1OKYA

Structure of human pdk1 kinase domain in complex with staurosporine
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
288
structure length
281
Chain Sequence
PQPRKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSPANFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEYLIFQKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTPPKLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords 3-PHOSPHOINOSITIDE DEPENDENT PROTEIN KINASE 1
publication title Structural Basis for Ucn-01 (7-Hydroxystaurosporine) Specificity and Pdk1 (3-Phosphoinositide-Dependent Protein Kinase-1) Inhibition
pubmed doi rcsb
source organism Homo sapiens
total genus 84
structure length 281
sequence length 288
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2003-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1okyA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1okyA02
2R9SA 3PP0A 5HCXA 4C3PA 2VTNA 4MTAA 4KWPA 3P0MA 3LMIA 4MEDA 4F6SA 3W33A 1KUTA 4W8EA 2IJMA 2WNTA 4FKQA 4BICA 2ESMA 5KMIA 4QQCA 3MIYA 4QRCA 2C6KA 3PVUA 4I0TA 4IWPA 4XUFA 1WBSA 1ZLTA 2OW3A 4CV8A 4F64A 1WVXA 3EMGA 2V22A 3FLZA 3NYNA 1WVWA 4FVPA 2WQMA 4B99A 5BYYA 3KREA 4FT7A 4RPVA 2JGZA 4CZTA 1OI9A 3HA8A 4E6DA 5KUPA 3V04A 4U6RA 2XYUA 4M15A 2EB3A 4LGHA 4QPMA 3BLHA 1UNGA 4PP9A 4XG7A 3PUPA 5HKMA 1GY3A 2VX3A 4M97A 5I3RA 3FZTA 4HYSA 3NRMA 4BCJA 2P55A 5EQPA 4QOXA 4RIYB 3R7GA 4PY1A 4FL3A 3TJDA 4FC0A 2X9FA 4L3PA 2WXVA 4UZHA 2W4JA 4PL5A 1Q5KA 2O64A 3LXNA 5HBEA 1KOAA 4FSWA 4UYAA 3W1FA 3W2QA 2G15A 2JEDA 4FKVA 3V6RA 4IB0A 2RFSA 4K1BA 2CHLA 4O2PA 4YBKA 3H9FA 2UW7A 4M0YA 5K5XA 3UYTA 4AW1A 1T45A 5AJQA 3D5VA 5HIBA 4JR3A 4O82A 2YZAA 3UMWA 3SC1A 5HG7A 5ETFA 3VS4A 1Q8YA 1H28A 2HK5A 2JDRA 4ACMA 1YHVA 4ACCA 1H25A 2HZ0A 3CXWA 4KIQA 4E4NA 3DQWA 2C6OA 3KF4A 3SW4A 4QMQA 3KCFA 4CYJA 5C8KA 3CQUA 4WRSA 3TUDA 4CEGA 3GCPA 5A54A 4PQNA 2NP8A 4QTDA 4NFMA 2QNJA 3FMLA 2BMCA 3FZSA 4FVRA 5D7VA 5CEOA 4K9YA 5EYCA 1YRPA 3CY2A 3EL8A 1F3MC 4D2RA 1M7QA 2PK9A 4DTBA 3JVRA 4K77A 5M4IA 1NW1A 2ETMA 4I1ZA 4G17A 2PVNA 2YITA 4ERKA 2PVHA 2W5AA 2ITWA 3O50A 4A9YA 2BAJA 3V8SA 1SYKA 3DPKA 4LMNA 1KSWA 3KXNA 3OEFX 3R6XA 4Q5HA 5KMOA 4PNKA 4UYNA 2OWBA 2YM8A 4FTKA 3MYGA 5ANGA 5HLWA 3DDQA 5ANIA 4WSQA 4OUCA 2J5FA 3CTHA 3A4OX 2Q0NA 4M7IA 1UNLA 3NEWA 2JC6A 4HOKA 1MRYA 3VRYA 4JG7A 5T3QA 1Q4LA 1UKIA 5AP7A 3TIYA 2UW4A 4QQJA 4FGBA 3VBQA 3N4VA 4O7YA 4FEUA 3RINA 4YSJA 3TKUA 1PXMA 2B52A 2VTHA 3TT0A 4EKLA 3DBFA 4NWMA 4E20A 1PMNA 3Q96A 5LWNA 4OBPA 2XK3A 4S32A 3LOKA 2VRXA 3VUIA 3DS6A 1A9UA 2CGVA 1U54A 3I6WA 2H8HA 2R3HA 4FMQA 4FYOA 2XK7A 4IH8A 5B7VA 1ZWSA 1BI8A 3KCKA 4BF2A 5E4HA 3D94A 2B7AA 2UW3A 3TDVA 1ATPE 4RVLA 4L67A 1CM8A 5IZFA 4FV1A 3JUHA 2Z7QA 1W0XC 1LEWA 2JITA 2HXQA 4RVMA 4CQGA 4CT2A 5HORA 1QPDA 4UX9A 4Z3VA 3D7TA 4FEWA 3LKMA 4F09A 2UW0A 4HGTA 4UZDA 3WBLA 1NVRA 1YXVA 3F5PA 4FV4A 5AV2A 5CF6A 4U3ZA 3ZSHA 5CAQA 2PL0A 2XNOA 3QGYA 5HX8A 4FZAB 3P08A 4GIIA 3C4WA 4W8DA 4EH6A 2XEZA 4U79A 3EQPA 3H4JA 4V0GA 2VTRA 2QU6A 4D5KA 4D2WA 4BBEA 5A4QA 3LJ0A 2OZOA 4X3FB 3DA6A 1BX6A 4ZJIA 4OAUC 2Y4PA 3ULZA 3ZRLA 5JFWA 1VZOA 5CLPA 4O38A 1ZY5A 2ACXA 4BTFA 1H1RA 4YC8A 4CV9A 3P7AA 2DQ7X 3QRIA 2OU7A 2CGXA 2IN6A 4FKLA 4X2NA 3GNIB 3W2PA 4U45A 3TACA 3PP1A 5HTCA 5GNKA 2ERZE 2W05A 5BUEA 4MCVA 2OZAA 3BU6A 5AUVA 3E92A 3QUEA 4OT6A 3V5QA 1OL6A 5CYIA 3KULA 3E3BX 4Z7HA 3CGOA 4OLIA 4U80A 4DGMA 3UPXA 5AR5A 3VRZA 3N4TA 2UW6A 5J5SA 1KOBA 4X0MA 3A7GA 4QMPA 1IRKA 2IZUA 4F1TA 3SW7A 4LV5A 4TZRA 3AT3A 4ANNA 4CQEA 4ZY4A 4I5CA 4MWIA 4NM7A 3RKBA 5IF1A 4YBJA 4YTCA 4QP8A 4FG7A 1GIHA 3F3VA 3RHKA 3E62A 3LHJA 2W96B 2DWBA 4NSTA 1YI3A 3AC3A 5EI6A 2B53A 3EHAA 4DBNA 4TW9A 4PPBA 5I0BA 4CTBA 4I93A 4Q2AA 5DRDA 2ITZA 5M08A 4L6QA 5CAPA 5JSMA 1FINA 4V05A 5IQIA 4FKRA 5D12A 3W8LA 3H10A 3TG1A 4EOPA 2BR1A 1Y8YA 4FZFB 2JAVA 4QTBA 4QYHA 4RX9A 3ZFXA 3ZHPC 3UMXA 4CKJA 3DOGA 3MA3A 2X2LA 4QTAA 1A48A 3G33A 3V5LA 2BTRA 2GFCA 3GCVA 3L9LA 4L52A 4E4XA 2WMRA 4PV0A 4ALWA 3MTLA 4RJ6A 4Q9SA 4QT1A 5EHOA 3DB6A 4R3RA 4D2PA 2C5XA 2WELA 1WMKA 2FSLX 4F4PA 1WBPA 5M55A 2HY0A 4ZXTA 5H3QA 5L2WA 3MS9A 3ODYX 1GZNA 4O0VA 2C1BA 2RGPA 3HRFA 3TKHA 2RSVA 1GZKA 4IWOA 4USEA 4DYMA 1H0WA 4BB4A 5CANA 2PE0A 3KKVA 2C3IB 2Y8OA 2YN8A 2I6LA 3AG9A 5KMLA 1VYZA 4IE9A 4DT8A 1QMZA 3A8XA 3FLYA 3QZFA 4OTIA 3U9CA 5AP1A 4CFVA 3NCZA 4Y95A 4XCUA 3QD4A 4ZY5A 4O0XA 3EN6A 2W9ZB 5H2UA 3II5A 3QYWA 2R64A 4RJ5A 5HTIA 3ZUUA 3GC9A 4FV9A 3UDBA 2ZDTA 3THBA 5A3XA 4GH2A 1P5EA 2QOIA 4KIOA 3VQUA 3MIAA 2C5VA 3S1HA 1K2PA 3IK3A 1XH8A 4ZS0A 3RM7A 4C7TA 1XKKA 3IW4A 4Y5HA 3MJ2A 4BDCA 3JYAA 2RIOA 5M4FA 4M13A 1MP8A 4ID7A 2R3RA 3F3ZA 3LFAA 2Z7RA 2W5BA 3WF9A 4DF3A 2ZYBA 3L8SA 2WIHA 1ZARA 3LM0A 3OY3A 2VD5A 3P78A 2J50A 3CTQA 4M67A 4NK9A 4FSRA 4X2FA 4F6WA 2QLQA 5JQ8A 4FE2A 4JDJA 4LQMA 1OUKA 5E9EA 4I6QA 2H96A 4V01A 1NY3A 3ORPA 2V7AA 4FT0A 3R7VA 3FI4A 1I09A 2YERA 5DEWA 3FQHA 3LLAA 4TYIA 1FMKA 2ZM3A 2OIQA 5AEPA 5M06A 2JBPA 3R8UA 3BGZA 5JMSA 3FAAA 4NIFB 4XYFA 5FTOA 4I3ZA 4F08A 4I4EA 2C30A 4MAOA 4U3YA 3ZBXA 2CLXA 3G90X 3E8DA 4DFLA 1OL2A 3C4EA 2VTJA 3M42A 2PMLX 4PDPA 4EKKA 3MVLA 3QCXA 3V5PA 4QMYA 3NUAA 2ZM4A 3IW7A 3QBNA 4JX3A 