3BIZA

Wee1 kinase complex with inhibitor pd331618
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
277
structure length
250
Chain Sequence
SRYTTEFHELEKIGSSVFKCVKRLDGCIYAIKRSKKPSVDEQNALREVYAHAVLGQHSHVVRYFSAWAEDDHMLIQNEYCNGGSLADAISENYRIMSYFKEAELKDLLLQVGRGLRYIHSMSLVHMDIKPSNIFISKVMFKIGDLGHVTRISSPQVEEGDSRFLANEVLQENYTHLPKADIFALALTVVCAAGAEPLPRNGDQWHEIRQGRLPRIPQVLSQEFTELLKVMIHPDPERRPSAMALVKHSVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Wee1-like protein kinase
publication title Synthesis and structure-activity relationships of soluble 8-substituted 4-(2-chlorophenyl)-9-hydroxypyrrolo[3,4-c]carbazole-1,3(2H,6H)-diones as inhibitors of the Wee1 and Chk1 checkpoint kinases.
pubmed doi rcsb
source organism Homo sapiens
total genus 83
structure length 250
sequence length 277
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2007-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3bizA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3bizA01
3NW6A 3D7ZA 3KF4A 3R83A 4BCJA 1OUYA 2O8YA 3LQ5A 3D5WA 4GYIA 2XK9A 4HGEA 3KK9A 4MNEB 4C3PA 4AGDA 4ZOGA 3EFKA 3C9WA 2W1DA 3QKMA 3UO4A 2X7FA 2XIXA 4IFCA 4ZLYA 5DVRA 3EQPA 1ZY4A 4YJRA 5EHYA 1OIUA 2QOHA 5T6KA 1ATPE 4JT3A 2HXQA 4WRGA 4BCPA 4XMOA 5HIBA 1W84A 1V0OA 4GJ3A 4USDA 5EYKA 5FGKA 3HZTA 4CNHA 3DJ5A 3TJCA 1EH4A 1ERKA 4FF8A 4DYMA 4BIDA 4R78A 5BVWA 4UEUA 2PVHA 5DNRA 1F5QA 3E64A 2GNFA 2Q0BA 3FI4A 4Y46A 3P7CA 4C35A 4FT0A 3NNWA 4GV1A 3HRBA 3UJGA 4PPAA 4KUJA 1GIIA 4ARKA 4DEHA 1B39A 5CNNA 2GS6A 4R3RA 5IMXA 2OIQA 4F7LA 3D94A 4D2PA 3GCQA 2P2HA 3DS6A 3VS3A 3DA6A 3NUYA 4FKSA 5J7HA 5IQHA 3PPKA 3IK3A 3R7GA 5AR7A 3ZEWA 4DBNA 5AEPA 2FVDA 2FO0A 4F7NA 1REKA 3DXQA 4K9YA 3QTQA 4C2WA 3B2TA 3D5XA 2HZ4A 4XJ0A 4ANOA 4FTJA 4FTLA 3ACJA 4QTCA 2Y4PA 4MXAA 2VRXA 4FT7A 2QOOA 2OXXA 5TKDA 3VF9A 3EZRA 2HW7A 3IS5A 4ACDA 4BDBA 3EN4A 2JD5A 2VO7A 3WILA 5KMLA 3KN6A 5IH6A 4RIOA 5JN2A 5JSMA 4L9IA 3EKNA 5H8EA 3OG7A 3W32A 4CQGA 3Q2JA 4RFZA 2AC5A 2BRHA 2QI8A 2FUMA 3CR0A 4LRMA 5AWMA 4D2VA 4ENXA 4I21A 4BDIA 3EQHA 5E8VA 3KXHA 4NM5A 3BELA 4FTKA 5EFQA 4MK0A 3HNGA 4YTFA 2YISA 4RQVA 4ORKA 5M4FA 3HMPA 4ZTRA 1NW1A 2CKEA 3C0GA 5HCZA 3W2CA 3VUTA 4JNWA 4XRJA 4MD9E 5IUGA 4D4RA 4V0GB 4JRNA 4BDJA 4W4VA 4FTAA 4FKGA 4K8AA 3QX2A 3PSDA 4D4SA 3OCTA 3Q4CA 5ANGA 3KK8A 3R7OA 3R8VA 3R9DA 1BI7A 2XIKA 4YPDA 5KO1A 3A8XA 5IQDA 4PNIA 4O7ZA 5FG8A 3TCPA 3QLFA 4YJOA 3MIAA 3QCQA 4F0IA 2XZSA 1WMKA 2ACXA 4BTKA 2OXYA 4A4LA 5HBEA 4NUSA 4OT6A 4M0ZA 5EOBA 3GXLA 5DG5A 3OWKA 4TNDA 5A4TA 5AUZA 4BGHA 3I7CA 4QPMA 5FWKK 3TI1A 2H6DA 3FQSA 2R0UA 2Y9QA 3LOKA 2WIHA 4Y95A 2UW3A 4CYIA 1WZYA 2NRUA 4GIHA 2Q0NA 5DI1A 2YWPA 1YDRE 4FGRA 4AU8A 5FD2A 4I20A 3KXMA 4A4XA 4CEGA 5JFXA 4F1TA 3QQJA 4U5JA 1GY3A 4U44A 1LR4A 5DGZA 3MA6A 3VHEA 4U41A 3AT4A 3SAYA 1H1QA 4G6NA 1CKPA 2BALA 5K9IA 4FZDB 3FBVA 4E5BA 4LMNA 4QTBA 4EQMA 4LV5A 5AP1A 2RF9A 2VX3A 4F9CA 4PMSA 4MBJA 1U54A 3AC1A 3FI3A 3HV4A 4DFXE 1YXSA 2RKUA 4ZEGA 4HPUE 5J9ZA 3MN3A 2ZMCA 4CXAA 2XBJA 2PZ5A 3Q53A 4BGQA 3DBFA 3UIBA 4XP2A 4B9DA 2ZM3A 3V6RA 2PYWA 2PY3A 4LMUA 4MF1A 2R3MA 4O2ZA 3PLAE 3OTUA 2YM6A 4JG7A 3H0ZA 1HCLA 2PMNX 2FSLX 4RGJA 3BPRA 4WUNA 4Q2AA 4QMUA 3WIKA 2GHGA 4DE4A 4AW0A 3BU3A 2YAKA 4FKUA 4NZWB 5CX9A 4O7NA 5KBRA 4H1MA 3ORPA 1OPKA 2VWIA 3GUBA 4BRXA 1F3MC 2ZM4A 4YURA 3DB8A 3HYHA 5EW9A 3OCBA 3GOPA 3IQ7A 3CKXA 4RC3A 5E92A 3ZO1A 2OIBA 2CNQA 4XUFA 1YHSA 1ZAOA 2ZJWA 3KC3A 4IWPA 1I44A 3D7TA 4I0SA 4HVGA 3ZONA 4AX8A 3GFEA 2VO6A 3BYVA 4LUEA 3F69A 5FRIA 3ORLA 4UY9A 5HLPA 1JLUE 3BCEA 3KCFA 4U40A 5CAQA 4OAVB 1YOJA 1CTPE 4C38A 2KTYA 3ODYX 2JIUA 3BBWA 4M84A 4XHKB 5HO6A 1O6LA 1U4DA 2W9FB 5IQCA 5GINE 2RFSA 4OTGA 4S2ZA 3HLLA 4AOTA 4DH5A 3U54A 4PTCA 4KKEA 4K0YA 1V1KA 4TZRA 2O2UA 5M53A 3ZRKA 1Q8ZA 3C4FA 1GZNA 2C3LA 2R7BA 4FV9A 4TYHB 4HYSA 4HVHA 5FEEA 4BCIA 2WZJA 5HESA 4ZP5A 5GJDA 3A7GA 4MVFA 4ERWA 3ZUTA 1P4OA 4FSUA 1H1WA 2RGPA 4FMQA 2FB8A 4BDHA 1G8AA 3KREA 3TV4A 3MDYA 3PJ8A 1OI9A 1YDTE 5KMIA 1IEPA 4KINA 5AIKA 4FKPA 3QRKA 3DKFA 2XF0A 3NYNA 2JBOA 3UOHA 4APCA 3O7LB 1YXTA 1UU3A 5C1QB 1CSNA 2J5FA 3U6IA 4UWYA 1PF8A 3QD2B 1JSVA 4LRKA 4CLIA 5AR8A 3ORTA 3VRZA 3L8VA 4FKOA 2R3OA 3RAHA 4L68A 4DEIA 5I3RA 2Q83A 3R6XA 4MEDA 4K33A 4JL9A 5EQYA 3V5WA 4BYIA 4ANNA 3LFBA 4EZ3A 3IPHA 3LCTA 4EH3A 2XRWA 4U9AA 4F4PA 4YJNA 3UTOA 3ZZEA 4J52A 4CYJA 3AGMA 3OEZA 1OBDA 4OTQA 2EVAA 3SRVB 4QMOA 4O7TA 2C6TA 4F7SA 1FMKA 4R6VA 4QQTA 4Z3VA 2JITA 4BICA 2X0GA 4S32A 3HRCA 3DB6A 1R39A 4B6LA 4DINA 2OH4A 2RG5A 3QHRA 2WQOA 4YSMA 4AQCA 1Q8TA 3R28A 5BPYA 4LFIA 2R3NA 4FKJA 3LXKA 2OLCA 3FV8A 4O2PA 4YZNA 4L8MA 5HNGA 2R0IA 4ONAA 3MPAA 4YNOA 4TWNA 4U81A 4WSQA 2JFLA 4YJSA 2CJMA 1YVJA 3F61A 3Q9YA 3DY7A 3R73A 1OECA 3OT3A 4QYGA 4XG6A 3UVQA 3ALOA 4EOQA 2OBJA 1XQZA 3UBDA 3TEIA 4BKJA 1WBTA 3BEGA 4CRSA 4C02A 4BDDA 5LMAA 2W99B 3P79A 4AN9A 2WQMA 3DLSA 4FV0A 4QRCA 3TIYA 2B54A 2EUFB 1OKVA 1PXNA 1W7HA 3HL7A 3ZFYA 4BDAA 1FINA 3MY0A 4IX6A 4MXZA 4F1MA 3UO5A 3LMIA 2PMIA 2WEIA 2XP2A 4M12A 1YDSE 3U9CA 1P14A 5AR4A 2SRCA 3RBWA 5IH4A 5D12A 2UZDA 5HKMA 4EOPA 4LUDA 3W2SA 3IW6A 4EK8A 2X4ZA 1GIHA 3PA3A 2WXVA 3BHYA 2UZEA 4IBMA 4U42A 5F9EA 5LMKC 5HNIX 2J0IA 2REIA 4UWCA 5DH3A 2NP8A 