GIJA 1GY3A 2PMLX 4CCBA 4ZSGA 4CEGA 1RE8A 4DGLC 3P9JA 2HZ0A 5J8IA 3RM7A 3ORLA 1H0VA 2EVAA 5ANEA 4BFMA 4FKOA 4KIOA 4TYHB 3GC9A 5EM5A 3A7JA 3A60A 4LFIA 4OLIA 1APME 4OTQA 3P1AA 4U97A 2R3NA 4XP0A 1GIHA 4FSUA 3EQPA 4W8EA 5BMSA 4USFA 3FMNA 4PL3A 4LGGA 5EYCA 3RTPA 4Y8DA 4C0TA 5HU9A 3HLLA 4FVPA 1OL2A 2BRGA 4I41A 3DV3A 4K33A 4KABA 4FR4A 3WILA 1OBGA 3PXQA 4OTWA 4RIXB 3R9HA 3SW4A 4D9UA 3KY2A 1W8CA 4E4XA 5CALA 2W96B 4XG9A 5L8LA 3DY7A 2AC5A 5DT3A 2WFYA 4ZY4A 1YKRA 2FSOX 4I5HA 5B2KA 3TG1A 4RX9A 5EI2A 4A07A 3ALNA 4WNPA 2W5AA 3FV8A 3LCOA 4FOBA 4IB5A 2GFCA 2XJ0A 4FYOA 4MQ2A 5DYJA 1PMEA 3MTFA 4FIFA 4DGMA 4YTCA 3QKMA 1W98A 2X6DA 3OBGA 2VO3A 4JDJA 5EHLA 2HOGA 2ZM4A 5JZJA 3QQJA 4WG4A 2P3GX 1Q8YA 2CKQA 5M57A 1TQMA 3FLNC 3WIGA 4J97A 4DE4A 4TYJA 5HX8A 3QRUA 2O64A 3U4UA 3F9NA 3NYXA 2X9FA 3EZRA 2E9UA 4QYYA 5HVJA 3RJCA 1NT2A 3R63A 4NM3A 3ODYX 3NR9A 2GU8A 4EOJA 3UP7A 2GS7A 1ZYDA 4ZLYA 5FDPA 2ITTA 3DGKA 2WIHA 3HRFA 1YOMA 3BWJA 5GZAA 2PUPA 4DTAA 5C1QB 5FBNC 4YZMA 5LVLA 2C6OA 4ZLZA 5EOBA 4ZJJA 4HGEA 4UALA 2YM6A 3OXTA 2WQMA 4PMSA 3S0OA 3PSBA 2BUJA 3UVQA 3SHEA 3ZDIA 5J7BA 5M08A 2C30A 4JAJA 4L8MA 4PWNA 2PVKA 4ZMEA 4DGOA 3IW8A 4JBQA 5DLSA 4HZRA 3P7CA 2C3KA 3R1SA 4IZ7A 2XH5A 3MFTA 4ANOA 2ESMA 4GV1A 2BPMA 4IZYA 3E62A 2QHMA 3FXWA 3FZOA 3NW7A 1ZRZA 1A9UA 5BUEA 3ORTA 4EH2A 4EQMA 5IEVA 4X2JA 4CZYB 2W9ZB 3TDVA 2VTQA 2REIA 2JFLA 2VTTA 3D94A 3WARA 3H0YA 3KKVA 5AR8A 4ITJA 3GU4A 2VWWA 3OWLA 1KOAA 2WMUA 3OY3A 4FZ7A 1U59A 5CF5A 3FMDA 4HYIA 2HZNA 4XV9A 5M55A 4FEQA 2YITA 2HXLA 2ITNA 5AA8A 4AW2A 5CAPA 4YZ9A 2G15A 3KULA 3BYMA 1B38A 2XNGA 1YHSA 2PVLA 2YLEA 1JSUA 4G3FA 4FKRA 1K2PA 3R8VA 3R9NA 1VYWA 3FYJX 2C6EA 4UMTA 5TOZA 4UMRA 3KRLA 2VTOA 4O0UA 4FOCA 1ZYJA 4FVQA 5K0XA 5ITAA 4U42A 5EQYA 2E9NA 3RALA 3RBWA 3SDJA 4RQKA 3CPCA 5CAUA 5EDRA 5CSXA 2W4JA 5FLFA 3GCUA 1QMZA 2X6EA 5KHXA 5DOSA 5KBQA 1F5QA 4EK5A 3IW4A 4OT6A 4EUUA 4G9CA 5C26A 4LMUA 2WEIA 5AV3A 2P55A 1GIIA 2QKWB 1JBPE 5EYDA 5B2MA 3FKLA 2HY0A 3KXXA 4ZEGA 3VF9A 3VO3A 3ZH8A 3LJ1A 4OTDA 3U8WA 4BGQA 2OLCA 4YJUA 2RFSA 3E93A 1CKPA 3R7VA 3VULA 3SV0A 4D0WA 4DEAA 4W4XA 3FLWA 4BTJA 5DBXA 1PJKA 4GSBA 1YI3A 4AGUA 2G1TA 4C3RA 4E6DA 3BGPA 1ZARA 3ITZA 2VTRA 3LOKA 4JBVA 4R6VA 2XK7A 1DS5A 4IVDA 3FZ1A 3L9NA 2VWXA 4FSZA 4J96A 4JR7A 2QOBA 4P5ZA 4WKQA 3DQXA 4FUYA 4AA4A 3OT3A 1W0XC 5FTOA 4Y83A 1RDQE 2PU8A 3HMNA 1WVYA 4IZ5A 3O96A 4OTRA 2RFDA 4RJ3A 3U6JA 2OF2A 3D2KA 3OCGA 3PPKA 4IAAA 4OUCA 3ZSIA 3NIEA 2OXDA 3FI4A 5AP0A 5I9UA 5JZNA 3A61A 4OR5A 1H01A 2YIRA 3GT8A 4FV1A 4IAYA 4QP9A 3RAWA 1YXXA 2UZOA 4X6RA 2QOIA 2X4ZA 4FV3A 1HCLA 2VTHA 2VWYA 2HELA 5AV0A 5BYZA 3NUSA 4GUEA 5GINE 3UGCA 2VX1A 1PKDA 3W33A 4J99A 4FTRA 2X7GA 3V3VA 5LVNA 3O0GA 4ZJVA 3VJOA 4C34A 2UW6A 2A4LA 2I0EA 4NIFA 3BWFA 4FV8A 1YDSE 4UWBA 5HCYA 3SAYA 1NY3A 5IDNA 4L00A 4O1OA 5KMLA 3NYVA 4GU6A 2VU3A 3A7IA 3LFCA 3SVVA 2VZ6A 2V22A 5HG9A 4DEEA 5ANJA 3M1SA 3G6GA 4EOMA 5BVFA 4DLJA 4PP7A 2LGCA 2WELA 3LFSA 3ZS5A 5ETIA 3E63A 4D1SA 2UVYA 3FZSA 2JGZA 4KIKA 4RMZA 4RSSA 4U7ZA 4XX9A 5L6PA 2QO2A 3DA6A 3OP5A 3PYYA 3R21A 2ITPA 2V5QA 4GMYA 2X7OA 1P5EA 4QMVA 3V5QA 4FV7A 2JDOA 4DG0E 3BX5A 1XBCA 2BHHA 1PRYA 5D12A 2IWIA 4FTTA 3NUYA 3UPXA 4F1OA 4AOTA 3FLQA 3D5WA 3FQHA 3TJCA 3KB7A 4IBMA 3E87A 2Z7QA 4IM2A 1TQIA 3SLSA 3UOLA 4C33A 3LMGA 2XUUA 4QP2A 3W2RA 3PVGA 4I0SA 4YZNA 1JSVA 3S2PA 3WIKA 2HIWA 3N4VA 3RZFA 1NW1A 4X3FB 2EWAA 3KVWA 3Q4ZA 3JY9A 1Y6BA 2XK4A 1Q41A 3H4JA 3UIXA 3PXKA 4FSMA 4KA3A 2ZV2A 1IAHA 3O8PA 4LGHA 4C4IA 3O51A 3PE1A 3R02A 3UNZA 2BIYA 4EKKA 3LJ2A 4FNXA 5L3AA 3TNWA 1ND4A 3NLBA 3NW5A 1Q8WA 3EN4A 1H24A 3SXFA 2XKFA 3PLSA 4GU9A 4EH7A 3OWKA 5CU2A 5DHJA 2BKKA 5EYMA 3GUBA 4QMZA 1GZNA 1E9HA 4WUNA 5A6NA 2PYWA 3OG7A 4GW8A 5AUVA 4ZTHA 5TR6A 1SZMA 2BRHA 4MKCA 3F88A 2PVRA 3ZONA 4BI1A 4EWQA 2XKEA 4IIRA 2WPAA 2J90A 3MH3A 3C5IA 3WE4A 2BRBA 4RRVA 3CTQA 4RFZA 4BY9E 5IA2A 4AGWA 4HVHA 3GOPA 4X2GA 5EDPA 4QP3A 5KZIA 3UOHA 3PA4A 5AAGA 2EUFB 2NRUA 2ZV9A 3MN3A 1Q61A 3PJ3A 4F63A 4YGAA 4BIDA 1SMHA 2R3PA 3F5PA 3R9OA 3V5JA 5CAQA 3DXNA 3EJ1A 1REJA 3RAIA 4OTGA 3BV2A 5IMEA 4XMOA 5AX9A 3ZLWA 3E92A 1EH4A 4I0TA 5GIPE 4ZSEA 1VYZA 3FLYA 2BAKA 3PA5A 4QMQA 2IPXA 4X3FC 3VAPA 4E26A 4FZDB 4U44A 3ATTA 5GJGA 2C6DA 4IVCA 1X8BA 4S30A 3V04A 5I0BA 2RGPA 4PDYA 3FY0A 3RMFA 1PXOA 5FGKA 4C35A 3UC3A 5D11A 1BUHA 3FMEA 3DU8A 3EQIA 5EYKA 2YIXA 4FICA 4BCMA 5J1VA 4RX8A 3NUAA 3EQDA 