1OKYA

Structure of human pdk1 kinase domain in complex with staurosporine
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
288
structure length
281
Chain Sequence
PQPRKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSPANFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEYLIFQKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTPPKLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-PHOSPHOINOSITIDE DEPENDENT PROTEIN KINASE 1
publication title Structural Basis for Ucn-01 (7-Hydroxystaurosporine) Specificity and Pdk1 (3-Phosphoinositide-Dependent Protein Kinase-1) Inhibition
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 84
structure length 281
sequence length 288
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2003-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1okyA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1okyA02
1KOAA 3FMJA 4LOQA 4O1PA 2QONA 5FRIA 2C5VA 1A48A 3HP5A 1ZLTA 3CSVA 3Q4UA 4AZVA 2R3PA 2ITQA 4NM0A 5LARA 3GGFA 4OBOA 4PMSA 2NP8A 3FLSA 1HCKA 3B8RA 3P79A 1CSNA 4BIBA 4DG0E 5EM7A 2OBJA 4WG4A 5DMZA 3G5DA 4C34A 2AC5A 2JGZA 3NRMA 4Y8DA 2YM8A 3ANRA 4AN2A 3S2PA 3PDTA 4QP8A 5GZ8A 3SHEA 5A14A 1G5SA 3UMXA 2IZSA 5IZFA 3R9RA 5AR8A 3F5PA 3KRJA 3HMIA 4TYHA 5DEWA 4BICA 2ITZA 5CVGA 4FNXA 4I5PA 3UG2A 3UOLA 2GS6A 3D7TA 1YI6A 5DI1A 2VWIA 2B52A 4MXCA 4FT0A 3QWJA 4AS0A 2C68A 1YKRA 2OFVA 3CTJA 4ZSEA 2IW8A 3VS6A 2W1IA 5ANJA 2CNUA 4ZSLA 2BRNA 3EL8A 3HUCA 4CFFA 3C51A 3ZFMA 1YWVA 2QQ7A 3QRIA 3IGGA 3ENMA 4BTJA 2OG8A 2BIKB 3ZEPA 3FXWA 4FSMA 4RVTA 2XK7A 3PTGA 2XBJA 4QMTA 4Y85A 5FQDC 2QOLA 1PXLA 3BGQA 4EK3A 3C4WA 5E8XA 4V01A 3FDNA 3BEGA 2Y7JA 3QLGA 3IDCA 4EK5A 4BTMA 3OUNB 5CEOA 5JQ5A 3KA0A 5KMIA 2XM8A 5JZJA 4BCOA 5AP4A 2YZLA 3MJ2A 4UMTA 3Q4TA 3OBJA 4YBKA 2RGPA 5AP1A 3TN8A 2UW8A 4FOBA 5AP0A 3CTHA 3GC9A 3T9IA 1VEBA 3R9NA 1W83A 4GCJA 4D2SA 3R0TA 2YDIA 4OTPA 4DE4A 5IA3A 5LMBA 3HMMA 3EFLA 4K1BA 2X0GA 5L2QA 3E3BX 3HDMA 4E4XA 4NFNA 4O7RA 4QMYA 1O6LA 3GEQA 4L67A 4FUXA 3M2WA 3R8ZA 3R02A 4HZRA 4EHVA 3F3TA 5DLSA 1FGIA 2PWLA 2ZV2A 3V5QA 2CCHA 3C4ZA 3W1FA 3MTFA 4CRLA 4G17A 3T9TA 3UVPA 4RX7A 3FPMA 3FZSA 4OTWA 4MXXA 4ZY4A 4U45A 4EWHA 3S1HA 3MB7A 1OPLA 3FYJX 3CC6A 2C3JA 5JGDA 3JPVA 5IPJA 2BRBA 3KF7A 3HGKA 2X7FA 3MSSA 4XRJA 4A07A 2W0JA 5C4LA 4G6LA 4QMVA 4L46A 2AC3A 4KWPA 1Y91A 4D5KA 3UIBA 1JKSA 2Q0NA 4TT7A 1M7QA 2W9FB 3FWQA 4X2FA 3HMPA 4G3CA 4EI4A 5J1VA 3TZ9A 2PVLA 3R7EA 3PJ3A 4JDJA 2F7XE 5HICA 2OKRA 2OLCA 1GZOA 3ORKA 4IC8A 4BRXA 4FZ7A 5C03A 2R7BA 3FKOA 3R8MA 1H1WA 3KVXA 4S31A 3G2FA 2JBPA 2YWVA 3DA6A 2XJ0A 4EJNA 4WRSA 5AR2A 4CLJA 1H1QA 4FSTA 2A27A 3RHKA 4AN3A 1IR3A 4JBQA 4RIYB 2CNVA 2QD9A 5CLPA 2VWBA 4FKWA 5LVMA 3O2MA 4O0XA 3QRTA 1IEPA 2VZ6A 4ARKA 2C3LA 5ANIA 3RI1A 1YXSA 2OO8X 3VN9A 2E2BA 3EFWA 2NRYA 3NIEA 4AT3A 4F65A 3DAEA 2XCHA 4QQTA 4F0GA 3RNIA 4W9WA 5DR9A 5EM8A 4IE9A 3EB0A 3O8TA 1QCFA 1CKJA 3PVBA 2XNNA 4DH5A 3N4VA 4O82A 1A9UA 2JEDA 4FKLA 4E6QA 1Z57A 3E5AA 2BROA 1R0EA 3ORNA 5TT7A 3CLYA 2YCFA 5J9LA 3H10A 3NYNA 2VTLA 3F5UA 3SAYA 5FEDA 2CN5A 4E8AA 4I5HA 2CJMA 4IM0A 4YNOA 5CEMA 4KSQA 5HLPA 4BL1A 3UQCA 3QTRA 3R30A 4FEVA 2V0DA 3WIGA 3MJ1A 5K9IA 3I6WA 5CF5A 5KMKA 2PUNA 2GHGA 2WEVA 3QTUA 4CMUA 3RNYA 4L00A 1WBPA 1H1RA 1KOBA 5BMMA 2XK3A 2GNFA 1WZYA 5I9WA 3QBNA 2Z60A 4QTEA 4F09A 2P4IA 2WMXA 4W4YA 4EUTA 4EOPA 4ERWA 4ZSAA 4E6AA 4YJNA 5IQCA 3HP2A 4M84A 2BZIB 4L6QA 2O64A 4Y46A 2WMUA 4RIYA 4TXCA 4RWKA 2NO3A 2W1EA 2A4LA 2GU8A 2PVNA 2W1HA 3LXNA 4IJ9A 4YJOA 4YR8A 2UV2A 3MY0A 4KA3A 3THBA 2J0JA 3U54A 2XRWA 4G16A 3KXZA 2XIRA 3F3UA 3I7BA 3PXQA 4IAKA 3W8QA 3O50A 4FIEA 3VUHA 2I0VA 4C61A 2KTYA 2R3FA 4DEIA 3NMUF 4V05A 3HYHA 3OROA 1SZMA 2XA4A 2CCIA 5T68A 2ZOQA 4O7ZA 4RFZA 2XKEA 1HCLA 5B2KA 3WYXA 4Q9ZA 5HG7A 3L9PA 2UZEA 2NRUA 3UG1A 4F99A 3QUDA 2ZV9A 5CU2A 3G33A 4FV7A 3SOCA 1EH4A 4AWIA 2WQNA 5J1WA 3ZEWA 5IG1A 3T3VA 3Q3BA 3DDQA 4DFUA 3T3UA 4KKGA 2PK9A 5IH4A 4JDIA 1NA7A 3OG7A 4U9AA 2C5OA 4XYFA 4HYHA 3SRVB 4CKJA 4GKHA 4FV6A 5C01A 4DEBA 4B8LA 4JIKA 3R83A 4UMQA 1PYXA 4YSMA 2OZOA 3DLZA 4DN5A 3TUBA 4M67A 2R0UA 1OL6A 2W1FA 3HRFA 4AT5A 4EK8A 2JITA 2OJIA 3FQHA 3N51A 4RFMA 1G8AA 2PMIA 4K18A 5TKDA 3REPA 4S34A 5I9YA 1BMKA 2W4JA 4PDSA 4DTAA 5AUUA 4FEWA 5CXHA 3VRZA 5IUGA 4Q9SA 4QQJA 3FHIA 3FV8A 4FVQA 5AEPA 5J79A 5DBXA 2BDJA 2IN6A 2Y8OA 1ZWSA 4FV2A 2QURA 3Q04A 1H28A 1KWPA 1YI3A 1W82A 4Y73A 4IAYA 5DNRA 1PXIA 4MF1A 2YISA 4BTFA 1W7HA 4ZS0A 3VBYA 1Z9XA 1PRYA 2PYWA 4Z7HA 3DK7A 4LUEA 4OTFA 5I9UA 5I9XA 5CAUA 3CQUA 4RC3A 4AGWA 4EH6A 2J0KA 3AD4A 4J95A 1JSVA 3E8EA 2VX1A 3NCGA 3BYSA 3OF0A 4ACMA 5DN3A 3TZ7A 3PZHA 3OD6X 2OH0E 4IZ5A 4KABA 3JXWA 4LL0A 2FO0A 4ZTMA 5JFWA 5CF4A 4DCAA 4OT5A 4BYIA 1FBNA 4AZSA 3VUIA 3V6RA 4CCUA 1AGWA 2IVUA 4GL9A 5FXSA 4ZZMA 3OXZA 4U42A 4MQ1A 4F7NA 3DBQA 2F49A 4XH6A 2XRUA 2G01A 3R01A 3HNGA 1HOWA 3H3CA 4R7BA 4E4LA 3MVLA 4TYJA 2YM6A 5AR7A 4YJPA 3M11A 3OFMA 3PLSA 4CTBA 4EONA 3CJGA 3HV3A 1P4OA 2PVRA 5E8ZA 5TF9A 2W06A 2BRGA 5D11A 2GNIA 3QD2B 1P4FA 3ROYA 3P7AA 1OKWA 3FLZA 5E8WA 2VRXA 2XIKA 4J8NA 4A06A 3I0QA 3LPBA 4GFMA 4YZBA 1G8SA 4BDFA 5D7VA 3PJ1A 2DS1A 2H6DA 4I5MA 3ANQA 4A9UA 5HD4A 3CY3A 3ZUVA 