2UZWE

Pka structures of indazole-pyridine series of akt inhibitors
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
336
structure length
336
Chain Sequence
VKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVMLVKHMETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKDGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFSEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC SUBUNIT
publication title Syntheses of Potent, Selective, and Orally Bioavailable Indazole-Pyridine Series of Protein Kinase B/Akt Inhibitors with Reduced Hypotension.
pubmed doi rcsb
source organism Bos taurus
total genus 100
structure length 336
sequence length 336
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2007-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2uzwE01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2uzwE02
5IUHA 3WIKA 3UNKA 5DG5A 5HG9A 2R2PA 5L2TA 3FI8A 4IJPA 4TNDA 4V0GB 5ANJA 5BVEA 2CKPA 2WTDA 2O65A 4C62A 3F5PA 3LMIA 4YJPA 3BHVA 3C4WA 3CS9A 1OB3A 1FMKA 3QZHA 4YC3A 2C6IA 4X2JA 2WTCA 4QMVA 2YM4A 1LUFA 4ID7A 5LVOA 2VTRA 3U4UA 4FIIA 5JSMA 4EWQA 2RFSA 5H8BA 4A9RA 5C1QB 4U7ZA 4K33A 2CLQA 3ZFMA 3FAAA 4IC8A 3IG7A 3BWJA 4A9TA 1CMKE 2YWVA 1GJOA 4JLCA 4YHJA 4ZMFA 4QTEA 2W5BA 5TO8A 5JRQA 2VWBA 5EQEA 5M08A 4IAFA 5AAGA 4C7TA 1OZ1A 3A7GA 2QHMA 5DIAA 2OIBA 2PE1A 2YACA 3NUYA 3DBEA 3QGYA 3RGFA 5A4EA 4JR7A 2YZLA 4YJSA 3VUTA 4G9CA 5CEIA 3IK3A 3EQHA 5CSPA 3VBYA 1AGWA 3GCSA 4KIOA 3VHEA 3WZKA 3JVSA 4I1ZA 2BZJA 2E2BA 3NEWA 1BKXA 4HJOA 4U97A 1WZYA 3DKFA 3ERKA 4ZY6A 4AUAA 5K5NA 3NS9A 4KRDA 3QA8A 3FZ1A 4FKVA 3OCSA 1PYXA 4GIIA 1OITA 2BRBA 3C4FA 4X21A 3EKNA 5DR2A 5EI2A 1UU8A 3RAKA 2HENA 4NM5A 2W96B 4ASZA 4M3QA 2EXMA 5D7VA 4QQ5A 2WD1A 3B8RA 3O8TA 5FP6A 2XBJA 1JLUE 5CT0A 5IDPA 4DTBA 1BI8A 4FKTA 4YUQA 3CSVA 1GY3A 2WMXA 3F3ZA 1YOMA 5ETCA 5HEZA 4FKQA 4Y8DA 4DFNA 3AC8A 3ORIA 4IE9A 5AUZA 1UKIA 1URCA 4RQKA 5T6KA 3RWPA 2AUHA 5AADA 4GFGA 2RKUA 1CM8A 4HYUA 3CGOA 2C68A 4HW7A 3EQDA 1UNLA 3QUPA 3VS4A 3CE3A 3TNHA 4IAYA 2F2CB 4C4JA 2W1DA 3R1YA 3LFBA 4D9TA 1YWNA 5IUGA 2X9FA 3TZ9A 4EZ7A 4KBCA 2V55A 4BRXA 4O22A 4DEGA 1ZLTA 3FMKA 4RZWA 4Y95A 3ODYX 1H1WA 4FTMA 1MQBA 3PPJA 4F1OA 5JQ8A 2QR7A 3JVRA 3V5WA 3VBXA 3IPHA 4I6FA 4EC8A 2BALA 5J5SA 3R01A 4APPA 1H27A 4BGHA 3VF9A 1XR1A 4QMMA 2B1PA 3UQFA 4UZHA 1Y6AA 4E1ZA 4EEVA 2UW5A 1W84A 3Q2MA 3KK9A 4KKHA 1LP4A 4BHNA 2Z7RA 3PY3A 4FICA 2C6DA 4S31A 2XIRA 5HLWA 3RM7A 2X2LA 3E64A 2EB2A 1BYGA 5D1JA 3UQGA 5HKMA 4D58A 1Y8GA 3PJ2A 5J5TA 3OW4A 4RFYA 5K4IA 5CEQA 3VW6A 4RVMA 2QQ7A 2YIRA 1OL2A 4FNYA 5B7VA 1PXLA 5BVNA 4R78A 5AA8A 2OXXA 3B2WA 1YHWA 3NX8A 2ZV2A 5DH3A 4EH2A 3QQGA 3KXXA 4TWPA 4GG7A 3DJ7A 3ZM9A 5HNGA 5CAPA 4AG8A 5CAOA 2PZRA 1XBCA 4K18A 5LMAA 1YHSA 4E26A 4F7NA 4G3FA 4U45A 3HP5A 1LEWA 3PG1A 4AFEA 2X6EA 2PVJA 1PHKA 3JY9A 1ZYCA 4EQCA 1H1PA 4XG6A 4F4PA 5I9XA 4ITHA 3LLAA 3E7OA 3K5VA 1BL6A 5I9WA 5L8KA 4KRCA 3OTVA 3DBDA 3UNJA 3N9XA 5IQDA 2R3MA 4XNEA 3VF8A 3MI9A 4CLJA 1SMHA 2WOUA 2R3RA 1KE6A 3O96A 4HCVA 4JDKA 4X3FB 3TIYA 4A9SA 1F3MC 5AR5A 3VS3A 1ZYLA 4NKSA 2GMXA 3V51A 3ZO2A 1G8SA 3H30A 3FEGA 4GS6A 2P2IA 2CHLA 3O7LD 1Y91A 4CMTA 4H05A 4Z3VA 3IW5A 4CEGA 3DAKA 4AU8A 3MWUA 4B9DA 4HNFA 4DGMA 3NIEA 3AC5A 3AC3A 1YI6A 5L2SA 3LJ2A 4YZBA 2EXEA 3ZCLA 4BZDA 4DAWA 5B2LA 1NT2A 4F65A 5CU4A 2RG6A 4GMYA 5GIPE 4QMUA 4DG2E 4B6LA 4U42A 1R0PA 2ETMA 3NYNA 4IDVA 5CQUA 2W0JA 3DT1A 2C3KA 4ZSGA 2RIOA 5LOHA 5IQGA 4O7VA 3UODA 4I5HA 4NTTA 3HV4A 5IUIA 5C27A 4XP2A 4D2SA 4LI5A 3UDBA 2IW8A 2UZLA 5FDXA 4IQ6A 5F94A 5KKRC 3R63A 3FMNA 2B9IA 4NU1A 3F5UA 1HCKA 3O7LB 2QCSA 4H1MA 5KMLA 2DS1A 3CTHA 3ZO3A 4BN1A 2R3KA 4ACGA 5KBQA 4XUFA 5ANEA 4E5BA 4BL1A 4KD1A 4WUNA 1YI3A 3GCUA 4UYAA 3WILA 1M17A 4FKOA 5BQ0A 3BYUA 5BYZA 4D1ZA 2CNVA 3NUNA 5B2MA 1U59A 3ZC5A 4BDHA 4JBOA 2H9VA 1B38A 5LWMA 4U40A 2XCHA 5HE2A 3LQ8A 4G6NA 3BQCA 3LFSA 1URWA 1FPUA 2XJ2A 4HZRA 4DFZE 3RPSA 5B0XA 4E4MA 3SAYA 3LFQA 3MY0A 5D9HA 2WMQA 2VX3A 4GH2A 5CS6A 5EDPA 3RPRA 5C01A 3HAVA 3BHUA 4RX9A 3MN3A 4ANMA 3P86A 2JKMA 4F9BA 3QTWA 4Y85A 3ENMA 4IHPA 3R7EA 2ESMA 5L6PA 4MF0A 3ZXTA 2GQSA 3AC4A 3BEAA 5KMNA 1JBPE 5EQPA 4RC3A 2XNBA 2RGPA 5TE0A 4FV0A 3C13A 3F2NA 2C5OA 3NYXA 4PTGA 5EYDA 5FRIA 1G8AA 4B4LA 4TZRA 5C8KA 4OTHA 3KVWA 2P0CA 4DGGA 3VUGA 4Z55A 2VZ6A 4FKUA 4USDA 4J52A 3MB7A 2CPKE 4YURA 2E9VA 2QHNA 4ZTHA 5HG8A 2J0IA 3WYYA 1O6LA 2BDFA 4BWXA 3U6HA 3S3IA 3GCPA 3QTUA 5M51A 3II5A 2YLFA 4C58A 3VNTA 5C26A 4YC6A 2WTIA 4OTGA 1GZ8A 2QOOA 2IWIA 4JBVA 3EOCA 3VS6A 3AD5A 4M0ZA 3IONA 4JBQA 1QCFA 4DEBA 4CD0A 4IWPA 4RX7A 3G90X 1CDKA 4FV7A 2XNGA 4YLLA 3UMWA 3R83A 4NCTA 4M15A 1F0QA 4G3DA 4HNIA 5CSVA 4CT1A 4DF3A 3MA3A 1PRYA 3FQEA 4FT5A 3OF0A 2XNOA 3NMUF 2ETRA 4FI1A 3CXWA 4WOVA 5IMXA 5AV1A 2J5EA 3Q6WA 4JL9A 4KIKA 3BHHA 4YBJA 5AR7A 3BV3A 1ZYSA 4OGRA 2G01A 3T3VA 4FEVA 2BAKA 3DA6A 1UNHA 3QQHA 1BMKA 2C47A 3PY1A 3BLQA 2ITQA 2PZYA 4L01A 4ZOGA 5AUVA 4RLKA 2JDTA 4CYJA 3V8TA 4EK6A 5EYMA 1NY3A 3IECA 3EYGA 4OTFA 2I40A 4XP0A 3QRIA 4KSQA 4MXOA 1ZY4A 4N6ZA 3RAHA 3DZQA 4C4HA 2B54A 5CVHA 3QHWA 3VHKA 5E8VA 4MF1A 2QOCA 3AGLA 3BLHA 2QKWB 4U9AA 3BBTB 2HXQA 4KS7A 5CU0A 4F1MA 2PUIA 4OT6A 4R1VA 