2UZWE

Pka structures of indazole-pyridine series of akt inhibitors
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
336
structure length
336
Chain Sequence
VKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVMLVKHMETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKDGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFSEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC SUBUNIT
publication title Syntheses of Potent, Selective, and Orally Bioavailable Indazole-Pyridine Series of Protein Kinase B/Akt Inhibitors with Reduced Hypotension.
pubmed doi rcsb
source organism Bos taurus
molecule tags Transferase
total genus 100
structure length 336
sequence length 336
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2007-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2uzwE01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2uzwE02
3GQLA 3LMGA 1F5QA 4KSPA 3HP5A 3DTCA 4DT9A 2VWUA 5TO8A 3QD0A 1OPLA 2XM8A 3Q53A 4YJUA 5I4NA 2XK4A 2WZJA 3OWJA 4QMMA 2GNJA 4AGUA 3PJ1A 4I1ZA 4KIKA 5HLWA 4ORKA 4LRJA 3KREA 4JQ8A 3BHHA 4E7WA 3DKFA 3EN4A 3G9NA 4FK6A 1T45A 3MI9A 4QP6A 4EWQA 4QTAA 4NEUA 4QT1A 4UZDA 3SOCA 4E20A 3Q4CA 3IGGA 4KA3A 4M13A 1XO2B 3MVHA 1Q62A 2EU9A 2DQ7X 1J91A 4FE2A 4YJRA 3P79A 4J99A 5FP5A 4F1OA 1MP8A 3R2YA 3FKNA 4MNEA 2O0UA 5J87A 3MY1A 5KMMA 3H0ZA 4Y8DA 3MJ1A 3NYVA 3WYYA 5LXMA 3LM0A 3WYXA 3VQUA 4II5A 4EBWA 4NW6A 4TNDA 3E64A 4WUNA 4X7QA 4UWCA 3LLAA 2RFEA 2XYUA 2XNEA 3PTGA 5D11A 4DH7A 4BN1A 4P5QA 4IAIA 4U6RA 2C3KA 3QC4A 4HZSA 4KIOA 3VS7A 3RPYA 4ZY5A 4P90A 3GCQA 4FSYA 5IMXA 3DK7A 2YM5A 3NVMB 4PMTA 3BEGA 2UZVA 4WSYA 1XWSA 4P7EA 4AS0A 3PXYA 1IEPA 2YCRA 4ZK5A 4BZNA 5AWMA 4XOZA 5FEQA 1YHWA 3QU0A 4WNPA 4RC3A 3MH1A 3CKWA 5AR2A 4BCQA 4BZDA 4Z3VA 4IJ9A 1UNLA 3HMOA 3TUDA 5AP2A 2BDWA 4IADA 3FMKA 3HECA 4KKHA 5HVJA 4L8MA 1TQPA 4NM0A 2OK1A 2GFCA 3PXQA 3GXLA 3L8PA 3AMYA 3SC1A 2YJSA 1ZARA 5KKRB 3V6RA 3R8ZA 1XH9A 4Q5EA 4XBUA 4ZXTA 3Q9WA 3BV3A 2GQSA 1W0XC 4KRDA 3DOGA 4RIYB 4ZMFA 2RFNA 2QNJA 3QQJA 2XJ1A 3FPQA 4G3DA 3TI1A 2Z60A 5HE2A 4O21A 4ENYA 4IVCA 4R1YA 3HMNA 5FM2A 4F9BA 4CYIA 2Z2WA 3I81A 4KNBA 4I21A 4YLJA 1FVTA 5AV1A 5CU3A 4E6CA 2IN6A 3EKNA 2VTIA 1XBCA 2QLUA 4UMPA 4AN3A 1Q99A 1UVRA 4TWCA 4DBNA 3UQCA 4YTIA 4HGTA 2F57A 5BVEA 2NNWB 4R6VA 2YZAA 3Q2JA 5L2IA 1Q8UA 3IDBA 4DEGA 4DFZE 3C0GA 4RIWB 4MKCA 3UIXA 3WARA 2X6EA 5A9UA 4ZEGA 3LVPA 1FQ1B 3ZHPC 3G15A 4OBQA 5JEBA 4I94A 5AAFA 4FVPA 2R0IA 1MQ4A 4ZSAA 3C0HA 4O1OA 2YZLA 5D7VA 4BDCA 4RG0A 4HCTA 1JVPP 3KMWA 5AV2A 4GVAA 4HYHA 2X1NA 5HICA 1LR4A 3FEGA 3FLWA 4ZS4A 3NUAA 3HVCA 4IB1A 2YM4A 3N51A 4YU2A 2YDJA 3KU2A 3NYOA 3WF6A 4FIGA 4EZ3A 3T3VA 3C9WA 4BWXA 1P4OA 4M66A 3S2PA 3KXMA 3ATTA 4U3YA 3ET7A 4C2WA 3UZTA 3KN6A 3G0EA 3A61A 3TJCA 2VTRA 5CQUA 3JYAA 3TJDA 1OB3A 1Z57A 4MBJA 4N57A 5EQYA 2GNLA 3NUSA 4O6EA 4QMZA 4TN6A 4X3FA 3FDNA 1YXTA 1GZKA 4FTKA 4C33A 1B39A 4EI4A 5FBOA 4E3CA 3MIYA 2QKWB 5G1XA 4BYIA 4EOQA 1WBOA 4G2FA 5H8EA 3ORXA 4FZDB 2QURA 3U6IA 4D1XA 5C8MA 4EOJA 3D83A 4EH9A 2Z7QA 3LLTA 4BCJA 4BGQA 4FUYA 4FKQA 4ZOGA 2ITZA 5FWKK 4O7WA 2WQMA 3VRYA 3KA0A 2YACA 5FDPA 4D9UA 2B54A 1R78A 3KVXA 4C34A 1P2AA 4UN0C 2EB3A 4RA5A 3UBDA 4CMOA 3DNDA 3EQGA 4I4FA 2XNGA 2X0GA 4QQ5A 3ZH8A 2OXXA 5J7HA 2W1IA 2OG8A 4MXOA 4GJ2A 4V04A 5ANEA 1REKA 3UG2A 4DEEA 4CG9A 5IUHA 3SRVB 1QPJA 1ZXEA 1PMNA 5T68A 2XKEA 5F9EA 5AR7A 1YI6A 3BEAA 4FEQA 3K2LA 4NCTA 3PSBA 4FUXA 2ZV8A 2UZTA 4M0YA 4A9TA 4BI0A 4BB4A 2J6MA 4YTFA 1G8AA 2E9UA 4BGHA 4G3FA 5HBJA 3F2RA 4LYNA 4RIXB 1XH7A 1MRUA 3OF0A 5EKNA 4CV9A 2YN8A 4MBIA 5M09A 4FT3A 2J0IA 2BCJA 4BDEA 4RC4A 3QD4A 4CKIA 3F88A 5A14A 3F2NA 2VTTA 5JK3A 4BY9E 5IH5A 4AXAA 5B2LA 1URWA 4AA0A 3QUEA 3CTJA 4ASXA 2V22A 3RAIA 3BLHA 2V0DA 3F5GA 1A9UA 1GY3A 3PLSA 5J95A 5ANKA 3DK6A 1M7NA 4FEWA 4QP4A 4L3JA 5AM6A 3DJ5A 4PUZA 2XUUA 4X21A 3R8LA 4O38A 3C51A 4YMJA 2X8IA 4AN9A 2RFSA 1YXXA 4XP3A 5TR6A 4DGMA 3BI6A 4FSQA 1J3HA 5DH3A 3EQRA 4NSTA 4AG8A 2QOCA 5A4TA 4FTOA 2ZDUA 1K2PA 4L52A 5M56A 3HRFA 3AC5A 3AMAA 5D9HA 5IQIA 2UUEA 3HV5A 3EOCA 5GJFA 3LCDA 3MV5A 3G5DA 4LOOA 4IX5A 2VX0A 3RK5A 4JDIA 5HESA 5J79A 3UO5A 4GIIA 2W05A 3ZLWA 2VTOA 4JT3A 5KUPA 3PP0A 3IW5A 1NY3A 2OIBA 5FTGA 3JVSA 3ETAA 3FMJA 3F3TA 1LPUA 4GFOA 5AJQA 5DGZA 3F9NA 4JIAA 2IVTA 2BHHA 1U59A 1QPEA 3WOWA 3A99A 4L00A 3LFEA 3TKUA 3OOMA 2F4JA 1RDQE 2YIRA 4IWQA 4QMLA 2BRGA 2G01A 1UNHA 2WQOA 3C5UA 2H96A 2WAJA 5CEPA 2UW8A 2XIXA 2OJIA 2VNYA 4BI1A 5EDQA 3BYVA 4MWHA 4PDPA 4WHZA 4ZIMA 3FQEA 2P0CA 3RM7A 1YRPA 2Q0NA 2PMIA 4G9CA 1JAMA 3CQWA 3NUNA 5D10A 4B9DA 2OBJA 5KMJA 3NW6A 4D58A 2OWBA 3W2QA 4APPA 5BUEA 3PXFA 4JR7A 4RQKA 2VO7A 3DJ6A 5CQWA 5DT0A 3ZLYA 4XH6A 3ZMMA 3FL5A 5KHWA 2ITXA 1YWRA 5M57A 3E7VA 3QRTA 4QMPA 5KMKA 5CLPA 3SG8A 3GC7A 1FGKA 3RKBA 4M97A 3HMMA 2OZAA 5AUYA 3O51A 2JIIA 5CAUA 5M4FA 3E8DA 2ERZE 1NVQA 4G34A 4L6QA 3D15A 5HNBA 4HVSA 4FV3A 3RTPA 3TNQB 4I24A 2C5VA 3RK9A 3V51A 2ZM4A 4U3ZA 3EQFA 3OFMA 4R1VA 2ZDTA 4FZ7A 4GT5A 4S30A 5EW9A 2YM6A 4R7HA 4BDHA 1PRYA 2VWIA 3QQKA 