3ZLWA 4MD9E 4X6RA 4Y85A 3ANRA 4HPUE 4MNFA 3UC3A 2B9HA 2BDFA 2HW7A 3OOGA 4RJ8A 2W17A 2YDJA 5A46A 2FVDA 1PMEA 4DT9A 5HU3A 4ACGA 2A4LA 1V1KA 3AC8A 4MNEB 2XUUA 4ZEGA 4CRLA 4YZBA 2GTNA 3DJ5A 3R8ZA 2CNUA 1J3HA 4MVFA 3COHA 3NW7A 5AUWA 4DEDA 3ANQA 2ETKA 5BVKA 5EOBA 4APCA 5CAOA 5ANDA 3GU5A 5ANOA 1HCLA 2XVDA 3DBCA 2VO7A 3HKOA 5FEEA 3GGFA 3K2LA 2O8YA 3AOXA 3UIMA 4RIXB 5FTQA 4X3FC 3M11A 4CMOA 5EQYA 3L9PA 3FLSA 4MBJA 2E9UA 3VUTA 5C27A 3Q9WA 3TV6A 3V5WA 4BDDA 5GINE 1S9IA 4DITA 1UKHA 2HW6A 4TWOA 5EFQA 5GZ9A 3OBJA 4BIEA 3BKBA 4WG4A 4BDKA 2F2CB 5AV0A 5HE2A 4A07A 4GT5A 4D4RA 5ICPA 3R7UA 4RWLA 3EQRA 2IVVA 4I22A 3JPVA 3QTWA 4I5HA 3GOPA 3NYXA 5BYLA 1YHSA 1PXPA 4I20A 2YAKA 3BZ3A 4C38A 2WMVA 4LL5A 3VN9A 4JRNA 2YAAA 4C34A 2BHHA 3RCJA 2FH9A 4YJTA 3UOHA 4OTGA 3GU4A 3VS5A 2YM7A 3OT3A 3E63A 3W2SA 2VUWA 2XJ2A 3O7LD 4JNWA 4KD1A 3KN5A 3R7OA 4ASEA 3EKNA 3MBLA 1WBOA 4LOQA 4OTHA 3SRVA 2UZEA 4XRLA 3GC7A 4AT5A 4M12A 4U7ZA 4IDVA 2BIYA 2JKMA 5E1SA 3N9XA 3T8OA 4F9AA 3L8PA 4EYJA 4B4LA 2IVUA 4S2ZA 3QA0A 4B6LA 3ZMMA 2PHKA 2OIBA 4YHTA 5HEZA 2BKZA 4BRXA 4M8TA 3ZLSA 4FT9A 3R8VA 3LXPA 4CZYB 2X7OA 2WQBA 3NNXA 4GK4A 5AP3A 2EXMA 3A99A 2WMBA 5DBXA 5HE1A 3FMDA 3V6SA 3OXIA 5IEVA 3GCUA 1GJOA 3HV6A 4ALVA 4HVDA 2J2IB 3RI1A 4IEBA 2I1MA 4C33A 3OROA 3LMGA 4EH5A 1H1PA 2XH5A 2ZDUA 1Y57A 5JN2A 4IM2A 2YM3A 3MFRA 4FYNA 4U81A 3CC6A 5CASA 3ZXTA 3JY9A 2GS7A 3PY1A 4WRGA 3WF6A 2DUVA 4RFZA 4AGUA 1U4DA 2BRNA 2LGCA 4R1YA 5G6VA 3DTCA 4C0TA 2YCQA 4RBLA 4BBMA 3A8WA 4F0IA 3G9LX 5CEPA 3A7FA 4FTIA 4HVHA 5I5ZA 4C37A 1JAMA 2XRWA 3E87A 4EUUA 3OS3A 4IWQA 1TQIA 4YZDA 5LVLA 5BMSA 4FIJA 3MH1A 1DI8A 3E93A 4N70A 4BDIA 4XX9A 3KQ7A 1RQQA 3JY0A 4B7TA 3VHKA 4FI1A 4TPTA 4D1ZA 1OBDA 1IASA 3U51A 1XBBA 1YOMA 4GJ2A 2I0EA 4O7LA 1VR2A 3Q2JA 4FF8A 2FYSA 1BLXA 1UNHA 4IAIA 2GHLA 3QX2A 4PMSA 4YJQA 4F7SA 3TNHA 4APPA 5HIEA 3UQCA 1OVEA 3ACKA 1W83A 4JL9A 5J1WA 2UZDA 2G1TA 3AC1A 1FVVA 4GIHA 3BEGA 5CEIA 1DI9A 3IPHA 3QQHA 5HVKA 4OTWA 5E1EA 4JAIA 3ZLYA 4XLVA 3UGCA 2EVAA 4E1ZA 4CG8A 2OJ9A 3IW6A 3Q6WA 3PZEA 4FTRA 1WBNA 3UJGA 1YDRE 4XV9A 2VWYA 5EM8A 4D2TA 5KMMA 4AZWA 4DLIA 3GI3A 2GSFA 2VNWA 2XNMA 4WIHA 2YCFA 4E4MA 5BVFA 3PSCA 4NM0A 4AACA 5HOAA 2W1EA 4UBAA 1EH4A 3QTUA 5CU2A 5C1QB 5HI2A 3PRFA 5E8SA 5C01A 5FRIA 2FSMX 1I44A 1JBPE 3QTZA 4JBPA 3LCKA 4XP0A 4DEAA 2CSNA 3CJFA 2GNLA 2OKRA 3R7IA 2PZYA 4F9WA 1Q8UA 3LFBA 4KABA 4RG0A 3HV4A 3REPA 1H26A 5A6OA 1YWRA 1GIIA 4TYHB 3PJ1A 3ZO3A 3Q9XA 4HW7A 5AFVA 4KKGA 3BV2A 5JKGA 5CTPA 2GQGA 1OZ1A 4JQ7A 4Q5EA 3CKXA 4F6UA 4FA2A 3BI6A 3BHYA 3BGQA 4ZK5A 4EORA 5CS6A 3IOPA 5CWZA 5CF5A 3EFLA 4PPCA 4MHAA 3EWHA 4ZMEA 1J1BA 3PVWA 4RMZA 5HTBA 4USFA 5TR6A 3U55A 4YTIA 4XG8A 5DOSA 4BKYA 2WU7A 4G5JA 4QPSA 3UQGA 5JGAA 4QYGA 5JFXA 4XNEA 3O8TA 3NIEA 4FNYA 1TQPA 2X0GA 4BHZA 1B6CB 5F4NA 3FSKA 3ZC5A 4YLKA 4D0XA 3V3VA 4EOOA 1CDKA 3NYVA 3G0EA 4KINA 4RT7A 3CSVA 4N6YA 4JJRA 4PTGA 3MWUA 1KE5A 3RJCA 4AOJA 4ZTNA 5B2KA 5C8MA 4L7FA 3MY1A 5LMAA 4G3CA 4IFCA 5HO8A 4EWQA 4GFOA 5HCZA 2RFEA 4ZSJA 3QLGA 1ZXEA 2XP2A 5DWRA 5TKDA 5IU2A 3OY1A 5L2QA 3NVMB 3FKLA 3TTIA 2IVTA 3FPMA 3WZDA 2R0IA 4RLKA 2UW8A 3EFJA 2VTOA 4E6QA 2QOKA 3KMUA 4FIEA 1URWA 4YJUA 2A19B 5KO1A 3VBWA 2HOGA 4YURA 5A9UA 4FIHA 4GEOA 1GZOA 4PMPA 5HNIX 4RJ4A 4P2KA 4PNIA 4YJRA 3NX8A 4NW5A 4HYUA 1G8AA 5ITAA 4AOIA 4J98A 4NW6A 4C4JA 4LRKA 1IG1A 3COMA 1IA9A 3TXOA 2WEVA 4CLJA 5F1ZA 5A4EA 4BI2A 5A4TA 3Q4UA 4GFGA 2JKKA 3LCSA 4EK5A 1YXXA 3P9JA 4L8MA 4QP9A 3UZPA 3IGGA 2JDOA 1WBVA 4RC3A 3GQLA 1TVOA 2VU3A 4GVJA 2E9OA 2R3QA 1NT2A 3PIYA 3S95A 1L3RE 3I5NA 3HRBA 4QP6A 5I9UA 3QLFA 3R01A 1ZYLA 3R9OA 3QQFA 4GL9A 4QQ5A 4YJOA 3VBVA 4HVIA 3UNJA 5FP5A 3MGYA 3HV7A 3LCOA 3UIUA 3BYOA 3RWPA 5AUTA 5A14A 2R4BA 2XKCA 4J71A 4D5HA 1W84A 4QMLA 1YXUA 4BCGA 3SXSA 4EOLA 4QNYA 5EYDA 2P0CA 4Y5QA 1TQMA 4UXQA 4MQ2A 4QYYA 3HAMA 2GCDA 4PPAA 3PA3A 5IUIA 2WQNA 3ENMA 3MB7A 3ORMA 3OZ6A 4K0YA 2BZIB 3W2OA 3L8XA 3W16A 4E5BA 1Q8WA 2OGVA 1OUYA 5EG3A 5M09A 5DVRA 2NRYA 3QF9A 4K11A 1AQ1A 4TTHB 4U8ZA 2XKEA 3D83A 5DRBA 2Y9QA 1PHKA 3CE3A 2EUFB 3D9VA 4H39A 4HCVA 3I60A 3FV8A 2OG8A 4OBQA 3ULIA 4RA5A 3ET7A 4TWNA 5IKWA 1UU7A 4NL0A 4YU2A 1XHAA 2XNBA 3UVRA 4EQMA 4GFMA 3W8QA 4LMUA 3ACJA 1B38A 2WMQA 1ZYCA 3FDNA 3FKOA 4G31A 5BMMA 3U6IA 4ZSGA 4EOQA 3G6GA 3WYYA 4E5WA 2QOOA 1QPJA 4F70A 1UV5A 3HMOA 3KN6A 5EKOA 2YWVA 4QMZA 4UN0C 1FOTA 5AP6A 4IAKA 4XG9A 3EN5A 4XMOA 2XNNA 2G2IA 3FMNA 3Q32A 4W4XA 4CCBA 4MH7A 4WNPA 5JRSA 1IAJA 2Q0BA 4AZVA 5JZJA 2HENA 3VHEA 2YM5A 3POOA 1ZZLA 4WHZA 4YTFA 5J9LA 4UMQA 3PZHA 5EH0A 5GZAA 1OGUA 2PYWA 3PFQA 3HECA 2PVLA 2PWLA 4QD6A 5CEQA 3EQGA 4RA4A 3L9MA 4KNBA 4AT4A 4EOJA 4IVBA 5K5NA 2GNFA 3UG1A 2W0JA 3PVGA 4LOOA 4YR8A 2I7QA 1LEZA 2YDKA 2PUPA 4IM3A 4FUXA 2F7ZE 4ERWA 4TXCA 3R1NA 3RAWA 5LVNA 2X39A 3TDWA 3ENHA 3WF8A 2YABA 4J8MA 4L46A 3O8PA 5E8WA 2JFMA 2KTYA 3N51A 4GMYA 5CAVA 1JVPP 4YNEA 3E88A 5H8EA 3WE8A 2W99B 1JKTA 3CY3A 1YKRA 2C5YA 2J51A 3B2WA 3NUUA 4MF1A 4O2ZA 4W4YA 1GAGA 4F63A 2PZRA 1PY5A 2PZPA 3QD2B 3DNDA 5IUHA 1KWPA 4M68A 3ZO4A 2VO6A 2HWOA 4ZAUA 5EKNA 3FMEA 4ASDA 3EB0A 4J8NA 4DC2A 4K6ZA 2H34A 2X81A 3G9NA 5CEKA 4XH6A 2HZNA 4G1WA 4FSQA 5J8IA 2CGWA 3TUCA 1M2PA 3CKWA 3VS6A 2RG5A 