5JRSA 4FKIA 4FNWA 4TY1A 3R02A 2RL5A 3EFJA 4WOVA 4W4WA 4BWXA 2ESMA 4BF2A 1Y57A 4L44A 1WVXA 1P2AA 1H26A 4M66A 3K5UA 1UKHA 3RAIA 3V5PA 3ZDUA 3EOCA 1OKWA 3O51A 3CJFA 4N70A 4Y73A 4ZY6A 4WNMA 4R77A 2ERZE 3PYYA 4YZCA 5IEXA 4KNBA 2RG6A 4MBLA 3RWPA 3UZPA 3HAVA 3KL8A 2J2IB 2UZOA 1DAYA 3K2LA 4BCOA 4DA5A 3C50A 4AW1A 4BTFA 1XH9A 3KRWA 2XNMA 1LEZA 3BZ3A 2JC6A 5KKRB 2IG7A 3BYOA 4F0GA 4U43A 4IANA 5K3YA 1YI3A 3K3IA 4FSNA 4XNEA 5I9ZA 3FMLA 4JQ7A 4TWOA 1WVWA 2F7EE 3MFSA 3V8TA 4YHJA 2BIKB 1PYEA 2IVUA 2RIOA 2W06A 2BAKA 2J50A 3QTZA 3QXPA 4FV3A 1WVYA 3MWUA 3TZ9A 3W10A 4CVAA 1JKTA 3FLZA 3QUPA 4BZDA 5KMNA 4O82A 4D28A 1XBAA 3QF9A 3R1SA 3V04A 3WZJA 2GMXA 3A61A 2WTJA 4EWHA 5J1WA 3NGAA 5BYZA 1R0PA 4GRBA 1V0PA 2QO7A 1J1BA 1XJDA 2R9SA 2VN9A 3KRLA 4WA9A 2OICA 3ZMMA 4E6AA 2RFDA 2WHBA 3C0HA 3DK7A 3I81A 4G6LA 5AUWA 1KWPA 3AD4A 3IW4A 5DN3A 1H4LA 3OF0A 3C4WA 3FDNA 3ATSA 3NVMB 4IAYA 4PL5A 3JPVA 3GCPA 3KKVA 5H2UA 4QYHA 3AD5A 2F7ZE 1XBCA 1Y8YA 3FXWA 1VEBA 4LL5A 1BX6A 3LFAA 2YEXA 4RVKA 4WG4A 5CU4A 3RZFA 3D2IA 2QURA 3E8EA 5AADA 3P78A 3AC2A 5BVFA 3G51A 4EZ5A 1IA9A 4MX9A 4RX8A 4AN2A 4OTWA 4ZY4A 4TPTA 1Y6AA 3VJNA 4C4HA 1QPCA 5HVYA 3ZBXA 3QD4A 1VYZA 5F4NA 4PP9A 5LVMA 1SZMA 4KWPA 4YSJA 2UZVA 3G5DA 4IEBA 3IW8A 4PMPA 5JFWA 2C6IA 2GS7A 2YM3A 3G90X 3VJOA 3H10A 4JXFA 4BGGA 4FSTA 4JDHA 4M14A 5HE0A 5J5SA 5TR6A 3OW3A 3FSFA 1ZOGA 2JIVA 2OO8X 2XNNA 4EHVA 2QVSE 4OTFA 5EM6A 4L7SA 4DLJA 4PL3A 5HTBA 3VIDA 4CT1A 4I41A 4R7IA 5CEKA 5ANOA 5ANDA 4RX7A 3HECA 3DQXA 2XK8A 4DFYA 2I0YA 2JKOA 4QMYA 5EKOA 4FE2A 3A8WA 2LAVA 4DITA 2R3JA 3HV7A 4QPAA 3TNQB 4F09A 2EU9A 2PK9A 1PXMA 3EL7A 1PXPA 3QZGA 4YUQA 3MVLA 2XMYA 4RWIA 5J79A 2J0LA 3O7LD 3PE1A 4I4EA 4EQUA 4RJ8A 5M06A 3PA5A 3A99A 3RTPA 2OK1A 3JVRA 4EOLA 5AUXA 4CTCA 3C4XA 3W55A 4IW0A 5DOSA 4CKRA 3QD3A 2YWVA 4FUYA 2ITZA 1HOWA 4BFMA 3HV6A 1VZOA 3FPMA 1KV1A 2PVKA 4NU1A 3QTIA 3EN7A 2QC6A 2WMXA 4BZNA 1QMZA 2W4JA 2J7TA 3WF7A 5JFSA 5E90A 4WG3A 1E1VA 1XO2B 2OKRA 3KVXA 3PJCA 3PWYA 4CT2A 3OWLA 4FNXA 5HNBA 5JKGA 1ZYSA 3VBVA 3D9VA 2CCIA 3MGYA 4DF3A 3EQRA 3T9TA 2E9NA 3DK6A 4I5CA 2UW6A 3W2PA 3ZSGA 4A4OA 4JDJA 3PXQA 4ZMFA 3IGOA 5HE3A 2VWUA 4KBAA 4C33A 4GCJA 4E4LA 4QQCA 3SW4A 5FBOA 4AN3A 2DUVA 5JRQA 1SM2A 3CD8A 3HP2A 2WTKC 4AP7A 1X8BA 4AA5A 3R00A 2GDOA 3G0FA 3JXWA 2J90A 4XLVA 3MY1A 5FQDC 3ZDIA 3UIUA 5JK3A 2UW4A 4UMQA 5LCJA 4O84A 3FI2A 4BN1A 3SA0A 1R1WA 4GFOA 3OTVA 4M3QA 3FXZA 4HW7A 3UZTA 3LCKA 2C6LA 3JUHA 1JPAA 3ZM9A 3FUPA 3PY3A 3TTJA 5IQBA 2WPAA 4D2SA 3QUDA 4LG4A 3WF9A 4IJ9A 3ZRMA 4O1OA 2W1EA 4IZYA 1SVGA 4U97A 3ANRA 2VZ6A 5J9YA 4E73A 3TNWA 1YWNA 3IW5A 5CVHA 5H9BA 4ZTMA 4CFVA 4CMTA 3MJ2A 4IX3A 4XBUA 4NM0A 5E9EA 1XR1A 5HG8A 4XG4A 2PZRA 5J87A 4APPA 3HUCA 3I0QA 4EC8A 2G2IA 5DYJA 5EQPA 3LJ0A 4H3BA 3MJ1A 4DFUA 3PWDA 5E91A 2OZAA 3QQKA 3GCUA 5FDXA 3A4PA 5HG9A 2HZ0A 4FV5A 4YMJA 3EYHA 3C4EA 2BHHA 1UWJA 1ZMUA 3EFWA 2W9ZB 5BVDA 4O86A 5BX0A 5IDNA 5F20A 5AV2A 5HBJA 5IU2A 4BB4A 2PVNA 4A9YA 2OGVA 3VUDA 5C9CA 3ZRLA 4F0FA 4EH9A 1OBGA 3W2OA 4GK2A 2ITYA 4Z7HA 1KE6A 3OVVA 1Z9XA 2C6OA 2X39A 4OGRA 4V04A 2PUNA 5CF5A 2OIDA 4LRJA 2O0UA 4PMTA 3GQIA 4F6WA 4I94A 3ODZX 1YW2A 4FKTA 2VTMA 5AP5A 3QQLA 1M2QA 2HCKA 3RPSA 5M4UA 1TKIA 5BYLA 3IECA 3UO6A 4EEVA 5JT2A 2YM4A 3O8PA 3GC0A 1S9JA 4ACCA 1H24A 1PRYA 3F5PA 2QHMA 3CCNA 3UODA 3C5UA 3CD3A 2VX1A 3EQFA 3QYZA 4MYGA 1VR2A 3V51A 2PZIA 5ACKA 4XEYA 4RIWB 3CTQA 4YZDA 4BWPA 2OF2A 4Q5EA 2R3QA 3BU6A 3F3UA 4RC4A 2YJSA 3O8TA 4RJ5A 4M68A 2HW6A 2F7XE 2I0HA 5FP6A 1W0XC 3BYMA 3GI3A 4GSBA 4B7TA 5C8NA 5HICA 3M1SA 1J1CA 3ULIA 3UQGA 3KRRA 3QRUA 3NZ0A 4DGOA 4ZSAA 4MCVA 3RPOA 1ZYJA 4JR7A 3ZLSA 4ZJVA 2G15A 3EQIA 4F99A 1YXUA 4DEDA 3AC5A 5C8KA 3K5VA 3OY1A 4YNEA 3UYSA 2C0OA 4ZAUA 2F2CB 1IA8A 4D1XA 4KBCA 1H0VA 4R3PA 5LVNA 3BWJA 4FSQA 4RWKA 5J9LA 3Q4UA 1KE9A 3TKHA 4CKIA 5FTGA 5C26A 4FV7A 1XBBA 4EOMA 5CWZA 4G3GA 1M7QA 4ZSLA 1DI8A 3DU8A 3QTUA 4PY1A 5HBHA 4A7CA 3QKLA 2NO3A 2ONLC 4KIKB 4DFZE 5T68A 4L3LA 2VTAA 4BL1A 1YKRA 5BQ0A 4FT9A 5EI6A 3OEFX 2FGIA 3U87A 4JOAA 4MD8E 4UXQA 4IVCA 3W8LA 2JAVA 3P23A 3A7JA 4QPSA 3SV0A 3EN5A 2BMCA 3AC8A 3FI8A 1ZYDA 3DFCB 4FKQA 4H05A 2ETKA 2O3PA 3E3PA 4QQ5A 5HX8A 3EL8A 2PVFA 3I4BA 2YCRA 5HE2A 1XWSA 4GKHA 4NCTC 3QA8A 2NPQA 4MF0A 4AZWA 4MKCA 5CAOA 4U8ZA 2LGCA 4YTIA 3TZ8A 2ITQA 1A06A 4HOKA 3F5XA 4QP4A 4WNOA 3V8SA 2GTMA 3BLHA 3FLSA 5E8YA 2P55A 5DHJA 4RX5A 2JLDA 3HX4A 3NUXA 4IB3A 3E63A 2VAGA 3QTXA 4TXCA 3MVMA 5EM7A 4C57A 3ZFMA 3R8ZA 3TJDA 4FVRA 3QD0A 3VAPA 2H9VA 3F2RA 3AC4A 3ORMA 5ICPA 3ROCA 4J8NA 2IW8A 2H34A 5HGIA 2WELA 2JKQA 4XV3A 4A06A 4PPBA 2PVJA 2ITOA 3E8NA 5CALA 2C6MA 4PX6A 4KSQA 4O96A 2ZDUA 3W18A 2ETRA 4A9TA 4L7FA 2W1CA 2J6MA 3N51A 3DNDA 4QO9A 5AR5A 4E4XA 3VNTA 2VTNA 2WTCA 2IW9A 3GBZA 4O0UA 2FSOX 4M13A 5CZHA 1OMWA 4LV8A 3ZXTA 1Q62A 5IEVA 2VUWA 3A7HA 5EDPA 1ND4A 4I0RA 1H27A 1DAWA 1LEWA 2A27A 2VTIA 3Q52A 4QD6A 1STCE 1ZLTA 3VN9A 2A4LA 3E7OA 4FYNA 4AF3A 2Z7RA 4HCVA 3BYUA 3QZIA 4GFMA 4AWIA 3DAJA 5ANIA 2ZV9A 2IWIA 4YC8A 4AOJA 5TF9A 4FEWA 4MD7E 2ONLA 3Q5ZA 4MQ1A 2BRGA 3JY0A 3MPMA 1BYGA 3NNUA 2EXEA 4S33A 4NIFB 2JFMA 5IQIA 3NUSA 4FTRA 1BKXA 4C4GA 4W4XA 3ZO3A 1XHAA 2BFXA 2R3FA 2HELA 4D4VA 4O7LA 4TKSA 2XKCA 1GZOA 3DBDA 3BRBA 