2C5XA 2ZMDA 3N51A 3ZO2A 4D2VA 5FM3A 3OOMA 2PVNA 3LQ5A 2C6KA 3LFAA 4FF8A 3ULIA 1CM8A 4ANQA 4A4OA 4M84A 4I21A 4YHJA 1ZOGA 4NKSA 1URWA 4MF0A 2OWBA 2R3IA 4I6FA 4JIAA 5LXMA 3SXSA 2J6MA 2JBPA 4RC3A 5EM8A 3ZXZA 1V1KA 3LFDA 3QKLA 4A06A 4DH7A 3HV6A 5ETCA 4C7TA 3PY1A 2JKMA 4FZ6A 5CF8A 1VJYA 5IZFA 4FTMA 3BKBA 2WMRA 5CQWA 5CU4A 1WBSA 4B8MA 4YTFA 2WTCA 3NUUA 4Z7HA 4ZSAA 2Z7RA 4R77A 4BKYA 3FSKA 3C0GA 5K4JA 2YDJA 4F0FA 4QMSA 3VW6A 3C4CA 3R22A 4IVBA 4RVLA 5F94A 3KQ7A 4Q9ZA 4GK4A 4IX3A 3HRCA 3E7OA 1BL7A 4FTUA 5CF6A 1MRUA 4P7EA 5ACKA 4IDTA 4XG7A 2ACXA 5ANGA 4EOLA 1AD5A 2PVFA 3VUIA 4JG6A 1IR3A 4L3LA 5DA3A 1PXLA 4AG8A 3Q32A 4O6EA 2W99B 1YI6A 3FHIA 4N4SA 4GYGA 3DBFA 2VTMA 1B6CB 1U54A 2HZ4A 3PP1A 1Q8ZA 4ARKA 4AS0A 3QHRA 4BCFA 4V0GA 5HHWA 1DI8A 3TL8A 3ROYA 4M15A 4YO4A 4L3PA 2P0CA 5JFVA 5IF1A 2H9VA 4MH7A 4HW7A 5KCVA 5ETAA 2QQ7A 4D2WA 4D5KA 4E1ZA 3P23A 3CTJA 4BI2A 2RSVA 4O0TA 5B7VA 1DAYA 3FMHA 1OIQA 3QX2A 4GK3A 4KKGA 3K5UA 4WIHA 4AGCA 4DGGA 5H8EA 2WTIA 4O84A 3D0EA 3ZC6A 2J0LA 3A4PA 3IGOA 2C6LA 2HCKA 3S00A 4XYFA 5M4UA 5A4LA 2RIOA 2QOCA 2XCKA 5HBHA 4CLIA 4M97A 3VS2A 5IG1A 5IQEA 5L2SA 4FIIA 3GCVA 1Q62A 1IEPA 3D9VA 5HLWA 4FNZA 3ORKA 4CV9A 3EOCA 2WKMA 3PFQA 3NUXA 4JVGA 3D14A 4G17A 4NK9A 1KE9A 2JC6A 3CLYA 3EB0A 5CU0A 2ITXA 3D5UA 4ZS0A 3QALE 5M44A 2UZUE 3TM0A 5FXSA 1H08A 4AN9A 4WHZA 3TT0A 5FTGA 5DRBA 5CXZA 1LEZA 4QMOA 3UTOA 1J7LA 2ITOA 4FKSA 4U79A 4XG2A 4CFMA 2Y6OA 3HUCA 1WZYA 3EQGA 3UO6A 4YHFA 2DS1A 2HWPA 4P90A 2C6MA 4EH6A 3MB7A 4S33A 5DMZA 3EFLA 3MIAA 4O38A 2OIQA 4TNDA 2YCFA 4OW8A 1GZKA 3ZZWA 5BYYA 1V0OA 1BKXA 2O8YA 3ZFXA 2UZBA 3BEGA 1GOLA 2GQGA 4TW9A 5I9XA 3NRMA 4O0YA 5L2TA 3W18A 3FC2A 3JPVA 1MP8A 3RNIA 3TI1A 4I5PA 4DEHA 2JKKA 5E8SA 5EQEA 2B0QA 2C5VA 3QCXA 1L3RE 4L53A 4DG3E 3EH9A 2OBJA 1Q3WA 3HA6A 5CLPA 5GHVA 5TT7A 2C4GA 3CR0A 3T8OA 3TDWA 4MWHA 1H4LA 3ZHPC 1I44A 3KXNA 3UDBA 3QYZA 3VUMA 3FHRA 4EH8A 5CU3A 2I0VA 5KMJA 3VIDA 3RNYA 1OPLA 4L6QA 2OFUA 4E7WA 5J5TA 4ZP5A 4FL1A 2J0JA 4QD6A 3KC3A 3O50A 3LAUA 4UZHA 4HVIA 2CMWA 4JX3A 4AN3A 4PTEA 3DK6A 2AUHA 2XMYA 3ET7A 2PTKA 2YIYA 4C4HA 3DAEA 3E3BX 4CQEA 3G9LX 1KOBA 4RJ7A 4A4XA 1H28A 5HNGA 4L46A 3TACA 5K5NA 4MK0A 1JQHA 5FP6A 3WZEA 2BKZA 2X8IA 4LG4A 1H1WA 3OC1A 4U81A 4B0GA 2VTJA 3UPZA 5E4HA 1Y8GA 2WQNA 3EN9A 5FDXA 4YC6A 4BHNA 3FMKA 3UQGA 4MNEA 3DKFA 3F2RA 4ZSJA 5HU3A 5CU6A 2GTNA 4YNOA 5AUTA 2UW3A 4FTJA 1PF8A 2QR8A 3BGZA 3E8DA 4MBJA 3VS5A 4EHGA 5E9EA 1M2RA 4XHKB 5FEEA 4QQ5A 3DTCA 4F0IA 3ZO4A 2CGWA 4PNKA 2CNVA 1SNUA 1OVEA 4NCTC 4EBWA 4AZVA 4ZLOA 2CKEA 1OUYA 4HVSA 1GAGA 4QYFA 5AWMA 3TCPA 4EEVA 2I0YA 3QRIA 3VBYA 3RKBA 4TT7A 4D4RA 1YHVA 4PP9A 3C0IA 2ITYA 1CTPE 3P7BA 3QU0A 3VHKA 3KCFA 3VBXA 1FPUA 2UZEA 3GU7A 4UX9A 3CGFA 3SC1A 3HP2A 4YTIA 4DN5A 3T9TA 3PSDA 5EKNA 1M7QA 4IWPA 3HMIA 2UZWE 1YWRA 4BDJA 3TKIA 3I79A 4IANA 2QOOA 4C8BA 4Y46A 5CEPA 4DT8A 4LRMA 3WF7A 5K9IA 1BI8A 4BWPA 3IO7A 2XJ1A 3RAHA 1HOWA 5KKRC 4EH9A 4D1XA 3LM5A 5FXRA 4X21A 5LMBA 4WG5A 3UYTA 3DOGA 4JRVA 2WMSA 3V5TA 4PDSA 4ASEA 2CGVA 1YHWA 4G3EA 2R3OA 3CPBA 1M2QA 4KIQA 4QPMA 4H58A 3NYNA 2Y7JA 3HAVA 4FGRA 4Y85A 1OITA 3G51A 3W32A 3VS3A 2CNUA 3BBTB 4KUJA 3F3VA 3K3JA 3BCEA 3E88A 4H3PA 3HYHA 4FNWA 5AA9A 3BRBA 4IX6A 2PE2A 3ELJA 4E73A 4BCOA 2A27A 2QR7A 2F2CB 2PHKA 1P14A 2BDFA 2UW0A 3FZRA 4RIYA 3VUHA 3WYXA 3ZEPA 4O7RA 5HICA 3QX4A 5ANDA 4BKZA 3CXWA 3F6XA 4IB1A 2QURA 3ENMA 4BB4A 3SGCA 3HGKA 5DG5A 4DH1A 5HE3A 2ITWA 3VUGA 5CSHA 2VWBA 4UY9A 3PJ1A 2ONLC 4G5PA 1J1BA 5AAFA 3CEKA 3BHUA 3RPYA 4EONA 5G1XA 3BU6A 3MVHA 1FOTA 3KXZA 3COIA 4ALVA 4E4LA 3BLRA 3E7VA 4RZVA 4AACA 3GB2A 4CT1A 4RWKA 1MQ4A 3A8XA 3OEZA 4EOSA 4TN6A 4K18A 5A4EA 2IVSA 1PXNA 3PXRA 4ACGA 4PRJA 4C36A 2YHVA 2JITA 3KVXA 2XJ2A 5CNOA 4YJVA 4F99A 4FKGA 5BVNA 5AR5A 1YVJA 4II5A 2DYLA 2QI8A 5BMMA 2CSNA 2ZOQA 3I4BA 1PXJA 4C4GA 3K2LA 4WA9A 5EOLA 2FVDA 1YQJA 4DFUA 4O22A 5CWZA 2OJ9A 3R8ZA 3FMJA 4UN0C 1XH5A 4G6OA 4I4FA 4BTKA 5C4LA 3VNTA 2UVZA 2BDWA 4MXOA 3VVHA 3KK8A 5BNJA 3UP2A 5H3QA 2GHGA 5AM7A 3HP5A 2BZIB 3ZMMA 3LCKA 4BDBA 5FTQA 3TIZA 4V01A 3FI2A 4NSTA 4DH8A 1YWVA 1Q99A 1M7NA 4BDHA 4D9TA 2W05A 2X2KA 4O7SA 3R6XA 4G16A 5T68A 2R3LA 3DFAA 1UV5A 2VTIA 4HOKA 4EQCA 5ICPA 1J7UA 3BLQA 2WZJA 1S9IA 1CMKE 3CKWA 3KULB 3R73A 4CFNA 2WMQA 3U6IA 3R2YA 5IQCA 1XR1A 2OO8X 1NXKA 4V0GB 4MD9E 5DR6A 4NW6A 1UVRA 4YJOA 3RM6A 2YM4A 2B53A 3HUBA 1GNGA 4C57A 3HKOA 2R4BA 