3KXXA 1O6YA 2Y6OA 3WYXA 2E9VA 3LQ3A 2OF4A 4W4VA 3IGOA 2QO9A 4YZMA 3IOKA 5FWKK 2J90A 2CN8A 3C1XA 3H30A 4D1XA 3LAUA 4I92A 3R00A 2GQRA 2ITNA 3RK5A 4R5YA 1SZMA 4DINA 3TNPC 3PLSA 3U4UA 4F9YA 4OGRA 1OM1A 3VBTA 4Z16A 2JDTA 2CKOA 4PX6A 5CX9A 5IA0A 3C5IA 1KE9A 2WQEA 3QTRA 5LOHA 4MD8E 5GJFA 2WTJA 3OMVA 2IW9A 4KA3A 4AF3A 1Q61A 3GFWA 4IB3A 3UVPA 2HIWA 3SHEA 4DEHA 4EH3A 1E1XA 3C0GA 4XOZA 4RZWA 2OXXA 2IPXA 5JRQA 4CTCA 3U8WA 3BHUA 3LXKA 4O6LA 3PG1A 4RIWA 3F69A 2WO6A 4IAFA 4K2RA 1P4OA 3ORTA 3UP2A 3OVVA 4O6EA 3SQQA 2BKKA 1WBTA 5FUTA 3VS7A 2ZAZA 5L2TA 2XJ0A 1B39A 4PF4A 4YGAA 5E91A 1YHWA 2ITXA 1LPUA 3SG8A 2BZHB 3F5XA 4J52A 4CFMA 5BVEA 2J7TA 3C4XA 4QMNA 4AWIA 2KULA 4Z7GA 1YXSA 2BCJA 3ETAA 2XF0A 1RDQE 2HXLA 4QP4A 3KU2A 1JKSA 5IA5A 3UVQA 4D2SA 5EQEA 4P5QA 2W4KA 2V0DA 2WTKB 4JQEA 2XM8A 2VTPA 3CD8A 5EI2A 1PXJA 4DGLC 3VQHA 5LMBA 1OIYA 1UU8A 3P1AA 4UWBA 3GU8A 1XJDA 2PVKA 2F57A 4XS2A 1Q8ZA 5DYJA 4HYHA 4XV1A 3W2RA 5J9YA 3EQHA 3ERKA 2B55A 4J1RA 4DTKA 1HCKA 3Q6UA 4BDEA 3QX4A 3MY0A 2FO0A 2ERKA 4C2VA 3CS9A 3WF7A 4WA9A 5AUYA 1FVRA 4C4FA 4F65A 3KC3A 2UUEA 3OUNB 4I0SA 3UE4A 4FTMA 2Z7SA 5GIPE 5K0KA 4YUQA 1ZOEA 1NVSA 2CLQA 1Q99A 4FKOA 2C6MA 2BFXA 4PUZA 4M69A 4K18A 3RK7A 3VWAA 3MESA 2V55A 3GEQA 1OB3A 1FPUA 3T3VA 5G1XA 3SX9A 3BBWA 3BV3A 4GT4A 4TYGA 2ZV2A 2Q83A 5KE0A 4Y83A 4AZFA 5L2SA 1OL7A 3P23A 4W9XA 2BZJA 1ZOGA 2ZMDA 2FSOX 4ALUA 3BHHA 3CLYA 4EH7A 4DFBA 3DAKA 4R3CA 4XBRA 2OI4X 4WNMA 3UBDA 4BWPA 4TL0A 5TE0A 5AUUA 3FZPA 3AD6A 5C9CA 4GG5A 3QQUA 5IQGA 4OBOA 1UU9A 4QNAA 5AUXA 1LUFA 3MFTA 3JR1A 4J97A 3FJQE 4QMXA 3ODZX 3PE2A 2QO7A 5EHLA 4HCUA 3TUBA 3FLWA 4BCKA 4BVUA 5KBRA 4PTEA 4HGSA 2C69A 4UB7A 3LFNA 4OTDA 4FSZA 4KKHA 2YIQA 2YLEA 3GU6A 5EW8A 3FSFA 5D7AA 4O1OA 2VWZA 2Z7LA 4O0TA 2WHBA 4MD7E 4NUSA 3EJ1A 4FIGA 4AE6A 1ZOHA 2WEIA 4A9TA 3G6HA 1M17A 4IB1A 1ZMVA 2ZVAA 3SXFA 5HVYA 4BY9E 3KA0A 4EBWA 4L01A 2XBJA 3OHTA 4TT7A 4FBXA 3PPZA 2QR8A 5DPVA 3CPCA 3A4PA 3B8QA 4C3RA 1H24A 4I24A 5F20A 3QTXA 4ZJJA 4H3PA 4AZSA 3NDMA 4ZIMA 2W1IA 4MXYA 1PMVA 3OP5A 1NXKA 3AMYA 5J9ZA 3RM6A 3AGMA 3GU7A 3WIKA 2EU9A 3BLRA 4DN5A 4EH2A 4EYMA 3Q04A 2BVAA 2QD9A 3HNGA 4ZTRA 4F1OA 3R9HA 3LFDA 4IB5A 2YJSA 4JG8A 5GHVA 3A61A 2QVSE 3F88A 4FZDB 1E9HA 4C61A 1FVTA 1PYXA 3OCBA 2X8DA 4RC4A 3VUGA 1A06A 3WE4A 2JKQA 3DXNA 4H1JA 4AA0A 5IA4A 5JH6A 3VS3A 4UMTA 1FGIA 1Q3DA 1SMHA 3MH3A 2C68A 5CSXA 4A4LA 3FZOA 3VUDA 1UA2A 2A0CX 3OCTA 5D1JA 5DR6A 4ACDA 4HVGA 4BYJA 2YACA 2GNJA 1J91A 3R8MA 4G16A 2BROA 3VS1A 3MPTA 2HYYA 1OKVA 1SM2A 2OBJA 4QQTA 2QU5A 4FKPA 5IMXA 5L8KA 4OW8A 2C3LA 3MVJA 2WTWA 4X2JA 3FZRA 4ASZA 5M07A 2YM4A 3OW4A 4J96A 3VW8A 4ZS4A 1KE7A 3NR9A 2ZJWA 4U97A 3C4FA 3OTUA 4YC3A 3NYOA 5KZIA 2XCHA 5CSHA 3TN8A 3OFMA 2P2IA 3I0QA 2W7XA 1R3CA 2CN5A 3BLQA 5CVFA 3QQJA 5CXHA 4C36A 4BFMA 2QCSA 4D0WA 3AMBA 5FXQA 3VVHA 4E3CA 2WMAA 4EC8A 4FICA 2JIIA 3V01A 4LRMA 1R1WA 2XIRA 1U54B 3UOJA 3DTWA 3ZZEA 3B2TA 1PF8A 5ANEA 1CKJA 3C51A 5AADA 4ONAA 5CENA 3POZA 3QL8A 1ZRZA 2J9MA 5BPYA 5EOLA 2O5KA 3C13A 2QHMA 5D9HA 4R7BA 3I5ZA 4N0SA 1IR3A 4RVKA 3D7TB 2GHMA 4E26A 5A4CA 3HDNA 1LR4A 3BWJA 4FSUA 4EZ5A 4I5PA 4BGQA 2JDSA 3ROCA 2X8EA 5KMNA 2GNGA 3RPRA 4V0GB 4JXFA 3GENA 4O7VA 2XZSA 4BWXA 3ZC6A 4ZMFA 3L8VA 4QYEA 3HZTA 2GQSA 3DXPA 1Y6BA 3LZBA 4I94A 4LGGA 3EZVA 4JDKA 3KFAA 3BCEA 5AR4A 5B0XA 4G9RA 4XV3A 3DKOA 3RALA 1JQHA 2X9EA 3OUKA 4FK3A 3TJCA 1ZMUA 3HYHA 5HNGA 3C0HA 3FEGA 2P33A 1YOJA 4XOYA 3BGPA 3DXQA 3Q4TA 3RP9A 3RTPA 2F4JA 2PVJA 4CFXA 2OZAB 4MK0A 4O0RA 1LP4A 1FBNA 3QZIA 4JDHA 3RNIA 5EHYA 2UZWE 2QLUA 3E5AA 4WNOA 4AN3A 3KULB 4UWCA 4C35A 4CLIA 3UNKA 3HAVA 3EN9A 5DA3A 2F7XE 4JQ8A 4DLJA 1PXNA 3RPSA 2X2MA 4QO9A 3UO6A 3R1QA 4IVAA 4AXAA 2R3PA 1KV1A 4IIRA 2X4ZA 4O81A 1M2RA 4USDA 2CJMA 2PMOX 5AIRA 4AGDA 3DFCB 4A4OA 2OIDA 3FL4A 4ANMA 3A60A 3F3WA 1OBGA 3Q9ZA 3ZZWA 1CMKE 3HLLA 4XG3A 4ENYA 4XP3A 2VV9A 5FD2A 1U46A 4CKIA 2R3JA 3LVPA 4IXPA 4YP8A 3KF7A 3HL7A 3E3PA 3HX4A 2OO8X 3Q2MA 4JBVA 4EK3A 1XBAA 3PA5A 4O0SA 2XCKA 3ZOSA 1Q3WA 5DLSA 4NJDA 3WIGA 4EK4A 3QTSA 5DHJA 2XEYA 4QMSA 5CVHA 5M4CA 5E8ZA 5M4UA 4YZNA 3UODA 1OITA 4JI9A 5J1VA 4AZTA 3WARA 3K5UA 3IDCA 3KMWA 3SOAA 1SVEA 5HG8A 3C7QA 3FY2A 5BVWA 4YLLA 1XBCA 3WZUA 3P7BA 2WGJA 1KE8A 4I0RA 3NUPA 3OOMA 2C1AA 1XH7A 3EZRA 5M56A 4FEVA 2QOQA 3EQIA 2UZBA 2BUJA 4GU6A 4NFNA 4HGEA 2YDIA 4I23A 4FSNA 4IZAA 1OPLA 2OXYA 3NZ0A 2PVMA 4FKWA 5J87A 2BALA 5DR2A 4FTQA 5H9BA 3N4UA 3UOLA 3IDBA 1M14A 5DEYA 2WU6A 3DU8A 3NUXA 4FV6A 4A9UA 3EYGA 4L3LA 2YCSA 3WI6A 4NKSA 1MUOA 2QONA 4FZ6A 2WQOA 3O0GA 4DCEA 2WTVA 4UWYA 2W1GA 5I9WA 4TYEA 5JFVA 3DZQA 5E8VA 5IMEA 2VGPA 4ANOA 4GG7A 4ITHA 3TZ8A 3R2YA 1F5QA 4EOSA 2ZB0A 4AN9A 4H3BA 2AC5A 3RPVA 4IAYA 3Q4ZA 2UV2A 5CNNA 3WF5A 5L3AA 4HNIA 2GNHA 3Q5IA 5FTGA 2J0KA 2OF2A 2QODA 3GC0A 3KXMA 3QKLA 4ZSLA 2C0IA 4KBAA 1X8BA 4D55A 4RIOA 3NCGA 5IUGA 1OKYA 3RZFA 2BILB 3ZRMA 4JBOA 4A06A 3FE3A 5K0XA 4D28A 3AT2A 4BTKA 1O6LA 3CTJA 2C3KA 4C4EA 1R0PA 5FP6A 5IQHA 2B4SB 1WAKA 1YDSE 3R1SA 4GK3A 5CF8A 4DH8A 2OLCA 4IZYA 3IW5A 2UW5A 3ORNA 2GS2A 1GOLA 5AR8A 5TOZA 2BFYA 1OKZA 3ZO2A 4JRVA 4Z55A 2VX1A 5KHXA 3NUNA 3DBEA 4IFGA 2WMXA 3DBQA 5CSWA 1VJYA 4AG8A 4CSVA 3EH9A 3KK8A 3NLBA 3NS9A 