1OKYA

Structure of human pdk1 kinase domain in complex with staurosporine
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
288
structure length
281
Chain Sequence
PQPRKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSPANFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEYLIFQKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTPPKLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-PHOSPHOINOSITIDE DEPENDENT PROTEIN KINASE 1
publication title Structural Basis for Ucn-01 (7-Hydroxystaurosporine) Specificity and Pdk1 (3-Phosphoinositide-Dependent Protein Kinase-1) Inhibition
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 84
structure length 281
sequence length 288
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2003-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1okyA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1okyA02
4EOKA 1SZMA 3WF8A 3T9TA 4CVAA 1U5QA 3GC9A 4IDTA 2JKOA 2QKWB 2XIZA 5J7BA 5M51A 3NWWA 3DNEA 4ASXA 3R6XA 2R3QA 4PDYA 3ZHPC 3U6HA 5J5TA 5HCYA 4AW5A 3NAXA 2R3LA 2BRNA 2J0KA 3CQWA 2YDJA 4N57A 1UWJA 2IN6A 2O0UA 4N6YA 4IB3A 1WVYA 3UC3A 4G2FA 4ZSGA 4DFXE 1IASA 3ORMA 4TYGA 3MPMA 4A9YA 2ITNA 5E8SA 5KHXA 3ZM4A 4QQCA 5E1SA 4ANMA 3MDYA 3WZJA 4MHAA 4AA5A 2VD5A 4F7LA 4JG7A 1TVOA 4TXCA 3Q5IA 3AD4A 3GCQA 3C0IA 2Y6OA 4CCBA 3ALOA 3SDJA 3WZUA 1ZWSA 3LLTA 4U41A 4MEDA 2ZDUA 4YZBA 3TUBA 4D2TA 4GU6A 2XK9A 1H1RA 4TRLA 1AGWA 3HP2A 2W1FA 4YHTA 2XNEA 4PPBA 1WVWA 2ITOA 3EB0A 3F3WA 2NRUA 3QTXA 4M3QA 3PPKA 2J0JA 2YJSA 1JKLA 1U54A 3PJ2A 4RSSA 4D1ZA 4QMLA 3TUCA 4UMPA 2XK8A 4F65A 2YIXA 2PTKA 4H1MA 4M69B 2RIOA 4GUEA 4AGWA 5A54A 1E9HA 1W0XC 2GHMA 4RJ8A 4RVKA 3T9IA 3HKOA 5I0BA 1UKHA 2YACA 5AAGA 4PL3A 4J8MA 2O5KA 2R7BA 2XUUA 5FP6A 2CN5A 2I6LA 4BCHA 5LVMA 1Q3DA 5AAEA 1XH7A 4G3FA 3RINA 5IUGA 1SVHA 4RFYA 2VTSA 1QPJA 3P0MA 3U4WA 1F3MC 3OD6X 4HCUA 2B1PA 2ERZE 2ETMA 2OXXA 4IDVA 2CGXA 4EOLA 2YITA 5I9UA 1SYKA 4IACA 5KUPA 4FV0A 5C26A 3VO3A 3KVXA 2C5OA 3MH2A 4BF2A 1VEBA 4PF4A 4O1OA 4N6ZA 4WG4A 4TWCA 3FKLA 2GTMA 5HTBA 1VZOA 2BHEA 4BIDA 3ENMA 1AQ1A 2Y4IB 4FT9A 2VV9A 5CENA 4Q9ZA 3SA0A 3PVWA 1H0VA 5JSMA 1GJOA 4EYJA 3QALE 4QP7A 4X2KA 3MY0A 4JDKA 2AYPA 4L3LA 2IW8A 4GRBA 4O0XA 1VYWA 4YO6A 1H1SA 4CLJA 2ZVAA 4JBOA 2P3GX 5DT4A 4ZEGA 3Q52A 3DK7A 4EOIA 1ZYCA 4QMMA 4YSJA 4FIEA 2WTCA 2UW9A 3R71A 4RWIA 5CALA 3W2CA 5IQHA 1WBSA 3GC7A 2B9IA 2ZJWA 4PTCA 3OROA 4ACCA 5GZ8A 5CQUA 5IQCA 4FTRA 3V6RA 4JXFA 2F2UA 1OL7A 3D7ZA 3O8PA 2W7XA 3NYOA 3ZSIA 3CS9A 4MXZA 4DTAA 5EHOA 3LQ5A 1R0EA 3BLHA 3HMOA 5KMLA 2OF2A 4F70A 1KV1A 3SW4A 5HBEA 3LFNA 4YC8A 4FT5A 3SGCA 1ZY4A 4WNKA 3AGMA 1OIYA 1RW8A 3F66A 3UJGA 3ATTA 5LVPA 5E9EA 3BEGA 3QXOA 4B7TA 2VX3A 3W32A 2R3IA 4XJ0A 4L68A 3CTQA 4QMOA 3MFSA 4G9RA 5J9LA 4RWJA 4XNEA 1OPKA 3QBNA 3ZOSA 5H9BA 2WMQA 3UMWA 4V01A 2W5BA 4C62A 3Q4CA 4Q2AA 5M09A 2J5EA 4EZ7A 4MXAA 1BLXA 2Z7RA 4BDEA 2WMWA 4XYFA 1UU3A 4NKAA 3TV7A 4F7SA 4AQCA 4GT4A 3NIEA 3KC3A 3U55A 3W8QA 2UW0A 3A2CA 2FSMX 5L8JA 2VWYA 3GGFA 4ZP5A 1Q8ZA 5IF1A 4KUJA 5JGDA 3F5GA 3CY2A 2YM6A 4W4VA 4FE2A 4Z16A 4U3ZA 4O7RA 3E5AA 4H3BA 3W2QA 4F9CA 4CV8A 5HLNA 2Z02A 2WQEA 2CDZA 2HXLA 3Q04A 3RPVA 4ERWA 1TQIA 3QX4A 4Y5QA 4FZDB 2WMXA 2ESMA 2UZTA 2X2KA 3E92A 3EYGA 4KKGA 3HAMA 3WF9A 1G8SA 1E1VA 4R1YA 1J7LA 5ETFA 2OJIA 1BI8A 2VO6A 4AE6A 3AT2A 5M4IA 1PXPA 2ZOQA 4M0YA 2DQ7X 4E4MA 5IUHA 2CCHA 4GG5A 4MTAA 2VGOA 3G2FA 4ORKA 4YJQA 4RX8A 2IWIA 2WIHA 5ANDA 3QUEA 1BUHA 3PYYA 4X6QC 5A4EA 2O64A 2WMUA 4I22A 5C1QB 5HU3A 1ZMWA 2PE0A 3OCGA 4ACMA 3AMBA 4V04A 5LCJA 1WBWA 4C34A 2GHGA 2CNQA 1MQ4A 3HUBA 5TOZA 4I21A 2JLDA 5D9HA 1ZARA 5C8NA 4C35A 2GMXA 3BHHA 5EKOA 4JOAA 1O6KA 3QTIA 2JDSA 3PRFA 3OHTA 1W83A 4FTUA 4FV6A 2KULA 2XCKA 1B39A 3HLLA 4FBXA 4C4EA 1Q8UA 3I1AA 3GQIA 3BI6A 4FSMA 4MBIA 3KMMA 4XG9A 4CFFA 3ORKA 4O83A 4LM5A 2Y7JA 3RHXA 5IA5A 3SG9A 4OTFA 3I0QA 5AR5A 3UOHA 4WIHA 3HV4A 1M17A 3V5LA 4IM0A 3C50A 2C6KA 4D9UA 4E4LA 2X4ZA 1M2RA 4IB5A 1KOBA 4XV1A 4FK6A 2IZUA 1OVEA 1Q8WA 2CPKE 2I1MA 3QC9A 4ACHA 5J7HA 4HNFA 3HRCA 3QTWA 4GFMA 3K2LA 4AS0A 5H8BA 4OTIA 5L2WA 4L3PA 2HCKA 3EQBA 4I3ZA 4FSTA 4R3RA 2H6DA 3K54A 4JG8A 3QTUA 4BCJA 2I7QA 2OIDA 4X3JA 4XRJA 3HDMA 4K11A 2OW3A 4L45A 4KAOA 2ITQA 5AR7A 4AU8A 4DTKA 4MH7A 1H08A 4P5ZA 4XV3A 3VF8A 2VNWA 3OWJA 3ZEWA 2BDWA 4WG5A 1JQHA 3O8UA 4G1WA 4ANSA 1TKIA 4NH1A 2J50A 3KREA 2BILB 4N4SA 1V0PA 3CLYA 3JXWA 4G34A 4WUNA 4EH5A 4GKIA 3QUDA 3PSCA 2QO2A 2XYNA 3H4JA 3TNWA 4EHVA 3DCVA 2R3MA 3QZIA 4L3JA 4YJOA 2CKPA 2J0MB 2WTVA 3PUPA 4BICA 3ZXTA 4D5HA 2C6MA 2NO3A 1Q8TA 1JSTA 1CSNA 2O65A 3SQQA 5M53A 5HIEA 5CT0A 3FMHA 2YZLA 3IPHA 3EL7A 4WSYA 3LM5A 3ZZWA 5HTIA 4NJ3A 1YVJA 2ZB0A 3OWKA 4GJ2A 4LOQA 5ANIA 5AUYA 4EZ3A 5AEPA 4C7TA 2C6LA 3U6IA 4QMXA 5AP2A 4DAWA 5G1XA 5LMKC 5DLSA 5FXQA 4RJ4A 5BX0A 1OUKA 1CKJA 3OXIA 4ZTLA 1WMKA 2C6TA 3TNPC 5KMKA 3BU3A 2BZHB 4E6DA 4BGQA 5EYCA 3R9HA 5CASA 4QP8A 3OG7A 2DWBA 3ZLSA 1YWRA 4XG7A 5J79A 4IXPA 1WFCA 3G90X 3ETAA 4DCEA 3WARA 5TO8A 5CWZA 2FYSA 3KRJA 2NP8A 3C1XA 5HE1A 3WYXA 2UZWE 3DK3A 4TZRA 3TV6A 4MK0A 1JOWB 2VTNA 1YWNA 4I1ZA 2UVYA 4FKTA 1NVSA 4LRKA 4OBPA 3ZC6A 3QTQA 3ZYAA 1GZKA 4EOMA 2BRHA 4JAJA 1WBNA 