3P0MA 2R3PA 1PKGA 4Z9LA 4NCTA 2WMUA 3AD6A 5EYDA 5CS6A 3MV5A 1YXXA 4HVSA 4ALUA 3GC9A 1KE7A 5HVKA 3QALE 3BKBA 2GFCA 2JAMA 3OD6X 2C69A 5DEYA 2Z2WA 3FXXA 5J1VA 4IVAA 4EOSA 3QRJA 2EXMA 5JGDA 3COHA 4D0XA 3E93A 3T8OA 3KMUA 3KXXA 4C3FA 2W5HA 3ZUVA 3O8UA 5DPVA 3ZC5A 3TDWA 5F95A 3ERKA 1XH5A 3KRJA 2JGZA 4IDTA 1JWHA 4I92A 2XKEA 4ZTNA 5IA3A 3UOJA 5LARA 4O7YA 5KHWA 1H00A 3EFLA 1TQIA 4FVQA 2ITTA 4O0WA 3ZOSA 4CFNA 2CSNA 2NRYA 4UXLA 5HHWA 4AG8A 4FEVA 3QUEA 1YRPA 4AZVA 3TIZA 2CKOA 4MQ2A 5L2QA 3F3WA 2WMVA 4XS2A 2QLUA 3RINA 4U3ZA 3Q4ZA 4C7TA 1HCKA 4IXPA 4EHEA 4DFBA 5EM5A 3OP5A 3MFRA 4YP8A 4GFGA 4IAAA 5BNJA 1JKLA 2W5AA 1UWHA 1JSUA 2VTSA 2WTDA 4Y5QA 3TTIA 5HD4A 4M69A 3OOMA 4FTQA 4O27B 5GNKA 2PE0A 4GIIA 4XG3A 4P4CA 3VQHA 3P7AA 4ANMA 2GPHA 3C0IA 5EYMA 5D41A 3LMGA 2YA9A 4X3FC 1PYXA 3DBEA 4GK4A 5JEBA 2R5TA 2WO6A 5H3QA 3UPXA 2VTQA 4P5ZA 4M15A 3DV3A 4W9WA 4DLIA 2E9OA 2QOQA 4Q9SA 1IASA 3DKGA 4RBLA 4YTCA 3NVKI 4EH8A 2JDVA 5LWMA 3WE8A 1Q8WA 5HU3A 1LPUA 3HDMA 3PY0A 4NFNA 4UZDA 5D1JA 2XBAA 5E7RA 4QMTA 5A3XA 1H08A 2IVSA 3KY2A 4F6UA 2OJIA 4QTDA 3HAMA 4DCAA 3RPYA 3DFAA 3O71A 4J96A 2HYYA 2PHKA 4HCUA 4B8LA 5EK7A 4NTSA 3LQ8A 4KB8A 4EH2A 4GVJA 2RFEA 3PFQA 4O0YA 3ZO2A 3VQUA 3HV5A 3SXSA 3OFMA 5CI7A 5FM3A 1NVSA 4DT9A 5JGAA 3ZHPC 3NSZA 4JJRA 4IDVA 4PF4A 3DGKA 3V01A 1OIYA 2YERA 3C1XA 2W05A 3NWWA 4LOOA 3L9LA 5B0XA 4BDKA 1O6YA 3OWJA 2AYPA 4X2KA 2B1PA 3PZHA 4EQCA 4G31A 4JBQA 4RWJA 4RFMA 1IAHA 4J8MA 3E8DA 3F7WA 5ETFA 4PTGA 3QAME 3DLZA 4USEA 4RLKA 3NW5A 3NW7A 4O1PA 3BLQA 2WTVA 1LUFA 3QRTA 4AW5A 3AOXA 3O17A 3U4WA 3QKKA 3W2RA 4DFLA 5BVKA 4DEAA 4FKWA 5HX6A 4IB1A 5CSXA 3VS1A 5KE0A 2YIQA 5D10A 4FV4A 2Y4IC 3OBJA 4O0TA 5EHOA 2DS1A 5ETIA 5GHVA 2YZAA 4EKLA 3IGGA 5IA1A 3OCGA 4I93A 4IM0A 5KNJA 2WAJA 1FVVA 4JIAA 4XP3A 4JIKA 3FJQE 4OLIA 3VBWA 4CMOA 2BTRA 2QOBA 5CENA 3PIYA 4FC0A 2VNYA 1L3RE 2UUEA 3AXWA 3HMMA 2PE2A 3OXZA 3PJ1A 4RIXA 1URCA 4WNPA 3LE6A 1SMHA 2PMLX 5T3QA 2C6DA 4X3FA 1OB3A 1H0WA 2PE1A 3O0GA 5H8BA 3U4UA 4PDYA 3LFCA 2Z02A 5G1XA 1J7LA 3PIXA 3QRIA 5IQGA 4MNEA 4CFFA 3SC1A 2R3KA 4YZBA 2H96A 3COKA 5CEIA 4G5PA 5CU3A 4TNBA 3GP0A 4QOXA 2CLQA 2ZV2A 3R1QA 2BRNA 2BR1A 3LMHA 4KKHA 3KMWA 3UZRA 3JYAA 3G15A 2G01A 4NKAA 5A46A 4FTUA 1JQHA 4JQEA 2Y7JA 4ENYA 4EK5A 2CHLA 3VS4A 3UP2A 2CKQA 4QTAA 4DC2A 2X81A 4JRVA 4ZTSA 5A14A 3R7EA 3F3VA 2YAAA 3E62A 3TNIA 4EI4A 2BHEA 2BVAA 2WMTA 4D55A 2P4IA 4TYJA 4WUAA 1NA7A 5I0BA 4AFEA 2B53A 3CPBA 3GCVA 5L3AA 1OPJA 5AX3A 5IA5A 2ITXA 4RT7A 4R5YA 2X9EA 2X6DA 3NX8A 3NDMA 4FEXA 2J51A 4YJVA 5E8WA 3VUIA 3PP1A 4ZZMA 4RSSA 2W96B 2R3LA 4K1BA 4TN6A 2BKZA 4JBVA 5AV3A 3NAYA 5DRBA 2C1BA 5KCVA 3ZBFA 3EIDA 3NUNA 1WBOA 4XV1A 4YO6A 1G8SA 2HXLA 3BHHA 4ZMEA 3KF7A 5HU9A 2BZJA 1S9IA 3MESA 3LPBA 4YZMA 3F3TA 4EOIA 2W0JA 2QO2A 2IJMA 2R64A 3MPTA 3NUUA 4L45A 4KS8A 5FM2A 3WE4A 2OZOA 4C59A 2WMWA 3PP0A 5L2IA 2V7OA 3WOWA 1MRYA 3NCGA 2CGXA 1OL2A 3R71A 4D4YA 4DTKA 3FQHA 3LLAA 1H25A 3F5UA 3D83A 4AS0A 4Q5HA 2VV9A 5DR2A 2WMBA 1E9HA 3LXNA 4PV0A 3RM7A 2VTJA 3CQWA 1AD5A 4C4IA 5AAFA 2ETMA 2QG5A 4EYMA 4NH1A 2XVDA 4Z55A 1J7UA 2FSMX 3TV6A 3UG1A 4GK3A 2X4FA 4NW5A 4LGDA 4N0SA 2BUJA 3TXOA 4V0GA 5CT7A 2ITUA 4U6RA 1Y6BA 4FSZA 3U51A 4P7EA 4NEUA 4FVPA 3LJ1A 4X2NA 4QYYA 2IO6A 2ZB0A 3S2PA 2QONA 3U8WA 3MBLA 3UVRA 3VUGA 3A60A 3VS5A 4RJ7A 1R0EA 4PL4A 4QT1A 5CF4A 1UU9A 2C47A 5CTPA 4OTRA 3A4OX 3OT8A 3F9NA 3NNXA 4CGAA 2E9UA 4O6LA 5EOLA 4RIYA 2WD1A 4YHFA 3TNPC 3WF5A 1VJYA 3FLNC 4Y8DA 2C5XA 1NXKA 3RK9A 2R4BA 2W4OA 4JG8A 4C36A 5J95A 4IZ7A 4KIPA 4P5QA 3REPA 2A1AB 2XUUA 3PRFA 4BCMA 4IVDA 4DH7A 3NRMA 3LZBA 4XV9A 1M2RA 2JEDA 3KULB 4IAIA 5ETCA 5FTQA 2P0CA 4OBQA 2R3HA 4USFA 1PJKA 1ZYLA 4EHZA 1SNUA 4CQEA 5IISA 4CV8A 5JQ8A 3COMA 4RX9A 5F1ZA 4G9CA 3I5NA 5A4QA 4JBPA 2A0CX 3ENMA 5C4LA 5D7VA 3PPZA 4IM2A 2NNWB 2YCSA 4CFMA 1QPJA 5LXMA 2PVMA 5AAEA 2VGOA 1YI4A 3HP5A 4EH7A 3CIKA 3EQGA 3WIGA 3PPJA 5AP0A 3DNEA 3RK7A 4AFJA 5B2MA 3UDBA 4K2RA 4B8MA 3AGLA 4YBKA 3DBCA 2J9MA 5L4QA 3DQWA 2GS2A 3R0TA 5HTIA 5DE2A 2XA4A 4I1ZA 1G3NA 3LCOA 5AUYA 4DG2E 4I0TA 4IVBA 2BZKB 1FOTA 5M08A 4FSRA 2VTRA 3LFDA 2XKDA 4O7RA 3GB2A 3Q6UA 1V0BA 3VW8A 4GJ2A 4WBOA 3TUCA 2C6EA 5CY3A 2OJGA 3VHKA 3LVPA 5IQFA 3V5LA 4ZXTA 1R3CA 3P08A 4AXAA 2UZLA 3ZZWA 3HA8A 3R9RA 4UYNA 3FL5A 2YIRA 5IQAA 4JAJA 2O65A 3ATTA 1Q24A 3ZYAA 4H39A 2J4ZA 2QODA 4G9RA 5I9XA 3GFWA 4FZAB 2C5VA 4X0MA 3UNKA 2QOLA 3CS9A 3Q04A 3C7QA 3TKUA 2YJRA 4WD5A 1XKKA 2XK7A 3PE2A 4W9XA 3SLSA 3AT2A 3R9NA 4FEQA 2A2AA 4IJPA 2IN6A 3R2BA 2VWZA 4UWBA 4RFYA 1QCFA 1WAKA 2PUUA 2Z7SA 2ZMDA 4Y85A 4C4EA 4RRVA 4HVIA 2AUHA 4ALVA 3OZ6A 2QKWB 3L1SA 1GAGA 3H9RA 1BLXA 5AM7A 3Q5IA 4O38A 2YM5A 1Y91A 2UVZA 4IX5A 2VWWA 3FMDA 3R22A 3ORIA 3FYJX 4JDKA 5FUTA 3H30A 2FSTX 4XRLA 4YJTA 3SDJA 3AC3A 1VYWA 1PMEA 2W1HA 3P4KA 4NM7A 4S31A 5HQ0A 2GQGA 4TYHA 3MH1A 5HLNA 3MIYA 2HY81 2OG8A 4CFUA 4D58A 4EUTA 1XH8A 2X6EA 3DTWA 3VBQA 4KD1A 4GW8A 4W8DA 3Q60A 2ZM1A 4KRCA 1MRUA 4ITIA 2GCDA 2CGVA 4E26A 4KS7A 1W98A 2WQEA 1Q3DA 2WTKB 3B2WA 4HVDA 3RP9A 3W1FA 2XM9A 5K4IA 4BHNA 2ERKA 3QQUA 3D5VA 3DAEA 4FOCA 4W4YA 3W16A 4B4LA 5E8ZA 4M97A 5AV4A 3L9MA 4CMUA 3EQBA 3F3ZA 2WOUA 1XH6A 4TRLA 4BDGA 2YDIA 1BI8A 2GNGA 3NIZA 4IZAA 4KABA 4AZEA 3OC1A 