4MNFA 5HTIA 5IQDA 4KD1A 4OTHA 3L8XA 5LMKA 4AZTA 1OECA 3L1SA 2J5FA 4A7CA 3A7GA 4FSRA 4IWDA 1UU7A 4O0RA 1YXSA 4Q9SA 4BGGA 4F7SA 3BI6A 2Q83A 3LHJA 3W1FA 3LCDA 2XK9A 3EQRA 3F69A 3FUPA 3QQFA 4M14A 3PIXA 4W9XA 3S95A 2XNMA 2GHLA 3CJGA 5CSWA 2Y4IC 3UIMA 2YABA 4EL9A 4LOPA 2WU7A 2R3HA 4O0VA 3UG1A 2W1HA 2XBJA 3U4WA 4JL9A 3UIUA 3OHTA 2OW3A 5I3OA 4CVAA 3PRIA 3BQCA 1OPJA 1JKKA 3BELA 4YLLA 4A9YA 3QF9A 3H0ZA 3L8PA 2OJJA 3LFQA 3GC0A 2YJSA 2W9FB 3LFFA 2WNTA 4KKHA 4NJ3A 3VS1A 2PK9A 3LVPA 3C4XA 1WBPA 2OZAB 4ANSA 4C38A 4E20A 4BCKA 3GEQA 4IWOA 5M06A 4I0RA 2CKPA 1UNHA 4AZEA 3AT2A 4FKVA 1PMNA 3R7OA 4TNBA 5AP4A 4I6BA 1H1RA 4PTCA 2C0TA 4TKSA 2XKDA 4C59A 3LJ0A 5FBOA 4PNIA 5AIRA 4XCUA 4E4MA 4R5YA 2W4KA 4GFGA 3PLAE 5H9BA 4EUTA 3IK3A 3D15A 4UBAA 2VGOA 4XLVA 3EZVA 3KRJA 4WRGA 3NUNA 4ERWA 2ZM1A 2YN8A 4FSWA 4RVKA 3Q96A 5HIBA 4JAIA 4F9CA 3DKCA 4MAOA 4W4YA 3VQUA 1U54B 4LV5A 5DPVA 4FA2A 4NJDA 3HVCA 3BE9A 3MVLA 5LQFA 4QOXA 2OFVA 3ZLYA 3FXXA 2R9SA 2IZSA 1UU9A 4KBKA 3DB6A 4TZRA 4O21A 4PDOA 1PXKA 2HWOA 2ZM3A 4I23A 4RFMA 3RPSA 4C02A 4IJPA 4EH5A 2QD9A 4BIBA 3RI1A 3NDMA 2BILB 4ERKA 5HGIA 4FIEA 4NIFB 5EG3A 4D55A 2W5BA 3AT3A 4I3ZA 4PMTA 5EW3A 4ZTSA 3DPKA 3PJ2A 3WZDA 4G6LA 2C68A 3IPHA 3QCSA 3PA3A 3PG1A 4GK2A 3SRVA 4DTBA 3Q9WA 3IECA 4MD7E 2QLQA 3KXGA 3V5WA 4BDKA 4JQ7A 5HVKA 4UMQA 1PW2A 3IQ7A 3CD3A 1DI9A 1R0PA 2GDOA 5GJDA 2GS6A 3DJ5A 3MESA 5IH4A 4ACMA 2XA4A 1NVSA 2XNNA 1YOLA 3NVKI 4QYEA 2RKUA 3FQSA 4FIGA 1Y57A 5IA0A 4FKTA 2PUUA 5CI7A 3VUTA 3QGWA 4I5MA 3VBQA 2WTDA 3W2OA 1YOJA 5A6OA 4QMWA 3FLSA 3PG3A 2R3QA 3OXIA 3W2CA 1SNXA 1UA2A 3KA0A 4FEXA 2VV9A 2ITQA 4NW5A 1OKYA 2PZYA 3AG9A 3Q5IA 4G31A 4J71A 5AEPA 3HV4A 5E1SA 4C58A 3FPMA 5HORA 1QPJA 4O86A 4DF3A 2Y8OA 3DBDA 4RPVA 3PRFA 2A1AB 3IONA 3ZBXA 3O23A 2Y0AA 3TZMA 4BCQA 2YIWA 4UWYA 4ACCA 2JDTA 3R8LA 3SG8A 3HEGA 2GNIA 2RF9A 3OW4A 3EL8A 3A99A 4JDIA 1CDKA 3AQVA 5AR2A 3Q2JA 4BC6A 4YUQA 4BI0A 2WOTA 4HZSA 3D4QA 4N6YA 3RPRA 4GJ3A 1DM2A 3V51A 4EH4A 5IQGA 3KRRA 2ZB1A 4G1WA 4F6UA 3KCKA 2J5EA 3DK7A 4C61A 4CKIA 4V04A 2CCHA 3QFVA 1WBWA 4IXPA 4ORKA 5KE0A 3WF9A 2GQRA 4BDDA 5B0XA 4DC2A 3LM0A 3R7IA 4CYIA 5FM2A 4XV1A 3E8NA 2ZV8A 4M67A 1Q24A 4RIWA 3T9IA 1ZZ2A 4OGRA 4D58A 1OL1A 4BTMA 4R3CA 5IA5A 2WQEA 4FKPA 3QLGA 4GT5A 5E1EA 3QC4A 5AAEA 3KEXA 4D5HA 3OCTA 1IA9A 2J51A 4O96A 4XBUA 2R7IA 2EXEA 3ULZA 4K0YA 3ZM4A 1U5QA 1ERKA 4KSQA 4CKJA 3QTQA 3I5ZA 3TNPC 3WF5A 4R78A 2QKRA 4A9TA 4FEUA 2PZ5A 3DZQA 3G33A 4GVAA 4BDEA 4JT3A 3GVUA 2B9JA 4ANBA 4G9RA 4O2PA 5IA3A 3BV3A 2UZDA 3V6RA 1BL6A 2IZUA 2RG5A 3M2WA 2WOUA 3DBCA 3NEWA 4KSPA 1O9UA 5DI1A 1YDTE 3G6HA 4IW0A 3ZM9A 2J7TA 5AM6A 2Z7SA 3ZDUA 2ETMA 4F0GA 2W5HA 3RVGA 3EFJA 2G01A 2XEZA 3QQLA 4QTEA 2BZKB 3EQHA 4CTCA 3OEFX 3R00A 2GQSA 2OJFE 1OUKA 4WBBB 5E8ZA 4EOPA 3E8CA 3EYHA 4QMYA 5CSPA 4J8MA 5DFPA 3R7YA 4O0XA 3COHA 5F20A 4C62A 5LARA 4YC3A 5LCKA 1R39A 4OAUC 2HYYA 4BDFA 4G3DA 3A8WA 2J0IA 1IG1A 4U6RA 1TKIA 2XKCA 4YMJA 1PYEA 3TUCA 4NM0A 3D83A 3NCGA 2YWPA 3OW3A 2V7OA 4A4LA 1PHKA 2GNJA 3DS6A 5JH6A 5M51A 3O71A 4QMPA 3PDTA 2H8HA 1UWJA 5IQAA 3DB8A 3MVJA 4YBKA 2PZRA 3Q4UA 3R9RA 2BTSA 3I0QA 4ZTLA 1OL6A 2IW9A 3NNWA 1LEWA 4HGLA 3UMXA 4JNWA 3IKAA 1OPKA 2VN9A 3LZBA 3QXPA 3ORXA 4GH2A 4LRKA 3S3IA 4F1MA 5CEKA 3COKA 5HD7A 4K77A 4QMLA 5CNNA 4NWMA 4C3PA 5TE0A 2B1PA 3JVRA 4NM5A 1U46A 2BZJA 5DH3A 4O7YA 4FKUA 3MH1A 5EM7A 5CENA 4USEA 3CY2A 3RINA 2HK5A 4IH8A 1RW8A 2JKOA 2OJGA 3SD0A 4QPAA 1JPAA 4DFZE 2W1ZA 4FG8A 1FINA 2WD1A 3IOPA 3MY5A 4IX4A 1YXUA 4YJQA 5AR4A 5AMNA 2CGXA 4O7TA 5IQBA 3AOXA 4I20A 4MQ1A 4O2ZA 1Q8TA 4MXYA 5AUXA 4ASDA 4K9YA 3MYGA 4E6AA 2I1MA 1R78A 2O5KA 1P2AA 4QTAA 2BAQA 4MX9A 2WEVA 1WBTA 3Q53A 3QHWA 4FL3A 2OXXA 5J87A 5BVEA 3TZ7A 1OIUA 2HW6A 3V5PA 2Y4PA 4JBOA 3GCSA 1OM1A 4QP1A 5FEQA 1J3HA 4H3BA 4ZAUA 3ZUUA 2PE0A 4PL5A 5JQ8A 5K0KA 2WAJA 3FYKX 2GNHA 2YCQA 1Z57A 4DEDA 2XNPA 4YJRA 4F6SA 4EZ5A 2WU6A 3QD4A 3OXZA 4L9IA 4B8LA 1CKIA 1Y91A 3EQFA 3R8PA 2OI4X 1KV2A 2FSLX 2B9HA 2C0IA 2CCIA 1O6KA 3CE3A 4ITHA 4XP3A 3RHXA 4GJ2A 4D2PA 3EIDA 3I0OA 2O65A 4M0ZA 2YCSA 4EHZA 3GFEA 3Q2MA 2G9XA 3NAXA 4MBIA 4TYEA 4AAAA 3EN7A 3NMUF 1IRKA 5IUHA 4G6NA 4XH6A 3UVRA 2NRYA 4TY1A 4X3JA 3MY0A 4QTCA 4C4FA 4DFLA 1XH4A 4CFUA 3PY3A 4FTIA 1SM2A 1H1QA 2ZMCA 3E3PA 4M66A 3VF8A 2IVTA 3BPRA 2XIZA 4XS2A 4TWPA 5J95A 4UWCA 2R3GA 4UYAA 4XUFA 3L8VA 4I5CA 3UYSA 1UKHA 4AU8A 2WTWA 3GXLA 4F9AA 4QNAA 5EFQA 