3QD4A 4YJSA 4FT3A 1VJYA 5BVFA 3JY0A 2HELA 1Q3WA 4RX9A 4DITA 4L42A 2UW4A 2VTTA 5KZ0A 5IA4A 2W5HA 4GFOA 4MXOA 4QYYA 4YTIA 2W1EA 1K2PA 3HV5A 3ZFYA 3FJQE 2QOFA 1ZZLA 3RALA 4IMYA 3R1QA 4FKQA 4D2WA 3G51A 3ERKA 2VWZA 4CEGA 1KUTA 2QONA 4RIWB 3OFMA 3FPQA 5C4KA 4KA3A 3FI4A 1JKSA 2VO3A 4BYIA 3R1SA 2F7EE 3RM6A 1R0PA 4BYJA 5CANA 4EK5A 2PMLX 3GENA 4QP3A 3VRYA 3EWHA 2J0LA 2UV2A 3VJNA 4ZJIA 4MBJA 4G3EA 4JR3A 4HVHA 2HW6A 2FB8A 1KSWA 4NTTA 5KZIA 4HYHA 2UZOA 1U54B 1XH8A 2NPQA 3HVCA 4RJ6A 3UO4A 3UOKA 3OY3A 1CKIA 4RLKA 3RBWA 2VWUA 3ORZA 1Y57A 4RRVA 3LMHA 3VBTA 2JKQA 4KIKA 4AA4A 2BRMA 3MSSA 4IZ5A 3FYJX 4FTAA 4AWIA 4IAIA 2C4GA 5CLPA 4BKYA 4ZLZA 3EH9A 3U4UA 5HIBA 4EQCA 5KKRB 2WTJA 3DB8A 4NU1A 4RQVA 4QP1A 3PY1A 4YHJA 5DR6A 3VW8A 5LMAA 5DFPA 3IDBA 4XBUA 4FIHA 4O82A 5EQEA 1JBPE 3D0EA 3C4ZA 2YIYA 4DGOA 3PXYA 4TWNA 4EH9A 4KRDA 3PRIA 2V55A 3DFCB 3E3BX 3FMJA 4FOBA 5DA3A 4BZOA 3EFLA 4EL9A 4NIFA 3VUHA 3VHKA 4IZAA 4S33A 3KCFA 3LFDA 5AM6A 1SNUA 2X2MA 4M7IA 4UZHA 4ENYA 3ZEPA 3R21A 2X9FA 3CKXA 2YISA 5JH6A 3DQWA 4KIOA 3AT3A 4GEOA 4X2FA 3T3VA 3SKCA 4BDBA 4EH6A 4Z7HA 5FXRA 3P7AA 5HQ0A 3UZTA 5C8MA 2JEDA 4G6NA 3RAKA 3KEXA 4J71A 5C27A 5FBOA 2W4KA 3A7HA 4I5MA 3S2PA 2WOUA 1M7QA 4L9IA 3RVGA 3NNUA 3WE4A 2E9OA 1Y91A 3NIZA 3RI1A 2VTIA 3CTHA 4H05A 2C6OA 1R39A 4TWPA 2IJMA 3U8WA 1AD5A 4AZSA 4OTDA 3G33A 3SXFA 4FIGA 1ZLTA 2OZAA 4MNFA 4UBAA 2B9HA 2H34A 4C3RA 1L8TA 3K3IA 3F7WA 4WT6A 3ODZX 4W4XA 5GIOE 2P4IA 3NS9A 3UYTA 4YSMA 4MYGA 1JSVA 3UIUA 3B8QA 3TUDA 4DE4A 3ROCA 4BGGA 4QYHA 5IH5A 2GS2A 4QMTA 3D5XA 3UIXA 4F08A 5T6KA 4EOPA 1Q8YA 5IZFA 4K33A 2R2PA 2XZSA 3O23A 4FSUA 4LGDA 1WZYA 4YBJA 2UZDA 4FVPA 4E3CA 4MVFA 3UNKA 2VTHA 2XM9A 3WIGA 4JRNA 4AW2A 3QX2A 3VUMA 4LUEA 2VWIA 2OJGA 5M44A 1Q5KA 4KINA 2ZV2A 1PXLA 4RVMA 3HMPA 4NM5A 4J52A 3VF9A 4RBLA 5FD2A 3EFJA 5IQEA 3H30A 4HYUA 3L9PA 4ZZMA 3QCSA 1OL2A 3VS2A 3SG8A 5A9UA 1H28A 2YIRA 3D7TA 5B2KA 2YN8A 1XBCA 4HNIA 1OECA 3TZ8A 3W18A 4APPA 5I9ZA 5JEBA 3QC4A 3TNQB 4FK3A 3P86A 2IW9A 4R1VA 4FUXA 4BDDA 1P4OA 1FVRA 3GU8A 4QP9A 3IW8A 5TR6A 3ZSGA 4A07A 4U8ZA 3OOMA 3OXZA 3BYVA 5KCVA 4WA9A 4BVUA 1R3CA 2ZYBA 4CYIA 3R7YA 1I44A 4H3QA 4LQMA 3CGOA 4TNBA 4WO5A 5IA2A 4S34A 5L6PA 3NYXA 4TPTA 4FF8A 3SAYA 4U0IA 3BLRA 3NEWA 1R78A 2ZDTA 2YCRA 3DPKA 4FL3A 2VU3A 3EN9A 3GFEA 2J4ZA 4G3DA 4M12A 5F94A 3OZ6A 3VS7A 2C1AA 4BBEA 4X21A 3TJCA 2OSCA 1E1XA 3ACJA 5M4FA 4BN1A 4RT7A 4BDJA 2C3IB 2WEVA 4K9YA 5HLPA 5B7VA 3WZKA 1PKDA 1G5SA 2WMVA 2YZAA 4Y46A 5D10A 4PPCA 1RE8A 5A6NA 2UUEA 5HX6A 3IONA 4UWBA 5IDPA 4PL5A 4P2KA 1JPAA 1O6YA 4CKIA 2W05A 3QZHA 2FUMA 3Q4ZA 4NFMA 1JKKA 2VTLA 3PE2A 4OLIA 5M08A 3W10A 4Z9LA 4QYFA 3VBWA 4C4GA 5ANJA 3ORIA 2WAJA 3PPJA 3W2OA 2X6DA 4PDPA 4KSQA 2ITUA 3KF4A 5EHLA 3HV3A 4LOOA 1M14A 3ZC5A 3NUAA 4JG6A 2BAJA 1H00A 4LOPA 4X0MA 3AXWA 5M56A 4GW8A 5BUEA 1SMHA 3F5PA 1A48A 3HP5A 4FTOA 2CCIA 4L43A 4FKGA 1CTPE 1PRYA 3RK7A 5AV3A 3QKKA 3SLSA 3DJ5A 1U59A 4BCNA 3HA8A 3F3ZA 3FAAA 3R30A 4F1OA 3MN3A 5EM6A 2ZMCA 3MA6A 3C51A 1NVQA 4QT1A 4E4XA 3VULA 2CNVA 1PXJA 4W9WA 3G9LX 3OEFX 2ITXA 3MYGA 2PPQA 4C3PA 5ANGA 1LEWA 5KMNA 2X2LA 3U51A 3BHVA 2I0YA 2BZJA 4E7WA 4NSTA 2Q0NA 3S1HA 3BYOA 3EIDA 3OWLA 4HVGA 4O7TA 1YQJA 2IZTA 3HYHA 3NUYA 2X4FA 2WTKB 4GT5A 4IAAA 4OTWA 2X39A 3DKGA 4QD6A 4U44A 2F7XE 4AACA 5IH4A 2UW5A 5CF8A 3NDMA 4FV7A 4TYJA 4EHEA 5K5NA 2UVZA 5DR9A 3KCKA 3LPBA 4DFZE 5IA1A 3EN4A 5AUWA 2QOIA 5LWNA 3QGYA 4OTRA 2B54A 3D14A 1LR4A 2WU7A 5FTGA 2YABA 4YHFA 1NVRA 4ZSAA 3A8WA 2FSOX 5A4LA 2VZ6A 4NUSA 2R0IA 2IPXA 3OOGA 1YDTE 5DEYA 3R83A 3ALNA 4C36A 4GFGA 5BVOA 1W98A 2RKUA 3CD8A 3VS4A 1FVVA 2Y8OA 3QUPA 4IADA 4M84A 4AUAA 4FIFA 3FLQA 3L1SA 2R3KA 3LCKA 4R5SA 4A9UA 4UZDA 2CJMA 4JI9A 3ZO1A 4CG8A 3BIZA 1BYGA 4W4YA 4O7YA 2BRBA 3LMGA 5IQGA 5AV2A 1OIRA 4ACGA 4C61A 4J8NA 2C5NA 2ETKA 3ZONA 4QMYA 4DT8A 2WB8A 5HE0A 3UP7A 2Y6MA 4B99A 3R8UA 3DFAA 3KXXA 3VN9A 2WKMA 4FTNA 5DMZA 3F3VA 3FMMA 1KE6A 3KVWA 4ZSJA 3UO6A 3I81A 4ENXA 3P5KA 1H26A 5CZHA 3RNYA 1YHSA 3ZS5A 4DC2A 3BHUA 2XVDA 3P23A 3PIZA 2HY81 5CF5A 2YWVA 1ZZ2A 2RFDA 3O7LB 3V04A 4DLIA 1FQ1B 2BDJA 4XLVA 5FGKA 2BR1A 4EBVA 2XKCA 4QNYA 4AG8A 3PA4A 3IGOA 1O9UA 4HVIA 4TY1A 3G15A 3LKMA 4RJ7A 3PWYA 4DGMA 3UZRA 5E90A 3MW1A 2J90A 2W1CA 1ATPE 5EYKA 3A62A 4U3YA 3FZTA 3MPAA 1GY3A 3VS0A 4CMTA 2XEZA 2OFUA 4EORA 3IOKA 3AD5A 4ERKA 3I7BA 3PDTA 1UNLA 2JIIA 3AC8A 3QRJA 2WEIA 3F3UA 4I4EA 5CSHA 3MESA 4FIIA 4CKJA 2YCQA 5IEXA 4OAUC 3C5UA 2A4LA 3KMUA 3QRIA 4GK3A 4AZFA 5E91A 2OH0E 3N4UA 3DV3A 1XH5A 3FMKA 4UWCA 3KK8A 4JDHA 5DT0A 2NNWB 4D2SA 3MY1A 4NCTA 3R9DA 3CQUA 4AOIA 2FSTX 3VS6A 1P4FA 2YWPA 1QMZA 2C69A 4M8TA 3EHAA 5CU4A 3KXNA 3GQLA 5EDRA 3PLAE 4AT5A 5GJGA 3ZRKA 3UQCA 4KIKB 3R22A 5HKMA 5LMBA 2XKEA 5BMSA 3C4FA 3RNIA 5I3RA 5AR8A 4X3FA 4UX9A 1PF8A 5EI2A 3FL5A 2VTAA 2CGUA 3C4EA 3O17A 3QCYA 5HNBA 3PG1A 5FP5A 4I6FA 3EQDA 4EHZA 4GV1A 4IB1A 5HBJA 2X9EA 3AOXA 3WF7A 2R4BA 2PULA 4OR5A 3MJ2A 4B8LA 5CXHA 3CE3A 4GIIA 2X7GA 2JFMA 1UNHA 1ZYDA 3BYMA 3WIKA 4FKIA 2HWPA 4ZTHA 3ENHA 4RIXA 3BE9A 5LWMA 5A3XA 3I60A 3DKFA 4NIFB 4WUAA 3TIZA 4ZMEA 4AT3A 1APME 4JQEA 4O0SA 4KBCA 3VJOA 5AIRA 1UKIA 4DFYA 4LRMA 3C9WA 3OP5A 1URCA 1BX6A 3PTGA 4IX3A 4TYEA 