5H2UA 3VF9A 2I40A 4MK0A 4EYMA 1PXMA 4GV1A 4FOBA 3AQVA 2F49A 4ITJA 3VC4A 2PVKA 3CBLA 3QC9A 3DAKA 4CXAA 2I7QA 2PZ5A 1JNKA 3FLNC 2VGPA 3RAHA 3TCPA 4JXFA 2YAAA 3B8RA 2O65A 4XX9A 3N4UA 2HZ0A 3HA6A 3IGOA 5GIPE 3L9PA 4D2VA 2UVZA 5KE0A 2QOIA 5CSVA 3H9RA 3OP5A 5LVPA 5FXQA 3FXWA 3E63A 2ZMCA 4FKJA 1A48A 1H24A 4FYOA 4IAFA 4FNZA 2X7OA 4MHAA 3VHKA 5IU2A 2CNUA 3ZBXA 4DG2E 4IWPA 5TF9A 3R2BA 3GNIB 4OTFA 5HO8A 2SRCA 2PVLA 3GCUA 4PMMA 2A1AB 2O5KA 4EH8A 3MY5A 3HKOA 3UMXA 4XCUA 1RE8A 2PE2A 2OO8X 4O0RA 1H1WA 1XH5A 4FT7A 2QO9A 4N6YA 4QMWA 4RVMA 2IW6A 3LCTA 2EXEA 3WF9A 4YHFA 4G1WA 2HENA 4LOQA 4J98A 3LQ3A 2CN5A 2JDSA 3TWJA 3PPZA 2X2KA 5EYKA 3UZPA 3ORMA 4CD0A 3LQ8A 5F95A 4QP9A 5AV0A 5HCYA 4XG9A 4FZ6A 1ZYLA 1DAYA 2XCHA 3LFNA 4FNWA 3C13A 3PLAE 3D9VA 3G0FA 3CPBA 2PVRA 3E7OA 4S31A 3R8UA 3CY3A 4X2NA 4G6LA 3ZBFA 4DH1A 4FSMA 5AR4A 3I0OA 2UZDA 3FC2A 4I4EA 2IWIA 4C3FA 4F09A 3TN8A 1NT2A 4JDHA 1W83A 3LFQA 5LJJA 3ZOSA 5LVOA 3OBGA 5BVKA 3ORTA 5I9YA 4FKWA 4TYHA 3KB7A 3CQEA 1HCKA 2YIQA 1RQQA 3TT0A 4QNYA 2OXDA 3RI1A 4ZTNA 2Q83A 4O7NA 4R7IA 3OXTA 5KO1A 2QC6A 2WMTA 2CHLA 1JSVA 3DV3A 5IUIA 5LMKC 3ZFMA 1Y8GA 1J1BA 3BHVA 4IX3A 3S3IA 4GG5A 4G5PA 1PYEA 4Z7HA 1OKVA 2UW4A 2VO0A 4M8TA 3W8QA 5EW8A 2JIVA 4K0YA 3RBWA 3GU6A 4XYFA 5KKRC 4HYIA 1OIRA 4FEXA 1Y6AA 3R9HA 3RPRA 4YSJA 3PIYA 4G9RA 4RQVA 1OL7A 3KGAA 3VUMA 3EFWA 4RFZA 2W9ZB 3EZRA 4LMUA 3NW7A 5GZ8A 2VGOA 2XS0A 4HGSA 2QODA 4R3RA 4RLLA 3IW4A 1FPUA 3B2WA 4GU6A 5T3QA 4FIFA 1LEWA 2YIXA 4MXZA 5J9ZA 2X9EA 5HE0A 2VWBA 4MEDA 1ZYDA 1WVYA 3FLYA 4KS7A 5E8UA 4NL0A 3DU8A 4JR3A 3FLZA 3EKKA 3FZTA 3QRUA 3NRMA 4YNEA 4OTIA 5ETIA 3TNWA 5AP3A 4O86A 1FMOE 2ZMDA 5E8ZA 3T9TA 5CX9A 2IPXA 1YQJA 4DEBA 5CZIA 2UZEA 2ZB0A 4FTUA 4IWOA 3TZMA 4ZTRA 1BUHA 4IDTA 1H07A 2H6DA 4USEA 1SVEA 5FRIA 4QMXA 3R1SA 3GUBA 4HZRA 4XMOA 2F9GA 4YC6A 2ETKA 3FMMA 4ACMA 4OTDA 1TKIA 2R3IA 5IKWA 3K3IA 3QHRA 4UWBA 4GT3A 5HIEA 4WRGA 2O3PA 2IZSA 2WHBA 1GZNA 3R1QA 4RGJA 3K3JA 3K5UA 4HPUE 1YXVA 5LWMA 3UOKA 4AWIA 4IZ7A 4MYGA 4Y85A 5IQEA 3TNPC 5DT4A 2PVMA 1REJA 2GNIA 3FV8A 3NWWA 4FTQA 2JBPA 3RP9A 2QR8A 4CFFA 4H05A 5IQDA 3BQCA 4Y72A 3Q6UA 2XIYA 4MF1A 1VJYA 5HE3A 4OT6A 2IW8A 4A9YA 4AE6A 3ZSIA 5K5XA 2A0CX 2I0YA 4JG8A 3LFDA 4OAVB 4J71A 4OTPA 3AC3A 2JBOA 3R73A 3VUDA 4ANLA 4F1TA 5A4CA 2XK8A 1ZAOA 4B8MA 3FHRA 5LVMA 4IC8A 4KWPA 5HTCA 1KE6A 1ZWSA 4QMUA 3OEZA 3NNVA 3KVWA 3F66A 3C4WA 4G16A 4YBKA 4C4EA 4QYHA 4U41A 2OH4A 3VUGA 1V0PA 5KMIA 1OITA 3QXPA 3GENA 1NVSA 5LCKA 5HI2A 3LXPA 1WBNA 2X4ZA 4XG4A 2GFSA 4LL5A 3U87A 3NCGA 5GJDA 4C38A 2QI8A 2F7EE 4ENXA 3TL8A 1IAJA 1NW1A 2R0UA 4ALWA 2W4JA 4I20A 2ONLC 3ZM9A 4E6QA 3QCYA 2XRUA 4IDVA 4C4FA 2C5NA 2ZVAA 4GT4A 2CLQA 4GYGA 1WZYA 4OTGA 4A06A 2W06A 5ETCA 4AF3A 4ZY6A 4EOLA 2J0KA 4JNWA 4XOYA 2BMCA 2VV9A 4OTWA 5DR9A 4AU8A 1OUYA 4G17A 3UG1A 4QMOA 4EYJA 5AAEA 5BPYA 1M52A 5BX0A 4BTKA 4XV1A 3WIKA 1SMHA 3QTXA 4MAOA 3TTIA 3DK3A 1H01A 2J0LA 5M08A 5KMOA 4FTMA 3VNTA 3ZEWA 4IMYA 5IA1A 3DXQA 4MQ2A 1Y6BA 1ZYCA 2QONA 3GC0A 3MN3A 4NTTA 2HY0A 2OH0E 3GP0A 4FV9A 3TV7A 4DITA 3LKMA 3RAKA 3Q9ZA 3ZZWA 4EQUA 4L42A 4PL4A 3Q5IA 4PX6A 2QU5A 3UP7A 1QCFA 3R71A 4JI9A 4D5KA 4KB8A 4EHZA 4FKLA 4Q9ZA 5JZNA 4ZTSA 3PIZA 4AGCA 2B0QA 4I6FA 5DEYA 3ZC6A 1YXSA 4FV7A 4AA4A 4IX4A 2VTSA 2DUVA 4W8EA 4EOKA 2YIWA 3CTQA 3LMHA 4L9IA 2WQNA 4ZTLA 2QOKA 1OMWA 3FHIA 4WT6A 3AGMA 3OWPA 5ANGA 5E8YA 2GNFA 4ZP5A 3PE1A 1U54B 4DLJA 4MCVA 2FUMA 1U5QA 3KQ7A 4RJ3A 3MH2A 3FQHA 2X2LA 2YABA 4CFNA 4W8DA 4RJ6A 3VN9A 5A4QA 3FQSA 1YKRA 2HWOA 2OGVA 4U42A 4IW0A 2XH5A 2B1PA 4FSZA 4CKJA 4U44A 5HGIA 3MTFA 5LMKA 4FR4A 3KULB 4DH5A 2X4FA 2C30A 2BALA 2ZAZA 3FL4A 4YJOA 5TE0A 3V5LA 4BFMA 3SDJA 5AA9A 4O7RA 3K5VA 3QKLA 4X2GA 5AA8A 3IECA 3RWQA 5IA3A 1UKHA 4PNKA 5M4UA 3FZRA 4AGDA 4CCUA 1Q8YA 2GCDA 2NP8A 4QRCA 4YHJA 4EH5A 4RIYA 3P08A 3RINA 2XBJA 2F7ZE 3TIZA 4G3EA 3U54A 2JDTA 1M17A 4RC2A 3FSKA 2ZYBA 3LJ0A 5C8NA 1XH6A 3SG9A 2VTQA 4BIDA 4UMUA 4UWYA 2XNOA 3PUPA 5CU6A 3UODA 3OEFX 4IB5A 5HG9A 4EKKA 5A46A 4U81A 3U51A 4DEDA 3T9IA 1Q8TA 3R7OA 4IFGA 3FMHA 5AIKA 3AGLA 4TNBA 5HG5A 2FYSA 4TPTA 4E5AX 5AP4A 4EBVA 4HJOA 4CVAA 2R3RA 3VF8A 2P2HA 4XRLA 3AT4A 2C69A 3OCBA 4G3CA 1H00A 4FTNA 3FMLA 4NH1A 3DDQA 3PA5A 3WF8A 4ASDA 5HLNA 2BAKA 4RIWA 3TNIA 4EEVA 5JGDA 4Y46A 3UGCA 3LW0A 4YPSA 5EYDA 4PP9A 5K9IA 3VS2A 2AYPA 4PPAA 3UPXA 2YFXA 3D7TB 4Z9LA 3FKLA 3VAPA 4ASZA 1H8FA 3ZZEA 5HCXA 4ZSJA 2QVSE 4QYFA 4JQ7A 1YDTE 2YIYA 3RM6A 3TACA 3W2SA 4QMTA 4RIOA 4F6UA 4RX5A 3R02A 3ZS5A 4EH2A 2VU3A 2W5BA 4EQCA 4XP2A 3RALA 3FY0A 3LFFA 3D2KA 2PU8A 3OW3A 4FSTA 2ITYA 3E87A 4DGOA 4DTBA 1JWHA 1PF8A 2C3JA 3GOPA 1Q24A 2O2UA 1M7QA 4E5BA 3JR1A 3ALOA 4RZVA 5CAVA 2VWZA 4D2TA 3QQUA 4LGGA 2CGVA 3OG7A 2QOHA 4NK9A 1QPDA 2JDRA 2UZWE 4RSSA 5AP0A 1DI8A 2XMYA 4S33A 5C01A 3PPKA 3UQGA 4I5PA 1YI3A 2FO0A 3QUPA 3WI6A 5HNGA 2WTJA 1PXPA 2BRHA 3A4PA 4FZFB 3BE2A 4GK4A 1P4FA 4RVLA 2X8DA 3BBWA 4BI2A 4BCFA 3P7BA 2G2HA 3QHWA 2FH9A 3MH3A 4JG7A 3L9NA 4L67A 4FYNA 4CV8A 4DT8A 2B53A 3U8WA 1OKYA 2BZKB 3OMVA 4FICA 4S34A 2J9MA 4RLKA 