4KBAA 4YLJA 3PZHA 3COMA 5F9EA 4YZBA 5IH6A 2YIQA 3F3WA 5DRDA 3DNEA 4HGSA 4O27B 4EK3A 4BCHA 3ZFYA 4CFVA 3FI8A 3AMAA 3GC7A 5AIKA 4CYJA 4CSVA 5DR9A 5JKGA 5CT0A 3DAKA 1BYGA 2VNWA 4M69B 1KV1A 3TZ8A 5AADA 3R7EA 3ZRMA 4F70A 4FV9A 5M09A 2HZIA 2JAMA 3GFWA 1E1VA 4CGAA 3L8SA 4GVJA 2UZTA 5EI8A 4NYEA 4IC7A 3E5AA 5AUZA 2GTMA 4EOQA 5IA4A 3W2SA 2QU5A 1OIYA 2W1GA 5HG8A 4PV0A 1XWSA 4L7FA 3VUKA 2PVJA 2YZLA 2ZAZA 5I5ZA 2JIVA 4WSYA 2EB3A 4I22A 3R28A 3LLAA 5HO7A 5KX8A 3MB6A 2R3KA 4W8DA 2CDZA 4A9RA 4RA5A 2BR1A 3CQWA 4QRCA 3QRKA 3GQLA 3MJ1A 3QUEA 5L8KA 3LXNA 1HCKA 4AT3A 1FGIA 1ZMWA 2Q0BA 4YPSA 3ZC5A 2XIYA 2R2PA 4Y5HA 5IQFA 4BCJA 3ENHA 3OTVA 3C1XA 4YO6A 4R7HA 3UMWA 2QONA 4DA5A 2FH9A 2QLUA 2PY3A 3LQ8A 5TKDA 3AC2A 4DHFA 4JG7A 3F5UA 5L6OA 2CPKE 3QCYA 2XIXA 4WT6A 5F4NA 2VO0A 3MPTA 5IU2A 2WMXA 2PWLA 4EOKA 1FVTA 5JGBA 4MXAA 4FEVA 3RWPA 4IAZA 5E90A 3S4QA 3LFEA 1G8SA 4ID7A 2IG7A 2YA9A 1NVRA 5I9YA 5KO1A 2BFXA 4S31A 2I6LA 2J0KA 5E8YA 1OIRA 4WNMA 4CG9A 4O7VA 3PSCA 4B4LA 2XIRA 5GIOE 3PXFA 3EN6A 2X2LA 3W55A 5IA1A 3AD5A 3TKHA 4PL4A 5L4QA 2VWZA 4IC8A 3SRVB 5TO8A 4K2RA 4Q5HA 4DEIA 4G34A 2XK6A 3JS2A 3DBEA 5CS6A 4LV8A 1AQ1A 3U9NA 3VBTA 2VWIA 2EXMA 1H0WA 1XKKA 3B2WA 4BCIA 3NVMB 2E9PA 1M2PA 1W7HA 4Y73A 2OIDA 4FV0A 4KS8A 2PVHA 4UZDA 5LVOA 4Y72A 3U55A 4RX7A 3MIYA 1XBAA 3NCZA 2F7XE 3DBQA 3IW5A 2QCSA 2VNYA 4H39A 4K6ZA 2V7AA 1GZ8A 3D7TB 4KRDA 2HAKA 3MBLA 2UUEA 2QG5A 2IW8A 4BDIA 4IMYA 3BHTA 4APCA 3EYGA 4M3QA 2VTAA 5ANOA 3FSFA 2A0CX 3I81A 5K3YA 4NEUA 3QWJA 3F61A 4CXAA 4FT5A 3T3UA 2YAAA 1JNKA 2YERA 4GUBA 4IADA 5JFSA 2G2IA 4WNOA 3RCDA 4YNEA 2Z7LA 3QUPA 3A7HA 3THBA 3MTLA 4YJNA 4AGDA 2ZJWA 5KMMA 4DYMA 3GCPA 4HVGA 3HAMA 3SOAA 2NO3A 2XM8A 3QTIA 3CKXA 2UZVA 3ETAA 3H9FA 3MI9A 4D2SA 3P4KA 2X2MA 5BQ0A 2Z8CA 1V0PA 2VWVA 3C13A 3QD0A 1O6LA 1P4FA 3AT4A 3F3UA 4GIHA 2X81A 1WBOA 4HJOA 3GC8A 1XJDA 4ZZNA 4X3FA 4CCUA 3VN9A 4PDPA 4MWIA 2XRWA 3RPOA 3G0EA 4ZTMA 4IWQA 1KUTA 4TYIA 2WGJA 3AC1A 3JYAA 3OUNB 4XOYA 1PMVA 4EHEA 1OGUA 1RJBA 3LW0A 2WMVA 3GGFA 5IISA 5DE2A 1H27A 5EQPA 3TNIA 5JRSA 5CAVA 4L42A 4WD5A 4DH3A 3V5LA 2R64A 3C4FA 4JDHA 4ZY5A 2WTJA 4IFGA 1Q4LA 3UZPA 2UW5A 3K5VA 4I94A 1REKA 1YRPA 1RQQA 4H1JA 4L01A 4OAVB 3Q9ZA 5HD4A 2X7FA 3BHHA 5H8BA 5HVYA 4AP7A 4EOOA 3FZTA 4TRLA 4FTOA 4OBPA 2OG8A 3ORZA 3WZUA 3Q5ZA 3HMOA 4TTHB 4MXZA 2X8DA 2QO7A 2XEYA 2QU6A 3DLSA 4M13A 2XF0A 4UMUA 2EU9A 3KF4A 2WTKC 3I1AA 3VQHA 1A48A 5M4FA 4LUDA 3JY0A 2OSCA 3IW7A 4KINA 2FUMA 3R1QA 4RIOA 2IVUA 3TV7A 2B55A 3PPJA 3AMYA 3KRXA 4PY1A 1H07A 3KFAA 3EFKA 4L68A 4RQVA 4XG4A 2Y4IB 3R83A 3AC8A 4X2FA 1KE6A 5BVKA 1H00A 3W8LA 3SQQA 4EC9A 5LMAA 1ZMUA 4XRLA 1WVXA 1ZYCA 3P79A 3IDBA 3D7ZA 4FODA 1CKJA 3EQCA 2XNOA 4GYIA 4TWOA 3R8UA 4WRSA 4MXCA 4Z16A 3WBLA 4RJ8A 5JMSA 4NM7A 2WIPA 5HTCA 2QOQA 3QA0A 4CT2A 3UOKA 2CLQA 1BX6A 5C9CA 3KN6A 4U40A 4KRCA 2ERKA 3ORNA 3GP0A 3I7CA 4H3QA 5CZIA 4FSYA 4LRJA 1LPUA 2PE1A 2YM8A 3B8QA 4L44A 4UV0A 4E8AA 4EYJA 5C8NA 3ZTXA 3TN8A 3PZEA 4KKEA 4UXQA 3F3ZA 4JS8A 4C3FA 5DIAA 2J50A 3N4TA 4JXFA 4RG0A 1XH8A 4ZIMA 3ZYAA 3MSSA 4H1MA 4U0IA 2QOLA 3Q52A 1XO2B 4XOZA 4AX8A 4FVRA 5DT4A 3U6HA 5DWRA 4O7NA 1FVVA 1GZOA 4FKIA 2VO7A 4RJ5A 2QVSE 3ZEWA 2JD5A 3PJCA 4CRSA 2XNBA 3DAJA 3BE2A 2C5NA 4RX5A 5HO6A 2RFEA 1B39A 2WMBA 3ACJA 3P7AA 4NFNA 4AW0A 4DBNA 2IVVA 4FIJA 3U9CA 2BZHB 2F7EE 5DNRA 2YDKA 3ZSHA 4MCVA 3HMPA 4DH5A 2P4IA 2R5TA 4IFCA 4V05A 4FSTA 2J2IB 5JSMA 3OOGA 3OWPA 4RVMA 4BGHA 3JUHA 3P08A 2JDRA 4AXAA 4YR8A 4BHZA 3QC9A 4EYMA 2XRUA 4QQTA 2CN5A 4QMNA 4CKRA 2HY81 4ONAA 4EHVA 3QCQA 4D0XA 4JLCA 1WBNA 2WQOA 4E5BA 1W82A 4YC8A 4BBFA 5BVWA 5F95A 4BBMA 4CV8A 3IW6A 3R01A 2E2BA 3HDMA 5CAOA 1PMUA 4IM0A 1H8FA 2C5OA 5FEDA 3D2IA 3GU5A 5HNBA 5BUIA 3A4OX 4H36A 3BYSA 4IAIA 5IEYA 3C5UA 5J1WA 2V55A 2C69A 5D7VA 3SKCA 4LI5A 3E8EA 1QL6A 3WI6A 5KKRB 3VW8A 1SVGA 4MEDA 4FGBA 3QKKA 3I6WA 2NPQA 4OBOA 4U3ZA 3UE4A 4BCGA 5A9UA 3WOWA 2C1BA 4XG8A 3UVPA 3KK9A 5AP6A 4EBVA 2QHNA 4X0MA 3DJ6A 4JI9A 2VUWA 2LAVA 1T46A 2YEXA 4DFNA 4PX6A 1ZY4A 4QP6A 5KUPA 3UO4A 2JFMA 2R3FA 4DFXE 3OFMA 4J98A 3O8UA 1J7IA 3ZUTA 4LL0A 4YPDA 2YWVA 2BALA 3C50A 3OVVA 2IJMA 4NCTA 4CFFA 4EZ7A 3MJ2A 3O7LB 3EKKA 4DFYA 4EI4A 3OS3A 2BTRA 1ZYSA 4FV4A 2PUIA 4BCNA 4CG8A 2WHBA 3LCSA 3AC5A 4IM3A 3AMBA 3BQRA 2H34A 3PVBA 3MWUA 5AP1A 5KMKA 5KZ0A 4GL9A 4FZFB 4J95A 1UNLA 3OD6X 4LMNA 4BZOA 1OMWA 4CMTA 1MUOA 5E8TA 5A3XA 3MA6A 4ZJIA 