2QURA 4JIKA 5L8JA 3UTOA 2W1FA 4LV8A 5KKRB 4PL4A 5HESA 3HRCA 3LIJA 2BRGA 1W98A 4ANQA 3BU3A 3DKCA 3UQFA 3VJOA 4IX4A 1J7UA 3GCQA 1W8CA 1ZZ2A 3U9NA 4R3PA 2XA4A 2YIWA 4AW0A 4OTRA 3Q52A 4EH8A 1M2QA 4MWHA 3RBWA 3MTFA 5FEQA 3FQEA 5FDXA 4F7NA 1SNUA 5DR9A 4EUTA 2VTIA 1P4FA 2F9GA 2UZOA 4I21A 1R0EA 3S0OA 1FMOE 3TNWA 3MN3A 5KMJA 4FTTA 5DT4A 2JD5A 2QO2A 3DK3A 4C4IA 2J6MA 3F82A 2PVFA 3CBLA 5DNRA 3ZYAA 4X21A 4F0GA 3EQBA 2HAKA 3PXQA 3HGKA 4E8AA 2YHVA 3PPKA 4IM0A 2HZ4A 4UEUA 2IWIA 2J4ZA 2ZMCA 3O71A 4QMWA 2X2KA 4XG4A 3PJ2A 3AD5A 4GJ3A 4FSYA 4AGWA 2QOCA 2HELA 3FHRA 2OJJA 3PJCA 4E7WA 5AX3A 2QR7A 5AAFA 3PLAE 2J5EA 1MQ4A 1CSNA 1ZYJA 4ZSEA 4BDFA 4PL3A 5CU3A 3LFEA 5EM6A 4EBVA 1JKKA 3K3JA 4BCQA 3PXZA 4FEXA 3E8NA 3KRWA 2C0OA 2O63A 5CSVA 1STCE 1MRUA 3FKNA 3O7LB 4G34A 2C6EA 3BYUA 2XK6A 3D5WA 1ERKA 1OL1A 1QCFA 3A7HA 3OWLA 4JAJA 1JOWB 1PXOA 3G5DA 3V5JA 2JBOA 4FTJA 1XQZA 2FB8A 3PA4A 5AR7A 3BX5A 1ND4A 5HX6A 3OW3A 2NRUA 2W1CA 3GCSA 3LCTA 3QAME 4FOCA 3UG2A 4C3FA 3F2AA 3BQCA 3VS2A 3QRKA 3H9RA 3R02A 3ZEWA 4LI5A 4RX5A 4FT5A 2RL5A 4G3EA 5DIAA 4CRSA 4JG6A 2JIVA 4EK8A 4DBXA 3ID6C 4R8QA 3K3IA 3UIBA 2X7FA 3G0FA 4H58A 4YO6A 1J7IA 3AD4A 3NGAA 4FOBA 4DFNA 3EQFA 4J99A 3IW8A 3LPBA 3F2RA 2ITYA 3R83A 4ANLA 3E7VA 1S9JA 4F0FA 4WUAA 4U43A 4JT3A 3ROYA 2GNIA 3KRXA 2OK1A 3I81A 4PP7A 3AMAA 2QC6A 4AS0A 3SG9A 4YLJA 2QG5A 3FXZA 4S34A 4FKIA 4BKZA 5M53A 4QMOA 3FXXA 3ZM4A 4BCIA 4MXZA 5IDNA 3MB6A 3FWQA 3R71A 5C03A 3DLZA 4RSSA 3SRVB 3UPZA 4O7RA 3FYKX 4AA5A 4KIKA 5M57A 2UVZA 2ONLC 4DGNA 4G5PA 4FTOA 2WMTA 2P4IA 3ZTXA 2RKUA 5D41A 2O0UA 4E4LA 5HE3A 1T46A 2CMWA 4R7IA 5LXMA 1H8FA 2G9XA 5KCVA 2R3NA 2WOTA 2HZIA 4FNXA 4IANA 1JPAA 4BDHA 3LFQA 3AGLA 2Y7JA 3FI3A 4FKGA 4BI0A 5CAUA 4FG8A 2X4FA 1OECA 4WOVA 2Y0AA 3CJGA 3R1YA 4IJ9A 4IJPA 3RGFA 4XHKB 4FKUA 3DB8A 4RJ7A 5FM2A 1TKIA 4KS8A 4TN6A 3TKIA 5AX9A 4S30A 5HG5A 4KSQA 3ZCLA 4DH3A 4EQCA 5HLPA 4IWDA 4Z9LA 4F9CA 4AE9A 2I0YA 3PWYA 1OL5A 3QWJA 4FTUA 3ZFYA 4DH1A 2PUIA 2FSTX 1YDTE 1W7HA 3MPMA 1H4LA 1QPEA 2V62A 3R21A 2WTCA 5FLFA 4AT3A 3F3TA 3QZHA 4M14A 4FG9A 3MA6A 4I41A 5AAGA 3PVBA 2VGOA 1ZAOA 2X7GA 3OC1A 4QYFA 1Z9XA 4O21A 3H3CA 2XIKA 2WTIA 4HZRA 4D9UA 1Y8GA 4PRJA 4AU8A 3QUPA 4D4VA 3FHIA 5HZNA 5JQ5A 4U5JA 5DFPA 4RLLA 4LM5A 4YTHA 3CEKA 5IISA 3NSZA 2QKRA 3KXZA 5ACKA 4AUAA 3IS5A 3QQLA 5AV4A 5EW3A 3HV3A 4FNZA 2QG7A 2XMYA 3F5UA 4EOMA 5FQDC 5LMKC 4RFMA 4L45A 5M51A 4GT3A 4Y73A 5E90A 2EB2A 3K5VA 4GVAA 5KZ0A 3VAPA 5AA8A 3SVVA 3GFEA 4Y72A 1H1QA 1WBWA 3LFSA 1FGKA 3GBZA 4C02A 4RIYA 3SAYA 1V0PA 4LG4A 4WSYA 2CCIA 4DFUA 3BWFA 4WKQA 4Q9ZA 5AM6A 3NNUA 4C4GA 5KX8A 2YZLA 3MJ1A 4YJPA 5F95A 4U0IA 3DKFA 4FV8A 4AFEA 4BYIA 4OTQA 4QMUA 2OICA 4CMTA 3O96A 3FL5A 3MVMA 1DS5A 4IHPA 2R3LA 3PE1A 1H27A 5EYKA 1ZY4A 3W18A 3COKA 4H05A 3ZEPA 4PTCA 1KV2A 2XK4A 2WIPA 4MBIA 3UO5A 4DG3E 5FGKA 4ORKA 5BVNA 3ATTA 4BZDA 3W2CA 4NT4A 2WTDA 5EI8A 4ZLYA 3CP9A 3SLSA 4UXLA 4HYIA 5AUZA 3ORKA 3V51A 3CD3A 4NJ3A 2CKQA 3UYSA 2ZV9A 1YI4A 1RJBA 1PKDA 4IMYA 4D9TA 2VTAA 3SA0A 3EYHA 5HG9A 4TWCA 5BNJA 4D2VA 3QHRA 3OG7A 3HUCA 4YJVA 5J5TA 5K4JA 4PDYA 5I9XA 3KVWA 3BYMA 3CPBA 3IQ7A 3FUPA 2JIUA 3A62A 3HA6A 2CNQA 4O84A 2BDWA 2IO6A 3QRTA 1Z57A 4DAWA 3VBYA 2QOHA 2ITQA 4M66A 2B0QA 5M44A 3TCPA 2PUNA 2W5HA 1XH4A 1VYWA 4YJSA 5CU6A 2NO3A 3GB2A 3FMMA 4FIIA 2QQ7A 3TNQB 1JSVA 3DFAA 5BVDA 5B2LA 4KB8A 5CSPA 1RW8A 3MI9A 4TNDA 1IAHA 3MPAA 5AIKA 4DEIA 4F99A 4QP2A 2JKOA 3OXTA 3RWQA 4GKIA 2I0HA 2OFUA 4YC6A 2HWPA 2YCRA 4IZ7A 5L6WL 3JXWA 2OH4A 2WKMA 3D5UA 4ZLOA 4A9SA 2H6DA 3U6HA 5C4LA 5IQAA 2W06A 4CT1A 2YFXA 5L4QA 3LW0A 4KSPA 3TV7A 1GZ8A 3ZFMA 3ZXZA 5IH4A 4DEEA 5HGIA 4N6ZA 4U42A 4UMPA 3OTVA 2QHNA 5DN3A 4BKJA 3DJ7A 3MDYA 3Q3BA 4HGLA 4QMTA 5HCYA 4XEYA 4AW2A 4E5AX 3ITZA 1URCA 1BI7A 4B0GA 4EOIA 1BL6A 4G6NA 5E8UA 3DKGA 2ITPA 4AN2A 4P7EA 4NZWB 3E8EA 1PRYA 2GFSA 4NCTC 3EN4A 3LJ2A 4IX6A 5CI6A 4ZOGA 5EDQA 2XK9A 4EHGA 1G8SA 3EIDA 3NAXA 4IVCA 3L9NA 4MYGA 2I0VA 1Z5MA 1V0OA 5B2MA 5IQEA 2FGIA 2UZLA 3LQ5A 4HPTE 2JDVA 5TF9A 3LLTA 3ZBFA 4BDAA 4U44A 2QOBA 2WMWA 4X3FA 2R5TA 1JLUE 2XRUA 4AQCA 2C6LA 4DHFA 5K9IA 2BAKA 3KVXA 5IPJA 3RVGA 2VTQA 4K8AA 3C9WA 3Q53A 4FV0A 4W9WA 4CZUA 3TTJA 4O0UA 3ORXA 4LRJA 4BI1A 2GS6A 3KL8A 3QWKA 3TM0A 3NNWA 3KY2A 3LXLA 4L53A 4WUNA 4YHFA 5JGDA 3I7BA 2C5OA 5IA1A 2PUUA 5IQCA 3PXKA 3BBTB 3FMKA 5CXZA 4DCAA 2OFVA 5I3OA 4AOTA 3W10A 1PXLA 3QQKA 4R1VA 4TYJA 4O83A 1ZYDA 5DH3A 4FL2A 2XJ1A 2O3PA 2F7EE 2R3IA 2W1HA 4GSBA 4OTFA 4AAAA 2J0LA 4FTNA 4A9RA 4BHNA 4EHVA 2FA2A 2XIYA 2DS1A 2QOFA 2XNGA 4KKEA 4MXAA 3BELA 3RPOA 1PYEA 3QTIA 2VWUA 1YWNA 3TNIA 4DTAA 4KBKA 3GXLA 2JLDA 4CG9A 4I6BA 1WVYA 3LE6A 5CQWA 5C4KA 4D58A 4KIPA 3MV5A 1DAYA 2OSCA 3PYYA 1KE6A 4BCOA 1UWHA 4EI4A 1H1SA 2Z60A 5AV1A 4H1MA 3GP0A 4GUBA 2IVSA 3DNEA 4BL1A 4MKCA 1JSTA 3P5KA 4PDSA 5C8NA 3PY3A 5AR3A 1P14A 4DH7A 1W82A 2C5NA 3NAYA 3SKCA 2YISA 5HIDA 4LYNA 4OAVB 4WNKA 4JIAA 2J0MB 2BRHA 3S4QA 2PU8A 3LFFA 1ZYSA 3BE9A 2YM6A 2YWPA 3MH2A 4FL1A 3HMMA 5HHWA 4RX8A 4DFXE 4NM5A 2IZSA 3P7CA 4J7BA 4G2FA 5HLNA 5IQFA 3IONA 3PXFA 4IW0A 1PXIA 4FT3A 3WOWA 3BQRA 3UNZA 5JFSA 4GU9A 5K4IA 1UU3A 5EK7A 3MVHA 3U4WA 4CGAA 3HP5A 4YO4A 4EK6A 5FG8A 2REIA 4FSMA 4L3JA 5BVOA 