4FK6A 3W18A 1QPEA 3G9LX 2HOGA 4QP2A 1Q3DA 5AUYA 1VR2A 3R7IA 4DN5A 2WQOA 4DEAA 4YSMA 5KMMA 4ZTQA 3SGCA 3VBVA 3BX5A 4A4LA 2BRGA 4QT1A 4I94A 4O2PA 2PE0A 4YJOA 5FP5A 3W2RA 1V0PA 3ZLXA 3ID6C 1W7HA 2QOHA 3HLLA 5CEPA 4A06A 3ORNA 1P5EA 3CD8A 3PYYA 4FL1A 4H1JA 2P2HA 1EH4A 3HRCA 4LL0A 4JX7A 2JAMA 4OT5A 5BVKA 5IQHA 5HBEA 3DLZA 2PY3A 4IVCA 3WE4A 3ZDUA 3R7GA 1A48A 3NYOA 4PY1A 4JBPA 4QMZA 5D12A 4DINA 3HV5A 2OLCA 4W8DA 5GZ8A 3GOPA 3ANQA 3U55A 4IX4A 3F3WA 3CTQA 2OJJA 2YZAA 3R7OA 4NIFA 1U54B 4FSQA 4FTOA 2EU9A 5KHWA 3H9OA 3RHKA 2JDOA 4BB4A 5K4JA 4AZFA 3QRTA 3D4QA 4LUEA 3GI3A 4X2GA 3PRIA 3COIA 3L8VA 5CI7A 4ERWA 3D14A 5AMNA 5J87A 3TKUA 2GNJA 1YXVA 5DPVA 5FD2A 4PTCA 4JR3A 3LLTA 4U5JA 5JMSA 4FYOA 2IN6A 3PXQA 5EQYA 4U43A 4G3GA 3TKIA 3C0HA 5IMEA 1XH6A 2GS6A 4F9YA 4AA5A 2HYYA 5D41A 5EFQA 3W8QA 4BCKA 3FPQA 1ND4A 3QCQA 2OBJA 3TG1A 4C38A 2WMRA 4YU2A 4MNEA 4NIFB 4BTFA 3ETAA 2XMYA 3REPA 4MWHA 3LHJA 3U4WA 4QRCA 2ZOQA 3POZA 2IVTA 2YDKA 3A60A 3A7IA 4O0XA 4Y73A 4XG7A 2WOTA 3WBLA 5HG5A 2XK9A 3FI3A 3GENA 3QUDA 4JXFA 5IG1A 3ZBXA 5H8EA 3NNXA 3OCTA 4FIFA 3QRUA 4ONAA 2QG7A 4BHZA 1O6YA 4HCUA 5AP2A 3SC1A 5DBXA 4NWMA 4E6QA 3HMPA 3LW0A 4LRMA 5DE2A 3EMGA 3PTGA 3OXIA 1FGKA 2E9UA 3K3IA 5KKRB 3UO5A 2QOLA 4YJQA 2BHHA 3QGWA 3OT8A 2QU6A 3FYJX 4BCHA 1E1XA 2WELA 1TQPA 2F9GA 2XRUA 3KEXA 4M8TA 3W2QA 1GAGA 2CDZA 4JI9A 4AE6A 4IX5A 4M0YA 3DU8A 1KWPA 3BLRA 4FG7A 3G6GA 3LJ0A 2PVFA 3LAUA 4KIPA 3S4QA 4PNKA 5ITAA 5JGAA 3QWKA 3Q4CA 3FHIA 5FLFA 1OIUA 2QLUA 2E9OA 2WMUA 2JFMA 4CZTA 2A27A 3WF7A 5HIEA 3W2SA 2R7IA 2YM7A 3E3BX 4UB7A 3A2CA 4LOQA 3PA3A 4QYHA 2CNUA 2VTHA 2X8DA 5KUPA 2VTOA 4RT7A 3ZU7A 3P78A 5KMJA 1R78A 3WOWA 1R0EA 4CMOA 2C30A 3PIZA 3QFVA 3KXNA 3PUPA 3F88A 3TNPC 1UWHA 2HK5A 3KRWA 1Q99A 3L8XA 4I92A 4IAIA 4L68A 3TUBA 1AD5A 2GQGA 4BI1A 4EWHA 3EQCA 4K11A 2F57A 4BBMA 3DXQA 2WAJA 4BGGA 5K9IA 4FGRA 3LFDA 2GNFA 2W4JA 5TF9A 1GZOA 4ZY5A 1H4LA 3ORXA 3H10A 3VUHA 4IB3A 3VBTA 3M2WA 3PPKA 4AQCA 3K3JA 4YC8A 2YIYA 1PXJA 4LMUA 5AP7A 2XKDA 5AAFA 3RAWA 2UZDA 2V5QA 4UWCA 5HG7A 2A2AA 3MA6A 4QMOA 5IEYA 3GC7A 3PSDA 3BU6A 5CX9A 5E8YA 4GYGA 3TXOA 4EH8A 2IZSA 2VWIA 2C3LA 2BTRA 4YJRA 5DEYA 4WUAA 5FEQA 3U87A 4ALVA 5K0XA 2GQRA 4BR3A 4GEOA 2R0UA 2EWAA 3PSBA 2RFDA 3E8DA 4EK3A 2QG5A 3FI2A 4RX5A 4WHZA 4LOOA 4AA4A 5LVMA 3BIZA 3PE1A 3LM5A 3MY5A 3VBWA 4BDJA 2WTKC 5IQAA 3UE4A 3BQRA 3I6UA 1A9UA 3VQUA 3R22A 4ASDA 5C4LA 5CSHA 5KZIA 3FL5A 3HUCA 5I4NA 4F70A 3F5XA 4XH6A 3Q9ZA 1GOLA 3P9JA 3KRLA 5AR2A 3FLWA 4WG5A 1L3RE 4R3RA 4G17A 4FKPA 2YCSA 2QO7A 3MW1A 4XOZA 4I6QA 4FTAA 3BRBA 4HGSA 4LV8A 1DAYA 4IADA 1BI7A 2J50A 2F7XE 4G3EA 2Z02A 1PXKA 4W9WA 3DKOA 1ZOEA 3HMNA 4AW2A 2VN9A 4I5PA 4IVDA 3ZFYA 3ZFXA 2XIYA 2XYUA 2VTAA 4GK4A 4LMNA 4IWDA 2O63A 4O84A 5CWZA 3E8CA 4BTJA 4ZZOA 2UZEA 3AXWA 3KCFA 3EN5A 4J8MA 4CFVA 4EOSA 3SRVA 5JH6A 3HDMA 4KSPA 2UW7A 4GU9A 3RAIA 4ZY4A 2JDRA 5E90A 4I41A 1OL6A 1J1CA 4FTRA 2XJ1A 4QQTA 4QYYA 2CJMA 3PVUA 4DFBA 1WBSA 4YZMA 4HYSA 4O0TA 4ZK5A 3QTIA 4KB8A 3ZLWA 5KCVA 3BHTA 4NTSA 3BCEA 3G9NA 4WSYA 1J7UA 3OZ6A 3AD4A 5EDRA 3ULZA 5HD7A 4L7FA 4AN2A 3R7UA 4J98A 4AZTA 4WRSA 5J7BA 2GNHA 3EN6A 4BYIA 1PYEA 2VO3A 4O0VA 2XYNA 4TYGA 4G5JA 2VTPA 3RM6A 4IM3A 3AMBA 1OI9A 4YTFA 2UZBA 3PPZA 4I21A 3SRVB 3R8UA 3T9TA 4HPTE 1FVTA 4XV1A 2XIKA 3OTUA 4J8NA 3KFAA 1AQ1A 4GT5A 3R73A 3T9IA 4JQ7A 4IJ9A 4QQCA 3QZIA 3PG3A 4CTBA 3UZRA 4H39A 2C6LA 4GT4A 1H25A 3TEIA 3SXFA 5CNNA 5M07A 2O2UA 5M56A 4R1YA 1UA2A 4M84A 4FV3A 1CKPA 3QQUA 3EL7A 5KZ0A 1LR4A 5L2WA 4RA5A 2RL5A 3DLSA 5CALA 3EQBA 4O38A 5A46A 3MH2A 3KMWA 4QPAA 5JT2A 2H8HA 2QOQA 4ZSEA 2UUEA 2WHBA 2JD5A 3VJOA 2W7XA 3QZFA 3NUUA 4EBWA 4FL3A 3UIMA 4A4XA 3ZC6A 2OJGA 4I93A 3WZEA 3MDYA 4IAKA 4MHAA 4CYIA 1P4OA 5EG3A 3DB8A 2A19B 3DZOA 3M1SA 4JG8A 5L2QA 5F9EA 5IU2A 4FV1A 4F63A 4Y72A 3F2RA 1S9IA 4F64A 4RJ7A 4AF3A 3KC3A 2J2IB 2R5TA 2PVKA 2YM8A 3E63A 4FT7A 3FY0A 5H2UA 4EL9A 3PLAE 4OUCA 4IVBA 3GC0A 1Q8ZA 4GK3A 4MCVA 4E73A 5EW3A 2ERZE 4NM7A 4PL4A 1W0XC 2Y6OA 4D9UA 3KMUA 4G6LA 2UZUE 4PUZA 1OPKA 2VWYA 5DR9A 2CKQA 3RVGA 4DBXA 4H3PA 4L7SA 3ORMA 1OL7A 2YM3A 2QVSE 2WQNA 4XG8A 2I0YA 4BWPA 2UV2A 4IZYA 4O7WA 3FXWA 1OIRA 3TN8A 1ZARA 3FHRA 4EH9A 4V0GA 4UMUA 4WRGA 5IA5A 4FX3A 4QP8A 2FSTX 4O96A 4AWIA 3QA0A 3RHXA 3BGPA 3TKHA 3JUHA 3UGCA 4G5PA 4BICA 3QX4A 4HVHA 4ZSAA 1WAKA 1WBVA 4TL0A 3KF7A 4AGCA 5D11A 4QTDA 4WBOA 4MXAA 3EQFA 2CN5A 4O7TA 4LRKA 4FEXA 4J95A 1KSWA 4XV9A 4O83A 2R3OA 3RNYA 3LJ1A 4OTQA 4IM2A 1ZXEA 1GZNA 2I6LA 4RBLA 5CEKA 1Q5KA 2DWBA 2OJFE 3MESA 2VRXA 3UTOA 2XB7A 4RWIA 5AUUA 2VX0A 4USFA 1IASA 4RMZA 5FQDC 3PIYA 5GJGA 5ETFA 4CGAA 2YJSA 1STCE 2BRMA 1FINA 2CCHA 4PMMA 4I0RA 3GU7A 4IDTA 4O0WA 2FA2A 4YJUA 5F4NA 1OBGA 1U5RA 2JC6A 3G0FA 2VTIA 5HORA 4EQUA 3I7CA 4XBRA 2OZAB 3EB0A 4EOKA 3R9RA 4MYGA 4N70A 2NPQA 4E5WA 1GIHA 3FSFA 4S34A 2C4GA 3OXTA 1PXMA 4FVRA 4I4EA 3OW3A 3FQHA 5LWNA 2X4FA 4O86A 4J71A 3ZBFA 3CY2A 2HIWA 3QTSA 3HV7A 5CQWA 4NM0A 1ZYJA 3OY1A 2RSVA 3TJCA 2IW6A 2BRHA 1IAJA 4NM3A 5M44A 2XH5A 4DCAA 3ZUVA 5KMOA 2GHMA 4BY9E 3BWFA 3Q2JA 4LRJA 4IB1A 4MBIA 4CT2A 2XBAA 1H24A 4XG9A 1LEZA 5CU3A 4C3FA 3UVRA 3HMMA 1O9UA 3NW6A 4FC0A 4OTDA 3UOKA 5GZAA 4AS0A 1NVRA 4JS8A 