2OXYA 3W33A 4APCA 1E1VA 4K33A 3KRXA 3Q60A 4HCVA 4BCKA 3IW6A 5F20A 3CP9A 4DFNA 3FMEA 3SRVA 4J8MA 2CN8A 3OY3A 4W9XA 4C58A 1YOLA 1Q4LA 3ORPA 3NUYA 3LCOA 4GS6A 4OBPA 4JOAA 2H8HA 3CJFA 4H39A 3PP1A 5IZFA 4C4JA 4ZTHA 4B6LA 1XH4A 3A7IA 4TWOA 4EK8A 5BUIA 4J53A 4RIXA 5IEVA 3D7ZA 3N4VA 2OIQA 1KSWA 3I7BA 5IA2A 2WMQA 4BKYA 4YZ9A 3CEKA 5J5TA 1LUFA 5I3RA 2ZV7A 3UQFA 1XJDA 3D4QA 5HG8A 1OL5A 3WZDA 4O6LA 5TKDA 3ID6C 3LMIA 2X7FA 3LJ1A 3FJQE 3KRWA 3NIZA 2C6DA 4I6BA 4NKAA 4TW9A 5CVGA 4YZNA 4AT4A 3H4JA 3SV0A 2C6EA 2VX3A 1WCCA 4ACCA 3KMUA 3PZEA 2VWYA 3SD0A 3R7YA 5CF8A 4X6RA 2BAQA 3VULA 3QZIA 4FKPA 2LAVA 1H1SA 1H1PA 3QTQA 5HHWA 3UOJA 4RJ4A 5HORA 4FG9A 1R3CA 3V5WA 3LXLA 3MA6A 2CLXA 4IANA 2NPQA 3QTRA 3C4EA 4A7CA 4ACHA 5ICPA 3RNYA 3E5AA 2W99B 4DGGA 2B9HA 1BL6A 2BROA 2PVFA 4FTTA 4C4IA 4PMPA 2HXQA 2W1FA 1PXOA 4JDJA 3VHEA 4NFNA 4FVRA 4CFUA 1DAWA 2BRBA 3A7JA 4C57A 5CF4A 1P5EA 2W1HA 2OJ9A 1WVXA 4I6HA 2JAMA 4C8BA 5CF6A 3I4BA 4MNFA 4IVDA 4ZLOA 4JBVA 5LWNA 2E2BA 1OPJA 5GINE 4GEOA 4DG0E 4QOXA 3A7GA 3NAXA 5GNKA 3F3WA 4CG8A 4QPMA 2PVYA 4TWPA 3KKVA 2BKZA 5DOSA 5IDNA 4RVKA 2UZUE 2YISA 3CCNA 3C50A 4AZWA 4DC2A 3N4TA 4FSRA 4QP8A 4F65A 3ZXZA 5F4NA 1P14A 5FTOA 4B8LA 4YZCA 4PDYA 5F94A 3R8VA 3QRIA 4CYJA 3IPHA 4QYGA 4LFIA 5ANDA 3UTOA 3I5ZA 4E4XA 3W2PA 2Z02A 2JKKA 5IF1A 2C1BA 2R3NA 3HA8A 3U9CA 3DDPA 4MBLA 3RCDA 2R3FA 4H3QA 3PJ8A 3S95A 2NRYA 3OOGA 5ITAA 4UY9A 3DKGA 3E8EA 5JRSA 4AZEA 2ITUA 4C36A 4UYAA 3RMFA 4PL3A 1T46A 4EH4A 5EDPA 3BWJA 2PSQA 1K9AA 2BKKA 4MH7A 1Q61A 5BQ0A 3LZBA 2XK3A 3KN5A 1H0VA 4OBOA 5EYMA 4D4SA 4FKVA 2V7OA 1KV2A 2CGWA 2RG6A 4R3CA 2W4OA 4AT5A 4FV4A 2BRMA 5E8TA 4BVUA 3GVUA 5IQGA 3FYKX 3OXIA 4XHKB 4FSUA 5E8XA 3V3VA 4CZYB 4D9TA 4J96A 4XG3A 4FSWA 4GKIA 4ZS0A 3G2FA 4K9YA 4EHVA 1O9UA 4EUTA 1IRKA 4R5YA 1OPKA 2GTNA 2JITA 2PE1A 3UOLA 3E88A 2R3MA 2WMSA 2WTDA 3MWUA 2WMBA 3Q32A 3C1XA 1BX6A 2Y7JA 1YHSA 3Q9XA 4IH8A 4LGDA 4XJ0A 4B7TA 4XNEA 3PY0A 3DLSA 3UOHA 3ZU7A 4HW7A 2KULA 3SLSA 2HZNA 4LMNA 4IB0A 5IMEA 3TEIA 4HCUA 3MBLA 3KY2A 3IQ7A 3TKHA 3WZUA 4F0FA 5L8LA 2ESMA 2UW5A 3HGKA 4O27B 2FSOX 4DH8A 3MIAA 2ITOA 2R2PA 3BX5A 3QLFA 2W4KA 4D2RA 4WIHA 2PUNA 1HOWA 3QL8A 1W98A 3FAAA 5HVYA 5IQHA 4CNHA 1PY5A 5DFPA 5D7AA 4TXCA 4IFCA 3P23A 2C6IA 3DZQA 5CEIA 3H30A 3PPJA 4YP8A 4DGLC 4U79A 3DCVA 5BVDA 4F9WA 4JBPA 2C6LA 3VS6A 5IISA 1PXLA 4RZWA 4DEIA 3VW6A 4ANNA 4H3PA 2XKFA 3IKAA 4HVGA 4USFA 4H3BA 4NM5A 3VW8A 5JFVA 5DN3A 5A4LA 2OIDA 4UV0A 5FEEA 3QTWA 4ZSEA 4GW8A 3ROYA 1IG1A 4M84A 5EOLA 3DT1A 1APME 3BKBA 5H8GA 2R3PA 2HIWA 4BHNA 4I0SA 1UA2A 2RL5A 3LFAA 3QX4A 4WA9A 5CEMA 2XNNA 3AT3A 3RCJA 2WNTA 3JY0A 3KRRA 3BELA 3OHTA 1UU3A 4PPCA 3COIA 1ZRZA 5HQ0A 5JKGA 3VS1A 1GIJA 2ZM3A 3GCSA 3OWLA 4BDIA 3GT8A 2QO2A 5CS6A 3W2RA 4BDKA 5M07A 3PSDA 3ACJA 3QX2A 4ZLYA 1A06A 2J5FA 4O7TA 4NUSA 3AD5A 5AX9A 1UNGA 4PTCA 4G3GA 3CQUA 5FDXA 2W9FB 5DNRA 4F6SA 4M69B 4HVDA 2AC3A 1W8CA 2XJ2A 3O8UA 4ZZOA 3GEQA 4D2PA 2VTJA 2J0MB 5DPVA 1H1RA 4FMQA 3FXZA 2F7XE 3PDTA 2PE0A 3SW7A 4DCAA 5JGBA 4L3PA 2HK5A 3CD3A 1ERKA 4C0TA 3F7ZA 2E9OA 4YHTA 3ZYAA 4CT1A 4QQCA 4BDGA 3KXHA 5CTPA 2R3GA 2ITPA 5AUTA 4IX6A 4IE9A 1OIUA 2G1TA 1KOBA 1Q3WA 3NLBA 2XEZA 3W55A 3D14A 5BUJA 4PWNA 2YLEA 3F5PA 3L8VA 4C7TA 2CPKE 2ETRA 3FLSA 4QPAA 4I41A 2ZJWA 4S2ZA 3RGFA 3C4ZA 4O0YA 3DLZA 4CMUA 3Q4TA 1CMKE 2UZBA 3BRBA 3QCXA 4O2PA 5KCVA 2F2UA 2XK7A 1PMVA 5A4EA 2PPQA 4NFMA 3ZO4A 2JEDA 2W5HA 4F7JA 4AW5A 3ZO2A 4RWKA 3FBVA 4QP3A 4BCIA 2YM8A 3HMIA 1J7UA 5LARA 4N6ZA 2CGXA 4OW8A 1KE8A 3FPMA 3ZO3A 3GFEA 2XCKA 3QCQA 4I0RA 3UDBA 4XG6A 4U45A 1F0QA 2YAKA 1FGIA 1JSUA 3ZLXA 4F4PA 4R7BA 5HBHA 3SQQA 2UVXA 4C59A 2VTPA 1F3MC 5E8SA 1Q3DA 3NS9A 3KC3A 2G15A 4QD6A 4RMZA 5E1EA 2O8YA 3BCEA 4DLIA 4E6DA 4ZZNA 5I0BA 3NIEA 4GSBA 5E90A 5I9WA 3R01A 2REIA 2ETMA 2VWWA 2WFYA 4G5JA 4BF2A 3EB0A 4BYJA 4IVAA 3WILA 3MFSA 1JKKA 1GIHA 1LP4A 3OS3A 4IAKA 4UYNA 3VBTA 4WBBB 3O71A 2DS1A 2EWAA 4U8ZA 5JT2A 5CI6A 2GDOA 2YDKA 3KXZA 1OIQA 3UYTA 4FX3A 3I79A 1IR3A 2F2CB 3BHYA 2C5XA 4CZUA 4ZY4A 4QP1A 1STCE 3QGYA 1H25A 4XV2A 5F1ZA 4O84A 2R9SA 4ALVA 3SHEA 2WMAA 4QMYA 4ACGA 3O8TA 4EHEA 3EYHA 4XUFA 4AE9A 2O63A 1BLXA 3EZVA 3RPOA 3HAMA 3KL8A 4YUQA 4V0GB 4X2FA 3SOAA 4FNXA 1BI8A 2GNHA 4GMYA 3OUKA 1KUTA 2RFDA 4RBLA 4MD8E 3LFCA 4RA4A 3TIYA 4BIEA 3MYGA 4WG4A 2W5AA 1M14A 3ZUUA 4IWDA 4ID7A 5DT3A 2WTIA 2DYLA 5HBEA 3D5WA 2OJJA 5I3OA 3G6GA 4EORA 2Q0BA 4FT9A 2E9NA 3P78A 2YWVA 2GHMA 2W1CA 5FLFA 3HP2A 5CZHA 4EK6A 5I9UA 3LIJA 3DB8A 2ZV2A 4DEAA 4AN2A 3FWQA 3G90X 4D2WA 3DFCB 4LG4A 4HOKA 2WQEA 5GJGA 5L6OA 2YWPA 5HU3A 2R7IA 3RAWA 4U5JA 4MTAA 5HLPA 5AR8A 5IEYA 5EI6A 3AC1A 3BU6A 3V8SA 3HX4A 5K5NA 4HNFA 3JPVA 5FP6A 4EOIA 2PTKA 3EQPA 4KABA 1OL2A 1R0EA 3NZ0A 3CY2A 4CFXA 4FV0A 4Q9SA 1NA7A 3EN9A 4TKSA 1Q97A 3PXRA 2PK9A 3G33A 4U80A 4NJDA 4Q5HA 5EK7A 2VN9A 4YJPA 3EH9A 4G6OA 5CT0A 3P5KA 4K1BA 4NT4A 4AFEA 5CEOA 4GL9A 4UB7A 3BHUA 3JXWA 4CZTA 2QOQA 3FKOA 4FBXA 3ANRA 3DS6A 4JAIA 4MD7E 5DI1A 5HE1A 4ANOA 4EOOA 4F63A 3ORIA 4JRVA 1OUKA 4JIKA 4Y5QA 3ZUTA 4F08A 4YZMA 