5IKWA 1UA2A 1JOWB 3FSKA 2BAJA 2CN5A 4HYHA 4ID7A 1FGIA 4GL9A 3E88A 4F1OA 2CNUA 3LCSA 4FV2A 1GZ8A 4FIGA 2IZRA 3OWPA 4RZVA 5KUPA 4PMMA 1Q8YA 3NNVA 4FTTA 3G33A 3SRVA 3OOGA 4O83A 3KU2A 1LP4A 2VO3A 4IC7A 1PKDA 2FA2A 3DBQA 3V6SA 3WYXA 5KKRC 4RVLA 3UQCA 3GVUA 3CKWA 3LFFA 4GU9A 1DS5A 5IA0A 3QYWA 4K11A 5AM6A 3QTRA 2J0MB 2VO0A 4LGGA 3O96A 2O63A 4FZ7A 4NK9A 4YBJA 4ACMA 5IF1A 1PMNA 2UW8A 1AGWA 2QOCA 2YIWA 3FMKA 3R1NA 5DT3A 2YM8A 3D2KA 5TT7A 1GJOA 1H8FA 4EK6A 5HIEA 2GNLA 5AP7A 4EJ7A 5L6PA 3L9PA 5CSVA 4XP0A 4FTOA 4GUEA 4IWQA 3VF8A 4G17A 2B0QA 5HVJA 4AOIA 4DFNA 4O81A 3PLSA 5CXZA 4XBRA 2QG7A 3IKAA 4HCTA 2BROA 2V22A 4TWPA 2VTLA 4F9BA 4MWIA 1FQ1B 4Q9ZA 2I1MA 5IEYA 3BHUA 1OUKA 5M09A 3FZRA 3QCSA 5CSHA 5FTOA 4J97A 1NT2A 1BUHA 3QWKA 4FA2A 3FZPA 3FZOA 4WBBB 3I7BA 2V55A 2OH0E 4WIHA 4X2FA 3QGYA 2Z7LA 5EHLA 1JKSA 4DAWA 4BKYA 1PHKA 4BC6A 2G2FA 4I6QA 5BMMA 5EI2A 4U45A 5AFVA 3BEAA 3CGFA 1Z5MA 4BCHA 3LFQA 4HZRA 4L01A 2UZUE 3E8CA 4EUUA 1UV5A 3CTHA 5CEMA 2YN8A 4O6EA 3U6JA 4UX9A 5CU0A 4QMZA 4E5WA 3L8PA 5M55A 4XX9A 3MTLA 4S34A 3VS7A 4BBFA 3CC6A 3FKOA 1JVPP 4YR8A 3K3JA 3DT1A 3KN5A 2Z7QA 3FKNA 4CV9A 4J7BA 4IIRA 5GIPE 3TUDA 4OBOA 3R01A 2QO9A 1ZARA 4BVUA 4CZTA 3PG1A 3S3IA 2YIYA 3UMXA 3WYYA 4IX4A 2OXDA 4BCQA 3TWJA 3QQGA 1SYKA 5CU2A 3V5QA 3GC8A 4GG5A 4R7HA 5BYYA 2ZB1A 4OR5A 2XNPA 1JAMA 2XJ1A 3NIEA 3DDQA 2OU7A 2UW0A 4AT4A 4D5KA 4A9UA 2IZUA 4K6ZA 1OL7A 2GTNA 4EBWA 4G2FA 3EHAA 3NUPA 5DLSA 4CZYB 4FK3A 5IQEA 2XK6A 4L52A 4V01A 4F9YA 4RG0A 1K3AA 4I5HA 3AG9A 2R7IA 4KSPA 1WFCA 4PDPA 5GZ8A 3BGQA 3WBLA 3JR1A 3FQEA 4FK6A 3LCDA 4A07A 3QGWA 3WARA 4X6RA 4O7VA 5HZNA 2BIYA 4PDSA 4TYEA 3QA0A 3IDPA 4MH7A 5D9HA 4E5AX 3BIZA 4E8AA 4AT5A 4BI1A 4UBAA 3RGFA 1Z57A 4HNIA 5E1EA 4DBXA 5L2TA 3IDCA 1JKKA 2UVXA 3QHWA 1TQPA 4UALA 2X2KA 4EK3A 5HLWA 4OTDA 2IVTA 2PTKA 5I9WA 3R8UA 2O5KA 3PXYA 5DMZA 3CEKA 5IH5A 4D1ZA 1J3HA 3JY9A 4M67A 2H8HA 3ZEPA 3LJ2A 4C8BA 4ANBA 1OZ1A 2UZTA 5L8LA 1SNXA 5AA9A 3TACA 3RVGA 4FG8A 4OW8A 1OPLA 3E7VA 4YJPA 4G34A 3KEXA 4O91A 3HDNA 5EDQA 3ZCLA 2Z8CA 1Q61A 2C1AA 4ASZA 3CQUA 5CVGA 4ZJIA 2UZWE 4HYIA 3ZFXA 5HORA 3T9IA 4DG3E 3F7ZA 5KMOA 3QLGA 3BQCA 3OY3A 3I1AA 3A2CA 4PRJA 4XG8A 4UMUA 5CASA 5CF8A 3SGCA 2WFYA 4ALWA 4BHZA 4FSMA 3ITZA 2HIWA 2YDJA 1H01A 2XCHA 3EB0A 4IMYA 1J7IA 2CNVA 4E7WA 3EYGA 2XIZA 3D5UA 5AIRA 4F6SA 3GU6A 4QMQA 3AT3A 1NVRA 4DGGA 3H9OA 3WZUA 3PVWA 4AACA 4GVAA 5GIOE 4RA4A 3MB7A 3R7VA 3VRYA 1REJA 3TL8A 3M42A 2HAKA 4QMVA 3TKIA 3H4JA 3S1HA 3AQVA 4A9SA 3PJ2A 3PVGA 4IB5A 4IM3A 4F63A 4PPCA 1Q4LA 2G9XA 3SQQA 2ZV8A 5M4IA 1YXVA 3QZHA 1PXKA 4EYJA 2WMAA 3UP7A 4FV8A 3E87A 3KB7A 3U6HA 2JIIA 4J95A 2X1NA 4ASXA 5CAPA 4H3QA 2WIPA 3LM5A 4IE9A 4ZTQA 3LFNA 3N4VA 3LFSA 2OI4X 3VC4A 2FYSA 3L9NA 4U3YA 4HGLA 1FGKA 4KIQA 4C0TA 4E6QA 2QU5A 4Y83A 5A6NA 3GU8A 3EMGA 5I9YA 4F65A 2YABA 1URWA 3DTCA 4KAOA 4IAZA 5AR2A 3O23A 3ORXA 5A4EA 2AC3A 3H9FA 2C0IA 3E92A 1U54B 3VBTA 4FIFA 5EYCA 1MQBA 2ITWA 3RCJA 1OKZA 3O50A 3VS6A 3Q96A 2VTOA 3OBGA 4FOBA 2KULA 2V7AA 4EORA 2QCSA 4AE9A 1OM1A 3PXRA 3HEGA 5IDPA 4NL0A 1CKIA 5CQWA 3C4ZA 1XH4A 3A7FA 4XG9A 4IHPA 2YZLA 2C6KA 5CZIA 3NLBA 3F82A 5GZ9A 3THBA 4R7BA 1GOLA 2BZIB 3DK3A 4IACA 4E6CA 1ZWSA 4OUCA 4H36A 2IVVA 4BI0A 3GNIB 4MWHA 5GZAA 4GT4A 4YLJA 4NJ3A 4J71A 3QC9A 3FMEA 4YHTA 4RJ4A 5K4JA 2F49A 4YLKA 5C8MA 2Z60A 3TV7A 3D7TB 3R2YA 4P90A 1BL7A 5ANKA 4C58A 5F94A 2PPQA 5E8TA 4RJ6A 4BDEA 4DCEA 4I4FA 3SOAA 3CTJA 5CLPA 3WI6A 4EZ7A 4ZY5A 3IOKA 4PDOA 5CYIA 2I40A 4RVMA 3G6GA 3QZFA 4XG2A 5K0KA 4FG7A 3HRFA 3PSBA 3TZ7A 5KMMA 5KMJA 1FBNA 5K5XA 4EL9A 4Y72A 1OL5A 5CF6A 5IZFA 2IZTA 4ANSA 1DI9A 4K77A 3UIXA 5A9UA 2ZAZA 4EHGA 1PMUA 2B9HA 2QU6A 2WKMA 2XB7A 3QQHA 4JG6A 3R7UA 3ZTXA 3Q4TA 2P33A 3OXIA 3ELJA 2BRBA 5AV0A 2WMRA 4H1JA 2WGJA 3DOGA 3T3UA 5BVNA 4ZTLA 3VS0A 4WRSA 1A9UA 3I5ZA 3G9LX 4DH8A 3FZSA 2VWXA 3JS2A 5BVEA 5FBNC 4FIEA 4O22A 2GQSA 3UIMA 3KVWA 4N4SA 5DRDA 3P86A 3RALA 2X8IA 5D7AA 3F6XA 5G6VA 2OW3A 4C37A 5L2SA 3MVHA 3VBYA 2Y4IB 5I5ZA 5HI2A 3BV2A 4QMPA 4MXXA 3W8QA 1WBSA 1WBPA 5DBXA 2R3RA 4RIWA 4DH3A 5IMEA 3SG9A 2PSQA 3DXNA 3LAUA 3VVHA 4KA3A 2XIRA 2OJJA 5I9UA 5EW3A 2C3KA 2BTSA 2XEZA 4NFMA 3TG1A 3BU5A 3SG8A 2ZVAA 3DZOA 4CRLA 3R1YA 1ZOHA 4L46A 5LVLA 4BIEA 4QMMA 3W2QA 5HO7A 3MH2A 4L00A 2ITVA 2C5NA 3MY5A 3R63A 4QQJA 5E1SA 4E20A 3IDBA 1XH7A 3DKCA 3EJ1A 3RHXA 2XNEA 2BZHB 1U59A 5TE0A 3KXZA 2QOIA 3EKKA 4E93A 3KMMA 3EH9A 3RK5A 4D2RA 2CN8A 4FNYA 4XH6A 3FL4A 2HWPA 4G6OA 4UYAA 5HCYA 5CANA 4E4MA 5L8KA 4I5MA 4QMXA 4TT7A 5C27A 2EB3A 2XIYA 3CXWA 4BCNA 4KIKA 3SD0A 5TO8A 1OVEA 2X7OA 5EQEA 3U9NA 4MTAA 3POZA 4QMWA 4WNKA 3ZSHA 3CY3A 2QR7A 3UE4A 3FC1X 4L43A 4E4NA 4MXOA 2DWBA 2XEYA 4DGNA 3RM6A 4RIYB 3RCDA 3CBLA 3QC4A 2XYUA 4QYFA 4DG0E 4AZFA 3FZ1A 3VS2A 1O6KA 4FIJA 4L53A 5FP5A 1GNGA 1RQQA 4LQMA 2ITPA 2R2PA 3V8WA 5HG5A 2IZSA 1KSWA 3D15A 3PUPA 5DWRA 3FLWA 4KIOA 3V5TA 3RJCA 3OW4A 4CCBA 2W1ZA 4F70A 3H3CA 4N57A 3ZLYA 2QNJA 4BBEA 4NM3A 3F5GA 3FLQA 4C4JA 3CPCA 3I60A 5AX9A 2XM8A 4JBOA 5EG3A 3P5KA 3R8PA 3V3VA 3GU5A 3KXGA 4DTBA 1OKYA 3ZUUA 5K0XA 2HY0A 3BYSA 3ZH8A 3P7BA 4BR3A 1Q8UA 3KRXA 4L67A 5I9VA 3WZEA 4YLLA 4LGHA 5C4KA 2IW6A 3G6HA 2YDKA 4II5A 4EK4A 4PNKA 1OL6A 4UN0C 2BKKA 2DYLA 1UU7A 