1QPJA 4GEOA 4UWCA 3H30A 4X2KA 4ASZA 4IX4A 4C2WA 2BAKA 3IPHA 3HA8A 4E5AX 3AC8A 4YJSA 3CGOA 2I0HA 3BYVA 3LJ0A 4U8ZA 1H0WA 3OS3A 2FA2A 5CI6A 5EKOA 2F2UA 3CEKA 4HCUA 4DH1A 4BHZA 4YJQA 2IVTA 2R3RA 2PMOX 3NR9A 3UYSA 3R7IA 3ENHA 1JAMA 1OMWA 3AGLA 3UOKA 4BDAA 4C7TA 5KBQA 1OIUA 5EOLA 5KMLA 2CGWA 4LV8A 4DGMA 1OKZA 3UPXA 2J5EA 4DTBA 2EXMA 2VTSA 3FZRA 4IXPA 4BYJA 3UQFA 4O84A 3PXFA 4R3PA 5LCKA 5K4IA 3FI8A 4G3EA 2VNYA 4G34A 3UZTA 4FSYA 1CMKE 2HY81 1ZYSA 4Z3VA 2UW3A 2EXCX 4GK2A 2R5TA 3EQBA 4M3QA 2VUWA 5AV1A 4ALUA 2C0IA 3DXQA 4YO6A 3VQHA 3PJ2A 1PYEA 4HJOA 4FNYA 4FZDB 3TDVA 3D2KA 4GG7A 3G0FA 5F1ZA 4F9WA 4FL3A 2CGXA 4IWOA 5D1JA 3JR1A 5AADA 2FB8A 2ITNA 4ITJA 2UZVA 3IG7A 3ORIA 2VTJA 3MFSA 1AQ1A 4M0ZA 3WZEA 3EHAA 4LGHA 5HE3A 5L6WL 3WZDA 3RAHA 3UVRA 4EQCA 4PDYA 3VHKA 5K5XA 1Q8ZA 2FYSA 3C4EA 3VNTA 4JIAA 4NWMA 4WRGA 2PUIA 1B6CB 3KU2A 2IW9A 2IWIA 5L3AA 5M4UA 1MRYA 1VR2A 3DZOA 1DS5A 1PXOA 3LFDA 5CNOA 4BDKA 3KRXA 4P90A 3AD6A 4FTKA 3KRRA 1OBDA 4QP7A 4ZLZA 4RX8A 3GCPA 4WSQA 3CE3A 3I4BA 3RZFA 3VUKA 4LL5A 4BKZA 1RDQE 1NVSA 1KE9A 2IVSA 3OUKA 4TPTA 5IA5A 3QD3A 3LQ8A 3PSCA 4A9YA 4BDGA 4CSVA 5J87A 3NW7A 4MWHA 4RLLA 3MVMA 1UU7A 1JKLA 2OU7A 3VWAA 4ZJJA 3ZDUA 4F64A 3U6IA 4MKCA 5L8KA 3SGCA 4I3ZA 3D14A 1JWHA 1URWA 4QD6A 1UNLA 5DIAA 4MXOA 3I81A 3VUMA 4C4GA 2YJRA 5BMSA 3MY5A 1YXTA 4PPCA 2PE2A 4U43A 5BVOA 5HE2A 3BQRA 4GKIA 4FKTA 3GXLA 4IMYA 1R1WA 3GOPA 1H01A 4NCTA 4R5YA 3NNWA 2JFMA 5AUXA 5AA9A 3LCDA 3E7VA 3FLNC 4FVPA 1GIIA 1YVJA 2BMCA 5GJFA 5HQ0A 3R71A 3VBXA 4APCA 2UVZA 2H8HA 4TNBA 4EOLA 4C37A 4BCMA 2QOQA 3ZCLA 5M56A 3ZSHA 5A4EA 4CNHA 4ZTQA 2JD5A 4KBCA 2IG7A 1SM2A 3LLAA 2FUMA 3FL5A 2OIDA 4E26A 4EYMA 4PNIA 5KKRC 1DAWA 3DKFA 4FIFA 3WZJA 5DOSA 5DVRA 1G3NA 1REKA 5HNIX 4E5BA 5CVHA 3OT3A 2Z7SA 5CSVA 5F94A 4WHZA 2RFSA 3BBWA 2V7AA 4L43A 3VBWA 4NT4A 4O2PA 4Y5QA 4RIXB 2GTMA 1UU9A 4ZZOA 4LYNA 5JH6A 2W99B 3GVUA 2GQGA 3A60A 5EQEA 3CD3A 4XG3A 5FUTA 5C26A 2RSVA 2R0IA 2VNWA 3F3VA 5K3YA 4ZK5A 3U51A 2FGIA 4IC7A 4E3CA 5KUPA 1RJBA 2YLEA 4GK3A 5CT7A 4DHFA 4ZS4A 5HBEA 2Y0AA 4O7VA 5FWKK 2XKDA 1PMEA 4AF3A 3GCSA 2I0YA 2IW6A 1PF8A 1QPDA 4HPUE 5LMKA 3RM7A 4KBAA 2VTRA 4CFWA 4F7JA 4J71A 4K77A 4I93A 4BDEA 4DEHA 4P7EA 5T6KA 3R9DA 3FMEA 2E9NA 4AA4A 4D2TA 2R3GA 2X6EA 3KY2A 4EH4A 2W1CA 2JKQA 4M66A 3JS2A 4J97A 3ETAA 3GP0A 3ZXTA 3Q5IA 3EH9A 3PIYA 4JNWA 3EL7A 4OLIA 3W18A 2C6EA 5M55A 3PVWA 5IQIA 2J7TA 3BIZA 1CTPE 4PMPA 2R3QA 3R8LA 2WHBA 4R1YA 1K9AA 2V7OA 5CT0A 5EHYA 1Q24A 5D7AA 2VTIA 5JK3A 3EKNA 1RQQA 2CMWA 5AV3A 2BDWA 5F9EA 3FL4A 3A2CA 3FE3A 4JQEA 4D1XA 5CAPA 1W84A 2YAAA 5D41A 3QTZA 5HG9A 3ZONA 4GW8A 3TT0A 4CD0A 3OY1A 5A6OA 2CKQA 4RIXA 3W2SA 4BI2A 3F66A 2B1PA 4FTNA 2CLQA 1GZKA 2C0OA 3MPMA 3OTUA 4Y95A 4CEGA 4IANA 4E4NA 1TVOA 4FEUA 2C4GA 3K5UA 3UO5A 1XO2B 2ZVAA 5HIBA 3CBLA 3GC7A 4GYIA 1SNUA 2QO2A 4EKKA 3DTWA 3SG9A 2HYYA 3IW7A 5DT0A 5A46A 4I5CA 3PXZA 1BYGA 3MIYA 3Q96A 1NT2A 3NLBA 5AV0A 4PTCA 2ZV8A 3VJNA 1XWSA 1M2PA 1OL2A 3PWDA 2X2KA 4U40A 4C58A 4BR3A 4JT3A 4F70A 4L3JA 4BGQA 2C6TA 4MBLA 3NUPA 1GAGA 3LM5A 2WTCA 5CQUA 5IQBA 2PZYA 4U79A 4HYSA 4ANLA 3UIUA 2VTAA 2W7XA 2E9OA 2JDSA 4LFIA 4BF2A 3PJ8A 2VO3A 3MVHA 4D4VA 2W1DA 3LOKA 4J52A 4IM2A 1WMKA 1UV5A 5FBNC 5L8LA 2YIRA 1NW1A 4F1MA 4I0RA 2JDVA 4MXZA 4MAOA 2WTVA 3ZS5A 3HV6A 3QCSA 3V5TA 3WYYA 5AMNA 3EQPA 4DEEA 2O65A 4HCTA 2PVYA 4UV0A 4BN1A 5CAVA 4H58A 4IBMA 4XV1A 1OPJA 3V6SA 3RP9A 5M4FA 3BE2A 1Q4LA 1ZOHA 3I6UA 3K2LA 3AT4A 3SQQA 4QYGA 4D2RA 2XNBA 4IVDA 2JIUA 4P5QA 5DT4A 1XH9A 3EN4A 4DGLC 5AUTA 4F9AA 4I6HA 4FSNA 3MYGA 3QZGA 5J5TA 4G2FA 2P0CA 2UW5A 1JVPP 3GNIB 5FDPA 4GYGA 2XK6A 5HCYA 1YW2A 2O8YA 2UZTA 3AXWA 1JLUE 3RALA 5JSMA 2QG5A 5EW8A 4PUZA 2VU3A 4ASEA 2OSCA 4I24A 5JZNA 3HRBA 4BI1A 5CZHA 2QKRA 3D4QA 3L8VA 2O2UA 2GHLA 3R6XA 4XV2A 4WBOA 5HG5A 3TKHA 3D94A 4TWPA 3RK7A 2X9FA 5CU4A 3DBDA 5LWNA 3SA0A 3PG3A 2ITXA 3PRIA 5FP5A 5J7HA 4H1JA 4KINA 3MV5A 2OZAA 3DB6A 4N70A 4NJDA 1YDTE 2HZNA 4X6QC 4FT7A 4EOJA 4DFXE 4AN9A 1GIJA 5IQAA 3TV7A 5HIDA 3NIZA 4P5ZA 3FY2A 3R21A 2W5BA 3BHUA 4TYHB 3E87A 1QPEA 3POZA 3CCNA 4P2KA 4ZTRA 4K2RA 4YNEA 4L44A 4BCHA 4U5JA 2HW7A 4NW5A 4ZJIA 1BL6A 3KXXA 1ZMUA 4X3FA 4MNFA 4O7NA 3E62A 3I7CA 2O5KA 3Q5ZA 4BCQA 4DH7A 3F2AA 2QR7A 4BWXA 4L9IA 5C8NA 5HE1A 3BLRA 4PX6A 1NVQA 3OWJA 2JDTA 5E8YA 1PMVA 4FTQA 4DGOA 2SRCA 3CXWA 4ZMEA 3AG9A 5K0XA 4BCKA 5HZNA 4IZYA 4YUQA 2WFYA 1OVEA 3A8WA 3CS9A 4L53A 1W98A 4O38A 3AC5A 4U97A 1W8CA 3RZBA 4FGRA 3PP1A 5AAEA 1WBTA 5GIOE 4UX9A 3R2BA 2QKWB 2WOUA 3QD4A 4FOCA 3GC8A 3AT3A 2BZJA 4QPAA 4FKGA 3N4TA 1KV1A 3TIZA 1Q41A 2BILB 2VWZA 3TUCA 4F1TA 2ITVA 4QMPA 2E9PA 5JKGA 5L6PA 4D58A 1NXKA 4RMZA 2W1ZA 4JG7A 5CASA 1J7IA 3MH3A 2E9VA 2W4OA 4L01A 4QMZA 3Q9WA 5HHWA 1Q8YA 5ETAA 4LGDA 5H8BA 4KIPA 4D55A 3GCVA 3F82A 3D83A 5CWZA 4FT5A 4QMNA 2XNGA 4QMLA 2REIA 3KRWA 3IW8A 1JQHA 3LFAA 1R39A 3NUXA 3ZLWA 3VBQA 5BQ0A 4W4VA 3JVRA 4HGEA 4I23A 5J9YA 1UWJA 3JY0A 1M7NA 4FTOA 4YMJA 3BYUA 3O7LB 1R3CA 2WPAA 4C62A 3FJQE 3C5IA 1K2PA 3LXPA 2XK9A 1Y6BA 1YQJA 3KMMA 2WKMA 3IGOA 4EHZA 2ACXA 3KKVA 3E3PA 4LMUA 5DR2A 1ATPE 4H05A 4MH7A 4S30A 2CSNA 3BV2A 3FKNA 3Q2JA 3SOAA 5AP2A 3L8XA 2YCSA 3GBZA 4QOXA 3RK5A 4BY9E 1ZYLA 