4M0ZA 5IKWA 2UZVA 3DBCA 4BKJA 3REPA 4FV9A 2QU5A 2E9VA 3DBQA 3UVQA 2VN9A 2YM4A 4GK4A 1H27A 4PRJA 2C6DA 4RMZA 5GHVA 3MFRA 3ZRLA 3KXMA 2OLCA 3NCGA 2YLEA 4PTEA 4W8EA 4GYIA 3Q3BA 5AA8A 5BYZA 3ZMMA 4AXAA 3W55A 3LFSA 3ZFMA 4BBFA 1PXMA 2VWXA 2Z2WA 3LXKA 4LV5A 5BUJA 4NK9A 4G3CA 3EKNA 3FZPA 4RX7A 4DGNA 2OZAB 4GKHA 4IWDA 4Y95A 4MD7E 4XUFA 2GFSA 5I9VA 2WZJA 3JR1A 3FPMA 5IISA 3COKA 4D2RA 4FTMA 3SHEA 3P7CA 4DYMA 1QPDA 3T8OA 3MVLA 4F9BA 3WOWA 3ZFXA 1W7HA 4P5QA 1NT2A 2ITVA 2W1ZA 3BGPA 3EQGA 4IZYA 4MQ2A 4ANNA 4P7EA 4O1PA 4FTJA 4EONA 2V0DA 3L9MA 2QU6A 2YM8A 2X0GA 1ZYSA 3UIMA 3FBVA 3MWUA 4FG7A 4JIAA 4G9CA 2I0HA 3PZEA 4HCVA 4D28A 2J0IA 3F9NA 4O22A 4NWMA 4BDHA 2CSNA 4AZTA 4J97A 2WTIA 2YAKA 3FZ1A 4D9TA 5CU0A 3NW6A 2CMWA 4J7BA 3DJ7A 4U45A 5EG3A 3W8LA 2J51A 4AGUA 4CQGA 4YPSA 1OL5A 4E5BA 3R2YA 3KA0A 4IZ7A 4RZWA 4L53A 3F6XA 4D1XA 4EUUA 3LQ3A 3KRLA 3R04A 3O51A 4JDIA 3PJ3A 5AV1A 2GQGA 4L00A 3ET7A 2B4SB 3D7TB 3H10A 5AR3A 4PMTA 4XV2A 2G9XA 5DG5A 5I4NA 2VAGA 4XLIA 4QQ5A 1VYZA 3FZRA 5EW8A 1XJDA 3MV5A 5AP0A 3AG9A 3UC4A 3WBLA 3EJ1A 3BZ3A 3COIA 3GI3A 1OGUA 4HZRA 2UZLA 3ANRA 4IAYA 2UVXA 1MP8A 3VUKA 1PHKA 1OM1A 3FC2A 4ZJVA 2WMAA 5L4QA 4CG9A 4ID7A 4H58A 4FTLA 2R3JA 4BCOA 2GFCA 5HCXA 3ORPA 4FZ6A 1Y6BA 3V01A 5KMOA 1GNGA 2OJ9A 2JGZA 3TIYA 1R1WA 2OH4A 3UO5A 4EOJA 2X7FA 2PHKA 2QOOA 3PY0A 4IAKA 4TYHA 2PVYA 4CMOA 5HBHA 5CEKA 4TKSA 1I09A 5DHJA 5AP1A 2CHLA 4WKQA 3RPYA 3FC1X 4IVDA 2WELA 3QA0A 5CEIA 3ZZEA 4H3PA 2R64A 4WBBB 4K18A 4YU2A 3KQ7A 2HAKA 5HNIX 2YHVA 4FVRA 1XHAA 4KS8A 2HZIA 3R63A 3VS3A 4QOXA 5AV4A 3K5VA 3UG1A 4FEUA 5BYYA 4DLJA 4CKRA 5CSPA 3HRBA 5JGAA 5K3YA 4ZTMA 5IDNA 3QD3A 3H3CA 3LQ8A 3KB7A 4RWKA 4XOZA 3QKLA 2XNGA 3WYYA 4LL5A 4D0XA 2PMIA 4RIYA 3DDPA 4TNDA 3FMLA 2I0VA 4CSVA 4O2PA 4YZDA 5KMIA 4IX4A 4BWXA 3WI6A 4XG3A 4A06A 2Y0AA 4AP7A 4BZDA 4KBAA 4DG3E 5IMEA 1P2AA 4A7CA 2C3JA 4ASEA 4I0SA 2ZM3A 3TTJA 2ITPA 3NUSA 4C8BA 4U9AA 2FGIA 4FEQA 3UQFA 5FDXA 4BCGA 1J1CA 5HNGA 1A06A 3DK6A 4FX3A 4QPMA 2OBJA 4QTAA 4M67A 5AP3A 3ZO3A 5HOAA 4KWPA 5K0KA 2X8DA 3JY9A 1YDSE 3KXGA 1YXTA 4DF3A 3BPRA 2PUNA 4AF3A 4LL0A 4N0SA 2JBOA 2HXQA 4FI1A 4HCTA 1IR3A 4O0VA 4BBMA 2P33A 1GZ8A 4QQJA 1XR1A 5HZNA 4UWYA 1PY5A 2P55A 4E26A 1OZ1A 2BHHA 2BZIB 2UZUE 3HMMA 3I7CA 1F0QA 4YLKA 2YCFA 3AC2A 3ZTXA 2H96A 4NW6A 4ZLOA 4QPAA 5AR2A 4U43A 3QYWA 1T45A 4W4WA 2V22A 4IJPA 1JLUE 1WCCA 2DS1A 1W82A 1M52A 3DXPA 1FMOE 4PX6A 2X6EA 1GOLA 3PE1A 4DEEA 3TM0A 3NYNA 2IVVA 4FEWA 3D83A 4IAZA 4CFVA 3ZUUA 4D4SA 3ZM9A 3FHIA 4B8MA 4O86A 4F64A 3DBEA 3HRFA 4O96A 1FINA 3SXSA 4PP9A 1B6CB 2RSVA 5DR2A 3R7VA 3BGQA 2UW8A 3WF5A 4C2WA 4AFEA 1M2PA 4OT6A 2GDOA 4PY1A 4E1ZA 3ORXA 3NMUF 4NEUA 5FWKK 2YDIA 4TL0A 5IH6A 1M7NA 3POZA 4QQTA 3D5WA 1K3AA 2LAVA 3OF0A 4EEVA 3ATSA 2C0OA 2YM5A 3BYUA 2WPAA 4JAIA 2GSFA 2XK6A 3S95A 4C3FA 1DAYA 3GFWA 2BAQA 3E8EA 4IWQA 5GZ9A 3GEQA 5KBRA 4GUBA 3ZH8A 3A7IA 1ZY5A 2C47A 4EJNA 3R1YA 2A2AA 3UZPA 2EU9A 4PTGA 4XMOA 2QODA 3V5PA 2QD9A 2WGJA 3AGLA 5CAPA 4QMSA 2E9PA 2XRWA 3HDNA 3P79A 3Q53A 3E62A 1G8AA 4IB0A 2GNGA 2BIYA 4CRSA 1Y8YA 3NUXA 5E8VA 1G3NA 3L8PA 3ZUTA 4DEDA 1Q99A 4I4FA 5EYDA 1CKPA 3E88A 4RWLA 4PNIA 4EH4A 5CU6A 4JBVA 4JRVA 2E9UA 1SVGA 2BTSA 2O2UA 3L8SA 4OW8A 5EM7A 5HIDA 4BI2A 2UW6A 3WE8A 4EBWA 3N4VA 2WD1A 2ZV7A 3OMVA 3FXZA 4YJTA 5IEYA 4OT5A 1YHVA 2DUVA 4HJOA 3PFQA 2ZMDA 5EQYA 3UOLA 2QOLA 3EQPA 4ZLYA 3PA3A 1UA2A 4O6LA 4XX9A 5DWRA 4Z3VA 3QCXA 4BI1A 5BUIA 3KXHA 4DEIA 5D12A 5JK3A 2VWVA 2BPMA 5CYIA 3PPZA 3TJDA 4DH5A 2GNJA 3F2NA 2BKKA 4UALA 4BDIA 2R3FA 2OZOA 3O0GA 3OT3A 1YOJA 3QWKA 4EWQA 4XV9A 4PP7A 1GIJA 5A14A 4YJVA 5CNNA 4DFUA 2XIYA 4HZSA 2A1AB 2JBPA 3EOCA 4E5WA 5HVJA 4KIPA 2X8EA 4X7QA 5CVFA 4X2GA 3IW4A 4ITIA 4D4VA 2IG7A 4BDAA 4ITJA 4R3CA 3ZLYA 4YTFA 2ZV9A 4DH7A 2WMTA 2W99B 4FKOA 2JAVA 4BIEA 4F1MA 3CGFA 2OIQA 3HECA 5E8XA 2HK5A 4BCMA 5HE2A 2C3LA 3LW0A 4C2VA 4YLLA 5EOLA 3PJCA 4NKSA 5E4HA 3VUIA 4X3FB 2C5XA 3TZ7A 3H9FA 2RFNA 1UNGA 4L44A 4BR3A 2WQOA 2ONLC 3CC6A 4D55A 3R2BA 3U54A 1W84A 1Q24A 4ITHA 3EKKA 5HO6A 3D2IA 3CBLA 3Q9WA 3CY3A 4XOYA 3C0HA 3GU7A 4M68A 3TG1A 3QRKA 4YMJA 5JT2A 1NXKA 2F4JA 2WOTA 5BPYA 4AE9A 4RJ3A 5ACBC 3BCEA 3HUCA 3RP9A 2OG8A 2BRGA 3MVHA 3BEAA 4LMNA 4NJDA 4Y72A 3JVSA 4G3GA 2W1HA 3MFTA 4JQ8A 3QD2B 4RIXB 2VX0A 1QCFA 4U42A 1OPLA 2C3KA 5KNJA 2Z7QA 4AA0A 3OS3A 5I3OA 3TI1A 2Y4IC 2XRUA 4ACDA 5L6WL 5CAOA 1FVTA 3A60A 5D11A 5J5SA 3KULA 2W1GA 3QQLA 1PKGA 3QL8A 3GCVA 3ZUVA 3DBFA 2QC6A 5CEQA 1V1KA 2GQRA 3DXQA 2HZ4A 2O63A 4J98A 4KIQA 5JGBA 4FEXA 3FI8A 5C4LA 2XBAA 3KGAA 4CD0A 2XNMA 3U9CA 2YERA 1Q97A 2P2HA 3H0YA 4LI5A 3SC1A 3V5TA 2QHNA 2ZB1A 4GCJA 2XNBA 2XCHA 5AUUA 4IVCA 4JIKA 4OTGA 2HOGA 2I0EA 3PY3A 4FV5A 3R00A 4R6VA 5ANEA 1ZAOA 3TXOA 3GU6A 3KRRA 4I93A 5LMKA 2GCDA 4EQUA 4UMUA 3ZRMA 4WNOA 4FUYA 2WXVA 3FV8A 4FL2A 3IK3A 4LGGA 5ACKA 3ELJA 1H0WA 5DBXA 3E8DA 5AP7A 4J96A 4J1RA 2HY0A 2Z60A 3GOPA 2XEYA 3M42A 2ERKA 5AP6A 3A7JA 3LCSA 2IVSA 3A8XA 5JRSA 1YKRA 2REIA 3W2RA 3E64A 4DHFA 4K77A 2BMCA 1ZRZA 4A4XA 5CEPA 4BWPA 4CFWA 3QRUA 3NGAA 2Z8CA 4DBXA 2WQNA 4A9RA 4XS2A 5HO7A 4ANOA 3TCPA 2XM8A 5IQDA 4U7ZA 1OITA 5J95A 5L8LA 4EK6A 3RK5A 2X81A 3DAKA 4RVLA 3LLAA 1DS5A 2PZPA 3VBXA 2UZBA 