1KSWA 2FSTX 3MV5A 5LOHA 3LXPA 5HOAA 4A9UA 3IGGA 3OMVA 3QWKA 1G8AA 2BRMA 1WMKA 5HIEA 4FKLA 4LGDA 3TV4A 4O82A 4R1YA 3ZRLA 4FEWA 4GKHA 4XRJA 3CD8A 1Z9XA 1FMKA 4XP2A 5I9VA 3C7QA 3PIZA 4UXLA 2OICA 4ZTRA 3MDYA 1JLUE 4LQMA 3C4ZA 4IB0A 4F7LA 3NNVA 3QA8A 3LFBA 3CJFA 1WCCA 4APPA 3F66A 4BZNA 2XCHA 2R0IA 1MQBA 4FT0A 2W1DA 4FUXA 4CZTA 5EKOA 3DXQA 3VJNA 1LP4A 3G5DA 4OT5A 5CASA 4L52A 4FT9A 5DEWA 4BZDA 3V8WA 4WO5A 4JJRA 4U45A 1Y8YA 3POZA 2XZSA 3ORIA 3EQBA 5E8WA 3LQ3A 2ZV7A 4L45A 3QLFA 3R0TA 3R04A 1KE7A 2FYSA 5CQUA 4NFMA 4TXCA 4Q2AA 4IJ9A 4R1VA 1UNGA 2DQ7X 2VTNA 4B9DA 3NWWA 1BLXA 3C51A 3A2CA 3ZZEA 4EQUA 3HECA 5M4IA 4F9BA 4K8AA 3QAME 2JBOA 4RVTA 3POOA 3QL8A 4ANNA 3ZO1A 4GS6A 1GJOA 4BL1A 3NNXA 5HCZA 3KGAA 2VTLA 5L8JA 4ACDA 3QRJA 4AFEA 3R71A 5HE0A 2Z2WA 2OZAA 4HCTA 1PY5A 4IQ6A 4LL5A 4I6HA 2JDVA 4JQ8A 2F4JA 2YM7A 3MPMA 4MYGA 4EORA 4JQEA 4JOAA 3JVSA 4E6CA 1OBDA 3DFCB 1YXTA 3AC3A 5HBEA 2QNJA 5L2WA 4NUSA 4GT3A 4ZS4A 5KMNA 3PWDA 4XJ0A 5EH0A 2OK1A 2XK8A 2PSQA 3LKMA 4H05A 3UZRA 4I92A 4EKLA 5FD2A 3PIYA 3F2AA 1R1WA 2XM9A 4AT4A 4QTBA 3ORMA 4L7SA 4RZWA 2VRXA 4NKAA 4C2VA 3DDQA 3QD3A 3FBVA 4IAKA 2AYPA 4M69A 4ZOGA 5TF9A 5J79A 2PULA 2HENA 4W9WA 4P4CA 4BKJA 4CFWA 4EK6A 4U5JA 3ID6C 3TNHA 3IDCA 2YJRA 4RC2A 5DGZA 4JDKA 3QTUA 2R3JA 5HQ0A 2BAJA 4CZUA 3BGQA 1PXPA 3KN5A 4FTNA 4QMMA 4RT7A 4TWCA 4AQCA 2CGUA 3Q60A 4GCJA 4GFMA 3QBNA 1O6YA 3IS5A 4DTKA 5KMIA 2C0OA 2W1IA 3OBJA 4W4VA 5CVHA 2GS2A 4O83A 4ZTQA 3E64A 3JXWA 4IZAA 3H10A 2E9VA 4O7WA 1YDRE 4XG3A 2IN6A 2O63A 4N6ZA 5HG5A 4IVAA 1H1SA 4AA5A 3AGLA 2OGVA 3QYWA 3OUKA 4JG8A 2GFSA 1PXMA 3V8SA 2R7BA 3TTIA 3CP9A 4N0SA 4G2FA 4J7BA 4QPSA 1KE5A 5GNKA 3VS4A 2XBAA 3QQUA 4MBLA 4R3RA 2JIUA 3TXOA 3QRTA 3DNDA 5AP2A 2A2AA 3FE3A 4ALWA 3HMMA 5E8UA 5CSVA 3DCVA 4YBJA 1LR4A 5DR2A 1ZLTA 5FG8A 3F2NA 3MVMA 2X8EA 3CY3A 4F64A 4M0YA 4TWNA 2XNEA 4BTFA 3AGMA 4PQNA 4FTAA 3RK9A 4I4EA 3BYVA 5D10A 3R9DA 4AFJA 3N4UA 4ENYA 4FV2A 4QT1A 3MH0A 3QTRA 3FQEA 3FL5A 4L67A 2XS0A 1VEBA 3NGAA 4GG5A 3TUDA 3U51A 4M12A 3VBWA 3HDNA 2CN8A 3R7GA 5CEOA 4ANMA 3SXRA 2VTPA 3CC6A 2IO6A 1CSNA 3FI3A 3UNJA 3ZXTA 5DN3A 4LOQA 4EC8A 1OB3A 4PMPA 1OL7A 1H25A 5EW8A 4AW5A 4E6QA 4HCUA 4YP8A 2C6TA 2ITUA 2SRCA 3HV5A 5AV4A 5H2UA 4LM5A 2BHEA 4FT3A 3S1HA 3M11A 4R7IA 3ATSA 3ZCLA 2OH0E 4ZK5A 1JWHA 4DBXA 2PMNX 4NU1A 4G3GA 1QPCA 1ZY5A 3RP9A 5CYIA 5JQ5A 2VTSA 3TTJA 2X9EA 1Q5KA 1YWNA 4JX7A 5CANA 3UO5A 3MFRA 4D2RA 2OJIA 1UWHA 4KBCA 3ACKA 5ACBC 2VX0A 3R7UA 3O2MA 3VRYA 3HL7A 3NYOA 5EHOA 1URCA 3FMLA 4DEGA 4RIXA 2HW7A 3KMMA 3TIYA 1UU3A 2VX3A 2WMAA 5J9YA 4UEUA 2VAGA 5FUTA 3HRBA 1XQZA 4JRNA 5HKMA 4B7TA 5L2QA 4OTPA 4U80A 5J9LA 3OZ6A 3QGYA 1ZWSA 5AJQA 2C3JA 1ZOEA 2XP2A 3DJ7A 4HYSA 2XK3A 4AF3A 2F2UA 3LLTA 4HGTA 2V0DA 5ANIA 3TKUA 5BVOA 1FBNA 4FT7A 3HX4A 2A19B 3MH2A 1F3MC 5T3QA 4BR3A 2YLFA 4ZMFA 3WE8A 1I09A 2BVAA 3BHYA 3OROA 3OWJA 1OL5A 4MF1A 4DCEA 5K4IA 5M56A 3BIZA 3QUDA 2BMCA 4OTFA 5LJJA 4YSJA 2V62A 2GSFA 3EHAA 4TPTA 5HTBA 1T45A 4ANLA 3C0HA 2G2FA 2W4OA 3P0MA 5EHYA 2YDIA 5HE2A 4ASZA 5JEBA 2CHLA 3KRWA 2BFYA 3MS9A 4XEYA 2XVDA 3GOKA 5EDQA 3DZOA 3GU6A 4ACHA 3I6UA 2BROA 4BWXA 4EJNA 2G2HA 4BICA 3L9LA 3QZFA 5IPJA 3DXPA 5J7HA 4AE6A 4ASXA 2WO6A 4RIWB 2PMIA 1FQ1B 3WF6A 4DFBA 5L6WL 4QMXA 1AGWA 3T3VA 4CD0A 4FI1A 5LWNA 2C1AA 5M53A 4HYHA 3ZU7A 3FJQE 1QPDA 5CX9A 3FXZA 3SX9A 4GG7A 3G90X 3V01A 4UB7A 4AZWA 2W17A 3LPBA 4AT5A 2ZYBA 4F09A 5HNIX 4O0WA 3FAAA 1ZOHA 4G5JA 2F57A 4U3YA 4O91A 2UW7A 5C8MA 1G3NA 4MTAA 4XV2A 1K9AA 4PPBA 4RLLA 4WSQA 4FL2A 3ROCA 4CMOA 4DG2E 4Z55A 1P4OA 3TJDA 5AUUA 2B9IA 2JEDA 4XV3A 3KREA 2BCJA 3CQUA 2W1FA 1M14A 3GNIB 3F5XA 4GIIA 4ITIA 4PUZA 2OF4A 5AV2A 2FO0A
chains in the Genus database with same CATH superfamily
4YJTA 1FGKA 3PP0A 4F7NA 2CJMA 5IEXA 4FNYA 2Y9QA 5LVMA 4O7LA 4DGNA 3CS9A 4JBPA 5C03A 1JVPP 4BIEA 4Q5EA 2J0MB 5BYLA 3EWHA 1E1XA 5C4KA 3NAYA 4PMMA 2F49A 4DINA 2P2IA 2PL0A 4FG9A 2B4SB 3IG7A 4C2WA 4E93A 4S34A 4EK8A 4AWIA 3VONA 3QZGA 5IQHA 4BBEA 2W1CA 4ZY6A 3R30A 3H30A 1Z5MA 2WTKB 3CBLA 3DTWA 3RZBA 2CNQA 4N57A 2XYUA 3SOCA 5CTPA 4XG6A 4ZTNA 5E91A 4GFOA 3Q4CA 3BLHA 1OZ1A 4KS7A 4W4WA 5LCJA 2GPHA 4R5SA 1WAKA 4XLIA 1WFCA 5E8VA 1LUFA 4BWKA 4EOIA 4GKIA 4FTLA 3DKGA 3CGOA 4MHAA 4RJ6A 2UW8A 2YCRA 2OH4A 4R8QA 3D5VA 5GZ8A 3TUBA 4DAWA 4J52A 4E5WA 2QOKA 3CIKA 3PPZA 4J8NA 3Q3BA 4LUEA 3IOKA 5HBJA 2QO9A 3UQCA 1KE8A 3NPCA 2P33A 3TEIA 