2YACA 2WMSA 4O21A 2WMQA 2X8EA 3ZS5A 3SXFA 4YC3A 3F88A 4OT5A 3IO7A 4FTCA 3E3BX 4GYGA 4QP6A 2JKKA 3BV3A 3OMVA 4FYOA 4I23A 4UB7A 1T46A 1NVQA 2GHMA 4GH2A 1W8CA 5CVFA 1IG1A 3CJGA 4ANQA 1MP8A 4ACHA 3GGFA 3IW7A 3PXFA 2GNIA 5EI8A 2HWOA 3BLRA 4UMPA 4F64A 4IWOA 1A48A 4EOKA 4G1WA 1YI6A 4ASEA 4WKQA 4QP7A 3UNJA 5M4CA 4PWNA 3OS3A 3VO3A 5M57A 3M2WA 4FX3A 1O9UA 1ZY5A 3II5A 3Q6WA 4RPVA 1TQMA 1G5SA 3ETAA 3MVJA 3TT0A 4O7SA 2PL0A 4FTMA 2BDFA 2CGWA 3MW1A 3GCSA 4NIFA 4CFXA 2RFNA 5JZNA 3CE3A 4O0XA 4JDIA 5CAUA 5AUUA 4MHAA 5GJGA 3EQDA 5JFVA 1KUTA 4D5HA 1PXIA 2PVYA 3CSVA 5CEOA 5EDRA 4H3PA 3PDTA 3HMIA 2UZBA 2C4GA 2PVRA 4YJQA 3I6WA 4FODA 4F9WA 4X2JA 3G2FA 4HPTE 3UOLA 4FKRA 5IUIA 3ULZA 3MS9A 3FHRA 2E9PA 4H58A 2XNOA 4I6FA 5CXHA 3T3VA 2F57A 4BTMA 5CT0A 2C5OA 2ZDTA 2WNTA 3SXRA 3RMFA 2UVYA 1IRKA 3WZKA 4LOQA 2I6LA 4R1YA 4DH1A 5AUTA 5LVPA 3UVPA 3CGOA 3MB6A 3FMHA 3QFVA 4JR3A 4C2VA 5L8JA 1H1RA 1ZMVA 3GOKA 2CMWA 3KGAA 2WQBA 4BZOA 3RAKA 2UW9A 3NPCA 3EN9A 3DPKA 3RPVA 4CSVA 1R78A 3LM0A 3IONA 4IAFA 1PMVA 4KKGA 4R1VA 4AGUA 1JBPE 4L3PA 4BBMA 2B9FA 4GU6A 4G16A 4S30A 3ZLXA 3DXPA 4CG8A 3BHTA 3QXOA 1FVRA 5ANJA 1P4FA 1PXJA 5HCXA 4F08A 1AQ1A 2G1TA 4CFWA 5IA2A 1Q99A 4EH4A 1ZMWA 2QOFA 2GQRA 2VTPA 2UV2A 2X9FA 4R5SA 2RSVA 3KCKA 4O0SA 4FIHA 3ZU7A 3Q32A 5J7BA 2HK5A 4YTHA 5B2LA 1DM2A 3RNIA 3ORNA 3R9HA 2W7XA 4NSTA 4O7WA 1J91A 1MRVA 5FEDA 2BRMA 2QLQA 3ACKA 5BUIA 4MXCA 3SOCA 1FMOE 3L8SA 5AJQA 2PWLA 1OL1A 4X6QC 4EBVA 4UV0A 2YM7A 2J0JA 4BTJA 3QWJA 3VUMA 4DEEA 1H1SA 5LOHA 1YOMA 3MFTA 5AAGA 4C61A 5LJJA 1M52A 3HMOA 1CM8A 5FDPA 1Q97A 5ACBC 2A19B 4AAAA 5LMBA 2C3IB 4I5PA 1E1XA 4TWCA 5CQUA 3ID6C 1Y8GA 5KZIA 4GG7A 5M56A 5K5NA 4N6YA 5AP4A 2BCJA 4U80A 4IADA 3CP9A 4QP3A 4IH8A 2VWBA 5HD7A 4XOYA 1U5QA 3PIZA 4YO4A 1QPDA 3GC7A 4U0IA 2X7GA 4FT5A 2BPMA 3PSCA 3QX4A 3LW0A 1YQJA 2QOKA 3QCYA 5BVOA 5FXRA 2XJ2A 2VX0A 4FICA 2XRUA 4C34A 5B2KA 2P2IA 4GS6A 1Q41A 2EB2A 2VNWA 3R04A 1WBWA 4DEGA 4WSYA 3UGCA 1GIJA 5E8XA 4IQ6A 1ZZ2A 4UMRA 1PY5A 2PUIA 4WO5A 4YPSA 4MXYA 4M0YA 3K54A 2C0TA 5DFPA 4R8QA 3KXNA 3UNZA 1RDQE 3W33A 3PY1A 2ITNA 3VBXA 4JX3A 4R3CA 5KMKA 3DDPA 2G2HA 2JDSA 2YLEA 4J98A 2JKMA 4FL1A 3Q9WA 3PXZA 5CU6A 1M14A 2YLFA 1NY3A 2B9IA 4MBIA 4RA5A 4EWQA 2YCFA 3LIJA 1GZKA 1KOAA 2ZYBA 4FL3A 4P2KA 4ZIMA 4TL0A 4XYFA 3NUAA 3DAKA 3MYGA 3GT8A 5AUVA 4CZUA 3OCSA 5FXSA 3RNYA 2R3IA 2VU3A 2I0VA 4GMYA 4DEBA 4YC6A 3FWQA 4ITHA 2JDTA 4LOPA 1W82A 2WB8A 4FT3A 4UMTA 5HOAA 4F9AA 4PQNA 1YWVA 2OJFE 1W83A 2CCHA 5IPJA 3HV3A 4QYEA 3KQ7A 4U79A 2XCKA 4G3CA 4CKJA 5FLFA 1H28A 1B38A 4HZSA 3F2AA 3SW7A 2HOGA 2V62A 4A9RA 4XCUA 5HEZA 4AGWA 2PU8A 2HENA 2EWAA 3AMBA 3R8LA 2QD9A 2JBPA 3Q9ZA 3RI1A 4BCGA 4ERKA 1ZRZA 2OSCA 2OZAB 4EJNA 4D2TA 3FMNA 5IA4A 1ZZLA 3FEGA 1ZOEA 1U46A 3MH0A 3EN6A 5FEQA 4L3JA 4DHFA 4GT5A 4JS8A 5E4HA 3BHVA 5I3OA 3EWHA 3I79A 3I0OA 5DR6A 5CEPA 5CI6A 4BWKA 1UNHA 3BE2A 5A4LA 4FV1A 2B55A 3WF8A 3FC2A 3C51A 1RW8A 3KA0A 4FG9A 4G5JA 4RJ3A 5JQ5A 4BDCA 3NR9A 3HMNA 2GFSA 3NYVA 4NKSA 4C4FA 5M07A 4TYIA 4D9TA 3QTWA 1H1PA 1UVRA 3ANQA 4NTTA 3UG2A 5A4CA 5M51A 4E3CA 4D0WA 4O0VA 3FY0A 4N6ZA 3FY2A 2V0DA 3F2NA 4FI1A 4FSWA 4MNFA 4EC9A 4OAUC 2ZV7A 3TZMA 3PZEA 5LMKA 4AUAA 3GQLA 4DGMA 4FZ6A 3FKLA 2JDRA 4AGCA 3A7IA 4FSYA 2QQ7A 3BI6A 4NYEA 4RC2A 2UW5A 2PZPA 3PA4A 3SX9A 3VUKA 3M11A 2DQ7X 4B99A 3UC3A 3C13A 4FTIA 5J8IA 4ZS0A 1RE8A 2CDZA 1ZXEA 3QTSA 2YFXA 4OTHA 4YJUA 1YHVA 2WTWA 5AR3A 2YIXA 4ZK5A 4D2WA 2PUPA 3TM0A 4RWLA 4ZSGA 2PVLA 2JDOA 4E1ZA 3QQFA 3WF6A 5EM8A 5AP2A 3RAWA 2BFYA 2QR8A 1UU8A 3BX5A 3OXTA 3L8XA 4WHZA 3G0EA 2XKFA 2WQNA 5C03A 5DIAA 1PW2A 1PXOA 3O2MA 3R30A 1IR3A 5ITAA 5J5TA 5JZJA 4QMNA 4AT3A 4Z7GA 3NS9A 3PVBA 3NYOA 2VTTA 3POOA 2B7AA 4DTAA 4ASDA 5B7VA 2F4JA 5A54A 4GT3A 2EXCX 3DCVA 4CCUA 3ALNA 2UW7A 3CY2A 5HO8A 4G3DA 2XK4A 2WOTA 4CTBA 4FZFB 3TN8A 5IG1A 2I0EA 3LXLA 3LKMA 5L6WL 3FMMA 3QBNA 3OUNB 3R7YA 5CAVA 4QP8A 4RLLA 4EH6A 5EW8A 2HZIA 5H8GA 2E9VA 2WU6A 5ETAA 2B9JA 4YU2A 3MI9A 4X2GA 3RZBA 4V05A 3QL8A 4BKZA 3H0YA 2F2UA 2W17A 3KFAA 3OUKA 4RQKA 3BE9A 4ZLOA 4EONA 4QP1A 2PMOX 3KULA 5TOZA 4G3EA 2OJ9A 2BDJA 4FV6A 3ORZA 4PUZA 3UQFA 4RMZA 4JLCA 4AZSA 1M7NA 5LWNA 4YZ9A 2C3JA 4BCKA 2ZOQA 3VW6A 4FBXA 1CMKE 3UYTA 1L8TA 4JVGA 3S4QA 4L6QA 4XLIA 2J0KA 3WZDA 1JSTA 5DT0A 5KX8A 2XNGA 3ZM4A 2CKPA 5AMNA 4Y5HA 3ORKA 5DA3A 5D11A 3DJ7A 4MAOA 5E8UA 3N4TA 2GNHA 2W4KA 4LYNA 2PULA 5EH0A 2GU8A 1OITA 2I7QA 1OIRA 1SVEA 4XG7A 1KE8A 5JMSA 3NMUF 3DKOA 4I6BA 4F7JA 3FLYA 4U7ZA 2WTIA 4QMSA 3BQRA 3AMYA 1MUOA 3NAXA 1YHWA 4NT4A 2X2MA 3QCXA 2V5QA 4JI9A 4Z16A 3NYXA 4QNAA 5M44A 3R9OA 4BYJA 1WCCA 4TYGA 4AA4A 3SVVA 3TDVA 3AMAA 3R21A 3IOPA 2YCQA 3CQEA 5HG7A 4IWDA 3OHTA 4C3RA 5AP6A 3LXPA 1SVHA 5LCKA 1I09A 1Q3WA 3V5JA 4TW9A 2W1FA 2OWBA 4RVTA 3OROA 3LHJA 2P3GX 2UZNA 3LFEA 1OGUA 3A62A 2R3GA 4TTHB 4WT6A 4XOZA 5KBQA 2XS0A 5LVOA 4FEUA 5DEWA 1QPEA 1CDKA 2HZNA 5AP3A 4HJOA 3ZO4A 1P5EA 3HA6A 2WEVA 3NEWA 3HGKA 3RKBA 2XNBA 4DGLC 3B8RA 5L2WA 4J1RA 4LI5A 2C30A 1Q5KA 3P1AA 3R7IA 1T45A 3RHKA 2XJ0A 1BL6A 3F66A 5HE1A 4FR4A 4HYUA 4ZTHA 4J53A 4BI2A 2GSFA 3PTGA 4PP7A 3PJ3A 5LQFA 2BDWA 1OIQA 4M8TA 2GHLA 5BUJA 4DT8A 3B8QA 4X7QA 1U5RA 4QNYA 3D14A 3ZXZA 5JGBA 1H07A 2W1IA 4E6DA 5JH6A 3N9XA 