4O0YA 4B6LA 3LIJA 3HX4A 1WVXA 3O2MA 4M69A 4PPAA 5LVOA 3HGKA 5K4JA 3D94A 5F9EA 2ONLA 3F7ZA 4Z55A 2PVKA 3H9RA 3FQHA 3UDBA 1QL6A 5LOHA 3EZRA 2QKRA 5AAFA 4DINA 1JKTA 2QG7A 4G5PA 4PMPA 5J1VA 1WAKA 4BHNA 4S2ZA 2UZEA 3ACKA 1PYEA 4EHGA 5KMMA 2GS6A 3JUHA 3W2SA 4DTBA 4U5JA 3W16A 4ZTQA 2PMOX 2QLQA 2HENA 3A7GA 5HG7A 1BL7A 3Q9ZA 4QMQA 4FKJA 4MXYA 3CJFA 4P90A 4USEA 5JMSA 1KWPA 3ZSHA 3KN5A 5DVRA 4JQ7A 3F5UA 4BTJA 2DYLA 3GC0A 3FSKA 4O2ZA 4FV8A 3PP1A 3MS9A 3BQRA 4TYHB 1UU8A 4Y5HA 2AC3A 5BNJA 1PXKA 1UU9A 2W5AA 3UBDA 3QQGA 1FMKA 3FY0A 4QMPA 4XP0A 5E8WA 2B55A 3DBDA 3R1NA 1YI3A 4PUZA 4FNXA 5EYMA 5LCKA 4RG0A 4FKWA 3Q4UA 4KSPA 4O21A 5TE0A 1P5EA 1TQMA 1MRVA 2G2IA 2YAAA 3P9JA 4IWOA 4EYMA 1ZMUA 4O0WA 3RCJA 3RJCA 3JS2A 4F63A 1H1PA 4M66A 2R3HA 5CI6A 3UQGA 1FPUA 3BX5A 5EH0A 2B7AA 3VHEA 2G2HA 3UGCA 5EW3A 3FKOA 4FV2A 4KBKA 1YI6A 3QQJA 4BRXA 3ITZA 5CQWA 3H9OA 4ZZOA 2CKQA 3C4XA 5CAQA 4IFCA 2YLFA 3Q9YA 1YW2A 4IJ9A 2I40A 3RCDA 2B52A 4HPUE 1YOMA 2YA9A 3R7GA 4OBQA 4XH6A 4V05A 4NYEA 3E87A 3E8CA 3E7OA 4EWHA 2CKEA 3DZQA 2BIKB 5ANKA 3BWFA 1FBNA 3KY2A 2VO0A 3I5ZA 3BELA 1K9AA 2WQBA 1J91A 3CJGA 5A6OA 5KHWA 3OCBA 2PSQA 3NW5A 3P08A 5IU2A 5FUTA 5CNOA 3ZLWA 2VTMA 4YC3A 4FNZA 4I0RA 2PY3A 4EZ5A 3C0GA 5JRQA 3QAME 3NNWA 2XNOA 2OXDA 4CGAA 5AMNA 2V62A 5BYLA 1HCKA 3BU5A 3A99A 3D2KA 3KK9A 3F61A 2PZIA 3CKWA 3TACA 2XA4A 4D4RA 1ND4A 3LFCA 5J9YA 4CQEA 3UPZA 2QR8A 3VC4A 4B4LA 4FKVA 2O3PA 1MQBA 3QRTA 2GNLA 3KRXA 3NLBA 2OGVA 2F49A 3OC1A 2JDTA 5FTQA 4ANQA 4UV0A 5M4CA 3Q2JA 2XIKA 1ZYLA 1BL6A 3RPOA 2P2IA 4FKRA 5E1EA 2XYUA 3WILA 3DKCA 1OMWA 3BQCA 2PZ5A 1UWHA 5BVWA 4ZMFA 4C57A 1CM8A 4YO4A 3E8NA 3SD0A 3TKIA 3UVRA 4R5YA 3MPTA 3MI9A 4F7NA 5IQFA 4A4LA 3QQFA 4PMSA 4X2JA 3V8WA 1HOWA 5DT3A 1Q4LA 3V5JA 3CP9A 2OIBA 2VNYA 2YCSA 3HMNA 3IW7A 5D7VA 4M15A 5GZAA 4CNHA 5GJFA 4FG8A 3QQHA 5EM5A 3A4OX 1OBDA 3R0TA 4NTSA 4LV8A 4QP2A 5JFVA 4RC2A 4XEYA 3ZU7A 1H01A 1XKKA 5CVGA 4TW9A 4BZNA 4S31A 4QPSA 4FTKA 4CFMA 1B38A 4QTBA 4MWHA 4O7SA 3P1AA 1MUOA 1H24A 5M57A 1Q61A 2XK4A 4F9WA 4FGBA 5LVLA 3LM0A 5EI8A 5KBQA 3LVPA 4FIJA 5A46A 3KU2A 4M97A 5E8TA 5CT7A 3S0OA 3NUPA 4AX8A 4O91A 5HORA 3IOPA 4YPDA 3ANQA 4E6CA 1XO2B 5IQBA 4FZAB 5HVKA 3VWAA 2C6IA 3V8SA 4EC8A 3A7FA 1SM2A 5CF6A 1GZOA 3RWQA 4EOSA 3R9RA 4AZWA 4E73A 2IZRA 4AAAA 4KKEA 4CZUA 2OU7A 4XCUA 3TL8A 3UMXA 2EB3A 3ORLA 4BGHA 2GTNA 3D4QA 3NNVA 3MTLA 5AFVA 5CS6A 4JL9A 5IMXA 4UMTA 3DAJA 3DA6A 3LCDA 5IUIA 3V6SA 3AMYA 5L2QA 3UIBA 3BWJA 5JKGA 4IC8A 5F20A 4DFNA 3DAEA 3CD3A 3BRBA 3M1SA 4JX3A 2PE1A 4ZK5A 2YFXA 3CPBA 5FLFA 2PWLA 1UV5A 5I9YA 3KRWA 5DNRA 3T3UA 2BUJA 4M14A 3JPVA 4Y8DA 2JDVA 5FM3A 4ZS4A 5CVHA 1YI4A 2W1IA 3DDQA 2V7AA 2QO9A 2Y9QA 4RLLA 3IO7A 2R5TA 2C6EA 5HD7A 3ZDIA 3GOKA 5EW9A 4S30A 4D1SA 4UN0C 2OJFE 3Q6WA 4L52A 3OBGA 3QQKA 4RIOA 4ASDA 4FVQA 3KL8A 3R8ZA 4PDOA 5CAUA 4C02A 2QHMA 5FM2A 2IW6A 2YEXA 3F3TA 5HHWA 3QGWA 3S4QA 3G6GA 3THBA 3V3VA 3DB6A 4U97A 5KKRC 3MB7A 5HO8A 5AV0A 3CEKA 2QO7A 4MXCA 1PMNA 3QLFA 4ZSLA 2BKZA 5DN3A 1PW2A 5BVDA 3QXPA 1P14A 4EH2A 2VTJA 4IM2A 3I0OA 1JNKA 1LP4A 1XBAA 3FYKX 4FICA 5HICA 4R7BA 2JDRA 2R7IA 5EHYA 4HW7A 4GJ3A 3OW3A 2OFVA 3LAUA 3LFEA 5HG9A 2VUWA 2OKRA 4R3PA 3KULB 2JKKA 5CU2A 1OKWA 2YM7A 3AC1A 4WD5A 5J87A 5M55A 4WRGA 5TT7A 3OUKA 3QU0A 3RZBA 2V7OA 4JBPA 3Q4TA 4BDKA 4EQMA 4DT9A 4CTCA 4D58A 2HZ0A 4Q5HA 3G0EA 3QLGA 2ZM4A 4C58A 4F9YA 2VX1A 5ETCA 3NRMA 4A9TA 2RG5A 2BVAA 2O8YA 3EN6A 3GVUA 5ITAA 3L8VA 4FTTA 5L2SA 3TT0A 3KFAA 4AW1A 4ANBA 4FV3A 2XK3A 2EWAA 1X8BA 1EH4A 4RZVA 2BCJA 2X8IA 2WTDA 3A4PA 3HMIA 4HGEA 3V5QA 3OXTA 4YTCA 5D1JA 4FG9A 4Y73A 4IE9A 3C7QA 5LJJA 2R3NA 3R8LA 2W4JA 3LJ1A 1SNXA 4YNOA 5A4CA 3HV7A 4C0TA 2CLXA 5KMJA 3DJ6A 5B2MA 5FEDA 3UNZA 4IQ6A 4IEBA 4AZEA 4GT3A 4RIWA 2RGPA 3AQVA 3FKNA 4FTIA 4IW0A 3O8TA 1ZMVA 3DS6A 3MH1A 2WIPA 1UU7A 2P0CA 1OBGA 3ZBFA 2W4OA 1IAJA 5BVKA 4L6QA 4EI4A 4IFGA 4K6ZA 5DEWA 3LZBA 5DI1A 4NM3A 2Y4PA 3R7IA 4MF0A 3GU5A 4I20A 3BU6A 4QMWA 3TEIA 4E20A 1QPEA 3I4BA 3IDCA 4XHKB 4YGAA 4QMZA 3Q2MA 4XBRA 5AA9A 3GUBA 4NFNA 2CN8A 2PUIA 3IQ7A 2UZNA 5HI2A 2C0TA 4QTCA 3S00A 3ULIA 1U46A 3FXXA 4HGSA 4PV0A 4UB7A 3RKBA 3MIAA 1ZXEA 3G0FA 2C1BA 2XK7A 2CGVA 2W06A 3FI2A 4XG8A 5DRBA 5FXSA 4EOQA 4TT7A 3VVHA 1DM2A 4G31A 4S32A 4IVBA 4MNEA 3NW7A 1U4DA 4I24A 4YUQA 2XBJA 4LFIA 3DNDA 2E2BA 3TDVA 4OTQA 5FEQA 3B2WA 3TKHA 4AGCA 3CSVA 4ALUA 3GB2A 2C5YA 4LYNA 3NUNA 5CSVA 3KXZA 3R7OA 5FQDC 4HOKA 3UOJA 2C0IA 1YDRE 4L01A 2CGWA 4JS8A 5E7RA 3G6HA 2YIQA 4NL0A 1KV2A 1OPJA 4EUTA 5C8KA 1NY3A 1RDQE 5AJQA 2BROA 2BFYA 3L9NA 3R73A 1MRYA 2XIXA 2E9NA 1NA7A 4I92A 4L8MA 4NT4A 4HVDA 4YLJA 3RGFA 4EK4A 2XJ2A 3EMGA 4WBOA 3SV0A 2AUHA 3LFFA 3R8VA 4CLIA 4AOJA 3LFQA 1KE7A 4ZY4A 2EXCX 1H07A 5LXMA 4RFZA 4J99A 4IH8A 3UODA 1LUFA 1OKZA 4CXAA 2QOBA 4O81A 4UYAA 3CQEA 1KE5A 4ZY6A 4B0GA 2NRYA 1J3HA 3LJ2A 2F9GA 5G6VA 5D41A 3E3PA 3EYHA 4FV4A 1M2QA 3RPSA 3E93A 1HCLA 5H3QA 2G1TA 3DOGA 4XG6A 4YNEA 4O27B 4PDSA 5M06A 2VWWA 5DYJA 3HA6A 1VR2A 3ODYX 2HYYA 4F09A 3DTWA 3FUPA 5EK7A 1H4LA 4FT7A 4RJ5A 1JSUA 4RX5A 1OI9A 4TYIA 2XJ0A 3GNIB 4H39A 4RFMA 2XMYA 4WOVA 4ZZNA 4NW5A 2QQ7A 4PNKA 4E8AA 4OGRA 1PMEA 3BHTA 4QMNA 4FC0A 3NSZA 3RK9A 3EZVA 5JQ5A 4ANLA 2W96B 