3PA5A 2W5AA 3MB6A 4X2KA 3W32A 5CSXA 2YA9A 4C36A 4OTIA 1H1QA 4IVAA 3ROYA 3SX9A 4XBUA 4E4NA 5I0BA 4BCFA 1LPUA 5FTQA 4PP7A 3R8PA 1Q97A 3G6HA 2XK3A 2IVVA 3FQSA 3MIAA 4W4VA 4RRVA 2O0UA 4WG3A 3CGFA 3PXRA 3H9RA 4D1XA 2ITWA 4UMQA 3PXZA 3HP2A 3GU4A 2WTKB 2BRNA 3VO3A 4BZOA 5L4QA 2XEZA 5LMBA 4PMPA 3OWPA 2XNEA 4EHVA 2YCRA 4DA5A 5ACBC 3VS5A 4FV9A 1J3HA 1JQHA 5BMMA 1GIJA 5TOZA 3FPMA 1OIQA 1GZKA 1Q8TA 3QC4A 4FTIA 3C5IA 3CTJA 2IO6A 2XUUA 5E8ZA 4NL0A 1H8FA 2XP2A 5KX8A 3NNVA 3OT3A 4TYHB 4EH3A 3QC9A 2X7OA 5LCKA 2R3QA 5HO8A 2BAQA 2ERKA 4C8BA 5HZNA 3HRBA 3JXWA 3NWWA 1XQZA 4IWOA 3QKKA 4XX9A 2JKKA 5EDQA 2W1HA 3HRFA 1W98A 2X2KA 4K1BA 3SV0A 3W33A 4BC6A 2PVYA 3HMIA 4GSBA 5DRDA 3VS2A 3EHAA 2IJMA 2J5FA 1NA7A 1KUTA 2FO0A 2YWPA 3RALA 2VV9A 1TKIA 2ZV7A 1VZOA 2J7TA 5A3XA 4E7WA 4NK9A 3FKNA 5KMIA 3PXFA 4O81A 4X3FA 4L8MA 3WYXA 3TV4A 1JSVA 3EJ1A 1XWSA 3EYHA 1E9HA 4BCNA 2WGJA 4DYMA 5JFWA 2PMIA 3GC8A 5I9ZA 2OICA 2H96A 3LXPA 2VWXA 5IISA 3HUBA 4FV8A 4NUSA 3OD6X 4L43A 3A7FA 4IANA 2HZ4A 3VBQA 4U0IA 2I7QA 2NO3A 3ORTA 1UU9A 2CGVA 2XK7A 3EQRA 4ZTSA 4BDBA 3MGYA 4G6OA 4AA0A 4E6CA 4RJ4A 2W1CA 4FZ6A 3GEQA 3EIDA 4AAAA 3CPCA 3EFKA 2C6KA 3DDQA 4U3YA 3VAPA 1YOLA 3IDBA 4B0GA 4LGGA 5HVYA 3UO6A 3IS5A 2P55A 2B55A 3OVVA 5A9UA 4R6VA 3GFWA 2GHLA 3VIDA 4R3PA 4FIEA 3FWQA 3OUKA 4YO6A 3UP7A 4R7BA 4CKJA 3BEGA 4HVIA 4TKSA 4BCQA 2ITVA 4CG9A 2X6DA 2C0OA 1TQIA 4ITIA 3QRKA 3MS9A 3EKKA 3MY1A 3NIZA 4FYNA 4QMQA 1H0WA 3U54A 3PJCA 1H07A 3K5UA 1T45A 2HCKA 2Z8CA 1OIYA 1HCLA 3KKVA 3KXGA 4QP6A 4JDJA 3RPOA 2B9JA 2RFEA 2ZMCA 1JSTA 2BDJA 2FYSA 3I0OA 5AV2A 4OTRA 4BKYA 3HL7A 1SVHA 4HCTA 3I60A 3HDNA 4JAIA 4YLJA 5T68A 2WZJA 3QBNA 3EWHA 4ZEGA 4GFOA 4I24A 4QP4A 4C4GA 3EFWA 2VTSA 4FV2A 2G15A 4IMYA 4Q5HA 4UMTA 5CEMA 2PUNA 2CGWA 5I9UA 3L9PA 4ENYA 2J6MA 3H9FA 5B2KA 3DAEA 3DPKA 4HOKA 4Z9LA 3VW8A 4A7CA 2O5KA 3JR1A 2JKQA 5K5XA 5J1VA 4JDHA 4YHFA 1ZOHA 3GU8A 5I9VA 4DE4A 3WF6A 3JS2A 2PMOX 4DGOA 4FKSA 3SQQA 3F82A 4LGHA 4ZS0A 4ANNA 3P79A 5A4TA 3KRJA 2C3JA 3CLYA 4WNMA 2V7OA 5J95A 3UIXA 3NAYA 5EM8A 4G31A 4DC2A 3OY3A 2GCDA 3Q5IA 3R04A 4FOCA 4MXZA 4MD9E 2PULA 1R1WA 2VNYA 3RZBA 5DOSA 4EUUA 2E9NA 2XS0A 4MKCA 4AT5A 3CJGA 2C1BA 2REIA 3E7VA 2PL0A 3E93A 2JBOA 3IO7A 4HGEA 4QNAA 3SLSA 1MUOA 2JIVA 4TWCA 2IZTA 4FIJA 3IW4A 4CFNA 5F20A 3BZ3A 2QURA 3TWJA 5JZNA 5HU9A 4XV2A 1JNKA 2VD5A 3Q4TA 4BFMA 4QTCA 4O7SA 3MTLA 3QF9A 4KINA 1P2AA 3BYVA 4F9CA 4PRJA 1ZMWA 4O6EA 1ZY5A 2VTNA 5FTOA 2VGPA 3VRZA 3W2OA 4C33A 2OXYA 3O0GA 1QPDA 3U9CA 5K3YA 2QU5A 3GQLA 4IFCA 4JQEA 2X39A 3NNUA 5HI2A 3KF4A 4II5A 4RFZA 1VEBA 3DK7A 4XG4A 5J9ZA 5GNKA 5FTGA 4CCBA 3FZTA 4F9WA 2PVMA 4L42A 3UMXA 1JAMA 3H0YA 4FODA 2WMTA 4QMNA 1YWRA 1E1VA 4DFLA 5IH4A 5HTCA 5TKDA 2WU6A 3BYSA 2V7AA 4E5AX 4IWQA 5C8MA 2XJ0A 2HW7A 4RZVA 3V01A 5M4UA 2WXVA 4Z7HA 1YQJA 4RG0A 5HESA 4OAUC 3ULIA 5JFVA 1KV2A 3S0OA 2EB3A 1XH4A 4J99A 4C2WA 3EQIA 3V8SA 3MTFA 1JKLA 3JPVA 5BX0A 3QTXA 5HCYA 5CLPA 5JK3A 1S9JA 4FGBA 2XKEA 2HY81 2BHEA 4GUBA 1U4DA 5BYYA 2PZIA 1JVPP 3U8WA 4BCIA 5AM6A 3NW5A 4UALA 4G9RA 3C4ZA 2YHVA 3TJDA 2JIUA 3O17A 4J1RA 1YXUA 2OG8A 3OFMA 5AIRA 2W4KA 4XV3A 1OUKA 4C3RA 2UVXA 1OKYA 2YLEA 4DITA 4FEUA 2VTJA 5AJQA 3LCDA 4NKAA 1G3NA 3R02A 4QYGA 3ET7A 4FSNA 2JDVA 3FLYA 2YAAA 5DWRA 3TI1A 4FSRA 3FLZA 3PP1A 4D1SA 3OOGA 4NYEA 5HE3A 5CANA 3T3UA 4JG7A 3I5NA 4QP3A 3OOMA 4F7LA 5HTBA 4YTHA 5DT3A 3FI4A 2W1EA 2P3GX 4IACA 4LG4A 1UU3A 4GYIA 4I22A 1V0OA 2VWWA 3G5DA 4LYNA 3QQFA 3ZOSA 2HWPA 5BUIA 1J7LA 2R3FA 1W82A 3BU3A 1DAWA 2CKEA 3C5UA 3P5KA 3THBA 2BZIB 2CGUA 1IA8A 3R1SA 5LCJA 4QD6A 4BI0A 5JFSA 2BMCA 5D10A 3BPRA 4UMRA 3F5GA 5F95A 1WVXA 4QMXA 4ASEA 4Y5QA 3DBFA 2W99B 5TT7A 5HE0A 3WZUA 2R3GA 2W1ZA 4AT4A 4K9YA 2GTNA 4FNWA 4QMYA 5CF6A 2W1GA 5FXRA 3DTWA 1FQ1B 2GNIA 3QQJA 1NVSA 1XH7A 3RWQA 4O0UA 4AP7A 3I4BA 4UEUA 1RW8A 3V5QA 3NRMA 1U54A 2ZVAA 4L53A 4EK5A 1UVRA 3P23A 2RF9A 1Y8YA 2GFCA 4FG9A 4XRJA 4KAOA 3PE2A 4TNBA 2LAVA 2WTVA 2QC6A 4QTBA 3POOA 3Q52A 4L52A 3NVMB 4HVDA 3AD6A 3BGQA 2R3HA 3IGGA 3SW4A 3LMGA 3EN9A 3F3TA 3DOGA 5BVWA 1IA9A 5HBHA 2F7EE 5IA1A 4OBPA 4BIDA 4PWNA 5CSWA 4N4SA 2ITNA 2OF2A 4B99A 4C3PA 1W8CA 3DK3A 4EZ3A 1YXSA 4U6RA 5A4CA 3ZMMA 3LZBA 2IZRA 3R28A 5EKNA 2XCKA 4BDDA 4ZLOA 1DM2A 4BCGA 5IEVA 1DI9A 1ZWSA 4WNOA 4YJNA 4UX9A 2UZWE 3EZVA 2GPHA 4FVPA 5CAUA 1OPLA 3PIXA 4O1PA 1XKKA 3FKLA 3VWAA 1P4FA 3SA0A 3FZOA 4PX6A 1PMUA 3A4PA 3R2YA 4GV1A 2VGOA 5E7RA 5HO6A 1NXKA 4YO4A 3COKA 5TR6A 4AOJA 5KHXA 4FT3A 3TDVA 5JGDA 5J9LA 4K2RA 5AAEA 4AZVA 4YP8A 2G2IA 4MBJA 3ZEWA 3BYMA 2XKFA 3RPVA 4C0TA 4EJ7A 4TTHB 3KXZA 3R2BA 3ROCA 4G34A 3FMHA 1ZMUA 2UZOA 4FEQA 2Y9QA 3PWDA 4C61A 3TDWA 2X4ZA 3TTIA 4XLIA 2GFSA 3QZGA 4YMJA 1UNGA 3GVUA 5HU3A 1PXNA 4MXXA 3W8LA 3DBCA 3WF5A 5JFXA 4C57A 4C34A 1SNUA 4QYFA 3D7TA 5L8JA 4D2PA 5AIKA 4ZSJA 4D5KA 2B9HA 4NH1A 2ITTA 4PL3A 5FEEA 2XF0A 3TACA 2BKKA 4DT9A 4BDFA 5J1WA 4KABA 4CRLA 4UMPA 2I0EA 2YM6A 4D2RA 3F69A 3VVHA 1CSNA 3DS6A 1OVEA 1YDTE 4JVGA 3ZHPC 1H28A 3AMAA 2W5HA 1WBNA 4YJTA 3L9LA 2XEYA 2OH0E 5EM7A 3OROA 5M06A 3DJ5A 4C37A 3LFCA 4O7NA 3G0EA 4HGTA 2IVSA 4M69A 4H36A 5CTPA 4V05A 4BDEA 3QD2B 5FM2A 3LFEA 4EH5A 3PFQA 3TNQB 3C51A 3AC2A 4FZAB 3UO4A 2QO2A 3D7TB 