3A7FA 4FIGA 2PZ5A 3MGYA 3LXKA 3NNXA 4J8MA 4RJ4A 5CVFA 5CQWA 3QUPA 4D0XA 2QOIA 3ATSA 1H8FA 4IFCA 3UPZA 1URCA 1I09A 4CFNA 3FQSA 4GU6A 3P78A 4TTHB 4V0GB 2WEIA 4EH7A 4WIHA 4FTAA 3U87A 4O83A 4CV9A 4UB7A 2J0IA 1KE6A 5IUHA 4DT8A 1PXJA 4FTTA 4ENXA 4GVJA 3BU6A 2OH4A 3F3WA 4O7TA 2GNJA 4QTCA 4PP7A 3QUEA 2YDJA 3MPTA 2UW9A 3DS6A 3A99A 3ZZWA 4BFMA 4BHNA 4EBWA 5AX9A 4F0FA 1XH6A 4JOAA 5J7BA 4GIHA 2Y4IB 4NM5A 5LVLA 3RHXA 3RPYA 4MXYA 4E1ZA 4KUJA 5HVYA 2WAJA 5E91A 3FUPA 5FBOA 4NKSA 1LPUA 1KV2A 5BVKA 3FMNA 4R77A 2OXDA 2R3HA 1YRPA 4HYIA 1XH8A 3LIJA 4S32A 4RWLA 4FNWA 5KMJA 5BNJA 4FKOA 3OW4A 2WMWA 3GOKA 3LFEA 1SYKA 4GT5A 4FVRA 5AM6A 3RWPA 2CKOA 1MQ4A 2OGVA 4FBXA 3NX8A 4XRLA 4O0SA 3FY0A 3PSDA 4Y72A 5I3OA 4BIDA 2J90A 4AE9A 5IQEA 5HIEA 3C4CA 5IQHA 1OL5A 2KULA 3OY3A 5M44A 4EOOA 4RVLA 3LFNA 4QYEA 3ZU7A 2OI4X 4QMXA 4R6VA 4M7IA 4A9TA 1Y6AA 3CR0A 2FSOX 4MVFA 3PZEA 1W0XC 3QTXA 2WMBA 2YLFA 3W55A 1VZOA 3PA3A 3P5KA 4TZRA 4XEYA 4ANOA 4EORA 2QU5A 1MQBA 3JVSA 2O0UA 4RA5A 4X3FC 3LFFA 3LJ1A 3LAUA 5HTIA 4KS7A 3OEZA 4J98A 4CYIA 3LM0A 1BI8A 1CKPA 4ZLOA 4V0GA 3ZC5A 4W8DA 3UQGA 3LFCA 4JQ8A 4O91A 1QL6A 3MS9A 3UP2A 2XCKA 3ZBFA 3DFAA 2WQOA 2CKEA 4GUBA 3PIZA 3VAPA 4XOYA 1GOLA 4R3RA 3R22A 4WA9A 4ZP5A 2VTHA 5M07A 3JY9A 3WF9A 5J5SA 5FTGA 3M1SA 4IQ6A 5FTOA 2QR8A 4DG3E 3K3IA 4U6RA 4OT6A 1FVTA 4I6QA 4UWBA 3QYWA 3SXSA 4DGGA 3MVJA 2Y9QA 3E8DA 4BC6A 2ZMCA 3DJ7A 5C1QB 3FKLA 2GS7A 4GT4A 3G90X 2WNTA 3EQFA 4GK4A 3RPVA 4QYFA 3K54A 4J99A 1KE8A 1DI8A 2IZUA 1PW2A 3E64A 5CXZA 4USFA 4J96A 5HBJA 4FSQA 1OGUA 2H9VA 5EM6A 2OXXA 4CT2A 3VS5A 4A4OA 3MPAA 4BGHA 4IADA 4XS2A 4FV9A 5EKNA 4FV4A 2C3KA 4XV9A 2R3IA 1XBBA 4DFBA 2B4SB 5FXQA 4AOIA 3EZVA 4PMTA 3NYXA 2AYPA 4WT6A 3QAME 3AMYA 5DRBA 3UO6A 1GZNA 4AOTA 5BVDA 2ERKA 2WO6A 5JFXA 2C47A 3BHYA 5DT3A 3H0ZA 5E90A 4PNKA 3DBEA 1Q8TA 1Q62A 3KF4A 3WE8A 4CVAA 5AWMA 3SKCA 3AC3A 4CMOA 4FL1A 5AP5A 5HCZA 3KL8A 4E5WA 4AP7A 3QLFA 4YTHA 5EW3A 4RQKA 2DQ7X 3EKKA 4R1VA 2BPMA 4DAWA 2YITA 2ZV7A 3PE1A 3IK3A 3VUTA 2LAVA 4YTFA 1H24A 3F5GA 3HL7A 2Y6OA 3R1QA 4H1MA 4FR4A 2I0EA 4EH2A 4JBPA 2DYLA 3NEWA 5TOZA 2PZRA 3LMGA 3WIKA 2FVDA 4YTIA 5I9VA 5KKRB 1O6YA 2R3LA 3VF8A 4IH8A 4HVDA 3WZKA 4JG6A 2BRMA 2ZM3A 5EI6A 4RJ7A 2OJ9A 2PE1A 3KEXA 2ZB0A 4O1OA 5H8GA 2XK8A 4IFGA 4IB0A 3TZ8A 3QX4A 2QOCA 3TNHA 1ZARA 2QVSE 3QALE 5BX0A 2R64A 2BFXA 3QQGA 4AGUA 4WNOA 4G5JA 4OAVB 4IAIA 5K4JA 2CLXA 3B2TA 4M97A 3TZMA 5A4LA 5HTCA 2BKZA 4EOMA 4FODA 3DNEA 3LLTA 3NW6A 2OK1A 2G1TA 4I0TA 3QC9A 4EOSA 1SMHA 1M2QA 5G1XA 3JUHA 3SV0A 4ZJVA 3V5LA 2P33A 2WTKC 3HRCA 4QP3A 2ZB1A 2BTRA 2X8EA 3PY0A 1QPCA 2XZSA 4ZY5A 3K3JA 5ACBC 3Q32A 3NNVA 5IA1A 5KCVA 4OTGA 4YZ9A 3D5VA 4EH8A 3FI2A 3MH0A 2ONLA 2IZTA 4MCVA 1T45A 2RFEA 3PE2A 3TNQB 5KMOA 2UW4A 4RWIA 4KIKA 3TKIA 4DEAA 2XKFA 4JRVA 5CANA 2VN9A 3DFCB 4YZMA 3S4QA 4JRNA 1YDSE 4OBPA 4PQNA 4QYYA 5LMAA 2BR1A 3U6HA 3U6JA 5EDQA 3PPZA 3R00A 3BHHA 5KZ0A 3EQIA 4PF4A 3F9NA 4HYUA 4BZOA 1P5EA 4WSYA 1M2RA 1IA9A 4FC0A 3VS0A 4RJ8A 4NH1A 3ZFXA 3EQCA 2G2HA 1H07A 4U7ZA 5C4KA 4AA5A 5A6NA 4AQCA 3PA4A 3ZLYA 5GJGA 2GS2A 3BI6A 3P7CA 3C1XA 4FV1A 2JAVA 4CKRA 3BBTB 2I1MA 5EHLA 3F7WA 1JSTA 2PVFA 3ET7A 4YHJA 5M09A 4EH3A 1OBGA 1LEZA 5BUJA 4RFYA 2I7QA 3MWUA 2RG5A 5CEIA 4EBVA 2BDFA 5ETCA 1V1KA 4EZ7A 3UZRA 3R73A 2B53A 4FG8A 3RTPA 4ACDA 4DEGA 3UBDA 2C0TA 4DC2A 3MDYA 5L8JA 1B39A 4LOOA 3OTVA 2EU9A 1YXUA 2VV9A 1F0QA 3ROCA 1ZOGA 2XNMA 3O23A 4QTAA 3WE4A 3FSKA 2PULA 4K8AA 4FTJA 3WZUA 4F1OA 3KXNA 4OTRA 4GIIA 2XVDA 5IEYA 3MESA 2X9EA 3LJ2A 3VBTA 3SX9A 4DFZE 5CF8A 4G9RA 4JX7A 1YWNA 4W4XA 3EZRA 3LVPA 1IAHA 3NW5A 2FSLX 3NUUA 5EI2A 3TNWA 4RVKA 5CU3A 5E8SA 2PHKA 4YHTA 5DH3A 4O21A 4FTUA 1SVGA 2XIYA 2XNEA 2B55A 4USDA 3SD0A 4PDPA 4D1ZA 4YC8A 4YJTA 2BAQA 4O96A 5BUIA 5AV4A 5IH5A 2PU8A 4ZLYA 5DPVA 5E1SA 3LFBA 4ZZNA 5IUIA 3BGZA 1ZYCA 4D4YA 5KZIA 1OM1A 2XIZA 3CP9A 3S95A 2OF2A 4FUYA 2XYNA 2VAGA 2XJ1A 4F0IA 3UC3A 2IPXA 3C5UA 1H00A 4GVAA 3EFJA 2WQBA 2OWBA 4LRJA 3ZTXA 4QT1A 2QCSA 3UNJA 2XNPA 4NYEA 4FIHA 4YZDA 3FXZA 5HVKA 2J5FA 1M17A 3AC4A 1PY5A 4QMUA 4ZTLA 2X4FA 1Y8YA 2Z8CA 4BCGA 3C4FA 4O86A 1WVYA 5ANKA 4U44A 4CG9A 3MBLA 3U4WA 4O27B 4FL2A 4OBQA 5T3QA 5BYZA 3GU7A 1OKVA 4KKEA 4QPMA 4AZTA 5AUWA 3KXGA 4YP8A 2HZIA 3CGFA 2HWOA 3HX4A 3I5NA 4ZIMA 4KIOA 4UN0C 4RA4A 4DG2E 2J50A 5LCJA 3R7YA 4BCIA 1J3HA 3KGAA 1VYWA 3VULA 3A7HA 3V51A 3VVHA 2OXYA 1Q3DA 3VRYA 4AW0A 2UZLA 2GQRA 1UU3A 2YABA 2VO0A 4GSBA 4UMPA 3SVVA 3KK9A 2VWVA 3R1NA 3QQLA 4XG9A 3R8VA 5EK7A 5A4TA 3GB2A 1UKHA 3ID6C 2WTIA 5JEBA 3QYZA 4RC2A 4OR5A 4FV3A 4JDKA 5CY3A 3ZM9A 3QTWA 5JGBA 3WI6A 1WBSA 1SVHA 2QO9A 4BBEA 3NNUA 5LWMA 3IOKA 2C6DA 5BVEA 4FTLA 4IDVA 4F9CA 2PVKA 3DCVA 4KRCA 5LVOA 4AT4A 4ASDA 5IDPA 4M14A 3U8WA 3UOJA 4IB3A 3NUYA 3R2YA 4PMMA 5CSHA 1OITA 4HVIA 2WELA 5HO6A 3OZ6A 2Q0BA 4U81A 1KE7A 1LR4A 3HZTA 3P9JA 4F9YA 5IA2A 2GNLA 2BIYA 4RBLA 4ZOGA 3C50A 3QTSA 3LCSA 3UVQA 4BKYA 2ONLC 5M08A 2HIWA 4EOIA 1WBOA 3PPKA 2GNGA 3ELJA 1QMZA 5E4HA 4NKAA 3FZPA 3QKMA 4AW5A 4W8EA 2ZM1A 4CFXA 3DTCA 4IJPA 4CXAA 1YOLA 3E92A 4RZVA 2UZBA 5AAGA 2C1AA 4GV1A 4YC6A 4GS6A 4WKQA 3TM0A 3DJ6A 3BPRA 4AE6A 1TKIA 3DGKA 4G31A 4ITIA 3OXIA 4OAUC 5HOAA 3Q4CA 2HZ0A 3IDBA 