4EKLA 2B9FA 3I6UA 4P4CA 3OC1A 2X7GA 4FEUA 4X2JA 2HW7A 2XNBA 1WBTA 2IZTA 3HDMA 3L8SA 3ODZX 4FSNA 3H0YA 3TDWA 3FZ1A 2CNVA 2PWLA 4YJNA 4QMSA 2OU7A 2BTRA 1SVGA 3NEWA 1ZOHA 1XQZA 4NJ3A 2HYYA 1KOAA 2YITA 2WU6A 2BFYA 4IM0A 3P7AA 5L8JA 4PDOA 3U4WA 2C0TA 4GVJA 5E1SA 4E93A 3IW8A 4TY1A 4HYUA 3O23A 4YZDA 5C4LA 3GU7A 5E91A 2XKCA 3JY9A 5FBNC 1FVVA 4PV0A 1Q5KA 3AC4A 2OFUA 4WSQA 2YM7A 3DGKA 5H9BA 5CALA 4LV5A 2JAVA 1JQHA 5BVOA 3DQWA 4ACDA 3LJ2A 5LOHA 4M3QA 4BHZA 3QQLA 4ZTMA 2WMXA 3VUHA 2WOUA 1B38A 1Z9XA 4JG6A 2JIUA 3AG9A 5M55A 3W8LA 3GCVA 3MPMA 3OCSA 2PMOX 3DAEA 4C4GA 3H9FA 5AV4A 5AAGA 3BV2A 1U4DA 3UIUA 1U54A 1IA8A 3WE4A 2UW3A 3BPRA 2QU6A 3II5A 2OLCA 2C1AA 2IVSA 2BIYA 1VYZA 5EHOA 2W7XA 2VWVA 5EM7A 3PIXA 4D4VA 3OXZA 4UZHA 2VD5A 3NNXA 5JQ8A 4YSMA 3ZCLA 5CSXA 1U46A 4BWKA 4USDA 4Y5HA 5D41A 5C4KA 2OZAB 1UV5A 2ITVA 3KULA 3WF5A 4MF0A 3GGFA 4QTCA 3QQHA 2B55A 3PZHA 1H1QA 1CM8A 1E1XA 1WVWA 3HYHA 3S1HA 5DYJA 5ACBC 4RJ5A 1WBVA 4A9SA 2HZ4A 3VVHA 2BZHB 4A4OA 3Q3BA 1ZYSA 4FKOA 3HMPA 5DEWA 4X6QC 2FA2A 4QMVA 2WTCA 3R28A 5DBXA 4BL1A 3FC1X 4KIPA 5L6WL 5EG3A 2GS7A 2Z8CA 2J0JA 1W82A 1DM2A 1AQ1A 5CSWA 5FM3A 5LVNA 5AUVA 3PFQA 3QTSA 3ACKA 4X2KA 4I5MA 3CTHA 5J9YA 1PXIA 3NGAA 2BILB 2XP2A 3GFWA 5DLSA 3MJ2A 3E8NA 4FKTA 1ZOGA 2I1MA 4K2RA 3DTWA 5B7VA 3VBVA 3C4XA 2VTLA 3HUCA 5CY3A 2R3KA 3AT2A 4PDSA 4LM5A 1MQBA 5L2TA 4OLIA 2A2AA 4YTCA 1CKIA 3ZFYA 4CSVA 1RW8A 4MD9E 4V01A 3D94A 3R00A 3F69A 3PWYA 3LHJA 1S9IA 2VTMA 3E3PA 4DGNA 4WUAA 4A4XA 3AC8A 4GUBA 3VUKA 4DHFA 4RJ7A 2W96B 4GCJA 4U9AA 4YZBA 4BDFA 3RPVA 3QYZA 3REPA 3VRZA 3TKIA 4LL0A 4G6NA 1GNGA 4IIRA 1H0WA 3D7TA 4OT5A 5AP5A 5L4QA 5BMSA 2QHNA 3QZHA 3K54A 4BDDA 5JFXA 3ZDUA 5EM6A 5C26A 2ZOQA 2R3JA 2HELA 3EJ1A 4CGAA 3ZUVA 1CSNA 4QQJA 1YW2A 4Y83A 4F9CA 1YHVA 4EC8A 3VBYA 4BDAA 3KFAA 3PSCA 3R1NA 4JX7A 1VYWA 1CKJA 5CWZA 3O8PA 3GU5A 3BU3A 3FXXA 3EQIA 4EJNA 1IA9A 4BICA 1ZY5A 3FI2A 3ULZA 1VEBA 4E8AA 5M53A 4I3ZA 2YJRA 2YEXA 5ACKA 5JN2A 4L7FA 2EXMA 4UMRA 4TYEA 3UZRA 3RK7A 4DFLA 5M4IA 4NIFB 4XV3A 1YDRE 5B2KA 5L2WA 3SW4A 4L44A 4XP0A 1ZLTA 1CDKA 4YPDA 4E6AA 3A8XA 4TTHB 3KK8A 4YC3A 2XK9A 2Y9QA 3Q9YA 2BDJA 5J7BA 3N9XA 4U40A 5CNOA 1KE7A 4J8NA 4A9UA 3OUNB 4C62A 3PVWA 4GFMA 4UXQA 3ZLSA 1YVJA 3ZTXA 2C47A 4DG3E 2YA9A 4CQGA 4CTCA 4F6WA 3NVKI 4TYJA 4FOCA 2UZNA 2AC5A 4MQ1A 3O0GA 3IOPA 3BHTA 4EONA 4GG7A 1M2RA 1R1WA 3R6XA 5DHJA 5CI7A 2OI4X 3LXKA 4BTFA 4O2ZA 4OTRA 5JMSA 3DKCA 4EH6A 5DE2A 2BUJA 3R8PA 5T6KA 4ASEA 2HWPA 3GU8A 4IB3A 3QALE 2CSNA 4CTBA 5BNJA 1CTPE 5L8KA 3GB2A 3CIKA 4IC7A 3P4KA 3ZXTA 4F70A 1V0OA 2W1DA 1M2QA 4KS8A 4JX3A 4O82A 3I1AA 4F7SA 1SYKA 3TDVA 2VWXA 3V5TA 3ZRKA 4BIBA 3R21A 5A54A 3BYMA 3E8CA 5E92A 5EHYA 5JGAA 4UXLA 4ZJIA 4EHGA 3QF9A 2XNMA 2C68A 2XF0A 2BHEA 3DKOA 3LFBA 3EL7A 5LMBA 5KMLA 4ANQA 3KCKA 3F7WA 2VTNA 4J7BA 1WFCA 4JBQA 4LV8A 3ZM4A 4QYEA 2IG7A 2QO7A 4C37A 4D0XA 3NUPA 4EQMA 5HTIA 2PUUA 3RPSA 4O7SA 1FVRA 5HEZA 2V7AA 3E93A 5LQFA 4MX9A 1PJKA 3OZ6A 4PL5A 1FMKA 3IS5A 3POOA 3OY1A 2QOOA 4AZFA 4GIHA 4TRLA 1YOMA 3MPTA 4M7IA 2RF9A 1H08A 4IXPA 4O0SA 5JSMA 4KAOA 2GSFA 3PY1A 5KNJA 2WMWA 4BCPA 3HRCA 2ZV9A 2Z7RA 3FMDA 2BFXA 5BYYA 3DBQA 4EOPA 5C03A 4K18A 3G9LX 3M11A 3DB6A 4D4YA 2G2FA 4M68A 4L01A 4WD5A 3DZOA 2OJGA 4PRJA 5D1JA 3KXGA 1L8TA 4AQCA 4NKSA 4B99A 3U6JA 1SZMA 3AC2A 4G31A 3UVPA 5M51A 2RIOA 5E8WA 1KWPA 5TT7A 4FTJA 4HGLA 4KIQA 2CCIA 2XRWA 1PKGA 1W7HA 3QD3A 4BCNA 4PMSA 2R3OA 5EOBA 5CVHA 2JKMA 4QP7A 4AACA 4BTMA 3C5IA 3OTVA 4O0XA 5EYCA 3PJ3A 2OF2A 1H4LA 5CEKA 1GOLA 3O2MA 3MGYA 4IBMA 3WE8A 3M42A 4TYIA 4BR3A 1O6KA 2PL0A 3CGFA 3PXKA 4HVIA 2HCKA 1UU7A 4WG3A 4HVHA 5KBQA 4LRKA 4YLKA 4O7LA 4LI5A 5L3AA 2WTKC 4QTBA 2J7TA 4XRJA 5J5SA 3HV4A 5HX8A 4M14A 4FGRA 4AUAA 2XZSA 1AD5A 2QOLA 5DRBA 3FI3A 3SXRA 5KX8A 1ZMWA 3FZOA 3KXNA 3ZC5A 3CJGA 4NCTC 1ND4A 5HD4A 4HNIA 2IO6A 1ZY4A 4E73A 4QNAA 4KKEA 3ZSGA 2XEYA 5C9CA 1YWVA 2GNGA 4LUEA 5KZIA 4QMQA 3DXPA 3ODYX 3R83A 2B4SB 4WKQA 3O96A 4F0GA 5HU9A 3QRKA 4H1MA 2J5EA 4FF8A 3EMGA 4A9RA 4FKSA 3FI4A 3ATSA 4PPBA 5H3QA 2OW3A 2C6KA 3EWHA 4PTEA 4YGAA 5IH6A 1OBDA 3SVVA 3CKXA 4ZLZA 2YERA 4KUJA 4WNOA 3W10A 3EN5A 3P86A 4FNYA 3T3UA 5L2SA 4YLLA 5FTQA 1BMKA 3L9MA 4I93A 4BCHA 3BYUA 2J4ZA 5M06A 2ONLA 4AZVA 3VWAA 4AW0A 3L1SA 4WRSA 3QZGA 2VTAA 2EXCX 1Z5MA 4LUDA 4W9WA 3U9NA 3A2CA 4E1ZA 4YR8A 2J2IB 3Q6WA 3VS5A 4D55A 3RVGA 2CDZA 1OI9A 4FV1A 4C35A 1L3RE 3OW4A 3BE9A 4TZRA 4JQEA 2RSVA 2RG5A 4DFUA 2H34A 3OTUA 4CRLA 3UPZA 2JGZA 3QTZA 5L2QA 5DWRA 1QMZA 4N70A 4WNMA 2G9XA 1DS5A 1SNXA 4M0ZA 2ITNA 3COMA 3QTUA 1XBAA 3SGCA 2ZM1A 4EK4A 1UWHA 4EH3A 2FVDA 4KKGA 4YJQA 4K6ZA 1HCLA 3W16A 4QYYA 3CS9A 1DI9A 1I09A 2XYNA 3CLYA 3G51A 4FT0A 3PA3A 4JRNA 5EM8A 3Q4UA 4W4XA 5FG8A 3WZJA 5IPJA 2GHLA 3LM5A 5EHLA 2XA4A 3R1YA 4FGBA 5CSHA 2WQBA 4KINA 3NAYA 3UIBA 3OWKA 2IJMA 2GHGA 4DTKA 3U6HA 4L45A 1ZMUA 3HZTA 5DVRA 2P3GX 1G3NA 3HV7A 3GI3A 4XG2A 2PY3A 4JL9A 2P33A 5CF5A 3F5XA 3T8OA 4JBOA 1RJBA 2GPHA 2QOFA 2Y4PA 3FLQA 4R78A 4M69A 4F7NA 3MVJA 4J97A 1X8BA 4QP2A 2P55A 2Z7SA 4FL1A 5CU2A 4D2SA 