2PY3A 3VNTA 3G2FA 5JEBA 2RFDA 4JS8A 5CZHA 2WMUA 3FQSA 1XH5A 4NYEA 1Q97A 3DJ6A 1WFCA 1Y6AA 5E8YA 5AAEA 4R6VA 4FX3A 2YIXA 3GQIA 4DFYA 3BRBA 2W1DA 3WZEA 4BZOA 4J53A 1IA8A 2YJRA 3V5TA 4JBQA 5JT2A 4XV2A 2VWBA 5HICA 4EJ7A 2WB8A 4JDIA 4H3QA 5H8GA 5T6KA 5LCJA 2IW8A 1O9UA 4AP7A 5A4LA 4CNHA 4BCFA 2BDJA 1MQBA 1UVRA 3BYSA 3PJ3A 2XBAA 4ZTQA 3RAIA 5IQBA 3FLNC 4RVTA 2R0UA 1PW2A 5D10A 3QQGA 4B8LA 3QU0A 3IKAA 5AWMA 5LJJA 1H0VA 3T3UA 3NW6A 3O51A 3H0ZA 3LFCA 4V04A 4PMTA 4EOKA 4GS6A 3MH0A 2OH0E 4ZTMA 3VUKA 4BCHA 4EZ3A 4FR4A 3F6XA 1AD5A 5IDPA 4WBOA 3R0TA 3RZBA 5IA3A 3AT4A 2NPQA 2WAJA 4FV2A 3DCVA 1OMWA 1BMKA 2VTSA 3DDPA 3EN7A 3F7ZA 2E2BA 2VN9A 2C6IA 4P90A 4ARKA 5BX0A 2IW6A 2ETRA 1L8TA 5DE2A 4NIFA 4L9IA 2VO0A 2XIZA 3HMIA 3RMFA 3NVKI 3RHXA 3H0YA 2PE1A 2R2PA 3CQEA 1ZMWA 3QKKA 3KRLA 3VBXA 5KNJA 1CKPA 2GPHA 5BUJA 4KBCA 4R77A 2F49A 2ZV7A 3RPYA 3ATSA 4YPDA 4P5ZA 2VWXA 1RE8A 4D4SA 4RIWB 4FODA 2G2HA 3HVCA 1QPCA 2ONLA 3RAKA 1JSUA 3C0IA 5GIOE 3CR0A 1XH6A 3OWPA 2WOUA 4HCTA 2YEXA 2HCKA 2XB7A 4MNEA 4PDOA 1OKWA 4GYGA 3CGFA 4GYIA 3RK9A 3HMNA 5J95A 2WFYA 2WD1A 3TI1A 1XR1A 2Z8CA 5FXSA 1OIQA 3R9RA 3L1SA 4QPAA 5E8XA 4RX7A 3MSSA 2YIRA 3I4BA 2JAMA 2XYNA 4FTAA 4U9AA 5F94A 3AC4A 4IX5A 4RIXA 3SXRA 4FKJA 2UW9A 3QRUA 5BUIA 3UZRA 2ZV8A 5ETCA 2X6DA 3PSDA 2X1NA 4HZSA 4EJNA 3O23A 2UVYA 3ZONA 4MBLA 4RFYA 3ORZA 4G9CA 2CDZA 3R7YA 4N57A 5IH6A 3R04A 3QC4A 2ZB1A 4YNOA 4G3FA 2Z2WA 3ORIA 4LOPA 4M69B 4M3QA 2G2FA 4NKAA 4R7HA 4BIBA 3SOCA 2PMIA 4EHEA 1XO2B 4G3GA 5HQ0A 2VWVA 3F2NA 4DEGA 2BRMA 5FDPA 4RJ3A 4BTMA 5FEDA 3VF8A 3CIKA 4YMJA 4LUDA 1E1VA 3DT1A 3QKMA 4JLCA 2BZKB 4M0ZA 4O86A 1G5SA 3VUMA 4A7CA 3AQVA 3QUDA 4X2KA 3PXRA 5L6PA 3ZH8A 3ZSGA 5HU9A 5J79A 3KB7A 4BIDA 2YA9A 3VO3A 4L42A 4IZ5A 2RFNA 4JVGA 3NPCA 3DLSA 5LMKA 3R30A 4NM3A 4G3DA 4TKSA 3KGAA 3P86A 4IAZA 3F5GA 3PTGA 4CFFA 4XLIA 3WZJA 2PZIA 3SGCA 2YIYA 5IEXA 1OPJA 3NUYA 3ZDIA 2WMSA 4R5SA 2ITOA 2BIKB 3VULA 2UZTA 4M84A 1CKIA 2WTKC 3VC4A 4UALA 5HO6A 3GVUA 1MRVA 4HVSA 2B9FA 4MF0A 5ANJA 5D11A 2GTMA 3VW6A 1GIJA 5HD7A 2PVYA 4O91A 4ZJVA 4YZCA 2CKPA 2CCHA 4IBMA 5EM7A 4BDJA 5DT3A 5DGZA 1H1WA 1Q62A 1J1CA 4RWKA 4XRJA 3ELJA 3I7CA 3OT8A 4X3JA 2C6TA 1O6KA 4LL0A 5CT7A 3E64A 1M52A 4MXXA 2RF9A 3OD6X 4RC2A 3VS0A 4DGOA 4JOAA 4QP3A 5CALA 2AC3A 3CQWA 3C4CA 3AC2A 4KS7A 4BCNA 3V8TA 3D14A 3TEIA 3GUBA 3M2WA 4I5MA 3FY0A 2ITTA 3FC2A 3G51A 1YVJA 4ANSA 4C4HA 2QI8A 3Q5ZA 4E73A 5LQFA 3OF0A 4EZ7A 3NWWA 3QA8A 4F1MA 3VUHA 4OT5A 4BC6A 3EQCA 3ORLA 4O27B 1VEBA 3IDPA 5AP5A 5IH5A 5HVJA 3ZO1A 3LM5A 2B9JA 4GKHA 3D2KA 4BR3A 3DAEA 1REJA 4UV0A 5AP4A 3BPRA 3F7WA 4WG3A 5CQUA 3Q60A 4DEBA 2Z02A 4FZ7A 2UZVA 4J95A 5IG1A 4FKSA 2R3MA 2R3GA 4BDBA 1U59A 5GJDA 4ZP5A 5GZ8A 3O8UA 2ITVA 3R9NA 4CCUA 3UZTA 3P79A 3E7OA 3QXOA 1YQJA 3FI2A 3I0OA 3KMMA 5EYMA 3FPQA 3D5XA 5BYZA 4W4WA 3W32A 1BYGA 3OCSA 3QRJA 4O1PA 3D2IA 2EXEA 1R39A 1SVGA 3KRRA 3R73A 5AV3A 4CFNA 4AGCA 4E6CA 3FMJA 4F7LA 2I40A 4O0YA 4DE4A 3TWJA 3DZOA 3CCNA 4C8BA 1BL7A 3I1AA 3UO4A 4ITJA 5E7RA 3TZMA 4FIFA 2J0JA 3DK6A 5ACBC 5L2IA 4ZLZA 2IZRA 5LCKA 3I79A 5E8TA 3SV0A 4NCTA 5HO7A 3JVSA 2BAQA 3DGKA 3UC4A 3E8CA 3QFVA 3WILA 4DA5A 3KXHA 1PJKA 4TY1A 2GMXA 4Y46A 4TYHA 4F7JA 2PPQA 3TIZA 3R7EA 4BTJA 4CMUA 5E92A 3MY5A 3NUSA 4U41A 2FUMA 1XH9A 3F66A 2B54A 3NNVA 4KRDA 3I6UA 5CZIA 3ZDUA 2UVXA 1H07A 3SD0A 2Y4IB 4BWKA 2H9VA 4IAAA 4DG0E 4XBUA 1H01A 4D4YA 3BU5A 4MQ1A 3UOKA 3QALE 3ZLXA 3ZUTA 2JFLA 5DT0A 5IQDA 4O7WA 2XS0A 4IVDA 3WZKA 1BKXA 4B8MA 3VJNA 4E93A 3DY7A 3KXGA 2PSQA 3LCDA 3Q9YA 4ZSAA 4I6HA 4CKRA 2PTKA 3EOCA 3QYZA 2C0TA 3QCYA 2YLFA 4XG2A 4N4SA 4BBFA 3QC9A 5I9ZA 2BRBA 4EL9A 3M1SA 3FYJX 1UWJA 4L68A 3OCGA 5ANKA 5L6OA 2VNYA 2W9FB 2RG6A 5CF4A 1JKLA 3PWDA 5F9EA 3ZS5A 3FLQA 3U87A 4C59A 4RQKA 4YHJA 3D7ZA 1SVHA 4LFIA 3AC5A 4ZZOA 4FTLA 4DG2E 4IQ6A 5HBHA 1V0BA 2G01A 3ALNA 5AP2A 2WPAA 3FZ1A 3GOKA 4MXOA 4F9BA 3FI8A 4WT6A 4X6QC 4BCPA 2GDOA 4PMMA 3H9OA 5LVOA 3O17A 2IG7A 4C57A 4YJNA 5BQ0A 3ZUVA 4BCMA 3OBGA 1HOWA 1APME 3C5UA 4L7SA 3BIZA 3NIZA 4O96A 1DAWA 4RRVA 4UY9A 5CT0A 3EFWA 2XM9A 3EQDA 2QOLA 4FNWA 1K9AA 2CGUA 4CVAA 5JK3A 2XK8A 1F0QA 2AUHA 2IZTA 4Y8DA 4LUEA 3D15A 2PVRA 3AXWA 4S33A 3PG3A 3R8LA 1Q41A 3MFSA 2AYPA 5K3YA 5AA9A 3LMHA 4UMRA 4O7SA 3S00A 3TV4A 1H00A 2XIXA 3IG7A 1U5RA 3V8WA 4BN1A 2OJGA 4FV7A 5CEMA 3PPJA 4AX8A 3OXZA 4EEVA 3HMPA 4DFZE 5KBQA 5HBJA 3U54A 3NMUF 4IADA 3QZGA 1CTPE 3A7JA 3A7IA 3RNYA 3MFUA 3RCDA 3SDJA 4KAOA 3B8RA 5LARA 2BTSA 5I4NA 4GV1A 3QTQA 2EWAA 5J7HA 2ZM1A 2XNEA 4BZNA 3KRJA 5C26A 2CPKE 3PDTA 3F3UA 4II5A 3HV5A 4ZZNA 4EH9A 4GK2A 4ITIA 3S3IA 4EC9A 5KHWA 3R2BA 5HE0A 3LJ1A 5KMKA 3KK9A 1YWVA 4JX7A 3QXPA 5CU0A 5DI1A 4FSTA 4X7QA 5LWMA 3HDMA 3HEGA 4EQUA 2X8IA 2V5QA 4RZVA 3QGWA 2VWWA 4GUEA 4DGGA 4YPSA 5JGBA 1U5QA 1JNKA 4E6AA 4WO5A 2B1PA 5CNOA 4U40A 4XJ0A 5EW9A 2W4OA 1NVQA 3KEXA 4BDGA 3ZM9A 4AFJA 5T68A 4KUJA 4D1SA 5A6NA 5J7BA 3HP2A 3K54A 2A27A 2F2UA 2OJIA 2CKEA 2VX0A 3DBDA 3DK7A 4FTCA 3PIZA 4QTCA 3R9DA 4O22A 3EFKA 1YXTA 3QD3A 3ZRKA 3EL7A 4FUYA 4H36A 3DV3A 3OWJA 1P2AA 2DYLA 3COIA 5IEYA 1M7NA 3GT8A 4NH1A 4P4CA 5ETIA 2W1ZA 2PE2A 5LVMA 4FGRA 4FV3A 3QCSA 5AM7A 1WZYA 1OIUA 4TRLA 4TWPA 2C6DA 4ZTLA 1XWSA 2PMNX 2VTTA 