4AOIA 3GCQA 3M11A 5AR8A 4FT0A 3W2PA 5LARA 3ZRMA 3VULA 5D7AA 3QD0A 4ZTRA 3UYSA 3ZLYA 5HOAA 2YIXA 4RQVA 3CKXA 4QP9A 4C4FA 3L9MA 5HGIA 1FGIA 4CV8A 4KBAA 4D28A 2GTMA 4F0FA 4LUDA 2QOKA 4FG8A 4L44A 4CCUA 4I6BA 3Q9YA 1OM1A 3UC3A 4IZ5A 4RA4A 4QPSA 4PMTA 3S95A 2JFLA 4WSQA 2BFXA 2J0LA 4R7HA 1WCCA 4IB0A 3Q4UA 4UV0A 4CFXA 2WEIA 4O82A 3ATTA 2C6EA 4U79A 5AFVA 1QPCA 3R30A 3KCKA 4YZCA 2BPMA 3W16A 4ANBA 5HTIA 4M69B 4R8QA 3R9OA 4RFMA 5CF5A 1J7IA 5E9EA 5L6WL 4IZAA 4EHZA 1A06A 4FVQA 3UPZA 3W1FA 4IZ7A 3LVPA 4EBVA 4YSJA 3ZZEA 2A0CX 5M09A 3FZSA 1RE8A 3NSZA 2ZV8A 4EOPA 4AE9A 3CJFA 4XRLA 2W9ZB 4JG6A 4FSTA 1IG1A 5HHWA 3U6JA 2EVAA 5E8WA 4ACHA 5IA3A 3WF8A 2X1NA 4ITJA 5ETIA 2YISA 4U44A 4ZTNA 2Q83A 3R00A 3FZPA 5CU2A 3UOLA 4XYFA 4Y83A 5KO1A 4MBLA 3UOJA 5DI1A 2V62A 3QCXA 5HD4A 4FIGA 3MBLA 5ETAA 3DNDA 2H6DA 3WE8A 2IG7A 5CT7A 1VYZA 4RJ3A 2J51A 3WZJA 3LCOA 4FF8A 2PYWA 4E3CA 4R5YA 4RC4A 4D4RA 3QYWA 1UV5A 3W2CA 3UVPA 5IA0A 2F2UA 4MQ2A 3O2MA 4PPBA 3QWJA 1JKTA 2XNNA 4KA3A 2JEDA 3OCGA 3OS3A 4L46A 4MQ1A 5BUJA 2OGVA 2VTMA 3VRYA 4WD5A 3JY0A 3SG9A 3HMOA 2OO8X 4MH7A 4HGLA 3MPAA 3NW7A 1VYWA 4ZZNA 4IXPA 2GDOA 3DXNA 1PKGA 3ACKA 4Q5EA 5DGZA 3ORPA 2CMWA 5HCZA 4AN9A 3O50A 4EJNA 5AP6A 4FUYA 3FY2A 3QLGA 4FSZA 4NFMA 2BCJA 2R0IA 1V1KA 3KULA 4AT3A 3V5JA 2C6OA 2B53A 2FGIA 2Y0AA 4I20A 5HVKA 3O8UA 2PZPA 4WIHA 2QD9A 5CENA 1U46A 4FTUA 4P5QA 4CRSA 4F09A 3E87A 4O91A 4CFFA 3B8QA 2YN8A 5DT4A 3P08A 4D4VA 3QTRA 4WNKA 3AC1A 2OSCA 3ORLA 4GCJA 4O0RA 3F3UA 2PHKA 2V22A 3RTPA 2JBPA 4AGDA 4AN3A 2WPAA 2F4JA 1XO2B 3TL8A 3COMA 3WF9A 1YWVA 4ALWA 1TVOA 3FC1X 4KKEA 2XNPA 1Z57A 3MYGA 3KULB 4CMUA 3ZTXA 3OC1A 5CU6A 3MPTA 4LOPA 2W9FB 4U3ZA 2UW4A 5A6NA 5HO7A 2CKOA 3D83A 3HZTA 3HNGA 4FEWA 1PW2A 4AZWA 3CY3A 5IF1A 2ETKA 4UWYA 2BAJA 1J91A 1PMNA 4ZLZA 1V0BA 4NJDA 5E8TA 3TV6A 4MK0A 1YXXA 2DYLA 2NRUA 3P7BA 4BZNA 3FC2A 5JKGA 2Y6MA 2ZDUA 4UWBA 4DTAA 3RK7A 5CVGA 2ACXA 3KRRA 2JAVA 4X0MA 2VTTA 4XOYA 1H1RA 2PMLX 3T8OA 4KKGA 3WZDA 4DG3E 5IZFA 2WTJA 4FTJA 5H9BA 3KY2A 2KULA 3MH1A 3MJ1A 4RX8A 3VC4A 2OF4A 1YI4A 2XRWA 3A8WA 5CNOA 3SDJA 2WKMA 2OI4X 3F3VA 3P7AA 3VUDA 2CNQA 1PKDA 2W17A 4ORKA 2XIXA 4W8EA 1H08A 3SOCA 4W4WA 3CR0A 5G1XA 3R9DA 2XNMA 1Q8YA 1Q8WA 4YPSA 1YKRA 3E62A 3RP9A 3N4UA 3SD0A 1JPAA 3K54A 3ZXZA 3HVCA 1MRVA 2FSMX 3DKGA 2B9FA 3BBWA 4IAAA 2ZJWA 3R1NA 4B8LA 4BDAA 3TNWA 4WG4A 4DCEA 2R3LA 5C4KA 2IW9A 4E4LA 4WNPA 4R77A 4U8ZA 5CY3A 2OJIA 3FMLA 4FUXA 4ZJIA 1YXTA 1Q4LA 4W4YA 2X9EA 3EN4A 4DT8A 3PXYA 3VS1A 4N6YA 2C5VA 1Q3WA 1XH9A 3BKBA 2YJRA 2ZAZA 4O6LA 3TNIA 3LIJA 4USEA 4JIAA 2VU3A 2WQBA 3EFJA 1Y6BA 3I1AA 4Y46A 3PA4A 3B2TA 4FZDB 2OIDA 3PWYA 5BMSA 2WQEA 1ATPE 4PPAA 3QCSA 4I4FA 5AM7A 2EUFB 2HW6A 2OZAA 2Q0BA 2O64A 5AX9A 3FYKX 4K8AA 3GFEA 3ENHA 2J0JA 1PF8A 2CCIA 3OHTA 5DMZA 4DH1A 3MVJA 4L67A 4ZSLA 2C6TA 2UVYA 4BTMA 4BDIA 3OBGA 1WFCA 2W1FA 2VUWA 2WMBA 3NAXA 2G1TA 1MQ4A 1ZYDA 2XM9A 4CQGA 2ZM1A 2OZOA 3VN9A 1CKIA 1HOWA 1XBAA 4M13A 4TRLA 1WBWA 2YITA 4PDYA 4FE2A 3HA6A 3HYHA 4E8AA 4YZDA 2QO9A 4TXCA 4FTCA 3KB7A 4MAOA 4I23A 2XK6A 2DUVA 3AT2A 4BCOA 5C8NA 4ZXTA 5JZJA 3QTQA 5EI6A 5M55A 3U9NA 4Q9SA 4F9AA 1NW1A 3OXZA 4TW9A 3MFRA 4BI2A 1Q8UA 4H3BA 5HCXA 4D5HA 4DLJA 2C0TA 2PMNX 4WO5A 4YNEA 1NVQA 3KN6A 5H8GA 3LQ3A 1B6CB 3GU6A 3EL8A 3P4KA 3MV5A 1WMKA 4ASXA 3DJ6A 4QMWA 3E8EA 3CQEA 5E1EA 3QXOA 3VS7A 4GU6A 4CFMA 2GSFA 4L45A 3BHYA 3FSKA 3W55A 4BKZA 3D5VA 1FBNA 3QQLA 4P7EA 4FKRA 5EKOA 3LCKA 3PP0A 4XS2A 4NT4A 3E3PA 3TCPA 2I0VA 5BVOA 4QMLA 3Q60A 4PF4A 4AGUA 3GNIB 3FBVA 4QPMA 4F08A 3MFSA 1OKZA 5EK7A 1SVGA 4HVGA 2XKCA 3DB6A 3LXLA 4P5ZA 2AYPA 1WBOA 5IQEA 3GT8A 4CVAA 3R8MA 3Q3BA 3UOHA 1MRYA 1B39A 4TYHA 4DG0E 3U6IA 5BYLA 1W83A 2PVHA 3ALOA 4YBKA 4I5MA 3QX2A 3BE2A 4QOXA 1OECA 3QKMA 4WA9A 5AX3A 4RVKA 5LVLA 5JGBA 3CQUA 3UIUA 1M7QA 4FTLA 4QMSA 4GVAA 5FGKA 4XCUA 3D9VA 2RFNA 4G16A 3L8SA 4A4OA 2IPXA 4RJ6A 4NFNA 4X2FA 4EC9A 4YTIA 3D2IA 3PDTA 3UYTA 1KE8A 4EOQA 2O8YA 2O3PA 1Q24A 2PVLA 2PPQA 4I5CA 2JKOA 4IM0A 1OPJA 3PVWA 3UIBA 2PU8A 2B4SB 4HYHA 4CXAA 1XH8A 4I0TA 4EZ5A 1OL5A 3OCBA 2R4BA 3ZRLA 4BDCA 4JRNA 3N4VA 4L3JA 1ZZLA 4GFMA 5BUEA 2UZTA 3BYOA 3KMMA 4OTPA 3S2PA 3MVLA 2WNTA 3CPBA 3G51A 3PSCA 1J1BA 3FL4A 2Z7LA 3G15A 2EXCX 4GT3A 1ZMVA 4GUEA 3Q32A 2VO6A 5EHLA 4KBKA 4NW6A 3R7YA 2BZKB 3F7WA 3SXRA 2R3PA 3UQCA 2ZB1A 3OEZA 3DNEA 3ACJA 1I44A 4U81A 3NR9A 5GHVA 3MFTA 3MVMA 1H26A 3UPXA 4P2KA 3ZZWA 3FV8A 2B7AA 4K77A 4C4EA 1WVWA 3KXMA 4RIWA 4YTCA 5E4HA 3V5LA 4BTKA 4ANQA 3ZEPA 4NCTC 3O71A 5AP0A 3E5AA 4Q9ZA 4GL9A 3RJCA 3DBQA 5FUTA 5I3RA 2WO6A 4X6RA 2HAKA 3QRJA 2VWZA 4G3CA 4FKJA 2OKRA 5DNRA 3ZRKA 5IKWA 5J9YA 3UG2A 5HE1A 3NUAA 4EK4A 4DFUA 4I0SA 1Q62A 2ITUA 3CIKA 5IH6A 1Q41A 4RLLA 2Y4PA 1YHVA 4ZLYA 2A1AB 2UW3A 4YJVA 4O21A 1YW2A 3WARA 4IIRA 3ZUUA 5AP4A 2BILB 4O7YA 4EONA 5DEWA 1OL1A 4FKWA 4K6ZA 5LJJA 1REJA 5LVNA 3EH9A 5EHYA 2W06A 3RKBA 4EH6A 2OK1A 2OIQA 3HECA 2R3NA 2VTLA 5DLSA 4M66A 3V5TA 5IEXA 3CQWA 4RIWB 2BTSA 3OP5A 4UN0C 2WIHA 3CC6A 2ONLC 3CBLA 2F49A 3NGAA 4PDOA 3EQPA 3QCYA 4AZSA 4IFGA 4FTTA 3DKCA 4F1TA 4DLIA 4O7ZA 3ODZX 2X7FA 2VO0A 4WKQA 2VX1A 3G33A 4O1OA 3I81A 4HZSA 1PXOA 2PZ5A 2Z60A 5G6VA 4O0YA 2PVNA 4A9UA 2UVZA 2VTQA 3BU5A 