2QURA 3FDNA 5T68A 3DY7A 2WTWA 4OTPA 5KE0A 3FXWA 1URWA 5J8IA 2VTRA 4ASZA 2WMSA 4Z7GA 3IECA 2PVJA 4CZTA 2YDKA 2ZV8A 1PXOA 5AUTA 4TN6A 4JDJA 4UYNA 4E5AX 3U87A 4MKCA 2FVDA 5C9CA 5GIPE 5F95A 2HZNA 3FEGA 2XKDA 5H8EA 4ZY5A 5CEOA 4OBOA 5AUVA 2WU6A 1KOAA 2YM3A 3DLSA 1IEPA 4DEGA 2EXEA 4C4FA 4I5HA 5AADA 3SVVA 2JAMA 1XQZA 4O7LA 4FOCA 3E7VA 2ZAZA 4DH1A 2R3RA 2WTKC 4BDFA 2G2FA 2JDOA 2GNFA 2V5QA 3QF9A 4UY9A 3D15A 5HCZA 3C4WA 3PIXA 3O71A 3RAIA 4FEVA 3PXKA 3VNTA 3IGGA 4F6WA 4A4OA 4XP2A 3D9VA 3WZDA 1XWSA 2H8HA 3FHRA 5BQ0A 4O38A 1GZNA 3DTCA 2PE2A 4DA5A 2G01A 3R28A 3UE4A 4ALWA 4BL1A 1Q62A 5JZNA 5JFXA 2PUPA 4F0GA 2F2CB 4HYSA 1OIUA 4R7IA 4C4HA 2BAKA 2UW3A 3VUGA 1GIHA 3PSBA 5BVNA 4D2VA 1WBOA 2GPHA 3VAPA 5EI6A 3FLNC 2JKMA 4RQKA 3VUTA 1PMUA 5C01A 1BKXA 4BWKA 1H1QA 4ONAA 5K5XA 2WMRA 2FSLX 2PYWA 4E6QA 4K0YA 4QNAA 5EM8A 3TKUA 4ZIMA 5A4TA 2VGPA 4DFLA 2A27A 3OW4A 4ZS0A 4YTHA 4FNYA 3E63A 2B9FA 4PMMA 4BY9E 3ZO2A 5FDPA 3QWJA 4BTMA 4B9DA 5E8UA 3SW7A 1U5RA 4YJRA 4I0TA 4L46A 3HNGA 3DU8A 4USDA 3RPRA 4RC4A 4BDGA 3GC8A 4O0TA 2X7OA 4I41A 3EQIA 3FLZA 4IHPA 4JX7A 4DGGA 3Q6UA 4QP4A 5FTOA 3OUNB 5CSXA 3IS5A 4V0GA 4A9SA 4WHZA 3ZO4A 3Q96A 4W9XA 1CMKE 3FQSA 3IG7A 5DIAA 3GU4A 4KABA 3RTPA 2R3GA 4EC9A 2ITZA 3NX8A 5E8ZA 2OJJA 4BCFA 3U6JA 3NNXA 5EDQA 5E92A 1V0OA 4FGRA 1DI8A 1F5QA 1H25A 3VBVA 4F0IA 3JYAA 5LARA 4E6AA 4DEHA 3K3JA 4GG7A 2OO8X 4YJUA 3PP0A 5GINE 2ITYA 3I79A 3OVVA 3MTFA 3AT4A 3FZOA 4E4NA 4TWOA 5AM7A 4KKHA 2WQMA 3DZOA 1ZOEA 3HV6A 2EXMA 2QNJA 2VTPA 2W1DA 4O7VA 5LQFA 5BMMA 5CI7A 4K2RA 3G9NA 4FSYA 1Z57A 3KKVA 1IRKA 4FTQA 4W8DA 4KRCA 2C30A 4I6HA 5HESA 2HWOA 2SRCA 5T3QA 3QHRA 4BCKA 1PXNA 4I6BA 3NR9A 5CEMA 4EOOA 4EK8A 3F69A 4CZYB 1OIQA 3RMFA 5ANOA 3MH3A 3GCUA 3VBYA 4ZAUA 3C5IA 2WO6A 5L8KA 3LCTA 2F7ZE 3SRVA 4C37A 3ROYA 2OF4A 2GHLA 3PA5A 4TTHB 5C03A 3MFUA 3O96A 1JAMA 1NW1A 2JD5A 3ORTA 4FKSA 1ZYJA 2R0UA 1O6LA 4Y85A 5CSWA 2XNNA 2QOQA 4O6EA 4YBKA 2JITA 1JWHA 5AP5A 4KS7A 2PUUA 3PG3A 2QOHA 5AP4A 2EUFB 1YXVA 4RPVA 3TZ9A 3HEGA 3FSFA 5JFWA 5I9WA 4EK3A 1YOLA 2GNHA 4GYGA 4MD9E 4OUCA 2PL0A 3IKAA 3W1FA 3OBJA 3FY2A 1Y8GA 3O7LD 4RGJA 4F4PA 5HLWA 3VQUA 4LMUA 5J1WA 2X1NA 5JFSA 3BV2A 3G5DA 5HG8A 4GVAA 3EFWA 4QP6A 4ZTNA 4HYIA 5EQPA 3N4TA 4C4IA 3ZBXA 4HVSA 4UMRA 4F6UA 2Z7SA 1TQPA 3SOCA 4D4YA 4WNMA 3TWJA 3IW6A 1DI9A 5HGIA 5J9ZA 1V0BA 3ZXZA 3I6WA 2VTQA 2PVFA 4YZMA 4MX9A 3VQHA 3MY5A 2R3PA 3F82A 4PL4A 3PJ1A 1PXIA 3NCZA 3PXQA 3EQFA 4IWPA 1DAWA 5BVEA 3CTJA 3VUDA 5ETIA 5AX9A 4KD1A 4AZVA 3Q5ZA 1ZOGA 4BCIA 3LMIA 1GAGA 4K8AA 4JVGA 3BBTB 4RC3A 3R9OA 3LOKA 4CV9A 4YURA 3BE2A 1OL6A 3KMWA 5DRDA 4EH8A 3QA8A 2GQSA 3P78A 5F1ZA 4APCA 4FODA 2PVLA 3NPCA 2W9FB 3H0ZA 2CLQA 1PJKA 4UXLA 3PLSA 5F4NA 1WBTA 4GVJA 3RHKA 4JLCA 2ETRA 4O7ZA 1OKYA 3GBZA 1LPUA 4I5PA 4CT2A 4O84A 4J53A 4FYOA 1Y6AA 3P4KA 2ACXA 4WG3A 4AT4A 2XH5A 4ZJJA 2OXYA 3CXWA 2GS7A 4EKKA 4IC7A 4FV1A 4FYNA 3ZDUA 5AIKA 4CRLA 3AC5A 1ZOHA 3BBWA 5HU9A 1BMKA 1FOTA 2PVMA 3EN7A 5IPJA 5I9XA 4AGDA 2HW7A 4GL9A 4X2NA 4GMYA 3QFVA 4ALVA 3I6UA 2R3OA 1L3RE 1MRUA 4MNEB 4NZWB 5AUXA 5AUZA 4ZXTA 2QVSE 4MCVA 4GU9A 3B8RA 3ZCLA 4BFMA 2XS0A 1IG1A 2BFXA 3WZEA 3FMNA 4QTDA 2JC6A 5TF9A 3RAWA 4EJ7A 3QHWA 2JIUA 1PMVA 2J7TA 5KX8A 3GP0A 5CTPA 3V51A 3COHA 5FRIA 4U79A 4DEBA 5ICPA 3QKMA 4XG4A 4CTBA 3R01A 2QLUA 3CCNA 4MD8E 3DXNA 4QMUA 4G17A 4JT3A 5B2LA 4PQNA 4YP8A 1OL1A 4G5JA 5HE3A 3MVJA 4ZTSA 3ZLXA 1S9IA 3FLSA 3PXZA 3R8PA 3BGZA 2PK9A 4NM0A 4F99A 4F6SA 5IA3A 1YHWA 3UNJA 2RL5A 2IVUA 3OEZA 3RWPA 4YJNA 4AOTA 1IAHA 5AR4A 2B0QA 4G6LA 3FWQA 3QQUA 3ORNA 2W17A 3PIYA 4J95A 4JR7A 3TN8A 3GT8A 2Q83A 4CFUA 3EFKA 2BALA 1XBBA 1Z9XA 2VTOA 2G15A 4C33A 5TKDA 4AN2A 3PXRA 4IVAA 4PWNA 4Q9SA 2PVHA 2XB7A 3R9NA 4FZ7A 4MWIA 4H1JA 4R7HA 4L7FA 3BYSA 1IA9A 3QTRA 2XP2A 3KN6A 4Q5EA 1YXUA 3EQCA 5CF4A 3OTVA 2VO7A 2W0JA 4CCUA 2J9MA 3MBLA 3FL4A 4FKPA 4GK2A 4F1TA 2J5FA 3BV3A 2OICA 4BDCA 3N9XA 1J7UA 5GNKA 4AN9A 3HL7A 4C59A 4DN5A 5K4IA 4RA5A 3MA3A 5E8YA 3V5WA 3P7BA 4L67A 3POOA 5M07A 4CYJA 2H9VA 1YWVA 4P4CA 3DT1A 4BC6A 3LXPA 4HGTA 4QYEA 1REJA 2XJ1A 2RF9A 5L3AA 3BHYA 4GSBA 5JN2A 4I5CA 5H2UA 3SOAA 4AW0A 3LCOA 3DQXA 5H8GA 3NVMB 3DGKA 4I94A 3MH0A 3L8XA 5AWMA 5HX8A 5I5ZA 4ZSEA 2PZYA 3U9NA 4QMVA 2IZSA 3IDPA 3DLZA 5A4QA 4QRCA 4XG2A 3R7UA 1CDKA 3Q60A 4RIYB 4FKLA 2PVNA 4QO9A 4FL1A 1LEZA 2IO6A 3FMEA 3HZTA 4FKUA 1FGIA 2PVRA 4RA4A 3TNHA 3WF6A 4C4JA 4CT1A 3TDWA 4XP3A 4F9AA 5KO1A 2VWBA 3O50A 4JNWA 3QTSA 4U40A 4YZCA 4G6OA 5CX9A 5CY3A 2J2IB 5HVYA 3VS5A 4E93A 3D5VA 5DPVA 3BLQA 3OCSA 3PVBA 4YZ9A 5FBNC 1KE9A 3VRZA 3FQEA 4R8QA 4FSRA 3FLYA 3M11A 3NZ0A 4DGLC 4ARKA 3LJ0A 4MQ1A 4KB8A 2ZM1A 1QPCA 5L2TA 3PVGA 2C68A 3D5UA 3UTOA 4FNWA 3KF7A 5CZIA 1WBVA 2QCSA 5EFQA 4JBQA 5FEEA 4HPTE 4BI0A 4FA2A 4DCAA 3FMDA 3PXFA 4IIRA 4DH3A 4O7NA 3R7EA 4CFXA 2KTYA 4NM7A 3EQHA 4KNBA 4DBNA 3EL8A 1SVEA 4BKZA 2R9SA 3CR0A 1YRPA 3TZMA 2PMNX 2QOKA 3GCSA 2LGCA 2XNPA 2IVTA 4OTHA 3OCTA 3QZFA 2W9ZB 4UEUA 3F88A 3COMA 3MIYA 1W8CA 4LGHA 2FA2A 5JZJA 1XH6A 3VIDA 2FO0A 2RFEA 2YIWA 2RG6A 3EN5A 1REKA 2FH9A 3N51A 3PZHA 2WMBA 3K5UA 4FTCA 3JVRA 5LVNA 3GCPA 3IW5A 5CU3A 4R78A 4QTEA 1A9UA 5FG8A 4O7WA 3ID6C 2JFLA 4U80A 4GH2A 3PVUA 4V0GB 2OI4X 