4M13A 4IX3A 2IO6A 4YBJA 4K11A 4DH3A 3MFUA 4ZSJA 4XLVA 2OICA 4ZTHA 4DEDA 4D2VA 3Q4ZA 4JBOA 3UE4A 5E7RA 4WBBB 1GY3A 4QP4A 3PVUA 1P14A 3PY3A 5FD2A 3S0OA 1PJKA 3BELA 3ZLSA 4DT9A 2C30A 1XBAA 4C2VA 4CQEA 1L3RE 1S9JA 3AMAA 3LFQA 4HGLA 2E9UA 1J91A 1V0PA 4WOVA 4D5HA 5M53A 2CDZA 1RW8A 5I0BA 5BVFA 3BLQA 3GQLA 1J1BA 3VF9A 3FI4A 3NZ0A 2LGCA 4NK9A 3QQHA 3EIDA 2OW3A 3EYHA 1XH5A 3U55A 4NUSA 4RPVA 2WGJA 3F3ZA 4FSRA 3VS4A 2BHHA 3W2PA 5CSXA 1JBPE 3F7ZA 1FINA 3NDMA 4CZTA 4ALVA 4UZDA 3EQHA 4YTCA 3DOGA 4YZCA 3MIAA 2UUEA 4RWJA 1XR1A 3L8PA 3RVGA 3ZOSA 1YHWA 5BVNA 3NVKI 3W2CA 2OJGA 1Q8WA 4D4RA 3SG8A 1STCE 1YDRE 2JFLA 4FKRA 3TTJA 5C9CA 2ITWA 4G5PA 2C3IB 2WMTA 5HX8A 4YJUA 2C1BA 2UVYA 2YM5A 5EFQA 2OFUA 3RWQA 4TW9A 4CZUA 4DINA 3LCOA 3P7BA 4S33A 3UDBA 2R3JA 1OZ1A 3K5VA 3O7LD 4JL9A 4GFOA 4FEXA 3NAXA 4IACA 1PMNA 5F20A 2YHVA 3F2RA 3QRJA 2GTNA 4IVBA 4CGAA 4L3PA 3KK8A 5E92A 5IH6A 3QHRA 2R7IA 5FGKA 2GFSA 4CYJA 4F6SA 5CEKA 2ERZE 1YWRA 5K5NA 3TJCA 3UP7A 3DY7A 4FX3A 2VTNA 4IWDA 3DAKA 4TWNA 4MWIA 3UZPA 3GU5A 5IU2A 4ZSGA 2C5XA 1XBCA 4XNEA 3BWFA 2YN8A 4ITHA 3CY2A 4AOJA 4ZXTA 2WTDA 5E8UA 5IQFA 2HCKA 3PFQA 4CFVA 3C7QA 3F5XA 4YURA 4CFMA 1BUHA 3CPBA 4ONAA 5LJJA 5M51A 2YZAA 3QA0A 1B38A 2OZAB 3HA6A 3RK9A 3AGMA 4M0YA 3UNZA 4U0IA 4ANMA 4EQUA 4IWPA 3A7IA 4UMUA 4Z55A 3QTQA 2UW0A 4CRSA 3QTIA 3O96A 3ULIA 1FOTA 3ZRMA 3R63A 2XP2A 3IECA 2BTSA 1OL7A 3BQCA 4CZYB 3DK6A 4B99A 3CKXA 2VTQA 3CKWA 4AZFA 5FTQA 4F7LA 4QP6A 3QD0A 3DLSA 1IG1A 2WIHA 4FTCA 3CJFA 5GHVA 2IZRA 4WG3A 2J51A 3OT8A 3ACJA 1F3MC 3R7GA 4B0GA 4K0YA 4O81A 1H1SA 4FKUA 4KAOA 5HCXA 2BFYA 4X3FB 2R3OA 4XHKB 3GI3A 4A9SA 4O6EA 4DBNA 5D10A 1XH4A 2X8DA 2F57A 5CS6A 1U5QA 4R5SA 4W4WA 3WF6A 1M14A 3HKOA 3UODA 4AACA 3PLAE 3L9LA 3DDPA 4FICA 4KB8A 2CKPA 4QTBA 1CDKA 3TNPC 1E1VA 1O6KA 2PUUA 5HE0A 5AV2A 5IISA 3NS9A 3UJGA 2VWXA 4IIRA 3F6XA 4GJ3A 4BCPA 3FZ1A 2HXQA 4IAFA 5CEQA 2ESMA 4XX9A 3FZTA 1Q5KA 5A4CA 5KX8A 4EHGA 1JSUA 4FK3A 4ERKA 4KSPA 3QCYA 3KULB 3HV4A 4MTAA 4AX8A 2PTKA 1VJYA 4XV3A 4XG7A 3TG1A 4IHPA 1XQZA 2A1AB 2J4ZA 3OCTA 3LQ5A 3PP0A 4XG2A 3TIYA 1F5QA 2FSTX 3EN9A 2WMAA 4LRMA 2CHLA 2ZYBA 1OKYA 4WUNA 4B8MA 1Q61A 2Z2WA 2UZUE 2X6DA 3O0GA 4FV5A 1VYZA 3V04A 4D2PA 4D0WA 4ZAUA 1JPAA 1K3AA 3CD8A 3LCTA 1YHVA 4FNZA 4W9XA 3ZC6A 2UVXA 1BL7A 1YOJA 2BCJA 3Q9YA 5EYCA 4EL9A 4PDOA 3RCDA 5IMXA 1H08A 2UZNA 4NM7A 5EYKA 3P86A 4RZWA 3VC4A 5H3QA 3Q53A 2QHMA 3FMLA 5E8TA 3WF7A 2YDKA 2FSMX 1X8BA 3HUBA 4HZSA 1XJDA 4I6BA 3GCQA 3SXFA 3U9NA 3ORTA 1I44A 2B9JA 1FVRA 4RGJA 2ZDTA 4DGNA 5EQPA 4TY1A 4NJ3A 3BU5A 4FF8A 5JN2A 4FKVA 4LG4A 2Y4PA 4M15A 3DB8A 2V22A 5CSWA 3VO3A 4AW2A 3OP5A 1PMUA 2ITOA 2ZAZA 5EI8A 5B0XA 2HENA 5JRSA 1TQIA 4C8BA 2H96A 4IX6A 4KD1A 4G9CA 4Q5HA 1PHKA 1H26A 3RBWA 2YWPA 2YM3A 3RAKA 3DU8A 3KXMA 3L9MA 3EN7A 5M4CA 2HXLA 3TKUA 4BBMA 2JKOA 3KULA 4D28A 3W2QA 4RJ3A 4DFNA 4BDCA 4OW8A 2PUPA 2XUUA 3H9FA 2PL0A 4TRLA 5HO7A 4MHAA 3R1SA 3NCZA 4I1ZA 1YXXA 2VWUA 1OIQA 2JIVA 3F69A 4M8TA 1ZZ2A 4TNDA 4R3CA 4AGDA 3R9HA 4IVCA 1IA8A 3NUAA 3DT1A 3EYGA 5JGAA 5AP7A 4A4LA 2I6LA 3ZM4A 2AUHA 3CIKA 3LFSA 3RMFA 3VS1A 3EFKA 3GCUA 4Z7GA 4RRVA 2NNWB 4IVAA 2P3GX 1H4LA 2RG6A 2X1NA 2PPQA 2QG7A 4BCJA 2EXEA 2YM4A 3MY1A 4FEQA 5DHJA 4E93A 4FKJA 4WD5A 2PVMA 5BYLA 3B8QA 3KB7A 4IX5A 3DKCA 4XOZA 5EM5A 5CSPA 5AR5A 2WTKB 5DR6A 5FXRA 5L2SA 3IONA 3EN5A 4D9UA 3BHTA 3PA5A 4N0SA 4RJ6A 4TYEA 4WG5A 3KQ7A 5GNKA 3NVMB 2X8IA 2ZMDA 3DV3A 4LQMA 3ZRLA 5ICPA 4CTCA 5HU3A 3I60A 5KBRA 3KXHA 5I5ZA 4FG9A 4FSZA 4CV8A 4GH2A 3Q52A 3OOMA 4X3JA 4C3RA 3PSBA 2R3NA 1U46A 4IAZA 3KMWA 4QNAA 5DGZA 3V8SA 3M42A 4HW7A 4RG0A 5AX3A 3W2RA 2R2PA 2EVAA 2J6MA 3OXTA 4FA2A 4UMRA 1Z5MA 4MYGA 3ORZA 3PXKA 4ZMFA 2XMYA 4RIOA 3FMHA 4H36A 3PPJA 3OMVA 4B7TA 2HY0A 4HVSA 5LVNA 2OJFE 3BYMA 4IEBA 2VX0A 3UGCA 2B54A 3GU4A 3O71A 4YHFA 3OWKA 2PZPA 2WZJA 2A19B 4E20A 5D9HA 4DA5A 1FGKA 3QF9A 2C5NA 4K33A 4O0WA 3SLSA 4BI0A 1PXMA 2WQMA 4F63A 5HU9A 2XIXA 3D0EA 4MD8E 1RE8A 3A7GA 4XMOA 3A8XA 2XK4A 1Q8UA 4C36A 2WXVA 2X4ZA 5KMMA 3DPKA 2BALA 3NUSA 3UC4A 1WBWA 4HNIA 1FMOE 4EH9A 4PP9A 4YPDA 4YC3A 3WBLA 5AUVA 5HO8A 4QNYA 2XYUA 3VIDA 3QZHA 4XG8A 3G15A 3ZHPC 3TEIA 1PXPA 2QU6A 2R3KA 5CYIA 2JIIA 5IA0A 4WUAA 3BYOA 4EYJA 3NSZA 4F6WA 3QRKA 4LMNA 4FZ6A 1Q99A 3QFVA 5AR3A 1Q3WA 4WNPA 2XF0A 4JLCA 4F08A 2CGUA 4II5A 3C9WA 4F7SA 3NUNA 2A2AA 1ZY4A 2F4JA 3EOCA 4GFGA 4BB4A 4EUUA 1TQMA 1ZOEA 4ZTNA 5BPYA 4U41A 4FKSA 4M69B 4RIWB 4BZNA 1M52A 2HWPA 3I5ZA 3R28A 2XM9A 3ZO4A 5ACKA 4B4LA 5JT2A 1YHSA 2RF9A 5C27A 1JNKA 3FMMA 5CTPA 3ATTA 4JX3A 2ITYA 4HPTE 5BYYA 4JAIA 2WMSA 3D5WA 4HGSA 4PV0A 3ZSIA 4AU8A 3A62A 2Y6MA 3CPCA 4ZTSA 4L45A 5L2IA 4X2GA 1FVVA 3HV5A 4NIFB 5BUEA 4UYAA 5LXMA 3MH1A 3MH2A 4QP2A 4IM3A 5AP3A 3VUDA 4WNKA 5AIKA 4DFYA 4E4MA 3KMUA 5BVWA 1NVRA 4FG7A 1OL1A 4YJVA 5AAFA 3G9LX 4NL0A 2PMLX 1E1XA 5DA3A 4C4EA 1PXNA 2C69A 3MFTA 4UY9A 4EZ3A 5JFSA 2RKUA 5I3RA 3LHJA 2CGVA 2VTOA 3I0OA 3UO4A 4CLIA 4E6CA 3D15A 3KVWA 2QOHA 5CX9A 3ORXA 4ALWA 4ORKA 2RFNA 4AFJA 4DYMA 2VO7A 2JDOA 4OTIA 3QRUA 4Q5EA 4DH8A 3W8LA 2CPKE 3G6HA 1A06A 3RAWA 3I79A 4YLJA 4GMYA 3ZXZA 4XLIA 3COMA 3NWWA 4L7FA 3Q9ZA 4UBAA 3MFRA 5AUZA 4M68A 4B6LA 3BEAA 3IQ7A 2OIBA 3DQWA 3H9OA 2R9SA 