2AC5A 1XHAA 3D5UA 3U51A 4QP7A 4S32A 5ANDA 3S1HA 3M42A 4OAVB 2I1MA 5ANIA 4DHFA 5AR3A 5HLNA 2YFXA 4HYIA 3P0MA 3PZHA 2QOIA 4F6WA 4RIYA 2F7ZE 5AUXA 2UZVA 4CTCA 2UW8A 2XM8A 2BKZA 4DBNA 1XH5A 3COHA 2YIQA 4DEIA 1CTPE 3CD3A 4B8MA 2WFYA 4PQNA 4TN6A 3V3VA 5EYCA 2BIYA 3BELA 3NDMA 3OG7A 5C03A 4FZFB 4BF2A 5I3OA 5EI8A 3VS0A 4ACDA 1M2PA 5I9YA 2VWUA 2W1IA 3D2KA 4MTAA 1IRKA 4BCMA 1RDQE 4Z16A 4FKIA 4EYMA 1XBBA 2A4LA 3DTCA 1ZOGA 4L3PA 4APCA 3A62A 5JQ5A 3OMVA 5L8LA 3TUDA 4F7JA 4ARKA 5IDNA 1FVVA 1PMVA 4RIYB 3A61A 3VUKA 4GKHA 3FLSA 2R7BA 5DRBA 1JKKA 3PJ1A 4WBBB 2OW3A 3OWJA 2NNWB 2G2FA 5AR4A 2CGXA 1REKA 3AOXA 1JOWB 3PY0A 1Q61A 1SVEA 3NUPA 1YRPA 4L00A 4O2ZA 5HIBA 4J96A 5CF4A 2IZUA 4IB5A 4KWPA 2DQ7X 3TZMA 3ZSGA 3IW6A 2VO7A 4IC7A 3CEKA 5HIDA 4QP1A 2X8IA 3AMYA 3C50A 4M7IA 4KUJA 5IQFA 3MPMA 2FH9A 4S2ZA 4AXAA 2BVAA 4PNIA 4X3JA 4FMQA 1OMWA 5AWMA 4QYEA 3R9NA 3F61A 4YZ9A 5GJDA 2HZ0A 2JGZA 4BWKA 3GXLA 3FMMA 2G2HA 5J79A 2WMAA 3FMDA 5DT0A 2LGCA 4TT7A 4X7QA 3HV3A 5EYKA 2BZHB 3FDNA 1JWHA 2WTWA 4O7LA 2ZM4A 1ZRZA 3PJ8A 4ZTMA 3OUNB 5AUTA 2Y4IC 1XJDA 2GS2A 5FEDA 4HVSA 1UU7A 3DK6A 1Z5MA 3HEGA 3ZO4A 4YR8A 4CKRA 3AT4A 2C5XA 3OWKA 1YDSE 4C35A 2QOFA 4BIBA 2XIZA 2YM5A 1BLXA 5DVRA 4ANOA 4DTKA 5A54A 1K3AA 1H0VA 4N0SA 4TYIA 4F99A 1PY5A 2WQMA 5J8IA 4PP9A 3R7VA 1JSUA 2JITA 4MEDA 4RWKA 3UG1A 4DGNA 3R1QA 4EOIA 4BCJA 1UKHA 4BGQA 4F7SA 2HELA 1OKWA 5DYJA 3EZRA 4L6QA 4M14A 4GVJA 4FSUA 5H3QA 2Z7SA 5IPJA 3Q53A 5GINE 2X0GA 4IBMA 3EFLA 3UZTA 3FLQA 2W05A 3ZSIA 5FXSA 2C5YA 3LCSA 3Q04A 4FT9A 4M97A 3GBZA 3HGKA 3E88A 4A07A 4DEEA 4DH7A 4ANLA 3KN5A 5EOLA 3F6XA 4DFXE 2HXLA 2QNJA 3QYZA 3I6WA 4BIEA 3FJQE 2QODA 4B7TA 5EOBA 4EORA 4FV6A 3IW7A 4BCPA 2OWBA 1KE7A 4RWLA 4FSYA 1M52A 3O23A 5BVFA 3D5XA 5F1ZA 3TT0A 2HZIA 4IX3A 4RIXA 3LFNA 4MD7E 4TPTA 4BBFA 4W9XA 3K2LA 2QOBA 2GHGA 4RJ5A 5GZ9A 2YERA 3DV3A 4TY1A 1OGUA 4RWJA 3FZRA 3F2AA 5GIOE 1VJYA 4F6UA 4AGWA 3TUCA 2QLQA 2UW6A 5E1SA 2P33A 2R3JA 3A4OX 4FSWA 3D7ZA 4IH8A 4EH7A 4PTEA 4PDSA 4TWOA 4UBAA 4FNXA 4UXLA 4FZ7A 5LMKC 5AV4A 4FV5A 4RSSA 3CKWA 3LM0A 4RIXB 5FBNC 3R0TA 3V6SA 2HWOA 4CFWA 3C1XA 3QXPA 1PXPA 1PXIA 4EOJA 5HBJA 2WMVA 5CZHA 5K0KA 3GCVA 2OU7A 4NW5A 3MFUA 4O27B 2G9XA 5FDPA 2FSOX 2ZMDA 5EHOA 2YCFA 3CP9A 5C9CA 3FLNC 4J7BA 3QALE 3UC4A 3UNZA 4C59A 4FK3A 1PMEA 2WIPA 5CYIA 2ONLA 3KL8A 5HICA 1GIIA 3NPCA 3LMHA 3AGMA 3D94A 4EYJA 3FKOA 2WMWA 3ZUTA 4N57A 2QKRA 4R5SA 1Z9XA 4NEUA 1L8TA 2X81A 4G1WA 3A99A 5J7HA 1IEPA 4KIKB 4DFYA 1QL6A 3IW8A 2ITZA 5M4CA 5KE0A 3NVKI 4JQ8A 3HX4A 5FWKK 1IAHA 1ZZ2A 2YEXA 5IA4A 3QD3A 3P7CA 2HY0A 2YDIA 3DFCB 3ZO1A 5HNIX 3QTZA 4BVUA 3RK9A 3KRXA 3N51A 4NSTA 4W4XA 5E91A 1WVYA 2ITYA 3RINA 3HKOA 3HV6A 2WU7A 3ITZA 1MP8A 3PVBA 4AZEA 2UW0A 3C0GA 3FE3A 2XVDA 3L9NA 3SOAA 5EW9A 1CKJA 3Q6UA 4IAZA 5AP1A 4E93A 2ZB0A 4M67A 4Q2AA 2GU8A 4M12A 3MH3A 3IQ7A 2KTYA 3C9WA 3OBJA 3MH0A 5FBOA 5M4FA 3TM0A 5HVJA 4ZS4A 5ICPA 2Q0NA 4QQJA 3LPBA 4AW1A 3C4EA 2J9MA 4JRVA 3FXZA 3VQHA 5IH5A 4UXQA 5AA9A 3VUMA 1R39A 3ZONA 5M53A 1BL7A 2ZYBA 3O51A 4FNZA 1PJKA 2E9PA 2H34A 3IOKA 4JJRA 3V8WA 3BI6A 2P4IA 2SRCA 2ITPA 5CF8A 4RIOA 4GK2A 3H3CA 3UJGA 3DY7A 1OUYA 4D2WA 2ITXA 5L2IA 4GG5A 4FBXA 2Z7QA 4DH5A 4CZYB 5LVPA 3V04A 1M2RA 4YNOA 2X2MA 4LGDA 3QQKA 4ACCA 4OLIA 4CV9A 3ORKA 5BNJA 1YDRE 2Y7JA 4QNYA 5CASA 4GKIA 2OFVA 5A6OA 1F5QA 4OBQA 1APME 4FA2A 2B0QA 1QPJA 4YPDA 4IX6A 4FR4A 3DFAA 4NJ3A 2C3IB 1H1SA 4DH8A 5ANKA 5FG8A 3R9HA 2OXDA 5EW8A 2WEVA 5E8XA 3UBDA 2W4OA 4BBEA 3BGZA 4YZNA 5LQFA 1GNGA 2PTKA 4CSVA 3RI1A 4EI4A 4AACA 5CEOA 2OJ9A 3KQ7A 3LOKA 3NUXA 4M68A 3PZEA 5EH0A 2C0IA 4I3ZA 4ERKA 2R3IA 3EN7A 4EKKA 2OH4A 5IQIA 2XZSA 3ELJA 4D4YA 4PV0A 4EOMA 4CZUA 3FMJA 4F0IA 4O0SA 2PK9A 4MXCA 3LKMA 5ACKA 4S30A 2C5NA 3QKLA 3F66A 5CI6A 5AP3A 1JKSA 3R8VA 3TV7A 2J0KA 4D2TA 4XG3A 4MNEB 4OTWA 1X8BA 2QONA 2UZNA 1TQMA 3ZDIA 1M2QA 3DDPA 4P4CA 4EHEA 4CQEA 3LFAA 4MD8E 2FB8A 3PLSA 4LM5A 4D4SA 5HX6A 3AT3A 1YOJA 2ZV9A 2BDWA 3GC9A 5GJFA 5KBRA 3QAME 1P14A 4YHTA 4G2FA 2Y4IB 3RBWA 2JLDA 4GRBA 3Q4ZA 4X2NA 4D55A 5A4LA 3N4TA 2BFYA 4QO9A 5M4IA 3ATSA 3V5PA 4V01A 5IQBA 3RZFA 1H01A 3NCZA 3BV2A 5E8SA 3KGAA 5KNJA 3JYAA 5DHJA 4E6AA 3KU2A 4YLKA 4MWIA 4F6SA 3O8PA 1H00A 4ZP5A 3UP2A 4EKLA 1SYKA 1BX6A 4JIKA 4DGLC 1RQQA 1Y57A 3KREA 2FVDA 3C4XA 3Q9XA 5ANGA 3ZM4A 4FL2A 4X6QC 5JRSA 4JT3A 2PE2A 3FUPA 4ZIMA 4CNHA 1M7NA 3ALNA 3RNIA 3RPYA 4XP3A 5JN2A 4FOBA 4TYEA 1O6KA 3I5ZA 4AW0A 4LL5A 5LXMA 2R9SA 3PXKA 5A4QA 5E8UA 5BVDA 4XEYA 4ZAUA 5HQ0A 3SHEA 5IA2A 3F7ZA 5L3AA 4BKJA 3RCJA 3DXPA 5IQCA 1FVRA 3SKCA 2NRYA 3IDPA 3VJNA 3OWLA 3IKAA 3PJ3A 3MJ2A 4KNBA 4E20A 1G5SA 4EHGA 4XHKB 4EOOA 5LMKA 4HPUE 3IOPA 1IR3A 4ZTLA 4EK8A 3NCGA 5JEBA 3ZH8A 2PUUA 2YDJA 4E6DA 2B52A 3MIYA 4EUTA 5L6OA 3SW7A 2WMSA 4RJ8A 3QU0A 4U80A 4D0WA 4FTKA 4AW5A 1KV1A 3LE6A 4RC2A 4GW8A 3UZPA 3LCTA 1QMZA 2Y8OA 4AX8A 3KA0A 2YAKA 4ZJVA 2J90A 3ZS5A 3DCVA 3KXHA 5FM3A 3KVXA 4BYJA 2PVRA 2PWLA 1R3CA 3SVVA 2X8EA 2YIWA 3WIGA 1RJBA 4NZWB 4RPVA 4OR5A 1K9AA 3V6RA 3C4CA 4QMPA 3IGOA 3FMEA 3TZ8A 2GNLA 4UZDA 3D0EA 3NUSA 3P1AA 4XJ0A 3ZSHA 1KE9A 4GJ2A 5EM6A 5AEPA 2YCQA 4P90A 2XK4A 3PVGA 3C0IA 4PMSA 3GQIA 4CKIA 2AC3A 2C69A 1K2PA 4DH3A 2ZDTA 4FV4A 