4FSNA 4C38A 5DE2A 4USFA 4U81A 4MAOA 1S9JA 3TNIA 4IAFA 4O0UA 4FR4A 3VS1A 5K0XA 5L2IA 4D0WA 4I6QA 4IBMA 1UVRA 4G16A 2QR7A 5B0XA 3F5XA 4BB4A 3PJ8A 4GIHA 1XH9A 5HD4A 3OY1A 4FSQA 4IX6A 1ERKA 4FMQA 1J1BA 2XIRA 4RVTA 4BHZA 5L6OA 3NYVA 1OB3A 3R8MA 5GJDA 1YXXA 2Q0BA 4UMQA 4H36A 3M2WA 4UXQA 2BTRA 1OKVA 1RQQA 4I23A 2ITWA 4EH3A 5M4UA 4WNPA 3QTZA 5HTCA 3FE3A 2GU8A 4IM3A 5JQ8A 5K9IA 4L7SA 4ZOGA 4OAVB 5ETAA 4CMUA 5IQAA 3LFBA 4NCTC 3QCQA 3UYSA 3QYZA 3OWPA 4FT0A 2B9JA 3B2TA 3LXLA 3PWDA 3EQRA 2ITTA 4FSZA 3AD6A 2QI8A 4IX5A 1WBPA 5HG5A 4YJPA 3UP2A 1Q41A 3SRVB 3NVKI 2XKFA 4LG4A 5DOSA 3VW6A 2WHBA 3DKOA 4D2PA 4X3FC 3BKBA 5HEZA 3W33A 2XF0A 1KE8A 3R02A 4II5A 5D7AA 5EDPA 4F7JA 4YC6A 3TV4A 2PZRA 4F0FA 4JJRA 1YXSA 4YZNA 5EOBA 4HGLA 3V8TA 3OT8A 1T46A 5AX3A 3S3IA 5IA0A 4R77A 1RJBA 3LXNA 3TTIA 3QZGA 5DH3A 4ZTRA 3OTUA 2JIVA 2AC5A 1XH4A 2C5VA 3AC4A 2WNTA 1J7IA 2GNIA 4O0RA 5IQIA 3NAYA 3II5A 3W2PA 4DFBA 2CNUA 1GIIA 3Q9XA 1H8FA 4K1BA 5IEVA 3F2RA 3F2AA 2QOCA 2BDFA 3MJ1A 4YR8A 4WRSA 4DG2E 5EKNA 3MVMA 4WSQA 4EKLA 1JVPP 3FZSA 3LE6A 4DH8A 4DG0E 3HAVA 3SXRA 4GS6A 1BI7A 4D5KA 3MB6A 2PU8A 1PYXA 2HIWA 3UG2A 4CFNA 4X6RA 4QYGA 4BIBA 3AMAA 3I5NA 3NUUA 4FZFB 4N70A 3A61A 4LRJA 3CPCA 1H1WA 4IANA 5DGZA 3UVPA 3AC3A 3ULZA 2F57A 4DEAA 4BCQA 3PSDA 2OK1A 2EB2A 1IA8A 2B53A 2UW7A 2A0CX 3FI3A 4U6RA 3RZFA 4BTKA 1OUYA 3FLWA 4LUDA 3C13A 2A19B 4MXXA 4BCPA 2BZKB 3CIKA 3C4CA 3LFAA 4AFJA 3VBQA 5CAVA 3MGYA 2RFSA 2WFYA 3RAHA 3GXLA 2QG5A 4Y83A 2CKOA 3L9LA 4FSWA 3QD0A 3LHJA 1FGKA 3RM7A 1Z5MA 1STCE 2EVAA 2Z7LA 4BTFA 4EH7A 5CXZA 3Q32A 2VRXA 2YJRA 4XRLA 4M13A 4MBLA 5IG1A 2OWBA 4MF1A 3SX9A 4AN3A 3UPXA 2J6MA
chains in the Genus database with same CATH superfamily
4O4BB 4EOKA 1SZMA 3WF8A 3T9TA 4CVAA 1U5QA 3GC9A 4IDTA 2JKOA 2QKWB 2XIZA 5J7BA 5M51A 3NWWA 3DNEA 4ASXA 3R6XA 2R3QA 4PDYA 3ZHPC 3U6HA 5J5TA 5HCYA 4AW5A 3NAXA 2R3LA 2BRNA 2J0KA 3CQWA 2YDJA 4N57A 1UWJA 2IN6A 2O0UA 4N6YA 4IB3A 1WVYA 3UC3A 4G2FA 4ZSGA 4DFXE 1IASA 3ORMA 4TYGA 3MPMA 4A9YA 2ITNA 5E8SA 5KHXA 3ZM4A 4QQCA 5E1SA 4ANMA 3MDYA 3WZJA 4MHAA 4AA5A 2VD5A 4F7LA 4JG7A 1TVOA 4TXCA 3Q5IA 3AD4A 3GCQA 3C0IA 2XAMA 2Y6OA 4CCBA 3ALOA 3SDJA 3WZUA 1ZWSA 3LLTA 4U41A 4MEDA 2ZDUA 4YZBA 3TUBA 4D2TA 4GU6A 3BL7A 2XK9A 1H1RA 4TRLA 1AGWA 3HP2A 2W1FA 4YHTA 2XNEA 4PPBA 1WVWA 2ITOA 3EB0A 3F3WA 2NRUA 3QTXA 4M3QA 3PPKA 2J0JA 2YJSA 1JKLA 1U54A 3PJ2A 4RSSA 4D1ZA 4QMLA 3TUCA 4UMPA 2XK8A 4F65A 2YIXA 2PTKA 4H1MA 4M69B 2RIOA 4GUEA 4AGWA 5A54A 1E9HA 1W0XC 2GHMA 4RJ8A 4RVKA 3T9IA 3HKOA 5I0BA 1UKHA 2YACA 5AAGA 4PL3A 4J8MA 3NFFB 2O5KA 2R7BA 2XUUA 5FP6A 2CN5A 2I6LA 4BCHA 5LVMA 4LV7A 1Q3DA 5AAEA 1XH7A 4G3FA 3RINA 5IUGA 1SVHA 4RFYA 2VTSA 1QPJA 3P0MA 3U4WA 1F3MC 3OD6X 4HCUA 2B1PA 2ERZE 2ETMA 2OXXA 4IDVA 2CGXA 4EOLA 2XALA 2YITA 5I9UA 1SYKA 4IACA 5KUPA 4FV0A 5C26A 3VO3A 3KVXA 2C5OA 3MH2A 4BF2A 1VEBA 4PF4A 4O1OA 4N6ZA 4WG4A 4TWCA 3FKLA 2GTMA 5HTBA 1VZOA 2BHEA 4BIDA 3ENMA 1AQ1A 2Y4IB 4FT9A 2VV9A 5CENA 4Q9ZA 3SA0A 3PVWA 1H0VA 5JSMA 1GJOA 4EYJA 3QALE 4QP7A 4X2KA 3MY0A 4JDKA 2AYPA 4L3LA 2IW8A 4GRBA 4O0XA 1VYWA 4YO6A 1H1SA 4CLJA 2ZVAA 4JBOA 2P3GX 5DT4A 4ZEGA 3Q52A 3DK7A 4EOIA 1ZYCA 4QMMA 4YSJA 4FIEA 2WTCA 2UW9A 3R71A 4RWIA 5CALA 3W2CA 5IQHA 1WBSA 3GC7A 2B9IA 2ZJWA 4PTCA 3OROA 4ACCA 5GZ8A 5CQUA 5IQCA 4FTRA 3V6RA 4JXFA 2F2UA 1OL7A 3D7ZA 3O8PA 2W7XA 3NYOA 3ZSIA 3CS9A 4MXZA 4DTAA 5EHOA 3LQ5A 1R0EA 3BLHA 3HMOA 4AAYA 5KMLA 2OF2A 4F70A 1KV1A 3SW4A 5HBEA 3LFNA 4YC8A 4FT5A 3SGCA 1ZY4A 4WNKA 3AGMA 1OIYA 1RW8A 3F66A 3UJGA 3ATTA 5LVPA 5E9EA 3BEGA 3QXOA 4B7TA 2VX3A 3W32A 2R3IA 4XJ0A 4L68A 3CTQA 4QMOA 3MFSA 4G9RA 5J9LA 4RWJA 4XNEA 1OPKA 3QBNA 3ZOSA 5H9BA 2WMQA 3UMWA 4V01A 2W5BA 4C62A 3Q4CA 4Q2AA 5M09A 2J5EA 4EZ7A 4MXAA 4AXEA 1BLXA 2Z7RA 4BDEA 2WMWA 4XYFA 1UU3A 4NKAA 3TV7A 4F7SA 4AQCA 4GT4A 3NIEA 3KC3A 3U55A 3W8QA 2UW0A 3A2CA 2FSMX 5L8JA 2VWYA 3GGFA 4ZP5A 1Q8ZA 5IF1A 4KUJA 5JGDA 3F5GA 3CY2A 2YM6A 4W4VA 4FE2A 4Z16A 4U3ZA 4O7RA 3E5AA 4H3BA 3W2QA 4F9CA 4CV8A 5HLNA 2Z02A 2WQEA 2CDZA 2HXLA 3Q04A 3RPVA 4ERWA 1TQIA 3QX4A 4Y5QA 4FZDB 2WMXA 2ESMA 2UZTA 2X2KA 3E92A 3EYGA 4KKGA 3HAMA 3WF9A 1G8SA 1E1VA 4R1YA 1J7LA 5ETFA 4BJJA 2OJIA 1BI8A 2VO6A 4AE6A 3AT2A 5M4IA 1PXPA 2ZOQA 4M0YA 2DQ7X 3UDSA 4E4MA 5IUHA 2CCHA 4GG5A 4MTAA 2VGOA 3G2FA 4ORKA 4YJQA 4RX8A 2IWIA 2WIHA 5ANDA 4DHIB 1XMMA 3QUEA 1BUHA 3PYYA 4X6QC 5A4EA 2O64A 2WMUA 4I22A 5C1QB 5HU3A 1ZMWA 2PE0A 3OCGA 4ACMA 3AMBA 4V04A 5LCJA 1WBWA 4C34A 2GHGA 2CNQA 1MQ4A 3HUBA 5TOZA 4I21A 2JLDA 5D9HA 1ZARA 5C8NA 4C35A 2GMXA 3BHHA 5EKOA 4JOAA 1O6KA 3QTIA 2JDSA 3PRFA 3OHTA 1W83A 4FTUA 4FV6A 2KULA 2XCKA 1B39A 3HLLA 4FBXA 4C4EA 1Q8UA 3I1AA 3GQIA 3BI6A 4FSMA 4MBIA 3KMMA 4XG9A 4CFFA 4MUQA 3ORKA 4O83A 4LM5A 2Y7JA 3RHXA 5IA5A 3SG9A 4OTFA 3I0QA 5AR5A 3UOHA 4WIHA 3HV4A 1M17A 3V5LA 4IM0A 3C50A 2C6KA 4D9UA 4E4LA 2X4ZA 3P5JC 1M2RA 4IB5A 1KOBA 4XV1A 4FK6A 2IZUA 1OVEA 1Q8WA 2CPKE 2I1MA 3QC9A 4ACHA 5J7HA 4HNFA 3HRCA 3QTWA 4GFMA 3K2LA 4AS0A 5H8BA 4OTIA 5L2WA 4L3PA 2HCKA 3EQBA 4I3ZA 4FSTA 4R3RA 2H6DA 3K54A 4JG8A 3QTUA 4BCJA 2I7QA 2OIDA 4X3JA 4XRJA 3HDMA 4K11A 2OW3A 4L45A 4KAOA 2ITQA 5AR7A 4AU8A 4DTKA 4MH7A 1H08A 4P5ZA 4XV3A 3VF8A 2VNWA 