4MD7E 4RJ5A 4WNMA 3NGAA 5J8IA 3S3IA 4CCBA 4ASXA 4EC8A 3D9VA 3LE6A 4I22A 3TTIA 5AM7A 5A4QA 2G2FA 1YXVA 4RVMA 2YM7A 3CQEA 4KRDA 3FC2A 4JBVA 5D12A 4BIEA 4M69A 1UNHA 4N6ZA 4QMWA 4RIWA 4QMMA 4G1WA 3FXXA 4HGTA 2C6MA 5F95A 2HZ4A 5HNBA 2VTTA 3UTOA 4B9DA 2UW7A 3FHRA 1PKGA 4UWYA 3GENA 4YGAA 4FK6A 3QKKA 4XJ0A 3UYTA 3RKBA 4MQ2A 2F7ZE 1WVWA 5JRQA 4QP1A 4DBXA 2GFCA 2ITTA 4PTEA 1J1CA 1E9HA 4KIKB 4MX9A 4NIFA 3FMDA 5EYDA 3IDPA 3D7ZA 3ZO1A 3ZH8A 4AG8A 5ANOA 2BVAA 3OCSA 4JQ7A 3ZLXA 2J0MB 4FTIA 2HELA 1R78A 2XB7A 2BKKA 3NYOA 1ZMWA 3L8SA 4TN6A 5IQDA 4XUFA 2VGOA 3KN6A 3C0HA 4XP2A 5CAOA 2XNOA 4OUCA 4AW1A 3DBCA 3PRFA 2F9GA 5M4IA 5E9EA 5EQYA 4AZWA 1R0PA 2J0LA 1ZY5A 3EQGA 4QMSA 1MP8A 1UU8A 2B7AA 2GCDA 4FT9A 1Q97A 3DKOA 3SXRA 4APPA 2YAKA 1T46A 5LVPA 3ZUUA 4JXFA 3H4JA 3COIA 2VTPA 3PVGA 4DTKA 3OHTA 5TR6A 4XG6A 2WU6A 3IW6A 4NTTA 5IEVA 3BHVA 3G6GA 4JJRA 5CF6A 4O7WA 3C0GA 3VQUA 3SC1A 3LXLA 5HBHA 2UZWE 2F2CB 4ENYA 3W2OA 2JKKA 4O22A 3V8TA 5KO1A 3P1AA 1TQPA 5C8KA 5TO8A 3QZFA 3ZO3A 4BWKA 3F2NA 3ALOA 5HORA 3AQVA 3LQ3A 1SNXA 5HD7A 3BKBA 3BU3A 4ANSA 2XBAA 3D5UA 3V5JA 5CEPA 4KIQA 4Y83A 4QQCA 2G15A 3MB6A 5EG3A 1JKTA 3HAMA 4L68A 3ZO2A 3EWHA 3TCPA 1JOWB 4TL0A 2ETKA 5DFPA 3VW8A 3NYVA 3ZBXA 3D2IA 2XEZA 3PXRA 2WMQA 1UWHA 2B9HA 2Z7RA 3ORMA 5C8MA 3HAVA 4PWNA 4RSSA 4UEUA 4IZ7A 3AMBA 3ULZA 1PKDA 3ITZA 3ORLA 1GNGA 3PYYA 1WBVA 2C5YA 4HCVA 1IRKA 2EWAA 1FQ1B 2GNHA 1U5RA 1H0VA 3Q60A 4MXAA 4UYNA 3EQDA 2QO7A 3OVVA 2JBOA 5FM3A 3SDJA 2JC6A 3QL8A 3WARA 4HVHA 2YFXA 1H27A 3AC2A 3BV3A 5CZIA 1U54B 2J2IB 2X2LA 4V04A 3QXOA 5L4QA 3Q9XA 4C0TA 4JS8A 5ANEA 2Z02A 3R1YA 4BZDA 4UXLA 4O0YA 4L3LA 5EW9A 4YPSA 3OWLA 1Y8GA 2B9FA 4MF0A 3FQEA 3UIXA 2BZKB 3VHEA 2P2HA 2VO6A 3C0IA 4TYIA 2QLQA 3DBFA 3QC4A 5B2LA 4YJRA 4C4HA 1SVEA 4X0MA 4YLKA 2P2IA 3R9OA 1FMKA 3KC3A 4ANNA 3GT8A 4C3FA 5FG8A 3RINA 3N4UA 4C4FA 3MTLA 1CM8A 2R4BA 5KNJA 4I41A 1APME 1BLXA 2XS0A 2X7OA 4EWQA 2PY3A 2W17A 2BHEA 2JLDA 3ZZEA 2YA9A 4A7CA 3O8UA 1XHAA 2V55A 5FDXA 2Z7LA 2UZDA 4ZEGA 4AA0A 3ZUTA 2B9IA 2PVHA 3OEFX 3P4KA 2Y4IC 1ERKA 2JAMA 4S2ZA 4R8QA 2DWBA 2QODA 5HX6A 3C4XA 3SRVA 4RX5A 3ZFYA 3SW7A 2QOKA 2PZIA 2W1GA 2WB8A 4FV8A 5H2UA 5HLWA 2GMXA 4UALA 2FH9A 4FGBA 5L2TA 3LMHA 2Q83A 3TDWA 3QQFA 3KN5A 5EYMA 3T8OA 2QHNA 3QWKA 1UVRA 3RPRA 5ETIA 4LUDA 4NZWB 4C3PA 4QPSA 4PY1A 3IS5A 4CG8A 3WF8A 4FIIA 2HOGA 2OJJA 3QGYA 1WVXA 3QX2A 1GJOA 3P23A 4FKIA 3V3VA 3IOPA 1U54A 5DE2A 5JMSA 4NSTA 4EK4A 3W16A 5DEYA 4N57A 4U80A 5CU6A 3OW3A 4L8MA 1U4DA 5CNNA 5HESA 5FP6A 4LV5A 5IEXA 4JAJA 3ODZX 3R04A 3DXPA 1LUFA 3U9CA 1KUTA 4U3YA 3EJ1A 4ANQA 2QC6A 5FEEA 4HOKA 4FTRA 1BKXA 4G6NA 1S9IA 5DYJA 2HW6A 4OTQA 4RLKA 3FI3A 3COHA 3TACA 4BKJA 4E6DA 3E93A 4C35A 1ZMVA 1FPUA 4GG5A 4H3BA 5EDRA 1AD5A 2YJSA 3GC0A 4JVGA 4TWOA 2BZHB 4IB1A 2GHMA 2C6KA 2VX3A 4ZY6A 4H39A 2A0CX 1YI4A 3ORPA 3EQRA 3WF5A 1IAJA 4DLIA 3I1AA 3QGWA 4KNBA 4QQ5A 1CKIA 5M06A 2H34A 3GU6A 1KSWA 3KCFA 1WCCA 4H3QA 4I20A 4D1SA 4LRKA 4J7BA 1WAKA 2C6OA 3ZRKA 3FLYA 3ODYX 4NW6A 4FZAB 2X7GA 4IZAA 3OC1A 3LZBA 4KKHA 4U3ZA 3VS3A 4EOQA 2ETRA 3LCKA 3PJCA 4JDHA 5E1EA 3QQKA 5FM2A 3WILA 4ACGA 5AA8A 3GFWA 3POOA 4O7SA 1ZYDA 3LKMA 4NFMA 1DAYA 3G9NA 2WIPA 1ZRZA 4O7YA 2YIQA 3H9RA 5GIPE 3R8UA 1MRUA 2CNQA 2JDRA 3E63A 3TNIA 4FKQA 1H1PA 2W4KA 2RFDA 4EZ5A 1REJA 5M57A 3FBVA 3A4PA 3DJ5A 4YU2A 3IKAA 1ZZLA 5DRDA 3BX5A 4K9YA 3QXPA 4A9RA 4GU9A 4L7SA 4R7IA 1ZXEA 4IDTA 3MW1A 1IASA 5B7VA 2YCRA 3COKA 5KE0A 4K6ZA 5IQGA 4QTDA 1YOMA 4WO5A 2WOTA 5G6VA 4BCFA 5FLFA 4KS8A 1BI7A 3BZ3A 3PIXA 4G3DA 4J53A 4QYHA 4C57A 4EK6A 4CQGA 1LP4A 2YACA 2X39A 4EHEA 4EH5A 2HAKA 4C33A 3ACKA 1OUYA 1DM2A 4HVGA 4F9BA 4RX9A 2RIOA 4PPAA 3FYKX 3O17A 3OBGA 5DG5A 2Z7QA 3HVCA 4FIJA 4IB5A 4CKIA 3LW0A 2B0QA 5IF1A 4GRBA 4FYOA 4FI1A 4MBIA 1J7UA 4AAAA 1OECA 3FAAA 2QOOA 2R3MA 2CN8A 5IA4A 4IAAA 3P08A 3QU0A 4AXAA 4EQMA 2PVJA 4YZNA 2G2IA 2WU7A 2XEYA 5EOBA 3R7OA 1V0BA 2X81A 4I92A 2PE0A 5AFVA 2EB3A 4Z9LA 4C38A 4I6FA 3FLQA 3E8NA 2DUVA 4GT3A 5AJQA 3PUPA 3TV6A 2GQSA 3IW4A 3UOHA 3D5XA 5IKWA 3BE9A 3VW6A 4L42A 3LMIA 3F61A 4YSJA 5DWRA 4XBUA 2IVVA 4DLJA 3MI9A 4N4SA 4Y5HA 5F4NA 5J95A 4O0RA 3GU8A 2W05A 4YLLA 2YERA 4FZFB 3VUGA 4M12A 4MNEB 4LM5A 4FT3A 4X7QA 1UNGA 2EB2A 3OWPA 1ZAOA 3G51A 3UNKA 2WTJA 4OGRA 1BX6A 3GQIA 3OCGA 1Y57A 2BRHA 3H0YA 4FSWA 3KCKA 1V0OA 4EJ7A 4XP0A 4FV0A 3W32A 3E88A 1GIHA 5KHWA 3VBVA 4QMQA 3Q6WA 4BDJA 5EHOA 5FEQA 3PWYA 1OB3A 3HECA 4LOPA 3TJDA 4XCUA 3FZOA 3QKLA 4OTDA 5IDNA 5IMEA 3DZQA 5A9UA 1L8TA 5GJDA 4ACHA 1O9UA 1OI9A 3L9NA 4O0VA 4EOKA 3AD5A 3OOGA 4C4IA 5HVJA 3DK3A 4QMOA 3RM6A 3V5WA 2RL5A 3Q6UA 4G3GA 2W9ZB 2G9XA 4MEDA 5HEZA 4J1RA 4I21A 5L2WA 4FSUA 3VS7A 3DAJA 3V5PA 1PXKA 2VGPA 4USEA 2XKCA 1OIYA 3BRBA 3PY1A 4D4SA 2YIYA 4FE2A 3BLHA 3HV7A 3NAYA 4AUAA 3RGFA 4P4CA 4XP3A 5CENA 3DNDA 2YIXA 2VWYA 4BWPA 3BWJA 3FSFA 3CQWA 1UKIA 4MBJA 4YO4A 1J7LA 3FPQA 3FEGA 3IW5A 2P55A 3II5A 3QQUA 3U4UA 4I4FA 1U59A 3V01A 2EUFB 2ZM4A 3OCBA 3L1SA 5CU0A 3BGPA 2OF4A 3BCEA 3VS2A 3MN3A 3G0EA 2YIWA 2HK5A 5AIRA 3QZIA 5ANDA 4MNEA 3AT2A 2VD5A 2ZJWA 3HLLA 4O0UA 3WOWA 5ANGA 1DI9A 4O0TA 3HMNA 4AFEA 3RPSA 2OIQA 4DITA 3QCXA 4PL5A 2WD1A 3MA6A 2GSFA 2XH5A 4GUEA 4MD9E 4BBFA 5AUYA 