3I7BA 4AFJA 1OBDA 4RGJA 2QI8A 3ZYAA 3EQGA 3TTJA 3A8XA 3D5WA 3I0QA 1YVJA 3NYVA 4R7IA 4WT6A 4ALUA 3Q96A 5CXHA 4KIQA 4XG2A 3DAJA 4XLVA 4CFUA 4FKLA 5HLPA 3R6XA 5KMKA 4TYJA 4KS8A 3GP0A 2Z2WA 2J0MB 2VWVA 3E8NA 3QHRA 4FSMA 4FTQA 4LFIA 1I09A 1UWJA 4S33A 3LXKA 3CCNA 4FTNA 4ZZMA 4H3QA 3A7JA 3D15A 4O7RA 5AV0A 5FXQA 2VAGA 3Q5ZA 1WBPA 3SXSA 4EQMA 1KOAA 3L8PA 1ZAOA 4MVFA 4Y5HA 3FXXA 2C6MA 4C02A 4TWNA 1SNXA 4MXYA 3VUIA 1SZMA 2BR1A 4RVLA 3TZ7A 4FKGA 2GNGA 4BDGA 4ZJJA 4JNWA 5AUWA 3F9NA 4E4XA 2JDSA 4JAJA 3AQVA 3MSSA 2IVUA 4QMTA 4F0GA 4R3CA 2RG5A 4JX3A 3R8LA 2J4ZA 2NP8A 4DEDA 4BDKA 2QR8A 3I79A 3R21A 1T46A 4D0XA 1ERKA 2X7GA 3IDCA 3W10A 2CLXA 4X3FC 4ACMA 2PSQA 4Z7GA 2BIKB 3LQ5A 4C4IA 5DA3A 4ENXA 4JDIA 4OBOA 3AG9A 4CG8A 3QUEA 4XMOA 5EM5A 3R71A 3QLFA 2XK8A 2R64A 1MRUA 4FIHA 2V0DA 2ZM3A 3HAMA 5DFPA 5ANOA 3HA8A 3GB2A 1OKVA 4EOLA 3GU5A 4U41A 3DQXA 5CVFA 3ZLSA 4ZMEA 3NNWA 4ANSA 3GOKA 4AOTA 4EH4A 3MVHA 2XA4A 3WI6A 3NZ0A 3QD4A 3Q9WA 4PPCA 2BUJA 2HZNA 4J97A 4DEHA 4C2VA 2WB8A 4QTAA 3RCDA 5I5ZA 1BUHA 4PDPA 3RMFA 4UY9A 3QL8A 4RVTA 3R8ZA 5BPYA 3L1SA 1U5QA 1FOTA 3BE9A 3G2FA 5A14A 4D2VA 1KE5A 2VNWA 4UYNA 4IEBA 4IW0A 5DR6A 4CLIA 5M57A 3SG8A 2BROA 1KOBA 2CSNA 3E92A 3H4JA 3KK8A 4H58A 4JOAA 3GGFA 4J53A 4LQMA 5T3QA 3RK5A 2FUMA 4I6HA 2JIIA 1M14A 3TIZA 2PUPA 3H0ZA 5HNBA 3UVQA 5AV3A 2GS7A 4OW8A 5CAVA 2FSLX 3LFFA 2UW9A 4MNFA 5DN3A 2YABA 3PRFA 1SM2A 1DI8A 4V04A 2CN8A 4LV5A 3ANRA 4YGAA 5E92A 2OFUA 4GJ3A 4L9IA 4MX9A 3A7HA 3NLBA 1WBTA 3OEFX 5CZIA 2ITOA 5CXZA 3C7QA 2C1AA 3GUBA 3S00A 1FMOE 4K0YA 3DGKA 4A9YA 2I0HA 3ORZA 4L3LA 3LXNA 1DS5A 4GIHA 5CAQA 3DQWA 5HX8A 4PL5A 5AP5A
chains in the Genus database with same CATH superfamily
5IUHA 3WIKA 3UNKA 5DG5A 5HG9A 2R2PA 5L2TA 3FI8A 4IJPA 4TNDA 4V0GB 5ANJA 5BVEA 2CKPA 2WTDA 2O65A 4C62A 3F5PA 3LMIA 4YJPA 3BHVA 3C4WA 3CS9A 1OB3A 1FMKA 3QZHA 4YC3A 2C6IA 4X2JA 2WTCA 4QMVA 2YM4A 1LUFA 4ID7A 5LVOA 2VTRA 3U4UA 4FIIA 5JSMA 4EWQA 2RFSA 5H8BA 4A9RA 5C1QB 4U7ZA 4K33A 2CLQA 3ZFMA 3FAAA 4IC8A 3IG7A 3BWJA 4A9TA 1CMKE 2YWVA 1GJOA 4JLCA 4YHJA 4ZMFA 4QTEA 2W5BA 5TO8A 5JRQA 2VWBA 5EQEA 5M08A 4IAFA 5AAGA 4C7TA 1OZ1A 4BR3A 3A7GA 2QHMA 5DIAA 2OIBA 2PE1A 2YACA 3NUYA 3DBEA 3QGYA 3RGFA 5A4EA 4JR7A 2YZLA 4YJSA 3VUTA 4G9CA 5CEIA 3IK3A 3EQHA 5CSPA 3VBYA 1AGWA 3GCSA 4KIOA 3VHEA 3WZKA 3JVSA 4I1ZA 2BZJA 2E2BA 3NEWA 1BKXA 4HJOA 4U97A 1WZYA 3DKFA 3ERKA 4ZY6A 4AUAA 5K5NA 3NS9A 4KRDA 3QA8A 3FZ1A 4FKVA 3OCSA 1PYXA 4GIIA 1OITA 2BRBA 3C4FA 4X21A 3EKNA 5DR2A 5EI2A 1UU8A 3RAKA 2HENA 4NM5A 2W96B 4ASZA 4M3QA 2EXMA 5D7VA 4QQ5A 2WD1A 3B8RA 3O8TA 5FP6A 2XBJA 1JLUE 5CT0A 5IDPA 4DTBA 1BI8A 4FKTA 4YUQA 3CSVA 1GY3A 2WMXA 3F3ZA 1YOMA 5ETCA 5HEZA 4FKQA 4Y8DA 4DFNA 3AC8A 3ORIA 4IE9A 5AUZA 1UKIA 1URCA 4RQKA 5T6KA 3RWPA 2AUHA 5AADA 4GFGA 2RKUA 1CM8A 4HYUA 3CGOA 2C68A 4HW7A 3EQDA 1UNLA 3QUPA 3VS4A 3CE3A 3TNHA 4IAYA 2F2CB 4C4JA 2W1DA 3R1YA 3LFBA 4D9TA 1YWNA 5IUGA 2X9FA 3TZ9A 4EZ7A 4KBCA 2V55A 4BRXA 4O22A 4DEGA 1ZLTA 3FMKA 4RZWA 4Y95A 3ODYX 1H1WA 4FTMA 1MQBA 3PPJA 4F1OA 5JQ8A 2QR7A 3JVRA 3V5WA 3VBXA 3IPHA 4I6FA 4EC8A 2BALA 5J5SA 3R01A 2XALA 4APPA 1H27A 4BGHA 3VF9A 1XR1A 4QMMA 2B1PA 3UQFA 4UZHA 1Y6AA 4E1ZA 4EEVA 2UW5A 1W84A 3Q2MA 3KK9A 4KKHA 1LP4A 4BHNA 2Z7RA 3PY3A 4FICA 2C6DA 4S31A 2XIRA 5HLWA 3RM7A 2X2LA 3E64A 2EB2A 1BYGA 5D1JA 3UQGA 5HKMA 4D58A 1Y8GA 3PJ2A 5J5TA 3OW4A 4RFYA 5K4IA 5CEQA 3VW6A 4RVMA 2QQ7A 2YIRA 1OL2A 4FNYA 5B7VA 1PXLA 5BVNA 4R78A 5AA8A 2OXXA 3B2WA 1YHWA 3NX8A 2ZV2A 5DH3A 4EH2A 3QQGA 3KXXA 4TWPA 4GG7A 3DJ7A 3ZM9A 5HNGA 5CAPA 4AG8A 5CAOA 2PZRA 1XBCA 4K18A 5LMAA 1YHSA 4E26A 4F7NA 4G3FA 4U45A 3HP5A 1LEWA 3PG1A 4AFEA 2X6EA 2PVJA 1PHKA 3JY9A 1ZYCA 4EQCA 1H1PA 4XG6A 4F4PA 5I9XA 4ITHA 3LLAA 3E7OA 3K5VA 1BL6A 5I9WA 5L8KA 4KRCA 3OTVA 3DBDA 3UNJA 3N9XA 5IQDA 2R3MA 4XNEA 3VF8A 3MI9A 4CLJA 1SMHA 2WOUA 2R3RA 1KE6A 3O96A 4HCVA 4JDKA 4X3FB 3TIYA 4A9SA 1F3MC 5AR5A 4DHZA 3VS3A 1ZYLA 4NKSA 2GMXA 3V51A 3ZO2A 1G8SA 3H30A 3FEGA 4GS6A 2P2IA 3BLAA 2CHLA 3O7LD 1Y91A 4CMTA 4H05A 4Z3VA 3IW5A 4CEGA 3DAKA 4AU8A 3MWUA 4B9DA 4DHIB 4HNFA 4DGMA 3NIEA 3AC5A 3AC3A 1YI6A 5L2SA 3LJ2A 4YZBA 2EXEA 3ZCLA 4BZDA 4DAWA 5B2LA 1NT2A 4F65A 5CU4A 2RG6A 4GMYA 5GIPE 4QMUA 4DG2E 4B6LA 4U42A 1R0PA 2ETMA 3NYNA 4IDVA 5CQUA 2W0JA 3DT1A 2C3KA 4ZSGA 2RIOA 5LOHA 5IQGA 4O7VA 3UODA 4I5HA 4NTTA 3HV4A 5IUIA 5C27A 4XP2A 4D2SA 4LI5A 3UDBA 2IW8A 2UZLA 5FDXA 4IQ6A 5F94A 5KKRC 3R63A 3FMNA 2B9IA 4NU1A 3F5UA 1HCKA 3O7LB 2QCSA 4H1MA 5KMLA 2DS1A 3CTHA 3ZO3A 4BN1A 2R3KA 4ACGA 5KBQA 4XUFA 5ANEA 4E5BA 4BL1A 4KD1A 4WUNA 1YI3A 3GCUA 4UYAA 3WILA 1M17A 4FKOA 5BQ0A 3BYUA 5BYZA 4D1ZA 2CNVA 3NUNA 5B2MA 1U59A 3ZC5A 4BDHA 4JBOA 2H9VA 1B38A 5LWMA 4U40A 2XCHA 5HE2A 3LQ8A 4G6NA 3BQCA 3LFSA 1URWA 1FPUA 2XJ2A 4HZRA 4DFZE 3RPSA 5B0XA 4E4MA 3NFGB 3SAYA 3LFQA 3MY0A 5D9HA 2WMQA 2VX3A 4GH2A 5CS6A 5EDPA 4O4DA 3RPRA 5C01A 3HAVA 3BHUA 4RX9A 3MN3A 4ANMA 3P86A 2JKMA 4F9BA 3QTWA 4Y85A 3ENMA 4IHPA 3R7EA 2ESMA 5L6PA 4MF0A 3ZXTA 2GQSA 3AC4A 3BEAA 5KMNA 1JBPE 5EQPA 4RC3A 2XNBA 2RGPA 5TE0A 4FV0A 3C13A 3F2NA 2C5OA 3NYXA 4PTGA 5EYDA 5FRIA 1G8AA 4B4LA 4TZRA 5C8KA 4OTHA 3KVWA 2P0CA 4DGGA 3VUGA 4Z55A 2VZ6A 4FKUA 4USDA 