3RZFA 4LGHA 2C6OA 1R39A 1VR2A 4IM3A 5D12A 4ANBA 3COHA 3A4OX 4O7YA 4IAAA 3CXWA 4BDBA 3NYNA 2VO6A 2JFMA 2PVHA 4FKUA 4K11A 3SA0A 4XLIA 4U7ZA 3TG1A 5C1QB 4TWNA 2EB2A 3NNWA 2FB8A 4BZOA 4PTGA 5BYZA 4W4YA 1EH4A 5IA5A 3BQRA 3R8MA 4O0UA 5EDRA 3VBXA 3S0OA 4K77A 3ZFXA 5IEXA 4H36A 2X2MA 2XJ0A 3PA4A 2XIRA 3ORNA 4I5HA 4IZAA 3EQHA 4P2KA 3Q5ZA 4LRMA 4F64A 5C27A 3BGQA 4Z16A 4CQEA 4FT5A 5EQEA 4DE4A 1XH8A 4BCMA 3CE3A 4FKRA 4I23A 3ORZA 1OECA 4XG8A 2W1EA 3V5PA 5K3YA 4AFJA 2X81A 5GZAA 4O83A 4R77A 3DQXA 4TL0A 4O22A 1GZ8A 1Q41A 2QR7A 5L6PA 1OM1A 5KMNA 2GS2A 5A3XA 3QWJA 2ITQA 5ANIA 1CKPA 5AV3A 3TTJA 4BDJA 2X9FA 1AGWA 3I5NA 3OT8A 3OVVA 5I9XA 3TV6A 1LEZA 3ZDIA 4JAJA 4UALA 1H27A 5CYIA 4AP7A 2YHVA 3P9JA 3KF7A 1GAGA 2CKEA 3QZFA 3BLQA 3EFJA 4N4SA 2R3LA 5CAQA 4YBJA 2HY81 1IAHA 4UMQA 3B8QA 3VJNA 4AAAA 5KHXA 3P1AA 5AP1A 2A4LA 5G6VA 3VJOA 3ERKA 1XR1A 4FL3A 5E9EA 2E9PA 1UWJA 2JDOA 3DA6A 2PZIA 4KIKB 4WOVA 1Y8YA 3BYOA 5EI8A 5B0XA 3TNHA 5GIOE 4D5HA 1J1CA 5FUTA 3GCPA 5CASA 1XKKA 3FUPA 3AXWA 4B0GA 4D0WA 4PNIA 4FTCA 3GOKA 4EZ5A 5FXRA 1QPCA 3EN7A 4BC6A 2Y4IB 1G5SA 2B7AA 2NRUA 2XVDA 5DR2A 4FI1A 3BGPA 2W17A 3ORKA 3DNEA 4V0GA 2IW9A 2WO6A 1H26A 3QTIA 2IVVA 3HV3A 2UW9A 4A07A 4MNEB 3FY2A 4FKGA 2C3IB 2PVNA 3NYXA 4FODA 4AZTA 4BBFA 2ACXA 3L9LA 5FGKA 2OICA 3B2TA 2A27A 4OGRA 4GU9A 4YJSA 4IQ6A 4C2VA 4FTAA 3FYJX 2YLFA 2BVAA 2V62A 4FTLA 2XNPA 3FZSA 5CXHA 5H8BA 2RKUA 5HO7A 2OJFE 4EJ7A 1O6LA 2Y8OA 4YNOA 4DFYA 5M44A 4O0TA 2VNWA 3R9RA 3IDCA 3L8XA 3UC3A 1NXKA 4YO6A 4ZAUA 4Y73A 3R30A 3EFLA 3FMNA 3SKCA 1BYGA 4TYGA 4CFVA 1OBGA 2R7BA 2QQ7A 2G2IA 3V6SA 3UYSA 1JKTA 3KEXA 4OTHA 2I6LA 2UVYA 3WZEA 4QTEA 3QKKA 3UO4A 3TUCA 2UW6A 1ZOEA 4FVQA 1PMEA 3Q2MA 2XKDA 4DEHA 5AUUA 4ITIA 3VO3A 3LQ5A 3PJCA 5AMNA 5EI2A 2VO3A 3W2CA 5E4HA 5AR5A 3V8WA 2GS6A 2JD5A 2WPAA 2WIHA 4IACA 3JS2A 5HNIX 4IM2A 4AZSA 4OAUC 2CGUA 4CLIA 3M1SA 2QKRA 4DYMA 3PWDA 3A62A 2UZLA 5CU4A 3QUDA 4O7ZA 3O7LB 4V05A 3VS0A 1H28A 4J52A 2C5OA 3QYWA 1YDSE 2GMXA 4IJPA 3RHKA 4YURA 3LFSA 5JFWA 2GTMA 3I60A 4JS8A 4XS2A 3R7EA 1MRVA 3LOKA 4E5WA 4BCOA 5IUGA 2QHMA 3HL7A 2OZOA 4MWIA 1UU9A 2C6MA 3PY3A 3H10A 3KK9A 5JH6A 3FSFA 2OKRA 3V01A 3R7UA 3EQDA 2X6DA 3UO6A 3QA0A 4HGEA 3G6HA 5KZ0A 5J9LA 5FD2A 5FEDA 3ITZA 2Z7LA 4FG8A 2C5YA 2CKQA 4QO9A 2J50A 5EW3A 4O91A 4DA5A 1S9JA 3VUTA 2EUFB 4FTRA 4JLCA 4UMTA 5ANJA 1XHAA 3GU4A 1MRYA 4RPVA 4YTHA 5ETFA 2BAJA 4QQTA 5TOZA 1IASA 3AD4A 1GIIA 3MB6A 4X3FB 4MXXA 3UE4A 3R7VA 3UVQA 1PHKA 4IAYA 3RHXA 5JRQA 4WO5A 4GYIA 5J1VA 2C0IA 2WB8A 3MW1A 4FG7A 3C4CA 4E4MA 3D5VA 1O6YA 2WEIA 3U55A 3MDYA 3LCSA 2PHKA 3TZ8A 4BRXA 2PYWA 5AR3A 4ZSLA 3W32A 2C4GA 4H58A 1MUOA 4EWHA 2IZRA 3SAYA 4RJ8A 5DMZA 4EUUA 5HG7A 5CXZA 1YXUA 2WMVA 4L43A 2P2IA 4M15A 1TQIA 2PMLX 3H9OA 5HVKA 5GZ9A 3GC9A 3LXNA 1J7LA 1GZOA 2WTKB 3V5QA 4DINA 4KD1A 3PVBA 4I92A 2I0VA 4FK3A 5HD7A 2I0EA 3R9NA 2QOBA 1KE5A 4IEBA 5CAPA 4RWIA 4ALUA 2CCHA 4FTIA 4J95A 4B4LA 3MFUA 3THBA 4BCGA 3TUBA 2R4BA 5JZJA 2UW7A 1WBSA 2FGIA 3NPCA 3NUUA 3QCSA 4FIJA 4A4LA 4F99A 4CLJA 2PUIA 1YI4A 2BR1A 3S4QA 4F7LA 4XG7A 1SM2A 3O50A 4RRVA 3WF7A 2Y0AA 3MS9A 4DF3A 5ANOA 4GRBA 1OVEA 3BLRA 2FSTX 3EIDA 3LAUA 2WIPA 2W1ZA 3HNGA 3I0QA 5FQDC 4EK5A 5BVFA 2BTSA 5BVWA 4CEGA 5KBRA 2XBAA 3LE6A 2UV2A 3MVLA 3PXZA 4ERWA 4GUEA 2A19B 2C6TA 4RVTA 2JC6A 4EK3A 2QD9A 3P7CA 1PXNA 3A7FA 2J90A 3IDPA 5LMAA 3SXFA 1Y57A 3IW7A 4C3RA 4KSQA 5EKOA 3SXSA 4QMNA 4BGGA 2WMUA 2JKQA 3TM0A 4KBKA 2VUWA 3QGWA 4DH3A 5DRDA 2C3LA 3ZO1A 4BKZA 3HRBA 4PY1A 4I5CA 2LGCA 3JUHA 4L7SA 4YO4A 3ENMA 3CD8A 5EQPA 3DXNA 3R63A 3EYGA 3QRJA 5IA0A 2B52A 3Q04A 1K3AA 1PXKA 2NO3A 3C4FA 2YM3A 3GBZA 3MY0A 5HIBA 5JQ5A 2EVAA 1PKDA 4IHPA 4NU1A 1BKXA 1VZOA 2PZRA 4DFBA 1B6CB 2V5QA 3CSVA 2IZUA 3EL8A 3QAME 5ETAA 3AD6A 4ZJVA 2OFVA 2R64A 3F3ZA 5E8VA 4ERKA 4C4HA 2FSMX 2I0HA 4AW1A 4O0VA 2B9JA 5J8IA 4NIFA 3HAVA 3UJGA 5FXSA 2QCSA 4H1JA 2C0OA 4DN5A 4AOJA 5IDPA 3AMBA 2HAKA 3E3BX 3NCZA 4PQNA 4O81A 4ITHA 4DAWA 3R9DA 3MB7A 3TV4A 4EL9A 2WTWA 4FA2A 3PVUA 1Q8WA 4S32A 3WBLA 3JVRA 1OZ1A 5AEPA 3F3UA 1KV1A 4FV5A 3KCFA 4NTSA 4UEUA 3V8TA 4ZZMA 4RFYA 3ANQA 4RWJA 4CFWA 2OSCA 3UP2A 3OCTA 4BKJA 5IQCA 2QG5A 4GFGA 2JFLA 4JDKA 4F9YA 5A6OA 1NVRA 3F6XA 5EH0A 4BBMA 3IONA 2YCFA 4U0IA 1BL7A 1PXJA 1ATPE 3A60A 4GK2A 4YJVA 3CC6A 4ANMA 4EOMA 3UIMA 3FZPA 3S00A 4RFMA 4RX8A 3GQIA 2P4IA 4P5ZA 4RX9A 3A7HA 3ORLA 3OBJA 2QLQA 3PG3A 3KXXA 4JVGA 4YJTA 3VS4A 5CANA 5AUXA 1ZZ2A 2YDIA 3U4UA 4M12A 4L46A 2WMRA 3MSSA 2BDFA 2B9IA 3POZA 3I6WA 2BZJA 3ZRMA 3MVMA 3WZKA 3A8WA 2BRNA 5HCZA 4MXYA 4E26A 5HO6A 1J7IA 5K0KA 4F1MA 5HZNA 3EHAA 4NWMA 4IVBA 4O1PA 3FE3A 2BPMA 2R3HA 2VZ6A 4GK3A 3MTLA 4L53A 3D2IA 3DBDA 3RJCA 4FV6A 2UW0A 5CVFA 1BI7A 3V5JA 4EOSA 4WNKA 4FV8A 4FEVA 4QTDA 3V04A 4C02A 3OROA 5EFQA 5BMMA 2W0JA 3QXOA 4O7VA 1M2PA 3C0IA 2WOTA 3F2AA 1YOJA 4D1ZA 4FV2A 5AFVA 3DJ7A 4XBRA 4AT3A 3W2OA 5CT7A 3QLGA 1OL6A 4FIEA 1Y91A 2O64A 4CKRA 3UNZA 3LCKA 3GC8A 5E7RA 4RWLA 2YCSA 5CNNA 3TXOA 4D1SA 3BYSA 2OF4A 3R7GA 1U5RA 4ONAA 3KF4A 3QD2B 1G8SA 3IK3A 5HTBA 5K4JA 