4GRBA 2XYNA 1QCFA 4LYNA 2GNFA 4TL0A 1NA7A 5FXQA 4EH3A 1PXIA 4IAFA 3V8TA 3G15A 2DWBA 3TWJA 4X7QA 2UZNA 1F0QA 3UJGA 3BBWA 4BN1A 2ZDUA 4AUAA 4HNFA 3WYYA 4U8ZA 5DT0A 2WXVA 5DEYA 3BLAA 3W8QA 3FY2A 5EK7A 1SYKA 2P2HA 4I1ZA 5C8KA 2Z02A 2JKQA 2WMWA 2C3LA 3QXOA 4Y5QA 2VWUA 4F9WA 3Q6WA 3NS9A 1U4DA 4PF4A 4FKWA 4QTDA 4MNEB 5I4NA 4PPAA 3LMIA 2WMTA 3QTXA 3CSVA 3NNUA 2XIKA 5D1JA 4BF2A 5HIDA 5KBRA 1PYXA 3RHKA 5JFXA 3AXWA 5D41A 4TYHA 4FMQA 5BVDA 3NFGB 2X39A 2ONLA 4EZ3A 1OGYA 3K54A 2YM3A 5C01A 4CRLA 3LCTA 5IDPA 4KNBA 4Y95A 3RGFA 3VHEA 4O7ZA 3PXZA 4WG3A 2IZTA 2JIIA 3NW6A 2UVXA 2OIBA 4QYGA 2YM5A 3F7WA 4D1ZA 4HVDA 4Z7GA 4D4YA 3CTHA 2ITVA 5KNJA 4QO9A 5EM6A 3ZSGA 3F82A 4UMPA 2NNWB 5AR3A 1XH7A 2ERZE 3C4EA 2PZIA 3FL4A 3I5NA 3O8TA 5AR7A 1OI9A 2W7XA 3D5XA 4LOOA 4IACA 4U9AA 3LMHA 1JKLA 3EN5A 3F7ZA 4FIHA 4I24A 5HLPA 4BCPA 5L2IA 3W2PA 3Q6UA 4J53A 1J1CA 2DUVA 3A7FA 4QP7A 4DT9A 4FE2A 4BDGA 4RLKA 5C27A 5A54A 5BUJA 4DCAA 5AP3A 4Z9LA 3OCSA 4P5QA 1ZMVA 4KB8A 4QYHA 4IDVA 4K11A 4RWJA 3RK7A 3P86A 4EJ7A 5A4QA 4QP4A 2PZPA 3B8RA 5D9HA 5E7RA 2BRNA 3KL8A 3RCJA 4S2ZA 2GHMA 2OZOA 3OT8A 2ITZA 5ETFA 4YURA 3HZTA 2NP8A 4IHPA 4X2NA 3KXMA 4N70A 3QD2B 4NZWB 2JAVA 5HCXA 3DDPA 2E9OA 5F1ZA 5A46A 5CEMA 2B7AA 1W84A 4FK6A 5B2LA 4YJSA 2YAKA 2H96A 3KU2A 2XB7A 4FBXA 5AUWA 4F08A 2CKOA 1K3AA 2ETKA 3ZLXA 2PPQA 5GJFA 4RJ4A 5I9ZA 5CXHA 4PPCA 1H26A 3L9MA 3PJ8A 4GEOA 1MRVA 2UW9A 3RWQA 3F5GA 3I7BA 4J1RA 3DLZA 3QTSA 4JIKA 5E8XA 4RWLA 3KF7A 3R8MA 3AD6A 3K3IA 4F1TA 1A06A 5JGDA 3QZIA 5G6VA 4RGJA 2C47A 3UNKA 2YFXA 2X0GA 2EXCX 3LXLA 5HI2A 2F9GA 4XBRA 4DEBA 4B6LA 1JOWB 4C4EA 4S32A 4FC0A 3PVUA 1W83A 5H8GA 3PY0A 4F4PA 1YXVA 2J9MA 4FKJA 4RA4A 2R3RA 1L8TA 3P5KA 3ALOA 3FEGA 1Q97A 4M7IA 5FWKK 2PVMA 4FSNA 5FQDC 2QOHA 3ANRA 5CVGA 3GENA 4B99A 5IUIA 5J9ZA 4KIKB 3ZRKA 1M52A 4WUAA 5IKWA 4BDCA 4NTSA 1J91A 2OU7A 5K5XA 3W10A 3PE2A 2RG6A 4FG7A 3MY1A 1U5RA 3BYOA 3SW7A 4YLKA 4CFXA 1OKVA 2AC3A 4G3CA 1R3CA 2C6IA 5EW9A 5I3RA 3FDNA 3EKNA 3MFUA 3R1NA 3H9OA 2BDJA 1QPEA 3P78A 3R2BA 2I7QA 1JKTA 2UV2A 3MPAA 3OF0A 4FYNA 5HZNA 1PKGA 2CLXA 4EWHA 3NX8A 1VZOA 3BYUA 5ANKA 4R7BA 4QMTA 3ZLSA 4O1PA 4AW1A 3MGYA 3DK3A 4AOJA 4C4JA 2ZDTA 4HPTE 2ZVAA 3NIZA 2FB8A 2R0UA 5AUYA 3CQEA 5CVFA 4BVUA 4BYIA 4YSMA 1XHAA 4K1BA 4A9SA 3LE6A 4MVFA 1Q8UA 3ANQA 3UC4A 5IQIA 4RWIA 3QQKA 5CT7A 3G0FA 2GCDA 4FSQA 5CEQA 1ZXEA 5CEIA 3U54A 2YISA 4E5AX 1G5SA 4NTTA 3F3TA 3HA8A 4HPUE 4NL0A 4JR3A 4I93A 4F9YA 2Z60A 5AFVA 1ATPE 3ERKA 4FZAB 3I60A 3BU3A 4QQJA 5A4CA 3VS7A 5JN2A 1WVWA 4KWPA 4L43A 4QMUA 3TZ9A 4USDA 5M4CA 4FKQA 5I9WA 2YACA 1FVRA 3G9NA 3GI3A 3O7LD 4PTGA 2I0HA 3GQIA 2H6DA 2WQBA 3QTWA 4IE9A 4X2KA 2QC6A 3ZOSA 4C37A 1WBVA 1ZZLA 1IAJA 3MW1A 2ZB0A 5AX3A 3TNQB 2X1NA 5A4TA 1UKIA 3Q9XA 5FRIA 3ZBFA 4FV6A 3M42A 4U43A 2R3MA 3GBZA 3II5A 4OTIA 4RC4A 5LVPA 3UODA 1IA8A 5HO8A 4GT4A 2B52A 4EK4A 4AA0A 1IASA 4O6LA 5JT2A 2PVYA 3G2FA 4YU2A 1BI7A 1JAMA 3JR1A 5FP5A 3UG2A 1XMMA 3EMGA 2O0UA 5AP5A 5JGAA 3VWAA 3EFWA 4IB3A 4Z3VA 3VS6A 1XH6A 4RBLA 4NH1A 1BMKA 4O0SA 3LFNA 3WF8A 2KTYA 3UOJA 3RPVA 3W0RA 1XBBA 2ETRA 4CNHA 4ZXTA 5JFWA 3ZUVA 5LMKC 2W1EA 1ZYLA 1JKSA 4WNKA 5A14A 4QNYA 2I40A 4CQGA 2IW6A 3QQGA 4XNEA 3KMUA 3PWYA 4D2TA 4I6QA 5HG7A 3QQHA 3AD4A 4L3JA 3BL9A 5M07A 3WZJA 5LWMA 2PUNA 3FKOA 2IZRA 4ENXA 1YI4A 1V0BA 2C3IB 3H9RA 4FV5A 5GZ9A 5HLNA 5EI6A 4AAYA 3SA0A 3ODZX 4DLIA 3REPA 3MA3A 2VGPA 2Q0NA 4FX3A 4WBOA 3UBDA 4ZZOA 2FGIA 3DQWA 4FTKA 2QOFA 3HNGA 3OCBA 2OXYA 3QZHA 1R0EA 4AN2A 3RK5A 3Q9YA 4AE9A 2VO6A 5KHWA 2JLDA 3NZ0A 4HCVA 3KMWA 3OY1A 3PTGA 3UIBA 1W2CA 4YTHA 3UZTA 4YZDA 4MXXA 3N9XA 4YHTA 3VC4A 1M17A 3D7TA 3ZO3A 4YJPA 3IDPA 3NUPA 3Q04A 4QP8A 4TYGA 5JRQA 4CMUA 2KULA 1STCE 5HE1A 5CF4A 2B9FA 4WOVA 2UZLA 3W2QA 1MRYA 1DAWA 5CZHA 4ZSLA 3GU8A 4YZCA 4D28A 3BZ3A 2J4ZA 5IUGA 2Y6MA 3HV7A 3FZPA 4D4VA 4HYUA 5CI6A 2W0JA 5AV1A 1S9JA 4MD8E 2C5YA 3FWQA 4F6WA 4FK3A 3GCQA 4QQCA 3FC1X 1KWPA 3TV6A 1Y6AA 3NSZA 3DKOA 5AP7A 2O3PA 3U87A 3Q4TA 3R1YA 4O4EA 3FMMA 5HX6A 3ZFMA 4UYNA 4AZFA 4ZZMA 4F65A 3L9PA 4D4SA 3OTUA 1TQPA 3AC4A 2VD5A 2W06A 2JDSA 3A62A 4NT4A 3RAKA 4BRXA 4R3PA 1OKZA 2WB8A 2X4FA 5IH5A 1SVEA 4AZSA 1FMOE 2B54A 1XH9A 4E4NA 3SG9A 2BIKB 2OKRA 3LIJA 2GNGA 3PUPA 2RL5A 1H1PA 4FTCA 5E92A 3V6SA 3KXHA 1G8JA 1NVQA 5D7AA 2X0PA 2YZAA 3BEAA 2QODA 2UW4A 3W16A 3QTZA 2ZFYA 2F7ZE 3BU5A 5KMOA 4HNIA 2WTVA 4P2KA 5T6KA 2GMXA 3HV3A 3O17A 5JK3A 