4IB0A 4IC8A 3R8MA 4EOJA 4ANLA 4AZTA 3JVSA 4BDFA 2X2LA 3FPQA 4FKLA 4ACGA 3ENHA 3IG7A 1UNLA 1TVOA 4OBPA 4PTEA 2FH9A 4DN5A 3MSSA 4AA0A 2W5BA 4FGBA 3RPRA 1F0QA 2WU7A 4XV2A 4QP9A 4IAKA 2OFUA 4I6HA 3NCZA 3G9NA 3U55A 2O64A 4CLJA 5C01A 3UC4A 4ZLZA 4K18A 5CEQA 5AV1A 4D1SA 3BBTB 3LLTA 4I24A 3I6UA 3S00A 4J99A 2XH5A 4FKVA 1JNKA 3FHIA 1FPUA 3N4UA 3CLYA 3ET7A 3EZVA 4HNFA 2VWVA 3HKOA 4C62A 3S95A 4HGSA 4JAIA 2Y0AA 2CLXA 4JX7A 4M69B 3BWFA 2B4SB 5KZ0A 3UPZA 4O0RA 4AW2A 4ITJA 2XK3A 4RZWA 4GUBA 3MTFA 4FIIA 2J5EA 4IZ5A 2E2BA 1M17A 2F9GA 1QL6A 4WG5A 5HIDA 1ZYCA 4ZS4A 3COIA 4I22A 3ZLWA 1BMKA 3QU0A 1K2PA 4JQ8A 4M7IA 5CNOA 4W8EA 3ZC6A 5AA8A 3FAAA 4FL2A 4ZZNA 1M2PA 3UMWA 4IFGA 4BIBA 2IPXA 1K9AA 3FYKX 3Q2MA 3Q3BA 2PZYA 2B52A 5HTCA 4HGTA 1UKIA 3C5IA 1YWRA 1APME 5ANEA 4GEOA 4BCFA 5CSWA 2VTHA 1YOLA 5E8SA 2C68A 2Y6MA 5BMSA 5EKNA 1B6CB 1KV2A 3GU4A 3D4QA 4ZJJA 2XYNA 3PG3A 3RWQA 4NJDA 3HVCA 2VWYA 3ROYA 3VULA 2W1GA 3VWAA 4KBKA 2BILB 4KRDA 2YITA 3TUBA 1WBVA 1KE5A 3GENA 4AE6A 3GU7A 3BGPA 4EKKA 5A6OA 5GJFA 3VUHA 3BGZA 1CKJA 2VD5A 2VGPA 4I3ZA 5DT4A 4ZSJA 4B0GA 4ZZOA 3FE3A 2BAQA 2CGUA 4X3JA 4ZSEA 3DJ6A 3Q9XA 1FVTA 1WBNA 5DR9A 2YHVA 4UZHA 5CSPA 4EOOA 4YGAA 4G3FA 4GKIA 4LL0A 4OTPA 3ZSIA 4QTEA 2GNJA 2X8DA 4NW6A 3S0OA 3HUBA 5IUHA 5L6OA 3PRIA 4D9UA 3TNHA 4X21A 3P9JA 4FNZA 5FXQA 2Y6OA 3DZQA 3PVUA 4L42A 3SHEA 2Y8OA 3MA3A 3UOKA 5KHXA 5I4NA 2C5YA 2QKRA 3FZTA 4QMLA 4CD0A 4LM5A 2QHNA 3LQ3A 4CG9A 4BY9E 3MFUA 4FUXA 5BUEA 1IAJA 3D0EA 4EH5A 1MQ4A 1KOBA 1PXLA 4NWMA 4QP2A 2OF4A 1RJBA 3C4CA 4FTNA 3SKCA 4RIXB 3MH3A 3E5AA 3PXKA 3FMJA 3EQCA 4X3FB 3GEQA 2CPKE 1UNGA 4OTIA 2OFVA
chains in the Genus database with same CATH superfamily
3NW6A 3D7ZA 3KF4A 3R83A 4BCJA 1OUYA 2O8YA 3LQ5A 3D5WA 4GYIA 2XK9A 4HGEA 3KK9A 4MNEB 4C3PA 4AGDA 4ZOGA 3EFKA 3C9WA 2W1DA 3QKMA 3UO4A 2X7FA 2XIXA 4IFCA 4ZLYA 5DVRA 3EQPA 1ZY4A 4YJRA 5EHYA 1OIUA 2QOHA 5T6KA 1ATPE 4JT3A 2HXQA 4WRGA 4BCPA 4XMOA 5HIBA 1W84A 1V0OA 4GJ3A 4USDA 5EYKA 5FGKA 3HZTA 4CNHA 3DJ5A 3TJCA 1EH4A 1ERKA 4FF8A 4DYMA 4BIDA 4R78A 5BVWA 4UEUA 2PVHA 5DNRA 1F5QA 3E64A 2GNFA 2Q0BA 3FI4A 4Y46A 3P7CA 4C35A 4FT0A 3NNWA 4GV1A 3HRBA 3UJGA 4PPAA 4KUJA 1GIIA 4ARKA 4DEHA 1B39A 5CNNA 2GS6A 4R3RA 5IMXA 2OIQA 4F7LA 3D94A 4D2PA 3GCQA 2P2HA 3DS6A 3VS3A 3DA6A 3NUYA 4FKSA 5J7HA 5IQHA 3PPKA 3IK3A 3R7GA 5AR7A 3ZEWA 4DBNA 5AEPA 2FVDA 2FO0A 4F7NA 1REKA 3DXQA 4K9YA 3QTQA 4C2WA 3B2TA 3D5XA 2HZ4A 4XJ0A 4ANOA 4FTJA 4FTLA 3ACJA 4QTCA 2Y4PA 4MXAA 2VRXA 4FT7A 2QOOA 2OXXA 5TKDA 3VF9A 3EZRA 2HW7A 3IS5A 4ACDA 4BDBA 4AXEA 3EN4A 2JD5A 2VO7A 3WILA 5KMLA 3KN6A 5IH6A 4RIOA 5JN2A 5JSMA 4L9IA 3EKNA 5H8EA 3OG7A 3W32A 4CQGA 3Q2JA 4RFZA 2AC5A 2BRHA 2QI8A 2FUMA 4BJJA 3CR0A 4LRMA 5AWMA 4D2VA 4ENXA 4I21A 4BDIA 3EQHA 5E8VA 3KXHA 4NM5A 3BELA 4FTKA 5EFQA 4MK0A 3HNGA 4YTFA 2YISA 4RQVA 4ORKA 5M4FA 3HMPA 4ZTRA 1NW1A 2CKEA 3C0GA 5HCZA 3W2CA 3VUTA 4JNWA 4XRJA 4MD9E 5IUGA 4D4RA 4V0GB 4JRNA 4BDJA 4W4VA 4FTAA 4FKGA 4K8AA 3QX2A 3PSDA 4D4SA 3OCTA 3Q4CA 5ANGA 3KK8A 3R7OA 3R8VA 3R9DA 1BI7A 2XIKA 4YPDA 5KO1A 3A8XA 5IQDA 4PNIA 4O7ZA 5FG8A 3TCPA 3QLFA 4YJOA 3MIAA 3QCQA 4F0IA 2XZSA 1WMKA 2ACXA 4BTKA 2OXYA 4A4LA 5HBEA 4NUSA 4OT6A 4M0ZA 5EOBA 3GXLA 5DG5A 3OWKA 4TNDA 5A4TA 5AUZA 4BGHA 3I7CA 4QPMA 5FWKK 3TI1A 2H6DA 3FQSA 2R0UA 2Y9QA 3LOKA 2WIHA 4Y95A 2UW3A 4CYIA 1WZYA 2NRUA 4GIHA 2Q0NA 5DI1A 2YWPA 1YDRE 4FGRA 4AU8A 5FD2A 4I20A 3KXMA 4A4XA 4CEGA 5JFXA 4F1TA 3QQJA 4U5JA 1GY3A 4U44A 1LR4A 5DGZA 3MA6A 3VHEA 4U41A 3AT4A 3SAYA 1H1QA 4G6NA 1CKPA 2BALA 5K9IA 4FZDB 3FBVA 4E5BA 4LMNA 4QTBA 4EQMA 4LV5A 5AP1A 2RF9A 2VX3A 3W0NA 4F9CA 4PMSA 4MBJA 1U54A 3AC1A 3FI3A 3HV4A 4DFXE 1YXSA 2RKUA 4ZEGA 4HPUE 5J9ZA 3MN3A 2ZMCA 4CXAA 2XBJA 2PZ5A 3Q53A 4BGQA 3DBFA 3UIBA 4XP2A 4B9DA 2ZM3A 3V6RA 2PYWA 2PY3A 4LMUA 4MF1A 2R3MA 4O2ZA 3PLAE 3OTUA 2YM6A 4JG7A 3H0ZA 1HCLA 2PMNX 2FSLX 4RGJA 3BPRA 4WUNA 4Q2AA 4QMUA 3WIKA 2GHGA 4DE4A 4AW0A 3BU3A 2YAKA 4FKUA 4NZWB 5CX9A 4O7NA 5KBRA 4H1MA 3ORPA 1OPKA 2VWIA 3GUBA 4BRXA 1F3MC 2ZM4A 4YURA 3DB8A 3HYHA 5EW9A 3OCBA 3GOPA 3IQ7A 3CKXA 4RC3A 5E92A 3ZO1A 2OIBA 2CNQA 4XUFA 1YHSA 1ZAOA 2ZJWA 3KC3A 4IWPA 1I44A 3D7TA 4I0SA 4HVGA 3ZONA 4AX8A 3GFEA 2VO6A 3BYVA 4LUEA 3F69A 5FRIA 3ORLA 4UY9A 5HLPA 1JLUE 3BCEA 3KCFA 4U40A 5CAQA 4OAVB 1YOJA 2IEWA 1CTPE 4C38A 2KTYA 3ODYX 2JIUA 3BBWA 4M84A 4XHKB 5HO6A 1O6LA 4DHJA 1U4DA 2W9FB 5IQCA 5GINE 2RFSA 4OTGA 4S2ZA 3HLLA 4AOTA 4DH5A 3U54A 4PTCA 4KKEA 4K0YA 1V1KA 4TZRA 2O2UA 5M53A 3ZRKA 1Q8ZA 3C4FA 1GZNA 2C3LA 2R7BA 4FV9A 4TYHB 4HYSA 4HVHA 5FEEA 4BCIA 2WZJA 5HESA 4ZP5A 5GJDA 3A7GA 4MVFA 4ERWA 3ZUTA 1P4OA 4FSUA 1H1WA 2RGPA 4FMQA 2FB8A 4BDHA 1G8AA 3KREA 3TV4A 3MDYA 3PJ8A 1OI9A 1YDTE 5KMIA 1IEPA 4KINA 5AIKA 4FKPA 3QRKA 3DKFA 2XF0A 3NYNA 2JBOA 3UOHA 4APCA 3O7LB 1YXTA 1UU3A 5C1QB 1CSNA 2J5FA 3U6IA 4UWYA 1PF8A 3QD2B 1JSVA 4LRKA 4CLIA 5AR8A 3ORTA 3VRZA 3L8VA 4FKOA 2R3OA 3RAHA 4L68A 4DEIA 5I3RA 2Q83A 3R6XA 4MEDA 4K33A 4JL9A 5EQYA 3V5WA 4BYIA 4ANNA 3LFBA 4EZ3A 3IPHA 3LCTA 4EH3A 2XRWA 4U9AA 4F4PA 4YJNA 3UTOA 3ZZEA 4J52A 4CYJA 3W0SA 3AGMA 3OEZA 1OBDA 4OTQA 4AQKA 2EVAA 3SRVB 4QMOA 4O7TA 2C6TA 4F7SA 1FMKA 4R6VA 4QQTA 4Z3VA 2JITA 4BICA 2X0GA 4S32A 3HRCA 3DB6A 1R39A 