2WGJA 2W1GA 3MESA 3VQHA 3D0EA 1WBPA 3VUIA 4KBAA 4CCBA 3ZSHA 1OIYA 5I9ZA 4RT7A 3OD6X 5HKMA 4D4RA 4Z7GA 3E92A 3IOKA 4O0WA 4BTJA 3EQCA 5AUWA 4R3PA 5EM5A 5HX6A 4MXCA 4C3PA 4DFXE 2UZOA 3R7IA 3UNJA 4FIHA 3NUXA 5K0XA 1YWNA 1WBWA 4NM3A 3CPCA 3W1FA 3WIGA 4ZTQA 4AOIA 4OTQA 2BZIB 4U97A 5CSPA 4EZ7A 3ELJA 1JOWB 2Y4IC 3DBFA 3NX8A 4I6QA 3R22A 4U43A 5HIDA 4C61A 5A6NA 2PUPA 1PYXA 2ITTA 2KTYA 3KRJA 4IZ5A 5I9VA 4I22A 5IG1A 3PYYA 4FL2A 2PZYA 5AP7A 4BBEA 4XEYA 5CU0A 5DG5A 3PE2A 3F61A 5IQFA 2HOGA 4JJRA 1TQMA 2VAGA 1E9HA 4FZAB 3BWFA 3NMUF 4YC8A 3MPAA 2GU8A 2FSLX 3EQBA 1ZZLA 5IQAA 3PG1A 2WKMA 3QA8A 2CKOA 3UMWA 2WELA 3MA3A 5CENA 2J51A 1JBPE 4NM7A 3PRIA 3BU5A 4TYHB 4Y95A 4PP7A 2GQRA 5K4IA 1GJOA 2PULA 4X0MA 4CFMA 1URCA 3BZ3A 5LVLA 3W18A 4EC9A 2XM9A 4CT2A 5BVNA 3HEGA 2HZIA 3O17A 4F0IA 4ZMEA 5AM7A 4ZSGA 3I7CA 2QG7A 3QKMA 2JKOA 2VX1A 4Q2AA 2IVUA 3HUBA 4FIIA 3UC4A 4XV9A 3P0MA 1OL1A 3F5UA 4R5SA 5DA3A 3PVGA 3BIZA 3HV6A 3ROCA 3VBWA 2PMNX 4PF4A 1JSTA 2GQGA 2XB7A 4DBXA 4X3JA 2PVJA 2X39A 3NNUA 4BWPA 3DBEA 5CAOA 1QL6A 5IH4A 4CRSA 3VS3A 4N0SA 4NYEA 1KE9A 1JKSA 4WBOA 3TZ7A 3OCGA 4GH2A 3ENHA 1OKZA 4EH7A 4DTAA 3DY7A 3HDNA 2R5TA 3MH0A 3ZRLA 5IQBA 2Y6OA 3KMMA 3ALNA 3NR9A 4K8AA 4HYSA 3VIDA 3R04A 4W4WA 2HW6A 4RX7A 4HPTE 2WD1A 2VRXA 2R3QA 3TZ9A 3IG7A 4MXAA 3ULIA 3KRLA 3CGOA 1WMKA 4Z55A 3COKA 4ARKA 1JPAA 2V55A 2XK6A 4TT7A 3ZONA 1OKWA 3FI8A 2JLDA 3F3VA 5I5ZA 1JKLA 4WG5A 3M2WA 5AIRA 3UVRA 5JFSA 5DR6A 4AA5A 3MFRA 3QBNA 2Y6MA 4OUCA 4I0TA 2RGPA 5AADA 3EN6A 3QWKA 3PRFA 4NZWB 5IA4A 2CMWA 1R0PA 2WU7A 1FOTA 1OGUA 3Q96A 4M67A 1FBNA 2PZPA 5BYLA 3IO7A 4E4LA 3R0TA 4XLVA 4IAZA 3QQFA 1TVOA 2ZB1A 3OT3A 4J1RA 4ZJJA 4L68A 1PMUA 3BGZA 3F82A 3RWPA 3AOXA 3DFAA 3QFVA 2HXLA 2X8EA 4LQMA 3QQGA 5GHVA 1PW2A 2VTHA 5C8KA 4UX9A 4X3FC 4OR5A 1JLUE 2CJMA 3D5XA 4W4VA 3DBCA 3NSZA 2ERKA 3RZBA 5LCJA 4GJ3A 1FINA 2WXVA 5AP6A 1UKIA 5CEQA 5B2MA 1SVHA 3EFKA 1UU8A 4KBCA 4AX8A 4O96A 4QPSA 3MFTA 2ITWA 3Q4ZA 4ANSA 4F9AA 1I44A 3SX9A 4AW2A 3E62A 2CNQA 5HOAA 4NW5A 4AOTA 3R9OA 2WTVA 3H3CA 3VBQA 1V0BA 1W84A 3NDMA 2H9VA 3NW5A 3Q52A 4LOPA 2XIKA 4FC0A 1SNUA 1ZYJA 3O7LD 4MVFA 4GKHA 1Q8ZA 2CKPA 4CMTA 5AX3A 2WEVA 1ZMVA 3CR0A 5M4CA 2XIZA 1XBBA 5DIAA 2JDVA 4AGWA 4DCEA 4IZYA 3RNIA 3DAJA 3C7QA 2DWBA 3DPKA 3PJ2A 4R8QA 2E9VA 3UNKA 4L3LA 5J1WA 3BBTB 2BIKB 1WAKA 2AUHA 4KRCA 5AUZA 2YCQA 4D28A 1V1KA 4UBAA 3HLLA 3ZEPA 3D5UA 3LPBA 4FKIA 4E4NA
chains in the Genus database with same CATH superfamily
3GQLA 3LMGA 3W0PA 1F5QA 4KSPA 3HP5A 3DTCA 4DT9A 2VWUA 5TO8A 3QD0A 1OPLA 2XM8A 3Q53A 4YJUA 5I4NA 2XK4A 2WZJA 3OWJA 4QMMA 2GNJA 4AGUA 3PJ1A 4I1ZA 4KIKA 5HLWA 4ORKA 4DDGA 4LRJA 3KREA 4JQ8A 3BHHA 4E7WA 3DKFA 3EN4A 3G9NA 4FK6A 1T45A 3MI9A 4QP6A 4EWQA 4QTAA 4NEUA 4QT1A 4UZDA 3SOCA 4E20A 3Q4CA 3IGGA 4KA3A 4M13A 1XO2B 3MVHA 1Q62A 2EU9A 2DQ7X 1J91A 4FE2A 4YJRA 3P79A 4J99A 5FP5A 4F1OA 1MP8A 3R2YA 3FKNA 4MNEA 2O0UA 5J87A 3MY1A 5KMMA 3H0ZA 4Y8DA 3MJ1A 3NYVA 3WYYA 5LXMA 3LM0A 3WYXA 4F78A 3VQUA 4II5A 4EBWA 4NW6A 4TNDA 3E64A 4WUNA 4X7QA 4UWCA 3LLAA 2RFEA 2XYUA 2XNEA 3PTGA 5D11A 4DH7A 4BN1A 4P5QA 4IAIA 4U6RA 2C3KA 3QC4A 4HZSA 4KIOA 3VS7A 3RPYA 4ZY5A 4P90A 3GCQA 4FSYA 5IMXA 3DK7A 2YM5A 3NVMB 4PMTA 3BEGA 2UZVA 4WSYA 1XWSA 4P7EA 4AS0A 3PXYA 1IEPA 2YCRA 4ZK5A 4BZNA 5AWMA 4XOZA 5FEQA 1YHWA 3QU0A 4WNPA 4RC3A 3MH1A 3CKWA 5AR2A 4BCQA 4BZDA 4Z3VA 4IJ9A 3NFGB 4DHJA 1UNLA 3HMOA 3TUDA 5AP2A 2BDWA 4IADA 3FMKA 3HECA 4KKHA 5HVJA 4L8MA 4O4EA 1TQPA 4NM0A 2OK1A 2GFCA 3PXQA 3GXLA 3L8PA 3AMYA 3SC1A 2YJSA 1ZARA 5KKRB 3V6RA 3R8ZA 1XH9A 4Q5EA 4XBUA 4ZXTA 3Q9WA 3BV3A 2GQSA 1XMLA 1W0XC 4KRDA 3DOGA 4RIYB 3KIOC 4ZMFA 2RFNA 2QNJA 3QQJA 2XJ1A 3FPQA 4G3DA 3TI1A 2Z60A 5HE2A 4O21A 4ENYA 4IVCA 4R1YA 3HMNA 5FM2A 4F9BA 4CYIA 2Z2WA 3I81A 4KNBA 4I21A 4YLJA 1FVTA 5AV1A 5CU3A 4E6CA 2IN6A 3EKNA 2VTIA 1XBCA 2QLUA 4UMPA 4AN3A 1Q99A 1UVRA 4TWCA 4DBNA 3UQCA 4YTIA 4HGTA 2F57A 5BVEA 2NNWB 4R6VA 2YZAA 3Q2JA 5L2IA 1Q8UA 3IDBA 4DEGA 4DFZE 3C0GA 4RIWB 4MKCA 3UIXA 3WARA 2X6EA 5A9UA 4ZEGA 3LVPA 1FQ1B 3ZHPC 3G15A 4OBQA 5JEBA 4I94A 5AAFA 4FVPA 2R0IA 1MQ4A 4ZSAA 3C0HA 4O1OA 2YZLA 5D7VA 4BDCA 4RG0A 4HCTA 1JVPP 3KMWA 5AV2A 4GVAA 4HYHA 2X1NA 5HICA 1LR4A 4O4BB 3FLWA 3FEGA 4ZS4A 3NUAA 3HVCA 4IB1A 2YM4A 3N51A 4YU2A 2YDJA 3KU2A 3NYOA 3WF6A 2X0QA 4FIGA 4EZ3A 3T3VA 3C9WA 4BWXA 1P4OA 4M66A 3S2PA 3KXMA 3ATTA 4U3YA 3ET7A 4C2WA 3UZTA 3KN6A 3G0EA 3A61A 3TJCA 2VTRA 5CQUA 3JYAA 3TJDA 1OB3A 1Z57A 4MBJA 4N57A 5EQYA 2GNLA 3NUSA 4O6EA 4QMZA 4TN6A 4X3FA 3FDNA 1YXTA 1GZKA 4FTKA 4C33A 1B39A 4EI4A 5FBOA 4E3CA 3MIYA 2QKWB 5G1XA 4BYIA 4EOQA 1WBOA 4G2FA 5H8EA 3ORXA 4FZDB 2QURA 3U6IA 4D1XA 5C8MA 4EOJA 3D83A 4EH9A 2Z7QA 3LLTA 4DDIA 4BCJA 4BGQA 4FUYA 4FKQA 4ZOGA 2ITZA 5FWKK 4O7WA 2WQMA 3VRYA 3KA0A 2YACA 5FDPA 4D9UA 2B54A 1R78A 3KVXA 4C34A 1P2AA 4UN0C 2EB3A 4RA5A 3UBDA 4CMOA 3DNDA 3EQGA 4I4FA 2XNGA 2X0GA 4QQ5A 3ZH8A 2OXXA 5J7HA 2W1IA 2OG8A 4MXOA 4GJ2A 4V04A 5ANEA 1REKA 3UG2A 4DEEA 4CG9A 5IUHA 3SRVB 1QPJA 1ZXEA 1PMNA 5T68A 2XKEA 5F9EA 5AR7A 1YI6A 