3DQXA 3HDNA 4O6LA 5K0KA 5L6OA 4F6UA 4JR7A 5ETFA 5LOHA 4TYGA 3F88A 3UMWA 4XBRA 3V8WA 2BUJA 4ID7A 2ETMA 4BVUA 4HNFA 4IW0A 5CAQA 4DF3A 4LGGA 3HMOA 4PL4A 3GUBA 4JR3A 2JKMA 3QA8A 4H3PA 3TXOA 3W10A 5AR4A 4QO9A 1MUOA 4BDIA 2YEXA 5A54A 4QP9A 4XG4A 3R8PA 5I9ZA 5HTBA 1ZYJA 2ITUA 4OTHA 4R78A 3R7VA 4BDBA 4X2JA 4DCEA 3TL8A 4UXQA 1UA2A 4L52A 4F4PA 3PXYA 4BDDA 5J9ZA 3RAIA 3UIMA 5GINE 2V5QA 1XKKA 2VTMA 4O2ZA 2BAJA 4NEUA 4CFUA 5JFVA 3TV4A 3EMGA 4FKPA 5EDPA 2J9MA 3A4OX 3B2WA 4AZEA 2C6LA 4C59A 4JG8A 4Z16A 3ALNA 3IO7A 3NPCA 3MA3A 4NCTC 4FTMA 3RPOA 2UZOA 3FLWA 4N6YA 5HI2A 3S00A 5HGIA 3QHWA 3A7JA 3TWJA 2O63A 5I4NA 1XH7A 2W5AA 5TE0A 4C02A 4EC9A 1JKKA 2NPQA 3N9XA 3ZMMA 2I40A 3VJOA 4C4JA 3AOXA 5ITAA 4PL3A 4Q2AA 1H25A 2XJ2A 3KFAA 4EKLA 3FMKA 5HNGA 4G6OA 2F7EE 4BGGA 3TUDA 4I94A 3RJCA 4D9TA 5JQ8A 4EEVA 1MRVA 3FC1X 5EH0A 2QOBA 2WQEA 2W96B 5HLNA 3KREA 4I4EA 4GJ2A 4NU1A 2GDOA 3KRLA 3PG1A 4RT7A 1KE5A 5H8EA 4KBKA 3ZYAA 2VWWA 4PTGA 3CTQA 3R7UA 2W5HA 1GZ8A 3HEGA 5KHXA 4A4XA 1WBNA 4NM3A 2QLUA 4NTSA 3JYAA 2ZDUA 4CT1A 3QCQA 1OIRA 1LEWA 3QQJA 4IWQA 4X2NA 3ZDIA 2X2MA 4X21A 1P2AA 3AC1A 4BDHA 1OPKA 2WTWA 2WMRA 5A3XA 1WFCA 4D2WA 1OUKA 2V62A 3ERKA 3TI1A 1NY3A 5B2MA 3D7TB 3DKGA 4RQVA 3EN6A 4BCNA 5HG8A 2QNJA 3E8CA 3O8PA 4TKSA 2QOFA 5CALA 4AGCA 5LMKC 4O7LA 5H9BA 2QI8A 4UZHA 4FMQA 4DFLA 4I0SA 4LI5A 3W33A 5E8VA 2GPHA 2PMNX 3GFEA 4QRCA 4BTKA 5HKMA 3RCJA 4X6RA 2C6IA 3DXNA 4CMTA 2UW6A 4R7HA 5LQFA 4FYNA 2YCQA 2O3PA 4E7WA 5CI7A 4TWCA 4ACCA 4PPBA 1ND4A 4G3FA 3A61A 3O51A 4MK0A 5KMNA 3ZSGA 3Q2MA 5AP6A 4E73A 2IJMA 2ITPA 3SW4A 4PRJA 4ANBA 4JI9A 4RC4A 5GZ9A 2WMVA 2PSQA 3P0MA 3C13A 5GZAA 3E7OA
chains in the Genus database with same CATH superfamily
1KOAA 3FMJA 4LOQA 4O1PA 2QONA 5FRIA 2C5VA 1A48A 3HP5A 1ZLTA 3CSVA 3Q4UA 4AZVA 2R3PA 2ITQA 4NM0A 5LARA 3GGFA 4OBOA 4PMSA 2NP8A 3FLSA 1HCKA 3B8RA 3P79A 1CSNA 4BIBA 4DG0E 5EM7A 2OBJA 4WG4A 5DMZA 3G5DA 4C34A 2AC5A 2JGZA 3NRMA 4Y8DA 2YM8A 3ANRA 4AN2A 3S2PA 3PDTA 4QP8A 5GZ8A 3SHEA 5A14A 1G5SA 3UMXA 2IZSA 5IZFA 3R9RA 5AR8A 3F5PA 3KRJA 3HMIA 4TYHA 5DEWA 4BICA 2ITZA 5CVGA 4FNXA 4I5PA 3UG2A 3UOLA 2GS6A 3D7TA 1YI6A 4DDIA 5DI1A 2VWIA 2B52A 4MXCA 4FT0A 3QWJA 4AS0A 2C68A 1YKRA 2OFVA 3CTJA 4ZSEA 2IW8A 3VS6A 2W1IA 5ANJA 2CNUA 4ZSLA 2BRNA 3EL8A 3HUCA 4CFFA 3C51A 3ZFMA 1YWVA 2QQ7A 3QRIA 3IGGA 1OGYA 3ENMA 4BTJA 2OG8A 2BIKB 3ZEPA 3FXWA 4FSMA 4RVTA 2XK7A 3PTGA 2XBJA 4QMTA 4Y85A 5FQDC 2QOLA 1PXLA 3BGQA 4EK3A 3C4WA 5E8XA 4V01A 3FDNA 3BEGA 2Y7JA 3QLGA 3IDCA 4EK5A 4BTMA 3OUNB 5CEOA 5JQ5A 3KA0A 5KMIA 2XM8A 5JZJA 4BCOA 5AP4A 2YZLA 3MJ2A 4UMTA 3Q4TA 3OBJA 4YBKA 2RGPA 5AP1A 3TN8A 2UW8A 4FOBA 5AP0A 3CTHA 3GC9A 3T9IA 1VEBA 3R9NA 1W83A 4GCJA 3NFGB 4D2SA 3R0TA 2YDIA 4OTPA 4DE4A 5IA3A 5LMBA 2NYAA 3HMMA 3EFLA 4K1BA 2X0GA 5L2QA 3E3BX 3HDMA 4E4XA 4NFNA 4O7RA 4QMYA 1O6LA 3GEQA 4L67A 4FUXA 3M2WA 3R8ZA 3R02A 4HZRA 4O4BB 4EHVA 3F3TA 5DLSA 1FGIA 2PWLA 2ZV2A 3V5QA 2CCHA 3C4ZA 3W1FA 3MTFA 4CRLA 4G17A 3T9TA 3UVPA 4RX7A 3FPMA 3FZSA 4OTWA 4MXXA 4ZY4A 4AQKA 4U45A 4EWHA 3S1HA 3MB7A 1OPLA 3FYJX 3CC6A 2C3JA 5JGDA 3JPVA 4DHZA 5IPJA 2BRBA 3KF7A 3HGKA 2X7FA 3MSSA 4XRJA 4A07A 2W0JA 5C4LA 4G6LA 4QMVA 4L46A 2AC3A 4KWPA 1Y91A 4D5KA 3UIBA 1JKSA 2Q0NA 4TT7A 1M7QA 2W9FB 3FWQA 4X2FA 3HMPA 4G3CA 4EI4A 5J1VA 3TZ9A 2PVLA 3R7EA 3PJ3A 4JDJA 2F7XE 5HICA 2OKRA 2OLCA 1GZOA 3ORKA 4IC8A 4BRXA 4FZ7A 5C03A 2R7BA 3FKOA 3R8MA 1H1WA 3KVXA 4S31A 3G2FA 2JBPA 2YWVA 3DA6A 2XJ0A 4EJNA 4WRSA 5AR2A 4CLJA 1H1QA 4FSTA 2A27A 3RHKA 4AN3A 1IR3A 4JBQA 4RIYB 2CNVA 2QD9A 5CLPA 2VWBA 4FKWA 5LVMA 3O2MA 4O0XA 3QRTA 1IEPA 2VZ6A 4ARKA 2C3LA 5ANIA 3RI1A 1YXSA 2OO8X 3VN9A 2E2BA 3EFWA 2NRYA 3NIEA 4AT3A 4F65A 3DAEA 2XCHA 4QQTA 4F0GA 3RNIA 4W9WA 3NFFB 5DR9A 5EM8A 4IE9A 3EB0A 3O8TA 1QCFA 1CKJA 3PVBA 2XNNA 4DH5A 3N4VA 4O82A 1A9UA 2JEDA 4FKLA 4E6QA 1Z57A 3E5AA 2BROA 1R0EA 3ORNA 5TT7A 3CLYA 2YCFA 5J9LA 3H10A 3NYNA 2VTLA 3F5UA 3SAYA 5FEDA 4AXEA 2CN5A 4E8AA 4I5HA 2CJMA 4IM0A 4YNOA 5CEMA 4KSQA 5HLPA 4BL1A 3UQCA 3QTRA 3R30A 4FEVA 2V0DA 3WIGA 3MJ1A 5K9IA 3I6WA 5CF5A 5KMKA 2PUNA 2GHGA 2WEVA 3QTUA 4CMUA 3RNYA 4L00A 1WBPA 1H1RA 1KOBA 5BMMA 2XK3A 2GNFA 1WZYA 5I9WA 3QBNA 2Z60A 4QTEA 4F09A 2P4IA 2WMXA 4W4YA 4EUTA 4EOPA 4ERWA 4ZSAA 4E6AA 4YJNA 5IQCA 3HP2A 4M84A 2BZIB 4L6QA 2O64A 4Y46A 2WMUA 4RIYA 4TXCA 4RWKA 2NO3A 2W1EA 2A4LA 2GU8A 2PVNA 2W1HA 3LXNA 4IJ9A 4YJOA 4YR8A 2UV2A 3MY0A 4KA3A 3THBA 2J0JA 3U54A 2XRWA 4G16A 3KXZA 2XIRA 3F3UA 3I7BA 3PXQA 4IAKA 3W8QA 3O50A 4FIEA 3VUHA 2I0VA 4C61A 2KTYA 2R3FA 4DEIA 3NMUF 4V05A 3HYHA 3OROA 1SZMA 2XA4A 2CCIA 5T68A 2ZOQA 3PUFC 4RFZA 2XKEA 1HCLA 5B2KA 3WYXA 4Q9ZA 4O7ZA 5HG7A 3L9PA 2UZEA 2NRUA 3UG1A 4F99A 3QUDA 2ZV9A 5CU2A 3G33A 4FV7A 3SOCA 1EH4A 4AWIA 2WQNA 5J1WA 3ZEWA 5IG1A 3T3VA 3Q3BA 3DDQA 4DFUA 3T3UA 4KKGA 2PK9A 5IH4A 4JDIA 1NA7A 3OG7A 4U9AA 2C5OA 4XYFA 4HYHA 3SRVB 4CKJA 4GKHA 4FV6A 5C01A 4DEBA 4B8LA 4JIKA 3R83A 4UMQA 1PYXA 4YSMA 2OZOA 3DLZA 4DN5A 3TUBA 4M67A 2R0UA 1OL6A 2W1FA 3HRFA 4AT5A 4EK8A 2JITA 2OJIA 3FQHA 3N51A 4RFMA 1G8AA 2PMIA 4K18A 5TKDA 3REPA 4S34A 5I9YA 1BMKA 2W4JA 4PDSA 4DTAA 5AUUA 4FEWA 5CXHA 3VRZA 5IUGA 4Q9SA 4QQJA 3FHIA 3FV8A 4FVQA 5AEPA 5J79A 