3OWJA 3ZEWA 2BDWA 4WG5A 1JQHA 3O8UA 4G1WA 4ANSA 1TKIA 4NH1A 2J50A 3KREA 2BILB 3W0PA 4N4SA 1V0PA 3CLYA 3JXWA 4G34A 4WUNA 4EH5A 4GKIA 3QUDA 3PSCA 2QO2A 2XYNA 3H4JA 3TNWA 4EHVA 3DCVA 2R3MA 3QZIA 4L3JA 4YJOA 2CKPA 3PUFC 2J0MB 2WTVA 3PUPA 4BICA 3ZXTA 4D5HA 2C6MA 2NO3A 1Q8TA 1JSTA 1CSNA 2O65A 3SQQA 5M53A 5HIEA 5CT0A 3FMHA 2YZLA 3IPHA 3EL7A 4WSYA 3LM5A 3ZZWA 5HTIA 4NJ3A 1YVJA 2ZB0A 3OWKA 4GJ2A 4LOQA 5ANIA 5AUYA 4EZ3A 5AEPA 4C7TA 2C6LA 3U6IA 4QMXA 5AP2A 4DAWA 5G1XA 5LMKC 5DLSA 5FXQA 4RJ4A 5BX0A 1OUKA 1CKJA 3OXIA 4ZTLA 1WMKA 2C6TA 3TNPC 5KMKA 3BU3A 2BZHB 4E6DA 4BGQA 5EYCA 3R9HA 5CASA 4QP8A 3OG7A 2DWBA 3ZLSA 1YWRA 4XG7A 5J79A 4IXPA 1WFCA 3G90X 3ETAA 4DCEA 3WARA 5TO8A 5CWZA 2FYSA 3KRJA 2NP8A 3C1XA 5HE1A 3WYXA 2UZWE 3DK3A 4TZRA 3TV6A 4MK0A 1JOWB 2VTNA 1YWNA 4I1ZA 2UVYA 4FKTA 1NVSA 4LRKA 4OBPA 3ZC6A 3QTQA 3ZYAA 1GZKA 4EOMA 2BRHA 4JAJA 1WBNA 3QD4A 4YJSA 4FT3A 1VJYA 5BVFA 3JY0A 2HELA 1Q3WA 4RX9A 4F78A 4DITA 1G8JA 4L42A 2UW4A 2VTTA 5KZ0A 5IA4A 2W5HA 4GFOA 4MXOA 4QYYA 4YTIA 2W1EA 1K2PA 3HV5A 3ZFYA 3FJQE 2QOFA 1ZZLA 3RALA 4IMYA 3R1QA 4FKQA 4D2WA 3G51A 3ERKA 2VWZA 4CEGA 1KUTA 2QONA 4RIWB 3OFMA 3FPQA 5C4KA 4KA3A 3FI4A 1JKSA 2VO3A 4BYIA 3R1SA 2F7EE 3RM6A 1R0PA 4BYJA 5CANA 4EK5A 2PMLX 3GENA 4QP3A 3VRYA 3EWHA 2J0LA 2UV2A 3VJNA 4ZJIA 4MBJA 4G3EA 4JR3A 4HVHA 2HW6A 2FB8A 1KSWA 4AXCA 4NTTA 5KZIA 4HYHA 2UZOA 1U54B 1XH8A 2NPQA 3HVCA 4RJ6A 3UO4A 3UOKA 3OY3A 1CKIA 4RLKA 3RBWA 2VWUA 3ORZA 1Y57A 4RRVA 3LMHA 3VBTA 2JKQA 4KIKA 4AA4A 2BRMA 3MSSA 4IZ5A 3FYJX 4FTAA 4AWIA 4IAIA 2C4GA 5CLPA 4BKYA 4ZLZA 3EH9A 3U4UA 5HIBA 4EQCA 5KKRB 2WTJA 3DB8A 4NU1A 4RQVA 4QP1A 3PY1A 4YHJA 5DR6A 3VW8A 5LMAA 5DFPA 3IDBA 4XBUA 2A98A 4FIHA 4O82A 5EQEA 1JBPE 3D0EA 3C4ZA 2YIYA 4DGOA 3PXYA 4TWNA 4EH9A 4KRDA 3PRIA 2V55A 3DFCB 3E3BX 3FMJA 4FOBA 5DA3A 4BZOA 3EFLA 4EL9A 4NIFA 3VUHA 3VHKA 4IZAA 4S33A 3KCFA 3LFDA 5AM6A 1SNUA 2X2MA 4M7IA 4UZHA 4ENYA 3ZEPA 3R21A 2X9FA 3CKXA 2YISA 5JH6A 3DQWA 4KIOA 3AT3A 4GEOA 4X2FA 3T3VA 3SKCA 4BDBA 4EH6A 4Z7HA 5FXRA 3P7AA 5HQ0A 3UZTA 5C8MA 2JEDA 2IEWA 4G6NA 3RAKA 3KEXA 4J71A 5C27A 5FBOA 2W4KA 3A7HA 4I5MA 3S2PA 2WOUA 1M7QA 4L9IA 3RVGA 3NNUA 3WE4A 2E9OA 1Y91A 3NIZA 3RI1A 2VTIA 3CTHA 4H05A 2C6OA 1R39A 4TWPA 2IJMA 3U8WA 1AD5A 4AZSA 4OTDA 3G33A 3SXFA 4FIGA 1ZLTA 2OZAA 4MNFA 4UBAA 2B9HA 2H34A 4C3RA 1L8TA 3K3IA 3F7WA 4WT6A 3ODZX 4W4XA 5GIOE 2P4IA 3NS9A 3UYTA 4YSMA 4MYGA 1JSVA 3UIUA 3B8QA 1W2FA 3TUDA 4DE4A 3ROCA 4BGGA 4QYHA 5IH5A 2GS2A 4QMTA 3D5XA 3UIXA 4F08A 5T6KA 4EOPA 1Q8YA 5IZFA 4K33A 2R2PA 2XZSA 3O23A 4FSUA 4LGDA 1WZYA 4YBJA 2UZDA 4FVPA 4E3CA 4MVFA 3UNKA 2VTHA 2XM9A 3WIGA 4JRNA 4AW2A 2X0QA 3QX2A 4LUEA 2VWIA 2OJGA 3VUMA 5M44A 1Q5KA 4KINA 2ZV2A 1PXLA 4RVMA 3HMPA 1OGYA 4NM5A 4J52A 3AKKA 3VF9A 4RBLA 5FD2A 3EFJA 5IQEA 3H30A 4HYUA 3L9PA 4ZZMA 3QCSA 1OL2A 3VS2A 3SG8A 5A9UA 1H28A 2YIRA 3D7TA 5B2KA 2YN8A 1XBCA 4HNIA 1OECA 3TZ8A 3W18A 4APPA 5I9ZA 5JEBA 3QC4A 3TNQB 4FK3A 3P86A 2IW9A 4R1VA 4FUXA 4BDDA 1P4OA 1FVRA 3GU8A 4QP9A 3IW8A 5TR6A 3ZSGA 4A07A 4U8ZA 3OOMA 3OXZA 3BYVA 5KCVA 4WA9A 4BVUA 1R3CA 2ZYBA 4CYIA 3R7YA 1I44A 4H3QA 4LQMA 3CGOA 4TNBA 4WO5A 5IA2A 4S34A 5L6PA 3NYXA 4O4DA 4TPTA 4FF8A 3SAYA 4U0IA 3BLRA 3NEWA 1R78A 2ZDTA 2YCRA 3DPKA 4FL3A 2VU3A 3EN9A 3GFEA 2J4ZA 4G3DA 4M12A 5F94A 3OZ6A 3VS7A 2C1AA 4BBEA 4X21A 3TJCA 2OSCA 1E1XA 3ACJA 5M4FA 4BN1A 4RT7A 4BDJA 2C3IB 2WEVA 4K9YA 5HLPA 5B7VA 3WZKA 1PKDA 1G5SA 2WMVA 2YZAA 4Y46A 5D10A 4PPCA 1RE8A 5A6NA 2UUEA 5HX6A 3IONA 4UWBA 5IDPA 4PL5A 4P2KA 1JPAA 1O6YA 4CKIA 2W05A 3QZHA 2FUMA 3Q4ZA 4NFMA 1JKKA 2VTLA 3PE2A 4OLIA 5M08A 3W10A 4Z9LA 4QYFA 3VBWA 4C4GA 5ANJA 3ORIA 2WAJA 3PPJA 3W2OA 2X6DA 4PDPA 4KSQA 2ITUA 3KF4A 5EHLA 3HV3A 4LOOA 1M14A 3ZC5A 3NUAA 4JG6A 2BAJA 1H00A 4LOPA 4X0MA 3AXWA 5M56A 4GW8A 5BUEA 1SMHA 3F5PA 1A48A 3HP5A 4FTOA 2CCIA 4L43A 4FKGA 1CTPE 1PRYA 3RK7A 5AV3A 3QKKA 3SLSA 3DJ5A 1U59A 4BCNA 3HA8A 3F3ZA 3FAAA 3R30A 4F1OA 3MN3A 5EM6A 2ZMCA 3MA6A 3C51A 1NVQA 4QT1A 4E4XA 3VULA 2CNVA 1PXJA 4W9WA 3G9LX 3OEFX 2ITXA 3MYGA 2PPQA 4C3PA 5ANGA 1LEWA 5KMNA 2X2LA 3U51A 3BHVA 2I0YA 2BZJA 4E7WA 4NSTA 2Q0NA 3S1HA 3BYOA 3EIDA 3OWLA 4HVGA 4O7TA 1YQJA 2IZTA 3HYHA 3NUYA 2X4FA 2WTKB 4GT5A 4IAAA 4OTWA 2X39A 3DKGA 4QD6A 4U44A 2F7XE 4AACA 5IH4A 2UW5A 5CF8A 3NDMA 4FV7A 4TYJA 4EHEA 5K5NA 2UVZA 5DR9A 3KCKA 3LPBA 4DFZE 5IA1A 3EN4A 5AUWA 2QOIA 5LWNA 3NFGB 3QGYA 4OTRA 2B54A 3D14A 1LR4A 2WU7A 5FTGA 2YABA 4YHFA 1NVRA 4ZSAA 3A8WA 2FSOX 5A4LA 2VZ6A 4NUSA 2R0IA 2IPXA 3OOGA 1YDTE 5DEYA 3R83A 3ALNA 4C36A 4GFGA 5BVOA 1W98A 2RKUA 3CD8A 3VS4A 1FVVA 2Y8OA 3QUPA 4IADA 4M84A 4AUAA 4FIFA 3FLQA 3L1SA 2R3KA 3LCKA 4R5SA 4A9UA 4UZDA 2CJMA 4JI9A 3ZO1A 4CG8A 3BIZA 1BYGA 4W4YA 4O7YA 2BRBA 3LMGA 5IQGA 5AV2A 1OIRA 4ACGA 4C61A 4J8NA 2C5NA 2ETKA 3ZONA 4QMYA 4DT8A 2WB8A 5HE0A 3UP7A 2Y6MA 4B99A 3R8UA 3DFAA 3KXXA 3VN9A 4QDEA 2WKMA 4FTNA 5DMZA 3F3VA 3FMMA 1KE6A 3KVWA 4ZSJA 3UO6A 3I81A 4ENXA 3P5KA 1H26A 5CZHA 3RNYA 1YHSA 3ZS5A 4DC2A 3BHUA 2XVDA 3P23A 3PIZA 2HY81 5CF5A 2YWVA 1ZZ2A 2RFDA 3O7LB 3V04A 4DLIA 1FQ1B 2BDJA 4XLVA 5FGKA 2BR1A 4EBVA 2XKCA 4QNYA 4AG8A 3PA4A 3IGOA 1O9UA 4O4CA 4HVIA 4TY1A 3G15A 3LKMA 4RJ7A 3PWYA 4DGMA 