4B6LA 4DINA 5BV3A 2OH4A 2RG5A 3QHRA 2WQOA 4YSMA 4AQCA 1Q8TA 3R28A 5BPYA 4LFIA 2R3NA 4FKJA 3LXKA 2OLCA 3FV8A 4O2PA 4YZNA 4L8MA 5HNGA 2R0IA 4ONAA 3MPAA 4YNOA 4TWNA 4U81A 4WSQA 2JFLA 4YJSA 2CJMA 1YVJA 3F61A 3Q9YA 3DY7A 3R73A 1OECA 3OT3A 4QYGA 4XG6A 3UVQA 3ALOA 4EOQA 2OBJA 1XQZA 3UBDA 3KIOC 3TEIA 4BKJA 1WBTA 3BEGA 4CRSA 4C02A 4BDDA 5LMAA 2W99B 3P79A 4AN9A 2WQMA 3DLSA 4FV0A 4QRCA 3TIYA 2B54A 2EUFB 1OKVA 1PXNA 1W7HA 3HL7A 3ZFYA 4BDAA 1FINA 3MY0A 4IX6A 4MXZA 4F1MA 3UO5A 3LMIA 2PMIA 2WEIA 2XP2A 4M12A 1YDSE 3U9CA 1TFFA 1P14A 5AR4A 2SRCA 3RBWA 5IH4A 5D12A 2UZDA 5HKMA 4EOPA 4LUDA 3W2SA 3IW6A 4EK8A 2X4ZA 1GIHA 3PA3A 2WXVA 3BHYA 2UZEA 4IBMA 4U42A 5F9EA 5LMKC 5HNIX 2J0IA 2REIA 4UWCA 5DH3A 2NP8A 5JRSA 4FKIA 4FNWA 4TY1A 3R02A 2RL5A 3EFJA 4WOVA 4W4WA 4BWXA 2ESMA 4BF2A 1Y57A 4L44A 1WVXA 1P2AA 1H26A 4M66A 3K5UA 1UKHA 3RAIA 3V5PA 3ZDUA 3EOCA 1OKWA 3O51A 3CJFA 4N70A 4Y73A 4ZY6A 4WNMA 4R77A 2ERZE 3PYYA 4YZCA 5IEXA 4KNBA 2RG6A 4MBLA 3RWPA 3UZPA 3HAVA 3KL8A 2J2IB 2UZOA 1DAYA 3K2LA 4BCOA 4DA5A 3C50A 4AW1A 4BTFA 1XH9A 3KRWA 2XNMA 1LEZA 3BZ3A 2JC6A 5KKRB 2IG7A 3BYOA 4F0GA 4U43A 4IANA 5K3YA 1YI3A 3K3IA 4FSNA 4XNEA 5I9ZA 3FMLA 4JQ7A 4TWOA 1WVWA 2F7EE 3MFSA 3V8TA 4YHJA 3W0PA 2BIKB 1PYEA 2IVUA 2RIOA 2W06A 2BAKA 2J50A 3QTZA 3QXPA 4FV3A 1WVYA 3MWUA 4F78A 3TZ9A 3W10A 4CVAA 1JKTA 3FLZA 3QUPA 4BZDA 5KMNA 4O82A 4D28A 1XBAA 3QF9A 3R1SA 3V04A 3WZJA 2GMXA 3A61A 2WTJA 4EWHA 5J1WA 3NGAA 5BYZA 1R0PA 4GRBA 1V0PA 2QO7A 1J1BA 1XJDA 2R9SA 2VN9A 3KRLA 4WA9A 2OICA 3ZMMA 4E6AA 2RFDA 2WHBA 3C0HA 3DK7A 3I81A 4G6LA 5AUWA 1KWPA 3AD4A 3IW4A 5DN3A 1H4LA 3OF0A 3C4WA 3FDNA 3ATSA 3NVMB 4IAYA 4PL5A 3TMOA 3JPVA 3GCPA 3KKVA 5H2UA 4QYHA 3AD5A 2F7ZE 1XBCA 1Y8YA 3FXWA 1VEBA 4LL5A 1BX6A 3LFAA 2YEXA 4RVKA 4WG4A 5CU4A 3RZFA 3D2IA 2QURA 3E8EA 5AADA 3P78A 3AC2A 5BVFA 3G51A 4EZ5A 1IA9A 4MX9A 4RX8A 4AN2A 4OTWA 4ZY4A 4TPTA 1Y6AA 3VJNA 4C4HA 1QPCA 5HVYA 3ZBXA 3QD4A 3ML1A 1VYZA 5F4NA 4PP9A 5LVMA 1SZMA 4KWPA 4YSJA 2UZVA 3G5DA 4IEBA 3IW8A 4PMPA 5JFWA 2C6IA 2GS7A 2YM3A 3G90X 3VJOA 3H10A 4JXFA 4BGGA 4FSTA 4JDHA 4M14A 5HE0A 5J5SA 5TR6A 3OW3A 3FSFA 1ZOGA 2JIVA 2OO8X 2XNNA 4EHVA 2QVSE 4OTFA 5EM6A 4L7SA 4DLJA 4PL3A 5HTBA 3VIDA 4CT1A 4I41A 4R7IA 5CEKA 5ANOA 5ANDA 4RX7A 3HECA 3DQXA 2XK8A 4DFYA 2I0YA 2JKOA 4QMYA 5EKOA 4FE2A 3A8WA 2LAVA 4DITA 2R3JA 3HV7A 4QPAA 3TNQB 4F09A 2EU9A 2PK9A 1PXMA 3EL7A 1PXPA 3QZGA 4YUQA 3MVLA 3NFFB 2XMYA 4RWIA 5J79A 2J0LA 3O7LD 3PE1A 4I4EA 4EQUA 4RJ8A 5M06A 3PA5A 3A99A 3RTPA 2OK1A 3JVRA 4EOLA 5AUXA 4CTCA 3C4XA 3W55A 4IW0A 5DOSA 4CKRA 3QD3A 2YWVA 4FUYA 2ITZA 1HOWA 4BFMA 3HV6A 1VZOA 3FPMA 1KV1A 2PVKA 4NU1A 3QTIA 3EN7A 2QC6A 2WMXA 4BZNA 1QMZA 2W4JA 2J7TA 3WF7A 5JFSA 5E90A 4WG3A 1E1VA 1XO2B 2OKRA 3KVXA 3PJCA 3PWYA 4CT2A 3OWLA 4FNXA 5HNBA 5JKGA 1ZYSA 3VBVA 3D9VA 2CCIA 3MGYA 4DF3A 3EQRA 3T9TA 2E9NA 3DK6A 4I5CA 2UW6A 3W2PA 3ZSGA 4A4OA 4JDJA 3PXQA 4ZMFA 3IGOA 5HE3A 2VWUA 4KBAA 4C33A 4GCJA 4E4LA 4QQCA 3SW4A 5FBOA 4AN3A 2DUVA 5JRQA 1SM2A 3CD8A 3HP2A 2WTKC 4AP7A 1X8BA 4AA5A 3R00A 2GDOA 3G0FA 3JXWA 3UDZA 2J90A 4XLVA 3MY1A 5FQDC 3ZDIA 3UIUA 5JK3A 2UW4A 4UMQA 5LCJA 4O84A 3FI2A 4BN1A 3SA0A 1R1WA 4GFOA 3OTVA 4M3QA 3FXZA 4HW7A 3UZTA 3LCKA 2C6LA 3JUHA 1JPAA 3ZM9A 3FUPA 3PY3A 3TTJA 5IQBA 2WPAA 4D2SA 3QUDA 4LG4A 3WF9A 4IJ9A 3ZRMA 4O1OA 2W1EA 4IZYA 1SVGA 4U97A 1ST4A 3ANRA 2VZ6A 5J9YA 4E73A 3TNWA 1YWNA 3IW5A 5CVHA 5H9BA 4ZTMA 4CFVA 4CMTA 3MJ2A 4IX3A 4XBUA 4NM0A 5E9EA 1XR1A 5HG8A 4XG4A 2PZRA 5J87A 4APPA 3HUCA 3I0QA 4EC8A 2G2IA 5DYJA 5EQPA 3LJ0A 4H3BA 3MJ1A 4DFUA 3PWDA 5E91A 2OZAA 3QQKA 3GCUA 5FDXA 3A4PA 5HG9A 2HZ0A 4FV5A 4YMJA 3EYHA 3C4EA 2BHHA 1UWJA 1ZMUA 2AQXA 3EFWA 2W9ZB 5BVDA 4O86A 5BX0A 5IDNA 5F20A 5AV2A 5HBJA 5IU2A 4BB4A 2PVNA 4A9YA 2OGVA 3VUDA 5C9CA 3ZRLA 4F0FA 4EH9A 1OBGA 3W2OA 4GK2A 2ITYA 4Z7HA 1KE6A 3OVVA 1Z9XA 2C6OA 2X39A 4OGRA 4V04A 2PUNA 5CF5A 2OIDA 4LRJA 2O0UA 4PMTA 3GQIA 4F6WA 4I94A 3ODZX 1YW2A 4FKTA 2VTMA 5AP5A 3QQLA 1M2QA 2HCKA 3RPSA 5M4UA 1TKIA 5BYLA 3IECA 3UO6A 4EEVA 5JT2A 2YM4A 3O8PA 3GC0A 1S9JA 4ACCA 1H24A 1PRYA 3F5PA 2QHMA 3CCNA 3UODA 3C5UA 3CD3A 2VX1A 3EQFA 3QYZA 4MYGA 1VR2A 3V51A 2PZIA 5ACKA 4XEYA 4RIWB 3CTQA 4YZDA 4BWPA 2OF2A 1G8JA 4Q5EA 2R3QA 3BU6A 3F3UA 4RC4A 2YJSA 3O8TA 4RJ5A 4M68A 2HW6A 2F7XE 2I0HA 5FP6A 1W0XC 3BYMA 3GI3A 4GSBA 4B7TA 5C8NA 5HICA 3M1SA 1J1CA 3ULIA 1W2DA 3KRRA 3QRUA 3NZ0A 3UQGA 4DGOA 4ZSAA 4MCVA 3RPOA 1ZYJA 4JR7A 3ZLSA 4ZJVA 2G15A 3EQIA 4F99A 1YXUA 4DEDA 3AC5A 5C8KA 3K5VA 3OY1A 4YNEA 3UYSA 2C0OA 4ZAUA 2F2CB 1IA8A 4JMQA 4D1XA 4KBCA 1H0VA 4R3PA 5LVNA 3BWJA 4FSQA 4RWKA 5J9LA 3Q4UA 1KE9A 3TKHA 4CKIA 5FTGA 5C26A 4FV7A 1XBBA 4FRFA 5CWZA 4EOMA 4G3GA 1M7QA 4ZSLA 1DI8A 3DU8A 3QTUA 4PY1A 5HBHA 4A7CA 3QKLA 2NO3A 2ONLC 4KIKB 4DFZE 5T68A 4L3LA 2VTAA 4BL1A 1YKRA 5BQ0A 4FT9A 5EI6A 3OEFX 2FGIA 3U87A 4JOAA 4MD8E 4UXQA 4IVCA 3W8LA 2JAVA 3P23A 3A7JA 4QPSA 3SV0A 3EN5A 2BMCA 3AC8A 3FI8A 1ZYDA 3DFCB 4FKQA 4H05A 2ETKA 2O3PA 3E3PA 4QQ5A 5HX8A 3EL8A 2PVFA 3I4BA 2YCRA 5HE2A 1XWSA 4GKHA 4NCTC 3QA8A 4O4FA 2NPQA 4MF0A 4AZWA 4MKCA 5CAOA 4U8ZA 2LGCA 4YTIA 3TZ8A 2ITQA 1A06A 4HOKA 3F5XA 4QP4A 4WNOA 3V8SA 2GTMA 3BLHA 3FLSA 5E8YA 2P55A 5DHJA 4RX5A 2JLDA 3HX4A 