3BEAA 4FEQA 3K2LA 4NCTA 3PSBA 4FUXA 2ZV8A 2UZTA 4M0YA 4A9TA 4BI0A 4BB4A 3AKKA 2J6MA 4YTFA 1G8AA 2E9UA 4BGHA 4G3FA 5HBJA 3F2RA 4LYNA 4RIXB 1XH7A 1MRUA 3OF0A 5EKNA 4CV9A 2YN8A 4MBIA 5M09A 4FT3A 2J0IA 2BCJA 4BDEA 4RC4A 3QD4A 4CKIA 3F88A 5A14A 3F2NA 2VTTA 5JK3A 4BY9E 5IH5A 4AXAA 5B2LA 1URWA 4AA0A 3QUEA 3CTJA 4ASXA 2V22A 3RAIA 3BLHA 2V0DA 3F5GA 1A9UA 1GY3A 3PLSA 5J95A 5ANKA 3DK6A 1M7NA 4FEWA 4QP4A 4L3JA 5AM6A 3DJ5A 4PUZA 2XUUA 4X21A 3R8LA 4O38A 3C51A 4YMJA 2X8IA 4AN9A 2RFSA 1YXXA 4XP3A 5TR6A 4DGMA 3BI6A 4FSQA 1J3HA 5DH3A 3EQRA 4NSTA 4AG8A 2QOCA 5A4TA 4FTOA 2ZDUA 1K2PA 4L52A 5M56A 3HRFA 3AC5A 3AMAA 5D9HA 5IQIA 2UUEA 3HV5A 3EOCA 5GJFA 3LCDA 3MV5A 3G5DA 4LOOA 4IX5A 2VX0A 3RK5A 4JDIA 5HESA 5J79A 3UO5A 4GIIA 2W05A 3ZLWA 2VTOA 4JT3A 5KUPA 3PP0A 3IW5A 1NY3A 2OIBA 5FTGA 3JVSA 3ETAA 3FMJA 3F3TA 1LPUA 4GFOA 5AJQA 5DGZA 3F9NA 4JIAA 2IVTA 2BHHA 1U59A 1QPEA 3WOWA 3A99A 4L00A 3LFEA 3TKUA 3OOMA 2F4JA 1RDQE 2YIRA 4IWQA 4QMLA 2BRGA 2G01A 2ZFYA 1UNHA 2WQOA 3C5UA 2H96A 2WAJA 5CEPA 2UW8A 2XIXA 2OJIA 2VNYA 4BI1A 5EDQA 3BYVA 4MWHA 4PDPA 4WHZA 4ZIMA 3FQEA 2P0CA 3RM7A 1YRPA 2Q0NA 2PMIA 4G9CA 1JAMA 3CQWA 3NUNA 5D10A 4B9DA 2OBJA 5KMJA 3NW6A 4D58A 2OWBA 3W2QA 4APPA 5BUEA 3PXFA 4JR7A 4RQKA 2VO7A 3DJ6A 5CQWA 5DT0A 3ZLYA 4XH6A 3ZMMA 3FL5A 5KHWA 2ITXA 1YWRA 5M57A 3E7VA 3QRTA 4QMPA 5KMKA 5CLPA 3SG8A 3GC7A 1FGKA 3RKBA 4M97A 3HMMA 4FJVA 2OZAA 5AUYA 3O51A 2JIIA 5CAUA 5M4FA 3E8DA 2ERZE 1NVQA 4G34A 4L6QA 3D15A 5HNBA 4HVSA 4AQKA 4FV3A 3RTPA 3TNQB 4I24A 2C5VA 3RK9A 3V51A 2ZM4A 4U3ZA 3EQFA 3OFMA 4R1VA 2ZDTA 4FZ7A 4GT5A 4S30A 5EW9A 2YM6A 2XAOA 4R7HA 4BDHA 1PRYA 2VWIA 3QQKA 5H2UA 3VF9A 2I40A 4MK0A 4EYMA 1PXMA 4GV1A 4FOBA 3AQVA 2F49A 4ITJA 3VC4A 2PVKA 3CBLA 3QC9A 3DAKA 4CXAA 2I7QA 2PZ5A 1JNKA 3FLNC 2VGPA 3RAHA 3TCPA 4JXFA 2YAAA 3B8RA 2O65A 4XX9A 3N4UA 2HZ0A 3HA6A 3IGOA 5GIPE 3L9PA 4D2VA 2UVZA 5KE0A 2QOIA 5CSVA 3H9RA 3OP5A 5LVPA 5FXQA 3FXWA 3E63A 2ZMCA 4FKJA 1A48A 1H24A 4FYOA 4IAFA 4FNZA 2X7OA 4MHAA 3VHKA 5IU2A 2CNUA 3VONA 3ZBXA 3BLAA 4DG2E 4IWPA 5TF9A 3R2BA 3GNIB 4OTFA 5HO8A 2SRCA 2PVLA 3GCUA 4PMMA 2A1AB 2O5KA 4EH8A 3MY5A 3HKOA 3UMXA 4XCUA 1RE8A 2PE2A 2OO8X 4O0RA 1H1WA 1XH5A 4FT7A 2QO9A 4N6YA 4QMWA 4RVMA 2IW6A 3LCTA 2EXEA 3WF9A 4YHFA 4G1WA 2HENA 4LOQA 4J98A 3LQ3A 2CN5A 2JDSA 3TWJA 3PPZA 2X2KA 5EYKA 3UZPA 3ORMA 4CD0A 3LQ8A 5F95A 4QP9A 5AV0A 5HCYA 4XG9A 4FZ6A 1ZYLA 1DAYA 2XCHA 3LFNA 4FNWA 3C13A 3PLAE 3D9VA 3G0FA 3CPBA 2PVRA 3E7OA 4S31A 3R8UA 3CY3A 4X2NA 4G6LA 3ZBFA 4DH1A 4QEBA 4FSMA 5AR4A 3I0OA 2UZDA 3FC2A 4I4EA 2IWIA 4C3FA 4F09A 3TN8A 1NT2A 4JDHA 1W83A 3LFQA 5LJJA 3ZOSA 5LVOA 3OBGA 5BVKA 3ORTA 5I9YA 4FKWA 4TYHA 3KB7A 3CQEA 1HCKA 2YIQA 1RQQA 3TT0A 4QNYA 2OXDA 3RI1A 4ZTNA 2Q83A 4O7NA 4R7IA 3OXTA 5KO1A 2QC6A 2WMTA 2CHLA 1JSVA 3DV3A 5IUIA 5LMKC 3ZFMA 1Y8GA 1J1BA 3BHVA 4IX3A 3S3IA 4GG5A 4G5PA 1PYEA 4Z7HA 1OKVA 2UW4A 2VO0A 4M8TA 3W8QA 5EW8A 2JIVA 4K0YA 3RBWA 3GU6A 4XYFA 5KKRC 4HYIA 1OIRA 4FEXA 1Y6AA 3R9HA 3RPRA 4YSJA 3PIYA 4G9RA 4RQVA 1OL7A 3KGAA 3VUMA 3EFWA 4RFZA 2W9ZB 3EZRA 2NYAA 4LMUA 3NW7A 5GZ8A 2VGOA 2XS0A 4HGSA 2QODA 4R3RA 4RLLA 3IW4A 1FPUA 3B2WA 4GU6A 5T3QA 4FIFA 1LEWA 2YIXA 4MXZA 5J9ZA 2X9EA 5HE0A 2VWBA 4MEDA 1ZYDA 1WVYA 3FLYA 4KS7A 5E8UA 4NL0A 3DU8A 4JR3A 3FLZA 3EKKA 3FZTA 3QRUA 3NRMA 4YNEA 4OTIA 5ETIA 3TNWA 5AP3A 4O86A 1FMOE 2ZMDA 5E8ZA 3T9TA 5CX9A 2IPXA 1YQJA 4DEBA 5CZIA 2UZEA 2ZB0A 4FTUA 4IWOA 3TZMA 4ZTRA 1BUHA 4IDTA 1H07A 2H6DA 4USEA 1SVEA 5FRIA 4QMXA 3R1SA 3GUBA 4HZRA 4XMOA 2F9GA 4YC6A 2ETKA 3FMMA 4ACMA 4OTDA 1TKIA 2R3IA 5IKWA 3K3IA 3QHRA 4UWBA 4GT3A 5HIEA 4WRGA 2O3PA 2IZSA 2WHBA 1GZNA 3R1QA 4RGJA 3K3JA 3K5UA 4HPUE 1YXVA 5LWMA 3W0OA 3UOKA 4AWIA 4IZ7A 4MYGA 4Y85A 5IQEA 3TNPC 5DT4A 2PVMA 1REJA 2GNIA 3FV8A 3NWWA 4FTQA 2JBPA 3RP9A 2QR8A 4CFFA 4H05A 5IQDA 3BQCA 4Y72A 3Q6UA 2XIYA 4MF1A 1VJYA 5HE3A 4OT6A 2IW8A 4A9YA 4AE6A 3ZSIA 5K5XA 2A0CX 2I0YA 4JG8A 3LFDA 4OAVB 4J71A 4OTPA 3AC3A 2JBOA 3R73A 3VUDA 4ANLA 4F1TA 5A4CA 2XK8A 1ZAOA 4B8MA 3FHRA 5LVMA 4IC8A 4KWPA 5HTCA 1KE6A 1ZWSA 4QMUA 3OEZA 3NNVA 3KVWA 3F66A 3C4WA 4G16A 4YBKA 4C4EA 4QYHA 4U41A 2OH4A 3VUGA 1V0PA 5KMIA 1OITA 3QXPA 3GENA 1NVSA 5LCKA 5HI2A 3LXPA 1WBNA 2X4ZA 4XG4A 2GFSA 4LL5A 3U87A 3NCGA 5GJDA 4C38A 2QI8A 2F7EE 4ENXA 3TL8A 1IAJA 1NW1A 2R0UA 4ALWA 2W4JA 4I20A 2ONLC 3ZM9A 4E6QA 3QCYA 2XRUA 4IDVA 4C4FA 2C5NA 2ZVAA 4GT4A 2CLQA 4GYGA 1WZYA 4OTGA 4A06A 2W06A 5ETCA 4AF3A 4ZY6A 4EOLA 2J0KA 4JNWA 4XOYA 2BMCA 2VV9A 4OTWA 5DR9A 4AU8A 1OUYA 4G17A 3UG1A 4QMOA 4EYJA 5AAEA 5BPYA 1M52A 5BX0A 4BTKA 4AXEA 4XV1A 3WIKA 1SMHA 3QTXA 4MAOA 3TTIA 3DK3A 1H01A 2J0LA 5M08A 5KMOA 4FTMA 3VNTA 3ZEWA 4IMYA 5IA1A 3DXQA 4MQ2A 1Y6BA 1ZYCA 2QONA 3GC0A 3MN3A 4NTTA 2HY0A 2OH0E 3GP0A 4FV9A 3TV7A 4DITA 3LKMA 3RAKA 3Q9ZA 3ZZWA 4EQUA 4L42A 4PL4A 3Q5IA 4PX6A 2QU5A 3UP7A 1QCFA 3R71A 4JI9A 4D5KA 4KB8A 4EHZA 4FKLA 4Q9ZA 5JZNA 4ZTSA 3PIZA 4AGCA 2B0QA 4I6FA 5DEYA 3ZC6A 1YXSA 1W2CA 4FV7A 4AA4A 4IX4A 2VTSA 2DUVA 4W8EA 4EOKA 2YIWA 3CTQA 3LMHA 4L9IA 2WQNA 4ZTLA 2QOKA 