3UZRA 5E90A 3MW1A 2J90A 2W1CA 1ATPE 5EYKA 3A62A 4U3YA 3FZTA 3MPAA 1GY3A 3VS0A 4CMTA 2XEZA 2OFUA 4EORA 3IOKA 3AD5A 4ERKA 3I7BA 3PDTA 1UNLA 2JIIA 3AC8A 3QRJA 3W0QA 2WEIA 3F3UA 4I4EA 5CSHA 3MESA 4FIIA 4CKJA 2YCQA 5IEXA 4OAUC 3C5UA 2A4LA 3KMUA 3QRIA 4GK3A 4AZFA 5E91A 2OH0E 3N4UA 3DV3A 1XH5A 3FMKA 4UWCA 3KK8A 4JDHA 5DT0A 2NNWB 4D2SA 3MY1A 4NCTA 3R9DA 3CQUA 4AOIA 2FSTX 3VS6A 1P4FA 2YWPA 1QMZA 2C69A 4M8TA 3EHAA 5CU4A 3KXNA 4QDVA 3GQLA 5EDRA 3PLAE 4AT5A 5GJGA 3ZRKA 3UQCA 4KIKB 3R22A 5HKMA 5LMBA 2XKEA 5BMSA 3C4FA 3RNIA 5I3RA 5AR8A 4X3FA 4UX9A 1PF8A 5EI2A 3FL5A 2VTAA 2CGUA 3C4EA 3O17A 3QCYA 5HNBA 3PG1A 5FP5A 4I6FA 3EQDA 4EHZA 4GV1A 4IB1A 5HBJA 3UDZA 2X9EA 3AOXA 3WF7A 2R4BA 2PULA 4OR5A 3MJ2A 4B8LA 5CXHA 1XMLA 3CE3A 4GIIA 2X7GA 2JFMA 1UNHA 1ZYDA 3BYMA 3WIKA 4FKIA 2HWPA 4ZTHA 3ENHA 4RIXA 3BE9A 5LWMA 5A3XA 3I60A 3DKFA 4NIFB 4WUAA 3TIZA 4DHJA 4ZMEA 4AT3A 1APME 4JQEA 4O0SA 4KBCA 3VJOA 5AIRA 1UKIA 4DFYA 4LRMA 3C9WA 3OP5A 1URCA 1BX6A 3PTGA 4IX3A 4TYEA 4M0ZA 5IKWA 2UZVA 3DBCA 4BKJA 3REPA 4FV9A 2QU5A 2E9VA 3DBQA 3UVQA 2VN9A 2YM4A 4GK4A 1H27A 4PRJA 2C6DA 4RMZA 5GHVA 3MFRA 3ZRLA 3KXMA 2OLCA 3NCGA 2YLEA 4PTEA 4W8EA 4DHZA 4GYIA 3Q3BA 5AA8A 5BYZA 3ZMMA 4AXAA 3W55A 3LFSA 3ZFMA 4BBFA 1PXMA 2VWXA 2Z2WA 3LXKA 4LV5A 5BUJA 4NK9A 4G3CA 3EKNA 3FZPA 4RX7A 4DGNA 2OZAB 4GKHA 4IWDA 4Y95A 4MD7E 4XUFA 2GFSA 5I9VA 2WZJA 3JR1A 3FPMA 5IISA 3COKA 4D2RA 4FTMA 3SHEA 3P7CA 4DYMA 1QPDA 3T8OA 3MVLA 4F9BA 3WOWA 3ZFXA 1W7HA 4P5QA 1NT2A 2ITVA 2W1ZA 3BGPA 3EQGA 4IZYA 4MQ2A 4ANNA 4P7EA 4O1PA 4FTJA 4EONA 2V0DA 3L9MA 2QU6A 2YM8A 2X0GA 1ZYSA 3UIMA 3FBVA 3MWUA 4FG7A 4JIAA 4G9CA 2I0HA 3PZEA 4HCVA 4D28A 2J0IA 3F9NA 4O22A 4AQKA 4NWMA 4BDHA 2CSNA 4AZTA 4J97A 2WTIA 2YAKA 3FZ1A 4D9TA 5CU0A 3NW6A 2CMWA 4J7BA 4AXFA 3DJ7A 4U45A 5EG3A 3W8LA 2J51A 4AGUA 4CQGA 4YPSA 1OL5A 4E5BA 3R2YA 3KA0A 4IZ7A 4RZWA 4L53A 3F6XA 4D1XA 4EUUA 3LQ3A 3KRLA 3R04A 3O51A 4JDIA 3PJ3A 5AV1A 2GQGA 4L00A 3ET7A 2B4SB 3D7TB 3H10A 5AR3A 4PMTA 4XV2A 2G9XA 5DG5A 5I4NA 2VAGA 4XLIA 4QQ5A 1VYZA 3FZRA 5EW8A 1XJDA 3MV5A 5AP0A 3AG9A 3UC4A 3WBLA 3EJ1A 3BZ3A 3COIA 3GI3A 1OGUA 4HZRA 2UZLA 3ANRA 4IAYA 2UVXA 1MP8A 3VUKA 1PHKA 1OM1A 3FC2A 4ZJVA 2WMAA 5L4QA 4CG9A 4ID7A 4H58A 4FTLA 2R3JA 4BCOA 2GFCA 5HCXA 3ORPA 4FZ6A 1Y6BA 3V01A 5KMOA 1GNGA 2OJ9A 2JGZA 3TIYA 1R1WA 2OH4A 3UO5A 4EOJA 2X7FA 2PHKA 2QOOA 3PY0A 4IAKA 4TYHA 2PVYA 4CMOA 5HBHA 5CEKA 1TFFA 4TKSA 1I09A 5DHJA 5AP1A 2CHLA 4WKQA 3RPYA 3FC1X 4IVDA 2WELA 3QA0A 5CEIA 3ZZEA 4H3PA 2R64A 4WBBB 4K18A 4YU2A 3KQ7A 2HAKA 5HNIX 2YHVA 4FVRA 1XHAA 4KS8A 2HZIA 3R63A 3VS3A 4QOXA 5AV4A 3K5VA 3UG1A 2XANA 4FEUA 5BYYA 4DLJA 4CKRA 5CSPA 3HRBA 5JGAA 5K3YA 4ZTMA 5IDNA 3QD3A 3H3CA 3LQ8A 3KB7A 4RWKA 4XOZA 3VONA 3QKLA 2XNGA 3WYYA 4LL5A 4D0XA 2PMIA 4RIYA 3DDPA 4TNDA 3FMLA 2I0VA 4CSVA 4O2PA 4YZDA 5KMIA 4IX4A 4BWXA 3WI6A 4XG3A 4A06A 2Y0AA 4AP7A 4BZDA 4KBAA 4DG3E 5IMEA 1P2AA 4A7CA 2C3JA 4ASEA 4I0SA 2ZM3A 3TTJA 2ITPA 3NUSA 4C8BA 4U9AA 2FGIA 4FEQA 3UQFA 5FDXA 4BCGA 1J1CA 5HNGA 1A06A 3DK6A 4FX3A 4QPMA 2OBJA 4QTAA 4M67A 5AP3A 3ZO3A 5HOAA 4KWPA 5K0KA 2X8DA 3JY9A 1YDSE 3KXGA 1YXTA 4DF3A 3BPRA 2PUNA 4AF3A 4LL0A 4N0SA 2JBOA 2HXQA 4FI1A 4HCTA 1IR3A 4O0VA 4BBMA 2P33A 1GZ8A 4QQJA 1XR1A 5HZNA 4UWYA 1PY5A 2P55A 4E26A 1OZ1A 2BHHA 2BZIB 2UZUE 3HMMA 3I7CA 1F0QA 4YLKA 2YCFA 3AC2A 3ZTXA 2H96A 4NW6A 4ZLOA 4QPAA 5AR2A 4U43A 3QYWA 1T45A 4W4WA 2V22A 4IJPA 1JLUE 1WCCA 2DS1A 1W82A 1M52A 3DXPA 1FMOE 4PX6A 2X6EA 1GOLA 3PE1A 4DEEA 3TM0A 3NYNA 2IVVA 4FEWA 3D83A 4IAZA 4CFVA 3ZUUA 4D4SA 3ZM9A 3FHIA 4B8MA 4O86A 4F64A 3DBEA 3HRFA 4O96A 1FINA 3SXSA 4PP9A 1B6CB 2RSVA 5DR2A 3R7VA 3BGQA 2UW8A 3WF5A 4C2WA 4AFEA 1M2PA 4OT6A 2GDOA 4PY1A 4E1ZA 3ORXA 3NMUF 4NEUA 5FWKK 2YDIA 4TL0A 5IH6A 1M7NA 3POZA 4QQTA 3D5WA 4QEBA 1K3AA 2LAVA 3OF0A 4EEVA 3ATSA 2C0OA 2YM5A 3BYUA 2WPAA 4JAIA 2GSFA 2XK6A 3S95A 4C3FA 1DAYA 3GFWA 2BAQA 3E8EA 4IWQA 5GZ9A 3GEQA 5KBRA 4GUBA 3ZH8A 3A7IA 1ZY5A 2C47A 4EJNA 3R1YA 2A2AA 3UZPA 2EU9A 4PTGA 4XMOA 2QODA 3V5PA 2QD9A 2WGJA 3AGLA 5CAPA 4QMSA 2E9PA 2XRWA 3HDNA 3P79A 3Q53A 3E62A 1G8AA 4IB0A 2GNGA 2BIYA 4CRSA 1Y8YA 3NUXA 5E8VA 1G3NA 3L8PA 3ZUTA 4DEDA 1Q99A 4I4FA 5EYDA 1CKPA 3E88A 4RWLA 4PNIA 4EH4A 5CU6A 4JBVA 4JRVA 2E9UA 1SVGA 2BTSA 2O2UA 3L8SA 4OW8A 5EM7A 5HIDA 4BI2A 2UW6A 3WE8A 4EBWA 3N4VA 2WD1A 2ZV7A 3OMVA 3FXZA 4YJTA 5IEYA 4I6LA 4OT5A 1YHVA 2DUVA 4HJOA 3PFQA 2ZMDA 5EQYA 3UOLA 2QOLA 3EQPA 4ZLYA 3PA3A 1UA2A 4O6LA 4XX9A 5DWRA 4Z3VA 3KIOC 3QCXA 4BI1A 5BUIA 3KXHA 4DEIA 5D12A 5JK3A 2VWVA 2BPMA 5CYIA 3PPZA 3TJDA 4DH5A 2GNJA 3F2NA 2BKKA 4UALA 4BDIA 2R3FA 2OZOA 3O0GA 3OT3A 1YOJA 3QWKA 4EWQA 4XV9A 4PP7A 1GIJA 5A14A 4YJVA 1ST4A 5CNNA 4DFUA 2XIYA 4HZSA 2A1AB 2JBPA 3EOCA 4E5WA 5HVJA 4KIPA 2X8EA 4X7QA 5CVFA 4X2GA 3IW4A 4ITIA 4D4VA 2IG7A 4BDAA 4ITJA 4R3CA 3ZLYA 4YTFA 2ZV9A 4DH7A 2WMTA 2W99B 4FKOA 2JAVA 4BIEA 4F1MA 3CGFA 2OIQA 3HECA 5E8XA 2HK5A 4BCMA 5HE2A 2C3LA 3LW0A 4C2VA 4YLLA 5EOLA 3PJCA 4NKSA 5E4HA 3VUIA 4X3FB 2C5XA 3TZ7A 3H9FA 2RFNA 1UNGA 3AKJA 4L44A 4BR3A 2WQOA 2ONLC 3CC6A 4D55A 3R2BA 3U54A 1W84A 1Q24A 4ITHA 3EKKA 1TZDA 5HO6A 3D2IA 3CBLA 3Q9WA 3CY3A 4XOYA 3C0HA 3GU7A 4M68A 3TG1A 3QRKA 4YMJA