2WZJA 2XKDA 4IC8A 1PXKA 2X6EA 4IDTA 3PY0A 5IA2A 5DG5A 5FBOA 2BPMA 4C2WA 2J0IA 1G3NA 1Q24A 3MW1A 3F61A 2O65A 2QKWB 3IO7A 3FXWA 4MXCA 2UZUE 2P3GX 3T9IA 1WCCA 4PWNA 4ZZMA 2C47A 3FC1X 4CD0A 1J7LA 3G15A 2UZNA 3BHVA 1SNXA 4BGGA 1R78A 4FEQA 5EM5A 1PKGA 4HJOA 2R3FA 3TZ9A 4NEUA 4FV5A 5LVPA 3C50A 5FBNC 3VF9A 3QD0A 4MX9A 4X2GA 2C3JA 3LQ8A 3NW5A 2CNVA 3S2PA 1OIRA 3TZ7A 3D0EA 4EH4A 1YOLA 2SRCA 4GW8A 2OJFE 3PIXA 3JS2A 2R7BA 3R22A 2PULA 3HUBA 3OWKA 4S31A 4UMUA 1REKA 2VTLA 4ASXA 5HD4A 2R7IA 2GU8A 3FMHA 3O2MA 4YSMA 3ZU7A 4C62A 1IEPA 1Y91A 5KKRC 2Y4IC 2ZOQA 4WG5A 3ALOA 5TO8A 2C4GA 5FM3A 3BEAA 4O7ZA 1JWHA 1YI6A 2E9NA 2VZ6A 4BGHA 5DMZA 1QL6A 3VIDA 2B9IA 4ANBA 3GC8A 4OTPA 2GHGA 4FVQA 5AMNA 4EWHA 4L43A 3EKKA 3R63A 3IECA 3P4KA 4NTTA 4R78A 4QMVA 4ZY6A 4WBBB 4B9DA 5CU4A 5I9VA 3UP7A 5I9YA 1K3AA 4O7TA 4LGDA 2BHEA 4XG6A 3PJ8A 1NA7A 2VAGA 4QP1A 4TNBA 4IX3A 1BUHA 1AGWA 1DM2A 1H08A 3PXYA 5AP0A 2E9PA 5GJGA 4ZTSA 4CFUA 3QHWA 4RWJA 4EONA 3BYVA 4QTEA 4IACA 2V7OA 4I4FA 4RGJA 4QMMA 3U6JA 4KIKB 5CY3A 4CYIA 4IC7A 2VTMA 3FBVA 4QP7A 3A2CA 5H8BA 4CXAA 2VO3A 4FKTA 1OPKA 1Q8TA 1YW2A 3F9NA 2OXDA 4HNFA 2XNPA 5ETAA 2LAVA 4AA4A 4G6OA 4DH5A 3BE2A 3R8PA 3Q4CA 4G6LA 2Y6MA 4OR5A 4XP2A 5TT7A 3T9TA 3RAHA 4RQVA 3R28A 2A1AB 5CVGA 4ENXA 3PSBA 4CFWA 5EDRA 3TL8A 1PMUA 5HNBA 2NNWB 2HY81 5CI7A 4I6FA 4A4XA 4K33A 4NTSA 4GCJA 2ITUA 3DAJA 1GNGA 4FK6A 3PRIA 3C4ZA 4NU1A 5AR2A 4O7NA 3D4QA 3BHTA 1FQ1B 4C58A 3UIXA 5L8LA 4L00A 3DQXA 2EXCX 2VWIA 5FXRA 4O0WA 4EHZA 2P2HA 4YZ9A 2O2UA 4AZEA 3QCQA 4KRCA 4RWIA 5EDPA 5JZNA 2R3OA 4AW5A 4ACHA 4WD5A 4ZTHA 3W55A 3OEZA 4JR7A 4GRBA 4L44A 2XKFA 2A2AA 2R3KA 2PZ5A 3ZSIA
chains in the Genus database with same CATH superfamily
2R9SA 3PP0A 5HCXA 4C3PA 2VTNA 4MTAA 4KWPA 3P0MA 3LMIA 4MEDA 4F6SA 3W33A 1KUTA 4W8EA 2IJMA 2WNTA 4FKQA 4BICA 2ESMA 5KMIA 4QQCA 3MIYA 4QRCA 2C6KA 3PVUA 4I0TA 4IWPA 4XUFA 1WBSA 1ZLTA 2OW3A 4CV8A 4F64A 1WVXA 3EMGA 2V22A 3FLZA 3NYNA 1WVWA 4FVPA 2WQMA 4B99A 5BYYA 3KREA 4FT7A 4RPVA 2JGZA 4CZTA 1OI9A 3HA8A 4E6DA 5KUPA 3V04A 4U6RA 2XYUA 4M15A 2EB3A 4LGHA 4QPMA 3BLHA 1UNGA 4PP9A 4XG7A 3PUPA 5HKMA 1GY3A 2VX3A 4M97A 5I3RA 3FZTA 4HYSA 3NRMA 4BCJA 2P55A 5EQPA 4QOXA 4RIYB 3R7GA 4PY1A 2NYAA 4FL3A 3TJDA 4FC0A 2X9FA 4L3PA 2WXVA 4UZHA 3BLAA 2W4JA 4PL5A 1Q5KA 2O64A 3LXNA 5HBEA 1KOAA 4FSWA 4UYAA 3W1FA 3W2QA 2G15A 2JEDA 4FKVA 3V6RA 4IB0A 2RFSA 4K1BA 2CHLA 4O2PA 4YBKA 3H9FA 2UW7A 4M0YA 5K5XA 3UYTA 4AW1A 1T45A 5AJQA 3D5VA 5HIBA 4JR3A 4O82A 2YZAA 3UMWA 3SC1A 5HG7A 5ETFA 3VS4A 1Q8YA 1H28A 2HK5A 2JDRA 4ACMA 1YHVA 4ACCA 1H25A 2HZ0A 3CXWA 4KIQA 4E4NA 3DQWA 2C6OA 3KF4A 3SW4A 4QMQA 3KCFA 4CYJA 5C8KA 3CQUA 4WRSA 3TUDA 4CEGA 3GCPA 5A54A 4PQNA 2NP8A 4QTDA 4NFMA 2QNJA 3FMLA 2BMCA 3FZSA 4FVRA 5D7VA 5CEOA 4K9YA 5EYCA 1YRPA 3CY2A 3EL8A 1F3MC 4D2RA 1M7QA 2PK9A 4DTBA 3JVRA 4K77A 5M4IA 1NW1A 3P5JC 2ETMA 4I1ZA 4G17A 2PVNA 2YITA 4ERKA 2PVHA 2W5AA 2ITWA 3O50A 4A9YA 2BAJA 3V8SA 1SYKA 3DPKA 4LMNA 1KSWA 3KXNA 3OEFX 3R6XA 4Q5HA 5KMOA 4PNKA 4UYNA 2OWBA 2YM8A 4FTKA 3MYGA 5ANGA 5HLWA 3DDQA 5ANIA 4WSQA 4OUCA 2J5FA 3CTHA 3A4OX 2Q0NA 4M7IA 1UNLA 3NEWA 2JC6A 4HOKA 1MRYA 3VRYA 4JG7A 5T3QA 1Q4LA 1UKIA 5AP7A 3TIYA 2UW4A 4QQJA 4FGBA 3VBQA 3N4VA 4O7YA 4FEUA 3RINA 4YSJA 3TKUA 1PXMA 2B52A 2VTHA 3TT0A 4EKLA 3DBFA 4NWMA 4E20A 1PMNA 3Q96A 5LWNA 4OBPA 2XK3A 4S32A 3LOKA 2VRXA 3VUIA 3DS6A 1A9UA 2CGVA 1U54A 3I6WA 2H8HA 2R3HA 4FMQA 4FYOA 2XK7A 4IH8A 5B7VA 1ZWSA 1BI8A 3KCKA 4BF2A 5E4HA 3D94A 2B7AA 2UW3A 3TDVA 1ATPE 4RVLA 4L67A 1CM8A 5IZFA 4FV1A 3JUHA 2Z7QA 1W0XC 1LEWA 2JITA 2HXQA 4RVMA 4CQGA 4CT2A 5HORA 1QPDA 4UX9A 4Z3VA 3D7TA 4FEWA 3LKMA 4F09A 2UW0A 4HGTA 4UZDA 3WBLA 1NVRA 1YXVA 3F5PA 4FV4A 5AV2A 5CF6A 4U3ZA 3ZSHA 5CAQA 2PL0A 2XNOA 3QGYA 5HX8A 4FZAB 3P08A 4GIIA 4BJJB 3C4WA 4W8DA 4EH6A 2XEZA 4U79A 3EQPA 3H4JA 4V0GA 2VTRA 2QU6A 4D5KA 4D2WA 4BBEA 5A4QA 3LJ0A 2OZOA 4X3FB 3DA6A 1BX6A 4ZJIA 4OAUC 2Y4PA 3ULZA 3ZRLA 5JFWA 1VZOA 5CLPA 4O38A 1ZY5A 2ACXA 4BTFA 1H1RA 4YC8A 4CV9A 3P7AA 2DQ7X 3QRIA 2OU7A 2CGXA 2IN6A 4FKLA 4X2NA 3GNIB 3W2PA 4U45A 3TACA 3PP1A 5HTCA 5GNKA 2ERZE 2W05A 5BUEA 4MCVA 2OZAA 3BU6A 5AUVA 3E92A 3QUEA 4OT6A 3V5QA 1OL6A 5CYIA 3KULA 3E3BX 4Z7HA 3CGOA 4OLIA 4U80A 4DGMA 3UPXA 5AR5A 3VRZA 3N4TA 2UW6A 5J5SA 1KOBA 4X0MA 3A7GA 4QMPA 1IRKA 2IZUA 4F1TA 3SW7A 4LV5A 4TZRA 3AT3A 4ANNA 4CQEA 4ZY4A 4I5CA 4MWIA 4NM7A 3RKBA 5IF1A 4YBJA 4YTCA 4QP8A 4FG7A 1GIHA 3F3VA 3RHKA 3E62A 3LHJA 2W96B 2DWBA 4NSTA 1YI3A 3AC3A 5EI6A 3ZSIA 2B53A 3EHAA 4DBNA 4TW9A 4PPBA 5I0BA 4CTBA 4I93A 4Q2AA 5DRDA 2ITZA 5M08A 4L6QA 5CAPA 5JSMA 1FINA 4V05A 5IQIA 4FKRA 5D12A 3W8LA 3H10A 3TG1A 4EOPA 2BR1A 1Y8YA 4FZFB 2JAVA 4QTBA 4QYHA 4RX9A 3ZFXA 3ZHPC 3UMXA 4CKJA 3DOGA 3MA3A 2X2LA 4QTAA 1A48A 3G33A 3V5LA 2BTRA 2GFCA 3GCVA 3L9LA 4L52A 4E4XA 2WMRA 4PV0A 4ALWA 3MTLA 4RJ6A 4Q9SA 4QT1A 5EHOA 3DB6A 4R3RA 4D2PA 2C5XA 2WELA 1WMKA 4F78A 2FSLX 4F4PA 1WBPA 5M55A 2HY0A 4ZXTA 5H3QA 5L2WA 3MS9A 3ODYX 1GZNA 4O0VA 2C1BA 2RGPA 3HRFA 3TKHA 2RSVA 1GZKA 4IWOA 4USEA 4DYMA 1H0WA 4BB4A 5CANA 2PE0A 3KKVA 2C3IB 2Y8OA 2YN8A 2I6LA 3AG9A 5KMLA 1VYZA 4IE9A 4DT8A 1QMZA 3A8XA 3FLYA 4AAYA 3QZFA 4OTIA 3U9CA 5AP1A 4CFVA 3NCZA 