2QG7A 5CY3A 5HEZA 5J5SA 4X6QC 3CCNA 2RFNA 1UU8A 1OKWA 3MFSA 2FSMX 4KIPA 3UQFA 3B2TA 4CLJA 3FLZA 3C4WA 4BDAA 3DT1A 1VLRA 2GNLA 3C9WA 1JSTA 1VR2A 3BHVA 3EL7A 4FTQA 4CTBA 5BX0A 4KAOA 4RFYA 4F7JA 2PMOX 3LXKA 4O81A 2HXQA 4OBQA 4BYJA 4ALUA 2O2UA 1Q3DA 3VBVA 4RIYB 5BPYA 2EB2A 4QEBA 3VUDA 3WZKA 4IEBA 4AOIA 1TVOA 3H3CA 3FKNA 1ZAOA 1YW2A 5DVRA 5HESA 3FPQA 3VRZA 1SVHA 5IMXA 4M8TA 3VS0A 3PVWA 3PXYA 4E3CA 4IX5A 2FA2A 4U41A 4M68A 3ORPA 4DITA 1GIJA 1GY3A 2PMLX 4CCBA 4ZSGA 4CEGA 1RE8A 4DGLC 3P9JA 2HZ0A 5J8IA 3RM7A 3ORLA 1H0VA 2EVAA 5ANEA 4BFMA 4FKOA 4KIOA 4TYHB 3GC9A 5EM5A 3A7JA 3A60A 4LFIA 4OLIA 1APME 4OTQA 3P1AA 4U97A 2R3NA 4XP0A 1GIHA 4FSUA 3EQPA 4W8EA 5BMSA 4USFA 3FMNA 4PL3A 4LGGA 4AXFA 5EYCA 3RTPA 4Y8DA 4C0TA 5HU9A 3HLLA 4FVPA 1TFFA 1OL2A 2BRGA 4I41A 3DV3A 4K33A 4KABA 4FR4A 3WILA 1OBGA 3PXQA 4OTWA 4RIXB 3R9HA 3SW4A 4D9UA 3KY2A 1W8CA 4E4XA 5CALA 2W96B 4XG9A 5L8LA 3DY7A 2AC5A 5DT3A 2WFYA 4ZY4A 1YKRA 2FSOX 4I5HA 5B2KA 3TG1A 4RX9A 5EI2A 4A07A 3ALNA 4WNPA 2XAMA 2W5AA 3FV8A 3LCOA 4FOBA 4IB5A 2GFCA 2XJ0A 4FYOA 4MQ2A 5DYJA 1PMEA 3MTFA 4FIFA 4DGMA 4YTCA 3QKMA 1W98A 2X6DA 3OBGA 2VO3A 4JDJA 5EHLA 2HOGA 3AKKA 2ZM4A 5JZJA 3QQJA 4WG4A 2P3GX 1Q8YA 2CKQA 5M57A 1TQMA 3FLNC 3WIGA 4J97A 4DE4A 4TYJA 5HX8A 3QRUA 2O64A 3U4UA 3F9NA 3NYXA 2X9FA 3EZRA 2E9UA 4QYYA 5HVJA 3RJCA 1NT2A 3R63A 4NM3A 3ODYX 3NR9A 2GU8A 4EOJA 3UP7A 2GS7A 1ZYDA 4ZLYA 5FDPA 2ITTA 3DGKA 2WIHA 3HRFA 1YOMA 3BWJA 5GZAA 2PUPA 4DTAA 5C1QB 5FBNC 4YZMA 5LVLA 2C6OA 4ZLZA 5EOBA 4ZJJA 4HGEA 4UALA 2YM6A 3OXTA 2WQMA 4PMSA 3S0OA 3PSBA 2BUJA 3UVQA 3SHEA 3ZDIA 5J7BA 5M08A 2C30A 4JAJA 4L8MA 4PWNA 2PVKA 4ZMEA 4DGOA 3IW8A 4JBQA 5DLSA 4HZRA 3P7CA 2C3KA 3R1SA 4IZ7A 2XH5A 3MFTA 4ANOA 2ESMA 4GV1A 2BPMA 4IZYA 3E62A 2QHMA 3FXWA 3FZOA 3NW7A 1ZRZA 1A9UA 5BUEA 3ORTA 4EH2A 4EQMA 5IEVA 4X2JA 4CZYB 2W9ZB 3TDVA 2VTQA 2REIA 2JFLA 2VTTA 3D94A 3WARA 3H0YA 3KKVA 5AR8A 4ITJA 3GU4A 2VWWA 3OWLA 1KOAA 2WMUA 3OY3A 4FZ7A 1U59A 5CF5A 3FMDA 4HYIA 2HZNA 4XV9A 5M55A 4FEQA 2YITA 2HXLA 2ITNA 5AA8A 4AW2A 5CAPA 4YZ9A 2G15A 3KULA 3BYMA 1B38A 2XNGA 1YHSA 2PVLA 2YLEA 1JSUA 4G3FA 4FKRA 1K2PA 3R8VA 3R9NA 1VYWA 3FYJX 2C6EA 4UMTA 5TOZA 4UMRA 3KRLA 2VTOA 4O0UA 4FOCA 1ZYJA 4FVQA 5K0XA 5ITAA 4U42A 5EQYA 2E9NA 3RALA 3RBWA 3SDJA 4RQKA 3CPCA 5CAUA 5EDRA 5CSXA 2W4JA 5FLFA 3GCUA 1QMZA 2X6EA 5KHXA 5DOSA 5KBQA 1F5QA 4EK5A 3IW4A 4OT6A 4EUUA 4G9CA 5C26A 4LMUA 2WEIA 5AV3A 2P55A 1GIIA 2QKWB 1JBPE 5EYDA 5B2MA 3FKLA 2HY0A 3KXXA 4ZEGA 3VF9A 3VO3A 3ZH8A 3LJ1A 4OTDA 3U8WA 4BGQA 2OLCA 4YJUA 2RFSA 3E93A 1CKPA 3R7VA 3VULA 3SV0A 4D0WA 4DEAA 4W4XA 3FLWA 4BTJA 3ML1A 5DBXA 1PJKA 4GSBA 1YI3A 4AGUA 2G1TA 4C3RA 4E6DA 3BGPA 1ZARA 3ITZA 2VTRA 3LOKA 4JBVA 4R6VA 2XK7A 1DS5A 4IVDA 3FZ1A 3L9NA 2VWXA 4FSZA 4J96A 4JR7A 2QOBA 4P5ZA 4WKQA 3DQXA 4FUYA 4AA4A 3OT3A 1W0XC 5FTOA 4Y83A 1RDQE 2PU8A 3HMNA 1WVYA 4IZ5A 3O96A 4OTRA 2RFDA 4RJ3A 3U6JA 2OF2A 3D2KA 3OCGA 3PPKA 4IAAA 4OUCA 3ZSIA 3NIEA 2OXDA 3FI4A 5AP0A 5I9UA 5JZNA 3A61A 4OR5A 1H01A 2YIRA 3GT8A 4FV1A 4IAYA 4QP9A 3RAWA 1YXXA 2UZOA 4X6RA 2QOIA 2X4ZA 4FV3A 1HCLA 2VTHA 2VWYA 2HELA 5AV0A 5BYZA 3NUSA 4GUEA 5GINE 3UGCA 2VX1A 1PKDA 3W33A 4J99A 4FTRA 2X7GA 3V3VA 5LVNA 3O0GA 4ZJVA 3VJOA 4C34A 2UW6A 2A4LA 2I0EA 4NIFA 3BWFA 4FV8A 1YDSE 4UWBA 5HCYA 3SAYA 1NY3A 5IDNA 4L00A 4O1OA 5KMLA 3NYVA 4GU6A 2VU3A 3A7IA 3LFCA 3SVVA 2VZ6A 2V22A 5HG9A 4DEEA 5ANJA 3M1SA 3G6GA 4EOMA 5BVFA 4DLJA 4PP7A 2LGCA 2WELA 3LFSA 3ZS5A 5ETIA 3E63A 4D1SA 2UVYA 3FZSA 2JGZA 4KIKA 4RMZA 4RSSA 4U7ZA 4XX9A 5L6PA 2QO2A 3DA6A 3OP5A 3PYYA 3R21A 2ITPA 2V5QA 4GMYA 3UDZA 2X7OA 1P5EA 4QMVA 3V5QA 4FV7A 2JDOA 4DG0E 3BX5A 1XBCA 2BHHA 1PRYA 5D12A 2IWIA 4FTTA 3NUYA 3UPXA 4F1OA 4AOTA 3FLQA 3D5WA 3FQHA 3TJCA 3KB7A 4IBMA 3E87A 4QDVA 2Z7QA 4IM2A 1TQIA 3SLSA 4FJVA 3UOLA 4C33A 3LMGA 2XUUA 4QP2A 3W2RA 3PVGA 4I0SA 4YZNA 1JSVA 3S2PA 3WIKA 2HIWA 3N4VA 3RZFA 1NW1A 4X3FB 2EWAA 3KVWA 3Q4ZA 3JY9A 1Y6BA 2XK4A 1Q41A 3H4JA 3UIXA 3PXKA 4FSMA 4KA3A 2ZV2A 1IAHA 3O8PA 4LGHA 4C4IA 3O51A 3PE1A 3R02A 3UNZA 2BIYA 4EKKA 3LJ2A 4FNXA 5L3AA 3TNWA 1ND4A 3NLBA 3NW5A 1Q8WA 3EN4A 1H24A 3SXFA 2XKFA 3PLSA 4GU9A 4EH7A 3OWKA 5CU2A 5DHJA 2BKKA 5EYMA 3GUBA 4QMZA 1GZNA 1E9HA 4WUNA 5A6NA 2PYWA 3OG7A 4GW8A 5AUVA 4ZTHA 5TR6A 1SZMA 2BRHA 4MKCA 3F88A 2PVRA 3ZONA 4BI1A 4EWQA 2XKEA 4IIRA 2WPAA 2J90A 3MH3A 3C5IA 3WE4A 3BL7A 2BRBA 4RRVA 3CTQA 4RFZA 