5DBXA 2BDJA 2IN6A 2Y8OA 1ZWSA 4FV2A 2QURA 3Q04A 1H28A 1KWPA 1YI3A 1W82A 4Y73A 4IAYA 5DNRA 1PXIA 4MF1A 2YISA 4BTFA 1W7HA 4ZS0A 3VBYA 1Z9XA 1PRYA 2PYWA 4Z7HA 3DK7A 4LUEA 4OTFA 5I9UA 5I9XA 5CAUA 3CQUA 4RC3A 4AGWA 4EH6A 2J0KA 3AD4A 4J95A 1JSVA 3E8EA 2VX1A 3NCGA 3BYSA 3OF0A 4ACMA 5DN3A 3TZ7A 3PZHA 3OD6X 2OH0E 4IZ5A 4KABA 3JXWA 4LL0A 2FO0A 4ZTMA 5JFWA 5CF4A 4DCAA 4OT5A 4BYIA 1FBNA 4AZSA 3VUIA 3V6RA 4CCUA 1AGWA 2IVUA 4GL9A 5FXSA 4ZZMA 3OXZA 4U42A 4MQ1A 4F7NA 3DBQA 2F49A 4XH6A 2XRUA 2G01A 3R01A 3HNGA 1HOWA 3H3CA 4R7BA 2A98A 4O4CA 4E4LA 3MVLA 4TYJA 4DHJA 2YM6A 5AR7A 4YJPA 3M11A 3OFMA 3PLSA 4CTBA 4EONA 3CJGA 3HV3A 1P4OA 2PVRA 5E8ZA 5TF9A 2W06A 2BRGA 5D11A 2GNIA 3QD2B 1P4FA 3ROYA 3P7AA 1OKWA 3FLZA 5E8WA 2VRXA 2XIKA 4J8NA 4A06A 3I0QA 3LPBA 4GFMA 4YZBA 1G8SA 4BDFA 5D7VA 3PJ1A 2DS1A 2H6DA 4I5MA 3ANQA 4A9UA 5HD4A 3CY3A 3ZUVA 1QPJA 4GEOA 4UWCA 3H30A 4X2KA 4ASZA 4IX4A 4C2WA 2BAKA 3IPHA 3HA8A 4E5AX 4LV7A 3AC8A 4YJSA 3CGOA 2I0HA 3BYVA 3LJ0A 4U8ZA 1H0WA 3OS3A 2FA2A 5CI6A 5EKOA 2F2UA 3CEKA 4HCUA 4DH1A 4BHZA 4YJQA 2IVTA 2R3RA 2PMOX 3NR9A 3UYSA 3R7IA 3ENHA 1JAMA 1OMWA 3AGLA 3UOKA 4BDAA 4C7TA 5KBQA 1OIUA 5EOLA 5KMLA 2CGWA 4LV8A 4DGMA 1OKZA 3UPXA 2J5EA 4DTBA 2EXMA 2VTSA 3FZRA 4IXPA 4BYJA 3UQFA 4O84A 3PXFA 4R3PA 5LCKA 5K4IA 3FI8A 4G3EA 2VNYA 4G34A 3UZTA 4FSYA 1CMKE 2HY81 1ZYSA 4Z3VA 2UW3A 2EXCX 4GK2A 2R5TA 3EQBA 4M3QA 2VUWA 5AV1A 4ALUA 2C0IA 3DXQA 4YO6A 3VQHA 3PJ2A 1PYEA 4HJOA 4FNYA 4FZDB 3TDVA 3D2KA 4GG7A 3G0FA 5F1ZA 4F9WA 4FL3A 2CGXA 4IWOA 5D1JA 3JR1A 5AADA 2FB8A 2ITNA 4ITJA 2UZVA 3IG7A 3ORIA 2VTJA 3MFSA 1AQ1A 4M0ZA 3WZEA 3EHAA 4LGHA 5HE3A 5L6WL 3WZDA 3RAHA 3UVRA 4EQCA 4PDYA 3VHKA 5K5XA 1Q8ZA 2FYSA 3C4EA 3VNTA 4JIAA 4NWMA 4WRGA 2PUIA 1B6CB 3KU2A 2IW9A 2IWIA 5L3AA 5M4UA 1MRYA 1VR2A 3DZOA 1DS5A 1PXOA 3LFDA 5CNOA 4BDKA 3KRXA 4P90A 3AD6A 4FTKA 3KRRA 1OBDA 4QP7A 4ZLZA 4RX8A 3GCPA 4WSQA 3CE3A 3I4BA 3RZFA 3VUKA 4LL5A 4BKZA 1RDQE 1NVSA 1KE9A 2IVSA 3OUKA 4TPTA 5IA5A 3QD3A 3LQ8A 3PSCA 4A9YA 4BDGA 4CSVA 3W0SA 5J87A 3NW7A 4MWHA 4RLLA 3MVMA 1UU7A 1JKLA 2OU7A 3VWAA 4ZJJA 3ZDUA 4F64A 3U6IA 4MKCA 5L8KA 3SGCA 4I3ZA 3D14A 1JWHA 1URWA 4QD6A 1UNLA 5DIAA 4MXOA 3I81A 3VUMA 4C4GA 2YJRA 5BMSA 3MY5A 1YXTA 4PPCA 2PE2A 4U43A 5BVOA 5HE2A 3BQRA 4GKIA 4FKTA 3GXLA 4IMYA 1R1WA 3GOPA 1H01A 4NCTA 4R5YA 3NNWA 2JFMA 5AUXA 5AA9A 3LCDA 3E7VA 3FLNC 4FVPA 1GIIA 1YVJA 2BMCA 5GJFA 5HQ0A 3R71A 3VBXA 4APCA 2UVZA 2H8HA 4TNBA 4EOLA 4C37A 4BCMA 2QOQA 3ZCLA 5M56A 3ZSHA 5A4EA 4CNHA 4ZTQA 2JD5A 4KBCA 2IG7A 1SM2A 3LLAA 2FUMA 3FL5A 2OIDA 4E26A 4EYMA 4PNIA 5KKRC 1DAWA 3DKFA 4FIFA 3WZJA 5DOSA 5DVRA 1G3NA 1REKA 5HNIX 4E5BA 5CVHA 3OT3A 2Z7SA 5CSVA 5F94A 4WHZA 2RFSA 3BBWA 2V7AA 4L43A 3VBWA 4NT4A 4O2PA 4Y5QA 4RIXB 2GTMA 1UU9A 4ZZOA 4LYNA 5JH6A 2W99B 3GVUA 2GQGA 3A60A 5EQEA 3CD3A 4XG3A 5FUTA 5C26A 2RSVA 2R0IA 2VNWA 3F3VA 5K3YA 4ZK5A 3U51A 2FGIA 4IC7A 4E3CA 5KUPA 1RJBA 2YLEA 4GK3A 5CT7A 4DHFA 4ZS4A 5HBEA 2Y0AA 4O7VA 5FWKK 2XKDA 1PMEA 4AF3A 3GCSA 2I0YA 2IW6A 1PF8A 1QPDA 4HPUE 5LMKA 3RM7A 4KBAA 2VTRA 4CFWA 4F7JA 4J71A 4K77A 4I93A 4BDEA 4DEHA 4P7EA 5T6KA 3R9DA 3FMEA 2E9NA 4AA4A 4D2TA 2R3GA 4AXFA 2X6EA 3KY2A 4EH4A 2W1CA 2JKQA 4M66A 3JS2A 4J97A 3ETAA 3GP0A 3ZXTA 3Q5IA 3AKJA 3EH9A 3PIYA 4JNWA 3EL7A 4OLIA 3W18A 2C6EA 5M55A 3PVWA 5IQIA 2J7TA 3BIZA 1CTPE 4PMPA 3UDZA 2R3QA 3R8LA 2WHBA 4R1YA 1K9AA 2V7OA 3BLAA 5CT0A 5EHYA 1Q24A 5D7AA 2VTIA 5JK3A 3EKNA 1RQQA 2CMWA 5AV3A 2BDWA 5F9EA 3FL4A 3A2CA 3FE3A 4JQEA 4D1XA 5CAPA 1W84A 2YAAA 5D41A 3QTZA 5HG9A 3ZONA 4GW8A 3TT0A 4CD0A 3OY1A 5A6OA 2CKQA 4RIXA 3W2SA 4BI2A 4I6LA 3F66A 2B1PA 4FTNA 2CLQA 1GZKA 2C0OA 3MPMA 3OTUA 4Y95A 4CEGA 4IANA 4E4NA 1TVOA 4FEUA 2C4GA 3K5UA 3UO5A 1XO2B 2ZVAA 5HIBA 3CBLA 3GC7A 4GYIA 1SNUA 2QO2A 4EKKA 3DTWA 3SG9A 2HYYA 4AAYA 3IW7A 5DT0A 5A46A 4I5CA 3PXZA 1BYGA 1W2FA 3MIYA 3Q96A 1NT2A 3NLBA 5AV0A 4PTCA 2ZV8A 4FJVA 3VJNA 1XWSA 1M2PA 1OL2A 3PWDA 2X2KA 4U40A 4C58A 4BR3A 4JT3A 4F70A 4L3JA 4BGQA 2C6TA 4MBLA 3NUPA 1GAGA 3LM5A 2WTCA 5CQUA 5IQBA 2PZYA 4U79A 4HYSA 4ANLA 3UIUA 2VTAA 2W7XA 2E9OA 2JDSA 4LFIA 4BF2A 3PJ8A 3P5JC 2VO3A 3MVHA 4D4VA 2W1DA 3LOKA 4J52A 4IM2A 1WMKA 1UV5A 5FBNC 5L8LA 2YIRA 1NW1A 4F1MA 4I0RA 2JDVA 4MXZA 3W0RA 4MAOA 2WTVA 3ZS5A 3HV6A 3QCSA 3V5TA 3WYYA 5AMNA 3EQPA 4DEEA 3BL7A 2O65A 4HCTA 2PVYA 4UV0A 4BN1A 5CAVA 4H58A 4IBMA 4XV1A 1OPJA 3V6SA 3RP9A 5M4FA 3BE2A 1Q4LA 1ZOHA 3I6UA 3K2LA 3AT4A 3SQQA 4QYGA 4D2RA 2XNBA 4IVDA 2JIUA 4P5QA 5DT4A 1XH9A 3EN4A 4DGLC 5AUTA 4F9AA 4I6HA 4FSNA 3MYGA 3QZGA 5J5TA 4G2FA 2P0CA 2UW5A 1JVPP 3GNIB 5FDPA 4GYGA 2XK6A 5HCYA 1YW2A 2O8YA 2UZTA 3AXWA 1JLUE 3RALA 5JSMA 2QG5A 5EW8A 4PUZA 2VU3A 4ASEA 2OSCA 4I24A 5JZNA 3HRBA 4BI1A 5CZHA 2QKRA 3D4QA 3L8VA 2O2UA 2GHLA 3R6XA 4XV2A 4WBOA 5HG5A 3TKHA 3D94A 4TWPA 3RK7A 2X9FA 5CU4A 3DBDA 5LWNA 3SA0A 3PG3A 2ITXA 3PRIA 5FP5A 5J7HA 4H1JA 4KINA 3MV5A 2OZAA 3DB6A 4N70A 4NJDA 1YDTE 2HZNA 4X6QC 4FT7A 4EOJA 4DFXE 4AN9A 5BV3A 1GIJA 5IQAA 3TV7A 5HIDA 3NIZA 4P5ZA 3FY2A 1ST4A 3R21A 2W5BA 3BHUA 4TYHB 3E87A 1QPEA 3POZA 3CCNA 4P2KA 4ZTRA 4K2RA 4YNEA 4L44A 4BCHA 4U5JA 2HW7A 4NW5A 4ZJIA 1BL6A 3KXXA 1ZMUA 4X3FA 4MNFA 4O7NA 3E62A 3I7CA 2O5KA 3Q5ZA 