4Y95A 4XCUA 3QD4A 4ZY5A 4O0XA 3EN6A 2W9ZB 5H2UA 3II5A 3QYWA 2R64A 4RJ5A 5HTIA 3ZUUA 3GC9A 4FV9A 2ZFYA 3UDBA 2ZDTA 3THBA 5A3XA 4QDVA 4GH2A 1P5EA 2QOIA 4KIOA 3VQUA 3MIAA 2C5VA 3S1HA 1K2PA 3IK3A 1XH8A 4ZS0A 3RM7A 4C7TA 1XKKA 3IW4A 4Y5HA 3MJ2A 4BDCA 3JYAA 2RIOA 5M4FA 4M13A 1MP8A 4ID7A 2R3RA 3F3ZA 3LFAA 2Z7RA 2W5BA 3WF9A 4DF3A 2ZYBA 3L8SA 2WIHA 1ZARA 3LM0A 3OY3A 2VD5A 3P78A 4AXCA 2J50A 3CTQA 4M67A 4NK9A 4FSRA 4X2FA 4F6WA 2QLQA 5JQ8A 4FE2A 4JDJA 4LQMA 1OUKA 5E9EA 4I6QA 2H96A 4V01A 1NY3A 3ORPA 2V7AA 4FT0A 3R7VA 3FI4A 1I09A 2YERA 5DEWA 3FQHA 3LLAA 4TYIA 1FMKA 2ZM3A 2OIQA 5AEPA 5M06A 2JBPA 3R8UA 3BGZA 5JMSA 3FAAA 4NIFB 4XYFA 5FTOA 4I3ZA 4F08A 4I4EA 2C30A 4MAOA 4U3YA 3ZBXA 1W2FA 2CLXA 3G90X 3TYKA 3E8DA 4DFLA 1OL2A 3C4EA 2VTJA 3M42A 2PMLX 4PDPA 4EKKA 3MVLA 3QCXA 3V5PA 4QMYA 3NUAA 2ZM4A 3IW7A 3QBNA 4JX3A 3ZLWA 4MD9E 4X6RA 4Y85A 3ANRA 4HPUE 4MNFA 3UC3A 2B9HA 2BDFA 2HW7A 3OOGA 4RJ8A 2W17A 2YDJA 5A46A 2FVDA 1PMEA 4DT9A 5HU3A 4ACGA 2A4LA 1V1KA 3AC8A 3NFFB 4MNEB 2XUUA 4ZEGA 4CRLA 4YZBA 2GTNA 3DJ5A 3R8ZA 2CNUA 1J3HA 4MVFA 3COHA 3NW7A 3W0NA 5AUWA 4DEDA 3ANQA 2ETKA 5BVKA 5EOBA 4APCA 5CAOA 5ANDA 3GU5A 5ANOA 1HCLA 2XVDA 3DBCA 2VO7A 3HKOA 5FEEA 3GGFA 3K2LA 2O8YA 3AOXA 3UIMA 4RIXB 5FTQA 4X3FC 3M11A 3PFYA 4CMOA 5EQYA 3L9PA 3FLSA 4MBJA 2E9UA 3VUTA 5C27A 3Q9WA 3TV6A 3V5WA 4BDDA 5GINE 1S9IA 4DITA 1UKHA 2HW6A 4TWOA 5EFQA 5GZ9A 3OBJA 4BIEA 3BKBA 4WG4A 4BDKA 2F2CB 5AV0A 5HE2A 4A07A 4GT5A 4D4RA 5ICPA 3R7UA 4RWLA 3EQRA 2IVVA 4I22A 3JPVA 3QTWA 4I5HA 3GOPA 3NYXA 5BYLA 1YHSA 1PXPA 4I20A 2YAKA 3BZ3A 4C38A 2WMVA 4LL5A 3VN9A 4JRNA 2YAAA 4C34A 2BHHA 3RCJA 2FH9A 4YJTA 3UOHA 4OTGA 3GU4A 3VS5A 2YM7A 3OT3A 3E63A 3W2SA 2VUWA 2XJ2A 3O7LD 4JNWA 4KD1A 3KN5A 3R7OA 4ASEA 3EKNA 3MBLA 1WBOA 4LOQA 4OTHA 3SRVA 2UZEA 4XRLA 3GC7A 4AT5A 4M12A 4U7ZA 4IDVA 2BIYA 2JKMA 5E1SA 3N9XA 3T8OA 4F9AA 3L8PA 4EYJA 4B4LA 2IVUA 4S2ZA 3QA0A 4B6LA 3ZMMA 2PHKA 2OIBA 4YHTA 5HEZA 2BKZA 4BRXA 4M8TA 3ZLSA 4FT9A 3R8VA 3LXPA 4CZYB 2X7OA 2WQBA 3NNXA 4GK4A 5AP3A 2EXMA 3A99A 2WMBA 5DBXA 5HE1A 3FMDA 3V6SA 3OXIA 5IEVA 3W0RA 3GCUA 1GJOA 3HV6A 4ALVA 4HVDA 2J2IB 3RI1A 4IEBA 2I1MA 4C33A 3OROA 3LMGA 4EH5A 1H1PA 2XH5A 2ZDUA 1Y57A 5JN2A 4IM2A 2YM3A 3MFRA 4FYNA 4U81A 3CC6A 5CASA 3ZXTA 3JY9A 2GS7A 3PY1A 4WRGA 3WF6A 2DUVA 4RFZA 4AGUA 1U4DA 2BRNA 2LGCA 4R1YA 5G6VA 3DTCA 4C0TA 2YCQA 4RBLA 4BBMA 3A8WA 4F0IA 3G9LX 5CEPA 3A7FA 4FTIA 4HVHA 5I5ZA 4C37A 1JAMA 2XRWA 3E87A 4EUUA 3OS3A 4IWQA 1TQIA 4YZDA 5LVLA 5BMSA 4FIJA 3MH1A 1DI8A 3E93A 4N70A 4BDIA 4XX9A 3KQ7A 1RQQA 3JY0A 4B7TA 4AQKA 3VHKA 4FI1A 4TPTA 4D1ZA 1OBDA 1IASA 3U51A 1XBBA 1YOMA 4GJ2A 2I0EA 4O7LA 1VR2A 3Q2JA 4FF8A 2FYSA 1BLXA 1UNHA 4IAIA 2GHLA 3QX2A 1XMLA 4PMSA 4YJQA 4F7SA 3TNHA 4APPA 5HIEA 3UQCA 4LV7A 1OVEA 3ACKA 1W83A 4JL9A 5J1WA 1XMMA 2UZDA 2G1TA 3AC1A 1FVVA 4GIHA 3BEGA 5CEIA 1DI9A 3IPHA 3QQHA 5HVKA 4OTWA 5E1EA 4JAIA 3ZLYA 4XLVA 3UGCA 2EVAA 4E1ZA 4CG8A 2OJ9A 3IW6A 3Q6WA 3PZEA 4FTRA 1WBNA 3UJGA 1YDRE 4XV9A 2VWYA 5EM8A 4D2TA 5KMMA 4AZWA 4DLIA 3GI3A 2GSFA 2VNWA 2XNMA 4WIHA 2YCFA 4E4MA 5BVFA 3PSCA 4NM0A 4AACA 5HOAA 2W1EA 4UBAA 1EH4A 3QTUA 5CU2A 5C1QB 5HI2A 3PRFA 5E8SA 5C01A 5FRIA 2FSMX 1I44A 1JBPE 3QTZA 4JBPA 3LCKA 4XP0A 4DEAA 4DHJA 2CSNA 3CJFA 2GNLA 2OKRA 3R7IA 2PZYA 4F9WA 1Q8UA 3LFBA 4KABA 4RG0A 3HV4A 3REPA 1H26A 5A6OA 3UDSA 1YWRA 1GIIA 4TYHB 3PJ1A 3ZO3A 3Q9XA 4HW7A 5AFVA 4KKGA 3BV2A 5JKGA 5CTPA 2GQGA 1OZ1A 4JQ7A 4Q5EA 3CKXA 4F6UA 4FA2A 3BI6A 3BHYA 3BGQA 4ZK5A 4EORA 5CS6A 3IOPA 5CWZA 5CF5A 3EFLA 4PPCA 4MHAA 3EWHA 4ZMEA 1J1BA 3PVWA 4RMZA 5HTBA 4USFA 3UDZA 5TR6A 3U55A 4YTIA 4XG8A 5DOSA 4BKYA 2WU7A 4G5JA 4QPSA 3UQGA 5JGAA 4DDIA 4QYGA 5JFXA 4XNEA 3O8TA 4AXEA 3NIEA 4FNYA 1TQPA 2X0GA 4BHZA 1B6CB 5F4NA 3FSKA 3ZC5A 4YLKA 4D0XA 3V3VA 4EOOA 1CDKA 3NYVA 3G0EA 4KINA 4RT7A 3CSVA 4N6YA 4JJRA 4PTGA 3MWUA 1KE5A 3RJCA 4AOJA 4ZTNA 5B2KA 5C8MA 4L7FA 3MY1A 5LMAA 4G3CA 4IFCA 5HO8A 4EWQA 4GFOA 5HCZA 2RFEA 4ZSJA 3QLGA 1ZXEA 2XP2A 5DWRA 5TKDA 5IU2A 3OY1A 5L2QA 3NVMB 3FKLA 3TTIA 2IVTA 3FPMA 3WZDA 2R0IA 4RLKA 2UW8A 3EFJA 2VTOA 4E6QA 2QOKA 3KMUA 4FIEA 1URWA 4YJUA 2A19B 5KO1A 3VBWA 2HOGA 4YURA 5A9UA 4FIHA 4GEOA 1GZOA 4PMPA 5HNIX 4RJ4A 1TFFA 4P2KA 4PNIA 4YJRA 3NX8A 4NW5A 4HYUA 1G8AA 5ITAA 4AOIA 4J98A 4NW6A 4C4JA 4LRKA 1IG1A 3COMA 1IA9A 3TXOA 2WEVA 4CLJA 5F1ZA 5A4EA 4BI2A 5A4TA 3Q4UA 4GFGA 2JKKA 3LCSA 4EK5A 1YXXA 3P9JA 4L8MA 3O5AA 4QP9A 3UZPA 3IGGA 2JDOA 1WBVA 4RC3A 3GQLA 1TVOA 2VU3A 4GVJA 2E9OA 2R3QA 1NT2A 3PIYA 3S95A 1L3RE 3I5NA 3HRBA 4QP6A 5I9UA 3QLFA 3R01A 1ZYLA 3R9OA 3QQFA 4GL9A 4QQ5A 4YJOA 3VBVA 4HVIA 3UNJA 5FP5A 3MGYA 3HV7A 3LCOA 3UIUA 3BYOA 3RWPA 5AUTA 5A14A 2R4BA 2XKCA 4J71A 4D5HA 1W84A 4QMLA 1YXUA 4BCGA 3SXSA 4EOLA 4QNYA 5EYDA 2P0CA 4Y5QA 1TQMA 4UXQA 4MQ2A 4QYYA 3HAMA 2GCDA 4PPAA 3PA3A 5IUIA 2WQNA 3ENMA 3MB7A 3ORMA 3OZ6A 4K0YA 2BZIB 3W2OA 3L8XA 3W16A 4E5BA 1Q8WA 2OGVA 1OUYA 5EG3A 5M09A 5DVRA 2NRYA 3QF9A 4K11A 1AQ1A 4TTHB 4U8ZA 2XKEA 3D83A 5DRBA 2IEWA 1PHKA 3CE3A 2EUFB 2Y9QA 3D9VA 4H39A 4HCVA 3I60A 3FV8A 2OG8A 4OBQA 3ULIA 4RA5A 3ET7A 4TWNA 5IKWA 1UU7A 4NL0A 4YU2A 1XHAA 2XNBA 3UVRA 4EQMA 4GFMA 3W8QA 4LMUA 3ACJA 1B38A 2X0OA 2WMQA 