4BY9E 5IA2A 4AGWA 4HVHA 3GOPA 4X2GA 4MUQA 5EDPA 4QP3A 5KZIA 3UOHA 3PA4A 5AAGA 2EUFB 2NRUA 2ZV9A 3MN3A 1Q61A 3PJ3A 4F63A 4YGAA 4BIDA 1SMHA 2R3PA 3F5PA 3R9OA 3V5JA 5CAQA 3DXNA 3EJ1A 1REJA 3RAIA 4OTGA 3BV2A 5IMEA 4XMOA 5AX9A 3ZLWA 3E92A 1EH4A 4I0TA 5GIPE 4ZSEA 1VYZA 3FLYA 2BAKA 4F78A 3PA5A 4QMQA 2IPXA 4X3FC 3VAPA 4E26A 4FZDB 4U44A 3ATTA 5GJGA 2C6DA 4IVCA 1X8BA 4S30A 3V04A 5I0BA 2RGPA 4PDYA 3FY0A 3RMFA 1PXOA 5FGKA 4C35A 3UC3A 5D11A 1BUHA 3FMEA 3DU8A 3EQIA 5EYKA 2YIXA 4FICA 4BCMA 5J1VA 4RX8A 3NUAA 3EQDA 2C5XA 2ZMDA 3N51A 3ZO2A 4D2VA 5FM3A 3OOMA 2PVNA 3LQ5A 2C6KA 3LFAA 4FF8A 3ULIA 1CM8A 4ANQA 4A4OA 4M84A 4I21A 4YHJA 1ZOGA 4NKSA 1URWA 4MF0A 2OWBA 2R3IA 4I6FA 4JIAA 5LXMA 3SXSA 2J6MA 2JBPA 4RC3A 5EM8A 3ZXZA 1V1KA 3LFDA 3QKLA 4A06A 4DH7A 3HV6A 5ETCA 4C7TA 3PY1A 2JKMA 4FZ6A 5CF8A 1VJYA 5IZFA 4FTMA 3BKBA 2WMRA 5CQWA 5CU4A 1WBSA 4B8MA 4YTFA 2WTCA 3NUUA 4Z7HA 4ZSAA 2Z7RA 4R77A 4BKYA 3FSKA 3C0GA 5K4JA 2YDJA 4F0FA 4QMSA 3VW6A 3C4CA 3R22A 4IVBA 4RVLA 5F94A 3KQ7A 4Q9ZA 4GK4A 4IX3A 3HRCA 3E7OA 1BL7A 4FTUA 5CF6A 1MRUA 4P7EA 5ACKA 4IDTA 4XG7A 4JMQA 2ACXA 5ANGA 4EOLA 1AD5A 2PVFA 3VUIA 4JG6A 1IR3A 4L3LA 5DA3A 1PXLA 4AG8A 3Q32A 4O6EA 2W99B 1YI6A 3FHIA 4N4SA 4GYGA 3DBFA 2VTMA 1B6CB 1U54A 2IF8A 2IEWA 2HZ4A 3PP1A 1Q8ZA 4ARKA 4AS0A 3QHRA 4BCFA 4V0GA 5HHWA 1DI8A 3TL8A 3ROYA 4M15A 4YO4A 4L3PA 2P0CA 5JFVA 5IF1A 2H9VA 4MH7A 4HW7A 5KCVA 5ETAA 2QQ7A 4D2WA 4D5KA 4E1ZA 3P23A 3CTJA 4BI2A 2RSVA 4O0TA 5B7VA 1DAYA 3FMHA 1OIQA 3QX2A 4GK3A 4KKGA 3K5UA 4WIHA 4AGCA 4DGGA 5H8EA 2WTIA 4O84A 3D0EA 3ZC6A 2J0LA 3A4PA 3IGOA 2C6LA 2HCKA 3S00A 4XYFA 5M4UA 5A4LA 2RIOA 2QOCA 2XCKA 5HBHA 4CLIA 4M97A 3VS2A 5IG1A 5IQEA 5L2SA 4FIIA 3GCVA 1Q62A 1IEPA 3D9VA 5HLWA 4FNZA 3ORKA 4CV9A 3EOCA 2WKMA 3PFQA 3NUXA 4JVGA 3D14A 4G17A 4NK9A 1KE9A 2JC6A 3CLYA 3EB0A 5CU0A 2ITXA 3D5UA 4ZS0A 3QALE 5M44A 2UZUE 3TM0A 5FXSA 1H08A 4AN9A 4WHZA 3TT0A 5FTGA 5DRBA 2XAOA 5CXZA 1LEZA 4QMOA 3UTOA 1J7LA 2ITOA 4FKSA 4U79A 4DHIB 4XG2A 4CFMA 2Y6OA 3HUCA 1WZYA 3EQGA 3UO6A 4YHFA 2DS1A 2HWPA 4P90A 2C6MA 4EH6A 3MB7A 4S33A 5DMZA 3EFLA 3MIAA 4O38A 2OIQA 1W2FA 4TNDA 2YCFA 4OW8A 1GZKA 3ZZWA 5BYYA 1V0OA 1BKXA 2O8YA 3ZFXA 2UZBA 3BEGA 1GOLA 2GQGA 4TW9A 5I9XA 3NRMA 4O0YA 5L2TA 3W18A 3FC2A 3JPVA 1MP8A 3RNIA 3TI1A 4I5PA 4DEHA 2JKKA 5E8SA 5EQEA 2B0QA 2C5VA 3QCXA 1L3RE 4L53A 4DG3E 3EH9A 2OBJA 1Q3WA 3HA6A 5CLPA 5GHVA 5TT7A 2C4GA 3CR0A 3T8OA 3TDWA 4MWHA 1H4LA 3ZHPC 1I44A 3KXNA 3UDBA 3QYZA 3VUMA 3FHRA 4EH8A 5CU3A 2I0VA 5KMJA 3VIDA 3RNYA 1OPLA 4L6QA 2OFUA 4DHJA 4E7WA 5J5TA 4ZP5A 4FL1A 2J0JA 4QD6A 3KC3A 3O50A 4LDTA 3LAUA 4UZHA 4HVIA 2CMWA 4JX3A 4AN3A 4PTEA 3DK6A 2AUHA 2XMYA 3ET7A 2PTKA 2YIYA 4C4HA 3DAEA 3E3BX 4CQEA 3G9LX 1KOBA 4RJ7A 4A4XA 1H28A 5HNGA 4L46A 3TACA 5K5NA 4MK0A 1JQHA 5FP6A 3WZEA 2BKZA 2X8IA 4LG4A 1H1WA 3OC1A 4U81A 4B0GA 2VTJA 3UPZA 5E4HA 1Y8GA 2WQNA 3EN9A 5FDXA 4YC6A 4BHNA 3FMKA 3UQGA 4MNEA 3DKFA 3F2RA 4ZSJA 5HU3A 5CU6A 2GTNA 4YNOA 5AUTA 2UW3A 4FTJA 3W0QA 1PF8A 2QR8A 3BGZA 3E8DA 4MBJA 3VS5A 4EHGA 5E9EA 1M2RA 4XHKB 5FEEA 4QQ5A 3DTCA 4F0IA 3ZO4A 2CGWA 4PNKA 2CNVA 1SNUA 1OVEA 4NCTC 4EBWA 4AZVA 4ZLOA 2CKEA 1OUYA 4HVSA 1GAGA 4QYFA 5AWMA 3TCPA 4EEVA 2I0YA 3QRIA 3VBYA 3RKBA 4TT7A 4D4RA 1YHVA 4PP9A 3C0IA 2ITYA 1CTPE 3P7BA 3QU0A 3VHKA 3KCFA 3VBXA 1FPUA 2UZEA 3GU7A 4UX9A 3CGFA 3SC1A 2XANA 3HP2A 4YTIA 4DN5A 3T9TA 3PSDA 5EKNA 1M7QA 4IWPA 3HMIA 2UZWE 1YWRA 4BDJA 3TKIA 5BV3A 3I79A 4IANA 2QOOA 4C8BA 4Y46A 5CEPA 4DT8A 4LRMA 3WF7A 5K9IA 1BI8A 4BWPA 3IO7A 2XJ1A 3RAHA 1HOWA 5KKRC 4EH9A 4D1XA 3LM5A 5FXRA 4X21A 5LMBA 4WG5A 3UYTA 3DOGA 4JRVA 2WMSA 3V5TA 4PDSA 4ASEA 2CGVA 1YHWA 4G3EA 2R3OA 3CPBA 1M2QA 4KIQA 4QPMA 4H58A 3NYNA 2Y7JA 3HAVA 4FGRA 4Y85A 1OITA 3G51A 3W32A 3VS3A 2CNUA 3BBTB 4KUJA 3F3VA 3K3JA 3BCEA 3E88A 4H3PA 3HYHA 4FNWA 5AA9A 3BRBA 4IX6A 2PE2A 3ELJA 4E73A 4BCOA 2A27A 2QR7A 2F2CB 2PHKA 1P14A 2BDFA 2UW0A 3FZRA 4RIYA 3VUHA 3WYXA 3ZEPA 4O7RA 5HICA 3QX4A 5ANDA 4BKZA 3CXWA 3F6XA 4IB1A 2QURA 3ENMA 4BB4A 3SGCA 3HGKA 5DG5A 4I6LA 4DH1A 5HE3A 2ITWA 3VUGA 5CSHA 2VWBA 4UY9A 3PJ1A 2ONLC 4G5PA 1J1BA 5AAFA 3CEKA 3BHUA 3RPYA 4EONA 5G1XA 3BU6A 3MVHA 1FOTA 3KXZA 3COIA 4ALVA 4E4LA 3BLRA 3E7VA 4RZVA 4AACA 3GB2A 4CT1A 4RWKA 1MQ4A 3A8XA 3OEZA 4EOSA 4TN6A 4K18A 5A4EA 2IVSA 1PXNA 3PXRA 4ACGA 4PRJA 4C36A 2YHVA 2JITA 3KVXA 2XJ2A 5CNOA 4YJVA 4F99A 4FKGA 5BVNA 5AR5A 1YVJA 4II5A