3NUXA 4IB3A 3E63A 2VAGA 3QTXA 4TXCA 3MVMA 5EM7A 4C57A 3ZFMA 3R8ZA 3TJDA 4FVRA 3QD0A 3VAPA 2H9VA 3F2RA 3AC4A 3ORMA 5ICPA 3ROCA 4J8NA 2IW8A 2H34A 5HGIA 2WELA 2JKQA 4XV3A 4A06A 4PPBA 2PVJA 2ITOA 3E8NA 5CALA 2C6MA 4PX6A 4KSQA 4O96A 2ZDUA 3W18A 2ETRA 4A9TA 4L7FA 2W1CA 2J6MA 3N51A 3DNDA 4QO9A 5AR5A 4E4XA 3VNTA 2VTNA 3TYKA 2WTCA 2IW9A 3GBZA 4O0UA 2FSOX 4M13A 5CZHA 1OMWA 2X0PA 4LV8A 3ZXTA 1Q62A 5IEVA 2VUWA 3A7HA 5EDPA 1ND4A 4I0RA 1H27A 1DAWA 1LEWA 2A27A 2VTIA 3Q52A 4QD6A 1STCE 1ZLTA 3VN9A 2A4LA 3E7OA 4FYNA 4AF3A 2Z7RA 4HCVA 3BYUA 3QZIA 4GFMA 4AWIA 3DAJA 5ANIA 2ZV9A 2IWIA 4YC8A 4AOJA 5TF9A 4FEWA 4MD7E 2ONLA 3Q5ZA 4MQ1A 2BRGA 3JY0A 3MPMA 1BYGA 3NNUA 2EXEA 4S33A 2X0OA 2JFMA 4NIFB 5IQIA 3NUSA 4FTRA 1BKXA 4C4GA 4W4XA 3ZO3A 1XHAA 2BFXA 2R3FA 2HELA 4D4VA 4O7LA 2NYAA 4TKSA 2XKCA 1GZOA 3DBDA 3BRBA 3P0MA 2R3PA 1PKGA 4Z9LA 4NCTA 2WMUA 3AD6A 5EYDA 5CS6A 3MV5A 1YXXA 4HVSA 4ALUA 3GC9A 1KE7A 5HVKA 3QALE 3BKBA 2GFCA 2JAMA 3OD6X 2C69A 5DEYA 2Z2WA 3FXXA 5J1VA 4IVAA 4EOSA 3QRJA 2EXMA 5JGDA 3COHA 4D0XA 3E93A 3T8OA 3KMUA 3KXXA 4C3FA 2W5HA 3ZUVA 3O8UA 5DPVA 3ZC5A 3TDWA 5F95A 3ERKA 1XH5A 3KRJA 2JGZA 4IDTA 1JWHA 4I92A 2XKEA 4ZTNA 5IA3A 3UOJA 5LARA 4O7YA 5KHWA 1H00A 3EFLA 1TQIA 4FVQA 2ITTA 4O0WA 3ZOSA 4CFNA 2CSNA 2NRYA 4UXLA 5HHWA 4AG8A 4FEVA 2XANA 3QUEA 1YRPA 4AZVA 3TIZA 2CKOA 4MQ2A 5L2QA 3F3WA 2WMVA 4XS2A 2QLUA 3RINA 4U3ZA 3Q4ZA 4C7TA 1HCKA 4IXPA 4EHEA 4DFBA 5EM5A 3OP5A 3MFRA 4YP8A 4GFGA 4IAAA 5BNJA 1JKLA 2W5AA 1UWHA 1JSUA 2VTSA 2WTDA 4Y5QA 3TTIA 5HD4A 4M69A 3OOMA 4FTQA 4O27B 5GNKA 2PE0A 4GIIA 4XG3A 4P4CA 3VQHA 3P7AA 4ANMA 2GPHA 3C0IA 5EYMA 5D41A 3LMGA 2YA9A 4X3FC 1PYXA 3DBEA 4GK4A 5JEBA 2R5TA 2WO6A 5H3QA 3UPXA 2VTQA 4P5ZA 4M15A 3DV3A 4W9WA 4DLIA 2E9OA 2QOQA 4Q9SA 1IASA 3DKGA 4RBLA 4YTCA 3NVKI 4EH8A 2JDVA 5LWMA 3WE8A 1Q8WA 5HU3A 1LPUA 3HDMA 3PY0A 4NFNA 4UZDA 5D1JA 2XBAA 5E7RA 4QMTA 5A3XA 1H08A 2IVSA 3KY2A 4F6UA 2OJIA 4QTDA 3HAMA 4LDTA 3RPYA 4DCAA 3DFAA 3O71A 4J96A 2HYYA 2PHKA 4HCUA 4B8LA 5EK7A 4NTSA 3LQ8A 4KB8A 4EH2A 4GVJA 2RFEA 3PFQA 4O0YA 3ZO2A 3VQUA 3HV5A 3SXSA 3OFMA 5CI7A 5FM3A 1NVSA 4DT9A 5JGAA 3ZHPC 3NSZA 4JJRA 4IDVA 4PF4A 3DGKA 3V01A 1OIYA 2YERA 3C1XA 2W05A 3NWWA 4LOOA 3L9LA 5B0XA 4BDKA 1O6YA 3OWJA 2AYPA 4X2KA 2B1PA 3PZHA 4EQCA 4G31A 4JBQA 4RWJA 4RFMA 1IAHA 4J8MA 3E8DA 3F7WA 5ETFA 4PTGA 3QAME 3DLZA 4USEA 4RLKA 3NW5A 3NW7A 4O1PA 3BLQA 2WTVA 1LUFA 3QRTA 4AW5A 3AOXA 3O17A 3U4WA 3QKKA 3W2RA 4DFLA 5BVKA 4DEAA 4FKWA 5HX6A 4IB1A 5CSXA 3VS1A 5KE0A 2YIQA 5D10A 4FV4A 2Y4IC 3OBJA 4O0TA 5EHOA 2DS1A 5ETIA 5GHVA 2YZAA 4EKLA 3IGGA 5IA1A 3OCGA 4I93A 4IM0A 5KNJA 2WAJA 1FVVA 4JIAA 4XP3A 4JIKA 3FJQE 4OLIA 3VBWA 4CMOA 2BTRA 2QOBA 5CENA 3PIYA 4FC0A 2VNYA 1L3RE 2UUEA 3AXWA 3HMMA 2PE2A 3OXZA 3PJ1A 4RIXA 1URCA 4WNPA 3LE6A 1SMHA 2PMLX 5T3QA 2C6DA 4X3FA 1OB3A 1H0WA 2PE1A 3O0GA 5H8BA 3U4UA 4PDYA 3LFCA 2Z02A 5G1XA 1J7LA 3PIXA 3QRIA 5IQGA 4MNEA 4CFFA 3SC1A 2R3KA 4YZBA 2H96A 3COKA 5CEIA 4G5PA 5CU3A 4TNBA 1TZDA 3GP0A 2CLQA 2ZV2A 3R1QA 2BRNA 2BR1A 4QOXA 4KKHA 3KMWA 3LMHA 3JYAA 3UZRA 3G15A 2G01A 4NKAA 5A46A 4FTUA 1JQHA 4JQEA 2Y7JA 4ENYA 4EK5A 2CHLA 2XAOA 3VS4A 3UP2A 2CKQA 4QTAA 4DC2A 2X81A 4JRVA 4ZTSA 5A14A 3R7EA 3F3VA 2YAAA 3E62A 3TNIA 4EI4A 2BHEA 2BVAA 2WMTA 4D55A 2P4IA 4TYJA 4WUAA 1NA7A 5I0BA 4AFEA 2B53A 3CPBA 3GCVA 5L3AA 1OPJA 5AX3A 5IA5A 2ITXA 4RT7A 4R5YA 2X9EA 2X6DA 3NX8A 3NDMA 4FEXA 2J51A 4YJVA 5E8WA 3VUIA 3PP1A 4ZZMA 4RSSA 2W96B 2R3LA 4K1BA 4TN6A 2BKZA 4JBVA 5AV3A 3NAYA 5DRBA 2C1BA 5KCVA 3ZBFA 3EIDA 3NUNA 1WBOA 4XV1A 4YO6A 1G8SA 2HXLA 3BHHA 4ZMEA 3KF7A 5HU9A 2BZJA 1S9IA 3MESA 3LPBA 4YZMA 3F3TA 4EOIA 2W0JA 2QO2A 3BL9A 2IJMA 2R64A 3MPTA 3NUUA 4L45A 4KS8A 5FM2A 3WE4A 2OZOA 4C59A 2WMWA 3PP0A 5L2IA 2V7OA 3WOWA 1MRYA 3NCGA 2CGXA 1OL2A 3R71A 4D4YA 4DTKA 3FQHA 3LLAA 1H25A 3F5UA 3D83A 4AS0A 4Q5HA 2VV9A 5DR2A 2WMBA 1E9HA 3LXNA 4PV0A 3RM7A 2VTJA 3CQWA 1AD5A 3BL7A 4C4IA 5AAFA 2ETMA 2QG5A 4EYMA 4NH1A 2XVDA 4Z55A 1J7UA 2FSMX 3TV6A 3UG1A 4GK3A 2X4FA 4NW5A 4LGDA 4N0SA 2BUJA 3TXOA 4V0GA 4MUQA 5CT7A 2ITUA 4U6RA 1Y6BA 4FSZA 3U51A 4P7EA 4NEUA 4FVPA 3LJ1A 4X2NA 4QYYA 2IO6A 2ZB0A 3S2PA 2QONA 3U8WA 3MBLA 3UVRA 3VUGA 3A60A 3VS5A 4RJ7A 1R0EA 4PL4A 4QT1A 5CF4A 1UU9A 2C47A 5CTPA 4OTRA 3A4OX 3OT8A 3F9NA 3NNXA 4CGAA 2E9UA 4O6LA 5EOLA 4RIYA 2WD1A 4YHFA 3TNPC 3WF5A 1VJYA 3FLNC 2IF8A 4Y8DA 2C5XA 1NXKA 3RK9A 2R4BA 2W4OA 4JG8A 4C36A 5J95A 4IZ7A 4KIPA 4P5QA 3REPA 3W0OA 2A1AB 2XUUA 3PRFA 4BCMA 4IVDA 4DH7A 3NRMA 3LZBA 4XV9A 1M2RA 2JEDA 3KULB 4IAIA 5ETCA 5FTQA 2P0CA 4OBQA 2R3HA 4USFA 1PJKA 1ZYLA 4EHZA 1SNUA 4CQEA 5IISA 4CV8A 5JQ8A 3COMA 4RX9A 5F1ZA 4G9CA 3I5NA 5A4QA 4JBPA 2A0CX 3ENMA 5C4LA 5D7VA 3PPZA 4IM2A 2NNWB 2YCSA 4CFMA 1QPJA 5LXMA 2PVMA 5AAEA 2VGOA 1YI4A 3HP5A 4EH7A 3CIKA 3EQGA 3WIGA 3PPJA 5AP0A 3DNEA 3RK7A 4AFJA 5B2MA 3UDBA 4K2RA 4B8MA 3AGLA 4YBKA 3DBCA 2J9MA 5L4QA 3DQWA 2GS2A 3R0TA 5HTIA 5DE2A 2XA4A 4I1ZA 1G3NA 3LCOA 5AUYA 4DG2E 4I0TA 4IVBA 2BZKB 1FOTA 5M08A 4FSRA 2VTRA 3LFDA 2XKDA 4O7RA 3GB2A 3Q6UA 1V0BA 3VW8A 4GJ2A 4WBOA 3TUCA 2C6EA 5CY3A 2OJGA 3VHKA 3LVPA 5IQFA 3V5LA 4ZXTA 1R3CA 3P08A 4AXAA 2UZLA 3ZZWA 3HA8A 3R9RA 4UYNA 3FL5A 2YIRA 5IQAA 4JAJA 2O65A 3ATTA 1Q24A