4BCQA 4DH7A 4QDEA 3F2AA 2QR7A 4BWXA 4L9IA 5C8NA 5HE1A 3BLRA 4PX6A 1NVQA 3OWJA 2JDTA 5E8YA 1PMVA 4FTQA 4DGOA 2SRCA 3CXWA 4ZMEA 3AG9A 5K0XA 4BCKA 5HZNA 4IZYA 4YUQA 2WFYA 1OVEA 3A8WA 3CS9A 4L53A 1W98A 4O38A 3AC5A 4U97A 1W8CA 3RZBA 4FGRA 3PP1A 5AAEA 1WBTA 5GIOE 4UX9A 3R2BA 2QKWB 2WOUA 3QD4A 4FOCA 3GC8A 3AT3A 2BZJA 4QPAA 4FKGA 3N4TA 1KV1A 3TIZA 1Q41A 2BILB 2VWZA 3TUCA 4BJJB 4F1TA 2ITVA 4QMPA 2E9PA 5JKGA 5L6PA 4D58A 1NXKA 4RMZA 2W1ZA 4JG7A 5CASA 1J7IA 3MH3A 2E9VA 2W4OA 4L01A 4QMZA 3Q9WA 5HHWA 1Q8YA 5ETAA 4LGDA 5H8BA 4KIPA 4D55A 3GCVA 3F82A 3D83A 5CWZA 4FT5A 4QMNA 2XNGA 4QMLA 2REIA 3KRWA 3IW8A 1JQHA 3LFAA 1R39A 3NUXA 3ZLWA 3VBQA 5BQ0A 4W4VA 3JVRA 4HGEA 4I23A 5J9YA 1UWJA 3JY0A 1M7NA 4FTOA 4YMJA 3BYUA 3O7LB 1R3CA 2WPAA 4C62A 3FJQE 3C5IA 1K2PA 3LXPA 2XK9A 1Y6BA 3UDTA 1YQJA 3KMMA 2WKMA 3IGOA 4EHZA 2ACXA 3KKVA 3E3PA 4LMUA 5DR2A 1ATPE 4H05A 4MH7A 4S30A 2CSNA 3BV2A 3FKNA 3Q2JA 3SOAA 5AP2A 3L8XA 2YCSA 3GBZA 4QOXA 3RK5A 4JMQA 4BY9E 1ZYLA 3A7FA 4FIGA 2PZ5A 3MGYA 3LXKA 3NNXA 4J8MA 4RJ4A 5CVFA 5CQWA 3QUPA 4D0XA 2QOIA 3ATSA 1H8FA 4IFCA 3UPZA 1URCA 1I09A 4CFNA 3FQSA 4GU6A 3P78A 4TTHB 4V0GB 2WEIA 4EH7A 4WIHA 4FTAA 3U87A 4O83A 4BJJA 4CV9A 4UB7A 2J0IA 1KE6A 5IUHA 4DT8A 1PXJA 4FTTA 4ENXA 4GVJA 3BU6A 2OH4A 3F3WA 4O7TA 2GNJA 4QTCA 4PP7A 3QUEA 2YDJA 3MPTA 2UW9A 3DS6A 3A99A 3ZZWA 4BFMA 4BHNA 4EBWA 5AX9A 4F0FA 1XH6A 4JOAA 5J7BA 4GIHA 2Y4IB 4NM5A 5LVLA 3RHXA 3RPYA 4MXYA 4E1ZA 4KUJA 5HVYA 2WAJA 5E91A 3FUPA 5FBOA 1XMLA 4NKSA 1LPUA 1KV2A 5BVKA 3FMNA 4R77A 2OXDA 2R3HA 1YRPA 4HYIA 1XH8A 3LIJA 3BL9A 4S32A 4RWLA 4FNWA 5KMJA 5BNJA 4FKOA 3OW4A 2WMWA 3GOKA 3LFEA 1SYKA 4GT5A 4FVRA 5AM6A 3RWPA 2CKOA 1MQ4A 2OGVA 4FBXA 3NX8A 4XRLA 4O0SA 3FY0A 3PSDA 4Y72A 5I3OA 4BIDA 2J90A 4AE9A 5IQEA 5HIEA 3C4CA 5IQHA 1OL5A 2KULA 3OY3A 5M44A 4EOOA 4RVLA 3LFNA 4QYEA 3ZU7A 2OI4X 4QMXA 4R6VA 4M7IA 4A9TA 1Y6AA 3CR0A 2FSOX 4MVFA 3PZEA 1W0XC 3QTXA 2WMBA 2YLFA 3W55A 1VZOA 3PA3A 3P5KA 4TZRA 4XEYA 4ANOA 4EORA 2QU5A 1MQBA 3JVSA 2O0UA 4RA5A 4X3FC 3LFFA 3LJ1A 3LAUA 5HTIA 4KS7A 3OEZA 4J98A 4CYIA 3LM0A 1BI8A 1CKPA 4ZLOA 4V0GA 3ZC5A 4W8DA 3UQGA 3LFCA 4JQ8A 4O91A 1QL6A 3MS9A 3UP2A 3TMOA 2XCKA 3ZBFA 2X0QA 3DFAA 2WQOA 2CKEA 4GUBA 3PIZA 3VAPA 4XOYA 1GOLA 4R3RA 3R22A 4WA9A 4ZP5A 2VTHA 5M07A 3JY9A 3WF9A 5J5SA 5FTGA 3M1SA 4IQ6A 5FTOA 2QR8A 4DG3E 3K3IA 4U6RA 4OT6A 1FVTA 4I6QA 4UWBA 3QYWA 3SXSA 4DGGA 3MVJA 2Y9QA 3E8DA 4BC6A 2ZMCA 3DJ7A 5C1QB 3FKLA 2GS7A 4GT4A 3G90X 2WNTA 3EQFA 4GK4A 3RPVA 4QYFA 3K54A 4J99A 1KE8A 1DI8A 2IZUA 1PW2A 3E64A 5CXZA 4USFA 4J96A 5HBJA 4FSQA 1OGUA 2H9VA 5EM6A 2OXXA 4CT2A 3VS5A 4A4OA 3MPAA 4BGHA 4IADA 4XS2A 4FV9A 5EKNA 4FV4A 2C3KA 4XV9A 2R3IA 1XBBA 4DFBA 2B4SB 5FXQA 4AOIA 3EZVA 4PMTA 3NYXA 2AYPA 3W0MA 4WT6A 3QAME 3AMYA 5DRBA 3UO6A 1GZNA 4AOTA 5BVDA 2ERKA 2WO6A 5JFXA 2C47A 3BHYA 5DT3A 3H0ZA 5E90A 4PNKA 3DBEA 1Q8TA 1Q62A 3KF4A 3WE8A 4CVAA 5AWMA 3SKCA 3AC3A 4CMOA 4FL1A 5AP5A 5HCZA 3KL8A 4E5WA 4AP7A 3QLFA 4YTHA 5EW3A 4RQKA 2DQ7X 3EKKA 4R1VA 2BPMA 4DAWA 2YITA 2ZV7A 3PE1A 3IK3A 3VUTA 2LAVA 4YTFA 1H24A 3F5GA 3HL7A 3KIOC 2Y6OA 3R1QA 4H1MA 4FR4A 2I0EA 4EH2A 4JBPA 2DYLA 3NEWA 5TOZA 2PZRA 3LMGA 3WIKA 2FVDA 4YTIA 5I9VA 5KKRB 1O6YA 2R3LA 3VF8A 4IH8A 4HVDA 3WZKA 4JG6A 2BRMA 2ZM3A 5EI6A 4RJ7A 2OJ9A 2PE1A 3KEXA 2ZB0A 4O1OA 5H8GA 2XK8A 4IFGA 4IB0A 3TZ8A 3QX4A 2QOCA 3TNHA 1ZARA 2QVSE 3QALE 5BX0A 2R64A 3TYKA 2BFXA 3QQGA 4AGUA 4WNOA 4G5JA 4OAVB 4IAIA 5K4JA 2CLXA 3B2TA 4M97A 3TZMA 5A4LA 5HTCA 2BKZA 4EOMA 4FODA 3DNEA 3LLTA 3NW6A 2OK1A 2G1TA 4I0TA 3QC9A 4EOSA 1SMHA 1M2QA 5G1XA 3JUHA 3SV0A 4ZJVA 3V5LA 2P33A 2WTKC 3HRCA 4QP3A 2ZB1A 2BTRA 2X8EA 3PY0A 1QPCA 2XZSA 4ZY5A 3K3JA 5ACBC 3Q32A 3NNVA 5IA1A 5KCVA 4OTGA 4YZ9A 3D5VA 4EH8A 3FI2A 3MH0A 2ONLA 2IZTA 4MCVA 1T45A 2RFEA 3PE2A 3TNQB 5KMOA 2UW4A 4RWIA 4KIKA 3TKIA 4DEAA 2XKFA 4JRVA 5CANA 2VN9A 3DFCB 4YZMA 3S4QA 4JRNA 1YDSE 4OBPA 4PQNA 4QYYA 5LMAA 2BR1A 3U6HA 3U6JA 5EDQA 3PPZA 3R00A 3BHHA 5KZ0A 3EQIA 4PF4A 3F9NA 4HYUA 4BZOA 1P5EA 4WSYA 1M2RA 1IA9A 4FC0A 3VS0A 4RJ8A 4NH1A 3ZFXA 3EQCA 2G2HA 1H07A 4U7ZA 5C4KA 4AA5A 5A6NA 4AQCA 3PA4A 3ZLYA 5GJGA 2GS2A 3BI6A 3P7CA 3C1XA 4FV1A 2JAVA 4CKRA 3BBTB 2I1MA 5EHLA 3F7WA 1JSTA 2PVFA 3ET7A 4YHJA 5M09A 4EH3A 1OBGA 1LEZA 5BUJA 4RFYA 2I7QA 3MWUA 2RG5A 5CEIA 4EBVA 2BDFA 5ETCA 1V1KA 4EZ7A 3UZRA 3R73A 2B53A 4FG8A 3RTPA 4ACDA 4DEGA 3UBDA 2C0TA 4DC2A 3MDYA 5L8JA 1B39A 4LOOA 3OTVA 2EU9A 1YXUA 2VV9A 1F0QA 3ROCA 1ZOGA 2XNMA 3O23A 4QTAA 3WE4A 3FSKA 2PULA 4K8AA 4FTJA 3WZUA 4F1OA 3KXNA 4OTRA 4GIIA 2XVDA 5IEYA 3MESA 2X9EA 3LJ2A 3VBTA 3SX9A 4DFZE 5CF8A 4G9RA 4JX7A 1YWNA 4W4XA 3EZRA 3LVPA 1IAHA 3NW5A 2FSLX 3NUUA 5EI2A 3TNWA 4RVKA 5CU3A 5E8SA 2PHKA 4YHTA 5DH3A 4O21A 4FTUA 1SVGA 2XIYA 2XNEA 2B55A 4USDA 3SD0A 4PDPA 4D1ZA 4YC8A 4YJTA 2BAQA 4O96A 5BUIA 5AV4A 5IH5A 2PU8A 4ZLYA 5DPVA 5E1SA 3LFBA 4ZZNA 5IUIA 3BGZA 1ZYCA 4D4YA 5KZIA 1OM1A 2XIZA 3CP9A 3S95A 2OF2A 4FUYA 2XYNA 2VAGA 2XJ1A 4F0IA 3UC3A 2IPXA 3C5UA 1H00A 4GVAA 3EFJA 2WQBA 2OWBA 4LRJA 3ZTXA 4QT1A 2QCSA 3UNJA 2XNPA 4NYEA 4FIHA 4YZDA 3FXZA 5HVKA 2J5FA 1M17A 3AC4A 1PY5A 4QMUA 4ZTLA 2X4FA 1Y8YA 2Z8CA 4BCGA 3C4FA 4O86A 1WVYA 5ANKA 4U44A 4CG9A 3MBLA