1ZYCA 3FDNA 3FKOA 4G31A 5BMMA 3U6IA 4ZSGA 4EOQA 3G6GA 3WYYA 4E5WA 2QOOA 1QPJA 4F70A 1UV5A 3HMOA 3KN6A 5EKOA 2YWVA 4QMZA 4UN0C 1FOTA 5AP6A 4IAKA 4XG9A 3EN5A 4XMOA 2XNNA 2G2IA 3FMNA 3Q32A 4W4XA 4CCBA 4MH7A 4WNPA 5JRSA 1IAJA 2Q0BA 4AZVA 5JZJA 2HENA 3VHEA 2YM5A 3POOA 1ZZLA 4WHZA 4YTFA 5J9LA 4UMQA 3PZHA 5EH0A 5GZAA 2A98A 1OGUA 2PYWA 3PFQA 3HECA 2PVLA 2PWLA 4QD6A 5CEQA 3EQGA 4RA4A 3L9MA 4KNBA 4AT4A 4EOJA 4IVBA 5K5NA 2GNFA 3UG1A 2W0JA 3PVGA 4LOOA 4YR8A 2I7QA 1LEZA 2YDKA 2PUPA 4IM3A 4FUXA 2F7ZE 4ERWA 4TXCA 3R1NA 3RAWA 5LVNA 2X39A 3TDWA 3ENHA 3WF8A 2YABA 4J8MA 4L46A 3O8PA 5E8WA 2JFMA 2KTYA 3N51A 4GMYA 5CAVA 1JVPP 4YNEA 3E88A 5H8EA 3WE8A 2W99B 1JKTA 3CY3A 1YKRA 2C5YA 2J51A 3B2WA 3NUUA 4MF1A 4O2ZA 4W4YA 1GAGA 4F63A 2PZRA 1PY5A 2PZPA 3QD2B 3DNDA 5IUHA 1KWPA 4M68A 3ZO4A 2VO6A 4BJJA 2HWOA 4ZAUA 5EKNA 3FMEA 4ASDA 3EB0A 4J8NA 4DC2A 4K6ZA 2H34A 2X81A 3G9NA 5CEKA 4XH6A 2HZNA 4G1WA 4FSQA 5J8IA 2CGWA 3TUCA 1M2PA 3CKWA 3VS6A 2RG5A 3KXXA 1O6YA 2Y6OA 3WYXA 2E9VA 3LQ3A 2OF4A 4W4VA 3IGOA 2QO9A 4YZMA 3IOKA 5FWKK 2J90A 2CN8A 3C1XA 3H30A 4D1XA 3LAUA 4I92A 3NFGB 3R00A 2GQRA 2ITNA 3RK5A 4R5YA 1SZMA 4DINA 3TNPC 3PLSA 3U4UA 4F9YA 4OGRA 1OM1A 3VBTA 4Z16A 2JDTA 2CKOA 4PX6A 5CX9A 5IA0A 3C5IA 1KE9A 2WQEA 3QTRA 5LOHA 4MD8E 5GJFA 2WTJA 3OMVA 2IW9A 4KA3A 4AF3A 1Q61A 3GFWA 4IB3A 3UVPA 2HIWA 3SHEA 4DEHA 4AXDA 4EH3A 1E1XA 3C0GA 4XOZA 4RZWA 2OXXA 2IPXA 5JRQA 4CTCA 3U8WA 3BHUA 3LXKA 4O6LA 3PG1A 4RIWA 3F69A 2WO6A 4IAFA 4K2RA 1P4OA 3ORTA 3UP2A 3OVVA 4O6EA 3SQQA 2BKKA 1WBTA 5FUTA 3VS7A 2ZAZA 5L2TA 2XJ0A 1B39A 4PF4A 4YGAA 5E91A 1YHWA 2ITXA 1LPUA 3SG8A 2BZHB 3F5XA 4J52A 4CFMA 5BVEA 2J7TA 3C4XA 4QMNA 4AWIA 2KULA 4Z7GA 1YXSA 2BCJA 3ETAA 2XF0A 1RDQE 2HXLA 4QP4A 3KU2A 1JKSA 5IA5A 3UVQA 4D2SA 5EQEA 4P5QA 2W4KA 2V0DA 2WTKB 4JQEA 2XM8A 2VTPA 3CD8A 5EI2A 1PXJA 4DGLC 3VQHA 5LMBA 1OIYA 1UU8A 3P1AA 4UWBA 3GU8A 1XJDA 2PVKA 2F57A 4XS2A 1Q8ZA 5DYJA 4HYHA 4XV1A 3W2RA 5J9YA 3EQHA 2XALA 3ERKA 2B55A 4J1RA 4DTKA 1HCKA 3Q6UA 4BDEA 3QX4A 3MY0A 2FO0A 2ERKA 4C2VA 3CS9A 3WF7A 4WA9A 5AUYA 1FVRA 4C4FA 4F65A 3KC3A 2UUEA 3OUNB 4I0SA 3UE4A 4FTMA 2Z7SA 5GIPE 5K0KA 4YUQA 1ZOEA 1NVSA 2CLQA 1Q99A 4FKOA 2C6MA 2BFXA 4PUZA 4M69A 4K18A 3RK7A 3VWAA 3MESA 2V55A 3GEQA 3W0SA 1OB3A 1FPUA 3T3VA 5G1XA 3SX9A 3BBWA 3BV3A 4GT4A 4TYGA 2ZV2A 2Q83A 5KE0A 4Y83A 4AZFA 5L2SA 1OL7A 3P23A 4W9XA 2BZJA 1ZOGA 2ZMDA 2FSOX 4ALUA 3BHHA 3CLYA 4EH7A 4DFBA 3DAKA 4R3CA 4XBRA 2OI4X 4WNMA 3UBDA 4BWPA 4TL0A 5TE0A 5AUUA 3FZPA 3AD6A 5C9CA 1OGYA 4GG5A 3QQUA 5IQGA 4OBOA 1UU9A 4QNAA 5AUXA 1LUFA 3MFTA 2XARA 4O4BB 4J97A 3FJQE 4QMXA 3JR1A 3ODZX 3PE2A 2QO7A 5EHLA 4HCUA 3TUBA 3FLWA 4BCKA 4BVUA 5KBRA 4PTEA 4HGSA 2C69A 4UB7A 3LFNA 4OTDA 4FSZA 4KKHA 2YIQA 2YLEA 3GU6A 5EW8A 3FSFA 5D7AA 4O1OA 2VWZA 2Z7LA 4O0TA 2WHBA 4MD7E 4NUSA 3EJ1A 4FIGA 4AE6A 1ZOHA 2WEIA 4A9TA 3G6HA 1M17A 4IB1A 1ZMVA 2ZVAA 3SXFA 5HVYA 4BY9E 3KA0A 4EBWA 4L01A 2XAOA 2XBJA 3OHTA 4TT7A 4FBXA 3PPZA 2QR8A 5DPVA 3CPCA 3A4PA 3B8QA 4C3RA 1H24A 4I24A 5F20A 3QTXA 4ZJJA 4H3PA 4AZSA 3NDMA 4ZIMA 2W1IA 4MXYA 1PMVA 3OP5A 1NXKA 3AMYA 5J9ZA 3RM6A 3AGMA 3GU7A 3WIKA 2EU9A 3BLRA 4DN5A 4EH2A 4EYMA 3Q04A 2BVAA 2QD9A 3HNGA 4ZTRA 4F1OA 3R9HA 3LFDA 4IB5A 2YJSA 4JG8A 5GHVA 3A61A 2QVSE 3F88A 4FZDB 1E9HA 4C61A 1FVTA 1PYXA 3OCBA 2X8DA 4RC4A 3VUGA 1A06A 3WE4A 2JKQA 3DXNA 4H1JA 4AA0A 5IA4A 5JH6A 3VS3A 4UMTA 1FGIA 1Q3DA 1SMHA 3MH3A 2C68A 5CSXA 4A4LA 3FZOA 3VUDA 1UA2A 2A0CX 3OCTA 5D1JA 5DR6A 4ACDA 4HVGA 4BYJA 2YACA 2GNJA 1J91A 3R8MA 4G16A 2BROA 3VS1A 3MPTA 2HYYA 1OKVA 1SM2A 2OBJA 4QQTA 2QU5A 4FKPA 5IMXA 5L8KA 4OW8A 2C3LA 3MVJA 2WTWA 4X2JA 3FZRA 4ASZA 5M07A 2YM4A 3OW4A 4J96A 3VW8A 4ZS4A 1KE7A 3NR9A 2ZJWA 4U97A 3C4FA 3OTUA 4YC3A 3NYOA 5KZIA 2XCHA 5CSHA 3TN8A 3OFMA 2P2IA 3I0QA 2W7XA 1R3CA 2CN5A 3BLQA 5CVFA 3QQJA 5CXHA 4C36A 4BFMA 2QCSA 4D0WA 3AMBA 5FXQA 3VVHA 4E3CA 2WMAA 4EC8A 4FICA 2JIIA 3V01A 4LRMA 1R1WA 2XIRA 1U54B 3UOJA 3DTWA 3ZZEA 3B2TA 1PF8A 5ANEA 1CKJA 3C51A 5AADA 4ONAA 5CENA 3POZA 3QL8A 1ZRZA 2J9MA 5BPYA 5EOLA 2O5KA 3C13A 2QHMA 5D9HA 4R7BA 3I5ZA 4N0SA 1IR3A 4RVKA 3D7TB 2GHMA 4E26A 5A4CA 3HDNA 1LR4A 3BWJA 4FSUA 4EZ5A 4I5PA 4BGQA 2JDSA 3ROCA 2X8EA 5KMNA 2GNGA 3RPRA 4V0GB 4JXFA 3GENA 4O7VA 2XZSA 4BWXA 3ZC6A 4ZMFA 3L8VA 4QYEA 3HZTA 2GQSA 3DXPA 1Y6BA 3LZBA 4I94A 4LGGA 3EZVA 4JDKA 3KFAA 3BCEA 5AR4A 5B0XA 4G9RA 4XV3A 3DKOA 3RALA 1JQHA 2X9EA 3OUKA 4FK3A 3TJCA 1ZMUA 3HYHA 5HNGA 3C0HA 3FEGA 2P33A 1YOJA 4XOYA 3BGPA 3DXQA 3Q4TA 3RP9A 3RTPA 2F4JA 2PVJA 4CFXA 2OZAB 4MK0A 4O0RA 1LP4A 1FBNA 3QZIA 4JDHA 3RNIA 5EHYA 2UZWE 2QLUA 3E5AA 4WNOA 4AN3A 3KULB 4UWCA 4C35A 4CLIA 3UNKA 3HAVA 3EN9A 5DA3A 2F7XE 4JQ8A 4DLJA 1PXNA 3RPSA 2X2MA 4QO9A 3UO6A 3R1QA 4IVAA 4AXAA 2R3PA 1KV1A 4IIRA 2X4ZA 4O81A 1M2RA 4USDA 2CJMA 2PMOX 5AIRA 4AGDA 3DFCB 4A4OA 2OIDA 3FL4A 4ANMA 3A60A 3F3WA 1OBGA 3Q9ZA 3ML1A 3ZZWA 1CMKE 3HLLA 4XG3A 4ENYA 4XP3A 2VV9A 5FD2A 1U46A 4CKIA 2R3JA 3LVPA 4IXPA 4YP8A 3KF7A 3HL7A 3E3PA 3HX4A 2OO8X 3Q2MA 4JBVA 4EK3A 1XBAA 3PA5A 4O0SA 2XCKA 3ZOSA 1Q3WA 5DLSA 4NJDA 3WIGA 4EK4A 3QTSA 5DHJA 2XEYA 4QMSA 5CVHA 5M4CA 5E8ZA 5M4UA 4YZNA 3UODA 1OITA 4JI9A 5J1VA 4AZTA 3WARA 3K5UA 3IDCA 3KMWA