4J52A 3UDSA 3MB7A 2CPKE 4YURA 1W2DA 2XARA 2E9VA 2QHNA 4ZTHA 5HG8A 2J0IA 3WYYA 1O6LA 2BDFA 4BWXA 3U6HA 3S3IA 3GCPA 3QTUA 5M51A 3II5A 2YLFA 4C58A 3VNTA 5C26A 4YC6A 2WTIA 4OTGA 1GZ8A 2QOOA 2IWIA 4JBVA 3EOCA 3VS6A 3AD5A 4M0ZA 3IONA 4JBQA 1QCFA 4DEBA 4CD0A 4IWPA 4RX7A 3G90X 1CDKA 4FV7A 2XNGA 4YLLA 3UMWA 3R83A 4NCTA 3ML1A 4M15A 1F0QA 4G3DA 4HNIA 5CSVA 4CT1A 4DF3A 3MA3A 1PRYA 3FQEA 4FT5A 3OF0A 2XNOA 3NMUF 2ETRA 4FI1A 3CXWA 4WOVA 5IMXA 5AV1A 2J5EA 3Q6WA 4JL9A 4KIKA 3BHHA 4YBJA 5AR7A 3BV3A 1ZYSA 4OGRA 2G01A 3T3VA 4FEVA 2BAKA 3DA6A 1UNHA 3QQHA 1BMKA 2C47A 3PY1A 3BLQA 2ITQA 2PZYA 4L01A 4ZOGA 5AUVA 4RLKA 2JDTA 4CYJA 3V8TA 4EK6A 5EYMA 1NY3A 3IECA 3EYGA 4OTFA 2I40A 4XP0A 3QRIA 4KSQA 4MXOA 1ZY4A 4N6ZA 3RAHA 3DZQA 4C4HA 2B54A 5CVHA 3QHWA 3VHKA 5E8VA 4MF1A 2QOCA 3AGLA 3BLHA 2QKWB 4U9AA 3BBTB 2HXQA 4KS7A 5CU0A 4F1MA 2PUIA 4OT6A 4R1VA 4FK6A 3W18A 1QPEA 3G9LX 2HOGA 4QP2A 1Q3DA 5AUYA 1VR2A 3R7IA 4DN5A 2WQOA 4DEAA 4YSMA 5KMMA 4ZTQA 3SGCA 3VBVA 3BX5A 4A4LA 2BRGA 4QT1A 4I94A 4O2PA 2PE0A 4YJOA 5FP5A 3W2RA 1V0PA 3ZLXA 1G8KA 3ID6C 1W7HA 2QOHA 3HLLA 5CEPA 4A06A 3ORNA 1P5EA 3CD8A 3PYYA 4FL1A 4H1JA 2P2HA 1EH4A 3HRCA 4LL0A 4JX7A 2JAMA 4OT5A 5BVKA 5IQHA 5HBEA 3DLZA 2PY3A 4IVCA 3WE4A 3ZDUA 3R7GA 1A48A 3NYOA 4PY1A 4JBPA 4QMZA 5D12A 4DINA 3HV5A 2OLCA 4W8DA 5GZ8A 3GOPA 3ANQA 3U55A 4IX4A 3F3WA 3CTQA 2OJJA 2YZAA 3R7OA 4NIFA 1U54B 4FSQA 4FTOA 2EU9A 5KHWA 3H9OA 3RHKA 2JDOA 4BB4A 5K4JA 4AZFA 3QRTA 3D4QA 4LUEA 3GI3A 4X2GA 3PRIA 3COIA 3L8VA 5CI7A 4ERWA 3D14A 5AMNA 5J87A 3TKUA 2GNJA 1YXVA 5DPVA 5FD2A 4PTCA 4JR3A 3LLTA 4U5JA 5JMSA 4FYOA 2IN6A 3PXQA 5EQYA 4U43A 4G3GA 3TKIA 3C0HA 5IMEA 1XH6A 2GS6A 4F9YA 4AA5A 2HYYA 5D41A 5EFQA 3W8QA 4BCKA 3FPQA 1ND4A 3QCQA 2OBJA 3TG1A 4C38A 2WMRA 4YU2A 4MNEA 4NIFB 4BTFA 3ETAA 2XMYA 3REPA 4MWHA 3LHJA 3U4WA 4QRCA 2ZOQA 3POZA 2IVTA 2YDKA 3A60A 3A7IA 4O0XA 4Y73A 4XG7A 2WOTA 3WBLA 5HG5A 2XK9A 3FI3A 3GENA 3QUDA 4JXFA 5IG1A 3ZBXA 5H8EA 3NNXA 1VLRA 3OCTA 4FIFA 3QRUA 4ONAA 2QG7A 4BHZA 1O6YA 4HCUA 5AP2A 3SC1A 5DBXA 4NWMA 4E6QA 3W0RA 3HMPA 3LW0A 4LRMA 5DE2A 3EMGA 3PTGA 3OXIA 1FGKA 2E9UA 3K3IA 5KKRB 3UO5A 2QOLA 4YJQA 2BHHA 3QGWA 3OT8A 2QU6A 3FYJX 4BCHA 1E1XA 2WELA 1TQPA 2F9GA 2XRUA 3KEXA 4M8TA 3W2QA 1GAGA 2CDZA 4JI9A 4AE6A 4IX5A 4M0YA 3DU8A 1KWPA 3BLRA 4FG7A 3G6GA 3LJ0A 2PVFA 3LAUA 4KIPA 3S4QA 4PNKA 5ITAA 5JGAA 3QWKA 3Q4CA 3FHIA 5FLFA 1OIUA 2QLUA 2E9OA 2WMUA 2JFMA 4CZTA 2A27A 3WF7A 5HIEA 3W2SA 2R7IA 2YM7A 3E3BX 4UB7A 3A2CA 4LOQA 3PA3A 4QYHA 2CNUA 2VTHA 2X8DA 5KUPA 2VTOA 4RT7A 3ZU7A 3P78A 4LV7A 5KMJA 1R78A 3WOWA 1R0EA 4CMOA 2C30A 3PIZA 3QFVA 3KXNA 3PUPA 3F88A 3TNPC 1UWHA 2HK5A 3KRWA 1Q99A 3L8XA 4I92A 4IAIA 4L68A 3TUBA 3PFYA 1AD5A 2GQGA 4BI1A 4EWHA 3TMOA 3EQCA 4K11A 2F57A 4BBMA 3DXQA 2WAJA 4BGGA 5K9IA 4FGRA 3LFDA 2GNFA 2W4JA 5TF9A 1GZOA 4ZY5A 1H4LA 3ORXA 3H10A 3VUHA 4IB3A 3VBTA 3M2WA 3PPKA 4AQCA 3K3JA 4YC8A 2YIYA 1PXJA 4LMUA 5AP7A 2XKDA 5AAFA 3RAWA 2UZDA 2V5QA 4UWCA 5HG7A 2A2AA 3MA6A 4QMOA 5IEYA 3GC7A 3PSDA 3BU6A 5CX9A 5E8YA 4GYGA 3TXOA 4EH8A 2IZSA 2VWIA 2C3LA 2BTRA 4YJRA 5DEYA 4WUAA 5FEQA 3U87A 4ALVA 5K0XA 2GQRA 3BL7A 4GEOA 2R0UA 2EWAA 3PSBA 2RFDA 3E8DA 4EK3A 2QG5A 3FI2A 4RX5A 4WHZA 4LOOA 4AA4A 5LVMA 3BIZA 3PE1A 3LM5A 3MY5A 3VBWA 4BDJA 2WTKC 5IQAA 3UE4A 3BQRA 3I6UA 1A9UA 3VQUA 3R22A 4ASDA 5C4LA 5CSHA 5KZIA 3FL5A 3HUCA 5I4NA 4F70A 3F5XA 4XH6A 3Q9ZA 1GOLA 3P9JA 3KRLA 5AR2A 3FLWA 4WG5A 1L3RE 4R3RA 4G17A 4FKPA 2YCSA 2QO7A 3MW1A 4XOZA 4I6QA 4FTAA 3BRBA 4HGSA 4LV8A 1DAYA 4IADA 1BI7A 2J50A 2F7XE 4G3EA 2Z02A 1PXKA 4W9WA 3DKOA 1ZOEA 3HMNA 4AW2A 2VN9A 4I5PA 4IVDA 3ZFYA 3ZFXA 2XIYA 2XYUA 2VTAA 4GK4A 4LMNA 4IWDA 2O63A 4O84A 5CWZA 1W2CA 3E8CA 4BTJA 4ZZOA 2UZEA 3AXWA 3KCFA 3EN5A 4J8MA 4CFVA 4EOSA 3SRVA 5JH6A 3HDMA 4KSPA 2UW7A 4GU9A 3RAIA 4ZY4A 2JDRA 5E90A 4I41A 1OL6A 1J1CA 4FTRA 2XJ1A 4QQTA 4QYYA 2CJMA 3PVUA 4DFBA 1WBSA 4YZMA 4HYSA 4O0TA 4ZK5A 3QTIA 4KB8A 3ZLWA 2XAMA 5KCVA 3BHTA 4NTSA 3BCEA 3G9NA 4WSYA 1J7UA 3OZ6A 3AD4A 5EDRA 3ULZA 5HD7A 4L7FA 4AN2A 3R7UA 4J98A 4AZTA 4WRSA 5J7BA 2GNHA 3EN6A 4BYIA 1PYEA 2VO3A 4O0VA 4AAYA 2XYNA 4TYGA 4G5JA 2VTPA 3RM6A 4IM3A 2AEGA 3AMBA 1OI9A 4YTFA 2UZBA 3PPZA 4I21A 3SRVB 3R8UA 3T9TA 4HPTE 1FVTA 4XV1A 2XIKA 3OTUA 4J8NA 3KFAA 1AQ1A 4GT5A 3R73A 3T9IA 4JQ7A 4IJ9A 4QQCA 3QZIA 3PG3A 4CTBA 3UZRA 4H39A 2C6LA 4GT4A 1H25A 3TEIA 3SXFA 5CNNA 5M07A 2O2UA 5M56A 4R1YA 1UA2A 4M84A 4FV3A 1CKPA 3QQUA 3EL7A 5KZ0A 1LR4A 5L2WA 4RA5A 2RL5A 3DLSA 5CALA 3EQBA 4O38A 5A46A 3MH2A 3KMWA 4QPAA 5JT2A 2H8HA 2QOQA 4ZSEA 2UUEA 2WHBA 2JD5A 3VJOA 2W7XA 3QZFA 3NUUA 4EBWA 4FL3A 3UIMA 4A4XA 3ZC6A 2OJGA 4I93A 3WZEA 3MDYA 4IAKA 4MHAA 4CYIA 1P4OA 5EG3A 3DB8A 2A19B 3DZOA 3M1SA 4JG8A 5L2QA 5F9EA 5IU2A 4FV1A 2XANA 4F63A 4Y72A 3F2RA 1S9IA 4F64A 4RJ7A 4AF3A 3KC3A 2J2IB 2R5TA 2PVKA 2YM8A 3E63A 4FT7A 3FY0A 5H2UA 4EL9A 4AXFA 3PLAE 4OUCA 4IVBA 3GC0A 1Q8ZA 4GK3A 4MCVA 4E73A 5EW3A 2ERZE 4NM7A 4PL4A 1W0XC 2Y6OA 4D9UA 3KMUA 4G6LA 2UZUE 4PUZA 1OPKA 2VWYA 5DR9A 2CKQA 3RVGA 3BL9A 4DBXA 4H3PA 4L7SA 3ORMA 1OL7A 2YM3A 2QVSE 2WQNA 4XG8A 2I0YA 4BWPA 2UV2A 4IZYA 4O7WA 3FXWA 1OIRA 3TN8A 1ZARA 3FHRA 4EH9A 4V0GA 4UMUA 4WRGA 2IF8A 4FX3A 4QP8A 2FSTX 5IA5A 4O96A 4AWIA 3QA0A 3RHXA 3BGPA 3TKHA 3JUHA 3UGCA 4G5PA 4BICA 3QX4A 4HVHA 4ZSAA 1WAKA 1WBVA 4TL0A 3KF7A 4AGCA 5D11A 4QTDA 4WBOA 1TFFA 4MXAA 3EQFA 2CN5A 4O7TA 4LRKA 4FEXA 4J95A 1KSWA 4XV9A 4O83A 2R3OA 3RNYA 3LJ1A 4OTQA 4IM2A 1ZXEA 1GZNA 2I6LA 4RBLA 5CEKA 1Q5KA 2DWBA 2OJFE 3MESA 2VRXA 3UTOA 2XB7A 4RWIA 3UDZA 5AUUA 2VX0A 4USFA 1IASA 4RMZA 5FQDC 3PIYA 5GJGA 5ETFA 4CGAA 2YJSA 1STCE 2BRMA 1FINA 2CCHA 4PMMA 4I0RA 3GU7A 4IDTA 4O0WA 2FA2A 4YJUA 5F4NA 1OBGA 1U5RA 2JC6A 3G0FA 2VTIA 4O4CA 4EQUA 5HORA 3I7CA 4XBRA 2OZAB 3EB0A 4EOKA 3R9RA 4MYGA 4N70A 2NPQA 4E5WA 4BJJA 1GIHA 3FSFA 4S34A 2C4GA 3OXTA 1PXMA 4FVRA 4I4EA 3OW3A 3FQHA 5LWNA 2X4FA 4O86A 4J71A 3ZBFA 3CY2A 2HIWA 3QTSA 3HV7A 5CQWA 4NM0A 1ZYJA 3OY1A 2RSVA 3TJCA 2IW6A 2BRHA 1IAJA 4NM3A 5M44A 2XH5A 4DCAA 3ZUVA 5KMOA 2GHMA 4BY9E 3BWFA 3Q2JA 4LRJA 4IB1A 4MBIA 4CT2A 2XBAA 1H24A 4XG9A 1LEZA 5CU3A 4C3FA 3UVRA 3HMMA 1O9UA 3NW6A 4FC0A 4OTDA 3UOKA 5GZAA 4BJJB 4AS0A 1NVRA 4JS8A 3PA5A 2W5AA 3MB6A 4X2KA 3W32A 5CSXA 2YA9A 4C36A 4OTIA 1H1QA 4IVAA 3ROYA 3SX9A 4XBUA 4E4NA 5I0BA 4BCFA 1LPUA 5FTQA 4PP7A 3R8PA 1Q97A 3G6HA 2XK3A 2IVVA 3FQSA 3MIAA 4W4VA 4RRVA 2O0UA 4WG3A 3CGFA 3PXRA 3H9RA 4D1XA 2ITWA 4UMQA 3PXZA 3HP2A 3GU4A 2WTKB 2BRNA 3VO3A 4BZOA 5L4QA 2XEZA 5LMBA 4PMPA 3OWPA 2XNEA 4EHVA 2YCRA 4FJVA 4DA5A 5ACBC 3VS5A 4AQKA 4FV9A 1J3HA 1JQHA 5BMMA 1GIJA 5TOZA 3O5AA 3FPMA 1OIQA 1GZKA 1Q8TA 3QC4A 4FTIA 3C5IA 3CTJA 2IO6A 2XUUA 5E8ZA 4NL0A 1H8FA 2XP2A 5KX8A 3NNVA 3OT3A 4TYHB 4EH3A 3QC9A 2X7OA 5LCKA 2R3QA 5HO8A 2BAQA 2ERKA 4C8BA 5HZNA 3HRBA 3JXWA 3NWWA 1XQZA 4IWOA 3QKKA 4XX9A 2JKKA 5EDQA 2W1HA 3HRFA 1W98A 2X2KA 4K1BA 3SV0A 3W33A 4BC6A 2PVYA 3HMIA 4GSBA 5DRDA 3VS2A 3EHAA 2IJMA 2J5FA 1NA7A 1KUTA 2FO0A 2YWPA 3RALA 2VV9A 1TKIA 2ZV7A 1VZOA 2J7TA 4O4BB 5A3XA 4NK9A 3FKNA 4E7WA 3PXFA 5KMIA 4X3FA 4O81A 4L8MA 3WYXA 3TV4A 1JSVA 3EJ1A 1XWSA 3EYHA 1E9HA 4BCNA 2WGJA 4DYMA 5JFWA 2PMIA 3GC8A 5I9ZA 2OICA 2H96A 3LXPA 2VWXA 5IISA 3HUBA 4FV8A 4NUSA 3OD6X 4L43A 3A7FA 4IANA 2HZ4A 3VBQA 4U0IA 2I7QA 2NO3A 3ORTA 1UU9A 2CGVA 2XK7A 3EQRA 4ZTSA 4BDBA 4AXCA 3MGYA 4G6OA 4AA0A 4E6CA 4RJ4A 2W1CA 4FZ6A 3GEQA 3EIDA 4AAAA 3CPCA 3EFKA 2C6KA 3DDQA 4U3YA 4DDGA 3VAPA 1YOLA 3IDBA 4B0GA 4LGGA 5HVYA 3UO6A 3IS5A 2P55A 2B55A 3OVVA 5A9UA 4R6VA 3GFWA 2GHLA 3VIDA 4R3PA 4FIEA 3FWQA 3OUKA 4YO6A 3UP7A 4R7BA 4CKJA 3BEGA 4HVIA 4TKSA 4BCQA 2ITVA 4CG9A 2X6DA 2C0OA 1TQIA 4ITIA 3QRKA 3MS9A 3EKKA 3MY1A 3NIZA 4FYNA 4QMQA 1H0WA 3U54A 3PJCA 1H07A 3K5UA 1T45A 2HCKA 2Z8CA 1OIYA 1HCLA 3KKVA 3KXGA 4QP6A 4JDJA 3RPOA 2B9JA 4QDVA 2RFEA 2ZMCA 1JSTA 2BDJA 2FYSA 3I0OA 5AV2A 4OTRA 4BKYA 3HL7A 1SVHA 4HCTA 3I60A 3HDNA 4JAIA 4YLJA 5T68A 2WZJA 3QBNA 3EWHA 4ZEGA 4GFOA 4I24A 4QP4A 4C4GA 3EFWA 2VTSA 4FV2A 2G15A 4IMYA 4Q5HA 4UMTA 5CEMA 2PUNA 2CGWA 5I9UA 3L9PA 4ENYA 2J6MA 3H9FA 5B2KA 3DAEA 3DPKA 4HOKA 4Z9LA 3VW8A 4A7CA 2O5KA 3JR1A 2JKQA 5K5XA 5J1VA 4JDHA 4YHFA 1ZOHA 3GU8A 5I9VA 4DE4A 3WF6A 3JS2A 2PMOX 4DGOA 4FKSA 3SQQA 3F82A 4LGHA 4ZS0A 4ANNA 3P79A 5A4TA 3KRJA 2C3JA 3CLYA 4WNMA 2V7OA 5J95A 3UIXA 3NAYA 5EM8A 4G31A 4DC2A 3OY3A 2GCDA 3Q5IA 3R04A 4FOCA 4MXZA 4MD9E 2PULA 1R1WA 2VNYA 3RZBA 5DOSA 4EUUA 2E9NA 2XS0A 4MKCA 4AT5A 3CJGA 2C1BA 2REIA 3E7VA 2PL0A 3E93A 2JBOA 3IO7A 4HGEA 4QNAA 3SLSA 1MUOA 2JIVA 4TWCA 2IZTA 4FIJA 3IW4A 4CFNA 5F20A 1XMLA 3BZ3A 2QURA 3TWJA 5JZNA 5HU9A 4XV2A 1JNKA 2VD5A 3Q4TA 4BFMA 4QTCA 4O7SA 3MTLA 3QF9A 4KINA 1P2AA 3BYVA 4F9CA 4PRJA 1ZMWA 4O6EA 1ZY5A 2VTNA 5FTOA 2VGPA 3VRZA 3W2OA 4C33A 2OXYA 3O0GA 1QPDA 3U9CA 5K3YA 2QU5A 1TZDA 3GQLA 4IFCA 4JQEA 2X39A 3NNUA 5HI2A 3KF4A 4II5A 4RFZA 1VEBA 3DK7A 4XG4A 5J9ZA 5GNKA 5FTGA 4CCBA 3FZTA 4F9WA 2PVMA 4L42A 3UMXA 1JAMA 3H0YA 4FODA 2WMTA 4QMNA 1YWRA 1E1VA 4DFLA 5IH4A 5HTCA 5TKDA 2WU6A 3BYSA 2V7AA 4E5AX 4IWQA 5C8MA 2XJ0A 2HW7A 4RZVA 3V01A 5M4UA 2WXVA 4Z7HA 1YQJA 4RG0A 5HESA 4OAUC 3ULIA 5JFVA 1KV2A 3S0OA 2EB3A 1XH4A 4J99A 4C2WA 3EQIA 3V8SA 3MTFA 1JKLA 3JPVA 5BX0A 3QTXA 5HCYA 5CLPA 5JK3A 1S9JA 4FGBA 2XKEA 2HY81 2BHEA 4GUBA 1U4DA 5BYYA 2PZIA 1JVPP 3U8WA 4BCIA 5AM6A 3NW5A 4UALA 4G9RA 3C4ZA 2YHVA 3TJDA 2JIUA 3O17A 4J1RA 1YXUA 2OG8A 3OFMA 5AIRA 2W4KA 4XV3A 1OUKA 4C3RA 2UVXA 1OKYA 2YLEA 4DITA 4FEUA 2VTJA 5AJQA 3LCDA 4NKAA 1G3NA 3R02A 4QYGA 3ET7A 4FSNA 2JDVA 3FLYA 2YAAA 5DWRA 3TI1A 4FSRA 3FLZA 3PP1A 4D1SA 3OOGA 4NYEA 5HE3A 5CANA 2AQXA 3T3UA 4JG7A 3I5NA 4QP3A 3OOMA 4F7LA 5HTBA 4YTHA 5DT3A 3FI4A 2W1EA 2P3GX 4IACA 4LG4A 1UU3A 4GYIA 4I22A 1V0OA 2VWWA 3G5DA 4LYNA 3QQFA 3ZOSA 2HWPA 5BUIA 2A98A 1J7LA 2R3FA 1W82A 3BU3A 1DAWA 2CKEA 3C5UA 3P5KA 3THBA 2BZIB 2CGUA 1IA8A 3R1SA 5LCJA 4QD6A 4BI0A 5JFSA 2BMCA 3W0PA 4AXDA 5D10A 3BPRA 4UMRA 3F5GA 5F95A 1WVXA 4QMXA 4ASEA 4Y5QA 3DBFA 2W99B 5TT7A 5HE0A 3WZUA 2R3GA 2W1ZA 4AT4A 4K9YA 2GTNA 4FNWA 4QMYA 5CF6A 2W1GA 5FXRA 3DTWA 1FQ1B 2GNIA 3QQJA 3NFFB 1NVSA 1XH7A 3RWQA 4O0UA 4AP7A 3I4BA 4UEUA 1RW8A 3V5QA 3NRMA 1U54A 2ZVAA 4L53A 4EK5A 1UVRA 3P23A 2RF9A 1Y8YA 2GFCA 4FG9A 4XRJA 4KAOA 3PE2A 4TNBA 2LAVA 2WTVA 2QC6A 4QTBA 3POOA 1W2FA 3Q52A 4L52A 3NVMB 4HVDA 3AD6A 3BGQA 2R3HA 3IGGA 3SW4A 4MUQA 3LMGA 3EN9A 3F3TA 3DOGA 5BVWA 1IA9A 5HBHA 2F7EE 5IA1A