1OMWA 3FHIA 4WT6A 3AGMA 3OWPA 4O4CA 5ANGA 5E8YA 2GNFA 4ZP5A 3PE1A 1U54B 4DLJA 3O5AA 4MCVA 2FUMA 1U5QA 3KQ7A 4RJ3A 3MH2A 3FQHA 2X2LA 2YABA 4CFNA 4W8DA 4RJ6A 3VN9A 5A4QA 3FQSA 1YKRA 2HWOA 2OGVA 4U42A 4IW0A 2XH5A 2B1PA 4FSZA 4CKJA 4U44A 5HGIA 3MTFA 5LMKA 4FR4A 3KULB 4DH5A 2X4FA 2C30A 2BALA 2ZAZA 3FL4A 4YJOA 5TE0A 3V5LA 4BFMA 3SDJA 5AA9A 4O7RA 3K5VA 3QKLA 4X2GA 5AA8A 3IECA 3RWQA 5IA3A 1UKHA 4PNKA 5M4UA 3FZRA 4AGDA 4CCUA 1Q8YA 2GCDA 2NP8A 4QRCA 4YHJA 4EH5A 4RIYA 3P08A 1XMMA 3RINA 2XBJA 2F7ZE 3TIZA 4G3EA 3U54A 2JDTA 1M17A 4RC2A 3FSKA 2ZYBA 3LJ0A 5C8NA 1XH6A 3SG9A 2VTQA 4BIDA 4UMUA 4UWYA 2XNOA 3PUPA 5CU6A 3UODA 3OEFX 4IB5A 5HG9A 4EKKA 5A46A 4U81A 3W0MA 3U51A 4DEDA 3T9IA 1Q8TA 3R7OA 4IFGA 3FMHA 5AIKA 3AGLA 4TNBA 5HG5A 2FYSA 4TPTA 4E5AX 5AP4A 4EBVA 4HJOA 4CVAA 2R3RA 3VF8A 2P2HA 4XRLA 3AT4A 2C69A 3OCBA 4G3CA 1H00A 4FTNA 3FMLA 4NH1A 3DDQA 3PA5A 3WF8A 4ASDA 5HLNA 2BAKA 4RIWA 3TNIA 4EEVA 5JGDA 4Y46A 3UGCA 3LW0A 4YPSA 5EYDA 4PP9A 5K9IA 3VS2A 2AYPA 4PPAA 3UPXA 2YFXA 3D7TB 4Z9LA 3FKLA 3VAPA 4ASZA 1H8FA 3ZZEA 5HCXA 4ZSJA 2QVSE 4QYFA 4JQ7A 3AKJA 1YDTE 2YIYA 3RM6A 3TACA 3W2SA 4QMTA 4RIOA 4F6UA 4RX5A 3R02A 3ZS5A 4EH2A 2VU3A 2W5BA 4EQCA 4XP2A 3RALA 3FY0A 3LFFA 3D2KA 2PU8A 2XAMA 3OW3A 4FSTA 2ITYA 3E87A 4DGOA 4DTBA 1JWHA 1PF8A 2C3JA 3GOPA 1Q24A 2O2UA 1TZDA 1M7QA 4E5BA 3JR1A 3ALOA 4RZVA 5CAVA 2VWZA 4D2TA 4JMQA 3QQUA 4LGGA 2CGVA 3OG7A 2QOHA 4NK9A 1QPDA 2JDRA 2UZWE 4RSSA 5AP0A 1DI8A 2XMYA 4S33A 5C01A 3PPKA 3UQGA 4I5PA 1YI3A 2FO0A 3QUPA 3WI6A 5HNGA 2WTJA 1PXPA 2BRHA 3A4PA 4FZFB 3BE2A 4GK4A 1P4FA 4RVLA 2X8DA 3BBWA 4BI2A 4BCFA 3P7BA 2G2HA 3QHWA 2FH9A 3MH3A 4JG7A 3L9NA 4L67A 4FYNA 4CV8A 4DT8A 2B53A 3U8WA 3W0NA 1OKYA 2BZKB 3OMVA 4FICA 4S34A 2J9MA 4RLKA 2OXYA 3W33A 4APCA 1E1VA 4K33A 3KRXA 3Q60A 4HCVA 4BCKA 3IW6A 5F20A 3CP9A 4DFNA 3FMEA 3SRVA 4J8MA 2CN8A 3OY3A 4W9XA 4C58A 1YOLA 1Q4LA 3ORPA 3NUYA 3LCOA 4GS6A 4OBPA 4JOAA 2H8HA 3CJFA 4H39A 3PP1A 5IZFA 4C4JA 4ZTHA 4B6LA 1XH4A 3A7IA 4TWOA 4EK8A 5BUIA 4J53A 4RIXA 5IEVA 3D7ZA 3N4VA 5BV3A 2OIQA 1KSWA 3I7BA 5IA2A 2WMQA 4BKYA 4YZ9A 3CEKA 5J5TA 1LUFA 5I3RA 2ZV7A 3UQFA 1XJDA 3D4QA 5HG8A 1OL5A 3WZDA 4O6LA 5TKDA 3ID6C 3LMIA 2X7FA 3LJ1A 3FJQE 3KRWA 3NIZA 2C6DA 4I6BA 4NKAA 4TW9A 5CVGA 4YZNA 4AT4A 1W2DA 3H4JA 3SV0A 2C6EA 2VX3A 1WCCA 4ACCA 3KMUA 3PZEA 2VWYA 3SD0A 3R7YA 5CF8A 4X6RA 2BAQA 3VULA 3QZIA 4FKPA 2LAVA 1H1SA 1H1PA 3QTQA 5HHWA 3UOJA 4RJ4A 5HORA 4FG9A 1R3CA 3V5WA 3LXLA 3MA6A 3PUFC 2CLXA 4IANA 2NPQA 3QTRA 3C4EA 4A7CA 4ACHA 5ICPA 3RNYA 3E5AA 2W99B 4DGGA 2B9HA 1BL6A 2BROA 2PVFA 4FTTA 4C4IA 4PMPA 2HXQA 2W1FA 1PXOA 4JDJA 3VHEA 4NFNA 4FVRA 4CFUA 1DAWA 2BRBA 3A7JA 4C57A 5CF4A 1P5EA 2W1HA 2OJ9A 1WVXA 4I6HA 2JAMA 4C8BA 5CF6A 3I4BA 4MNFA 4IVDA 4ZLOA 4JBVA 5LWNA 2E2BA 1OPJA 5GINE 4GEOA 4DG0E 4QOXA 3A7GA 3NAXA 5GNKA 3F3WA 4CG8A 4QPMA 2PVYA 4TWPA 3KKVA 2BKZA 5DOSA 5IDNA 4RVKA 2UZUE 2YISA 3CCNA 3C50A 4AZWA 4DC2A 3N4TA 4FSRA 4QP8A 4F65A 3ZXZA 5F4NA 1P14A 5FTOA 4B8LA 4YZCA 4PDYA 5F94A 3R8VA 3QRIA 4CYJA 3IPHA 4QYGA 4LFIA 5ANDA 3UTOA 3I5ZA 4E4XA 3W2PA 2Z02A 2JKKA 5IF1A 2C1BA 2R3NA 3HA8A 3U9CA 3DDPA 4MBLA 3RCDA 2R3FA 4H3QA 3PJ8A 3S95A 2NRYA 3OOGA 5ITAA 4UY9A 3DKGA 3E8EA 5JRSA 4AZEA 2ITUA 4C36A 4UYAA 3RMFA 4PL3A 1T46A 4EH4A 5EDPA 3BWJA 2PSQA 1K9AA 2BKKA 4MH7A 1Q61A 5BQ0A 3LZBA 2XK3A 3KN5A 1H0VA 4OBOA 5EYMA 4D4SA 4FKVA 2V7OA 1KV2A 2CGWA 2RG6A 4R3CA 2W4OA 4AT5A 4FV4A 2BRMA 5E8TA 4BVUA 3GVUA 5IQGA 3FYKX 3OXIA 4XHKB 4FSUA 2AEGA 5E8XA 3V3VA 4CZYB 4D9TA 4J96A 4XG3A 4FSWA 3W0QA 4GKIA 4ZS0A 3G2FA 4K9YA 4EHVA 1O9UA 4EUTA 1IRKA 4R5YA 1OPKA 2GTNA 2JITA 2PE1A 3UOLA 3E88A 2R3MA 2WMSA 2WTDA 3MWUA 2WMBA 3Q32A 3C1XA 1BX6A 2Y7JA 1YHSA 3Q9XA 4IH8A 4LGDA 4XJ0A 4B7TA 4XNEA 3PY0A 3DLSA 3UOHA 3ZU7A 4HW7A 2KULA 3SLSA 2HZNA 4LMNA 4IB0A 5IMEA 3TEIA 4HCUA 3MBLA 3KY2A 3IQ7A 3TKHA 3WZUA 4F0FA 5L8LA 2ESMA 2UW5A 3HGKA 4O27B 4QDVA 2FSOX 4DH8A 3MIAA 2ITOA 2R2PA 3BX5A 3QLFA 2W4KA 4D2RA 4WIHA 2PUNA 1HOWA 3QL8A 1W98A 3FAAA 5HVYA 5IQHA 4CNHA 1PY5A 5DFPA 5D7AA 4TXCA 3BL9A 4IFCA 3P23A 2C6IA 3DZQA 5CEIA 3H30A 3PPJA 4YP8A 4DGLC 4U79A 3DCVA 5BVDA 4F9WA 4JBPA 2C6LA 3VS6A 5IISA 1PXLA 4RZWA 4DEIA 3VW6A 4ANNA 4QDEA 4H3PA 2XKFA 4AXCA 3IKAA 4HVGA 4USFA 4H3BA 4NM5A 3VW8A 5JFVA 5DN3A 5A4LA 2OIDA 4UV0A 5FEEA 3QTWA 4ZSEA 4GW8A 3ROYA 1IG1A 4M84A 5EOLA 3DT1A 1APME 3BKBA 5H8GA 2R3PA 2HIWA 4BHNA 4I0SA 1UA2A 2RL5A 3LFAA 3QX4A 4WA9A 5CEMA 2XNNA 3AT3A 3RCJA 2WNTA 3JY0A 3KRRA 3BELA 3OHTA 1UU3A 4PPCA 3COIA 1ZRZA 5HQ0A 5JKGA 3VS1A 1GIJA 2ZM3A 3GCSA 3OWLA 4BDIA 3GT8A 2QO2A 5CS6A 3W2RA 4BDKA 5M07A 3PSDA 3ACJA 3QX2A 4ZLYA 1A06A 2J5FA 4O7TA 4NUSA 3AD5A 5AX9A 1UNGA 4PTCA 4G3GA 3CQUA 5FDXA 2W9FB 5DNRA 4F6SA 4M69B 4HVDA 2AC3A 1W8CA 2XJ2A 3O8UA 4ZZOA 3GEQA 4D2PA 2VTJA 2J0MB 5DPVA 1H1RA 4FMQA 3FXZA 2F7XE 3PDTA 2PE0A 3SW7A 4DCAA 5JGBA 4L3PA 2HK5A 3CD3A 1ERKA 4C0TA 3F7ZA 2E9OA 4YHTA 3ZYAA 4CT1A 4QQCA 4BDGA 3KXHA 5CTPA 2R3GA 2ITPA 5AUTA 4IX6A 4IE9A 1OIUA 2G1TA 1KOBA 1Q3WA 3NLBA 2XEZA 3W55A 3D14A 5BUJA 4PWNA 2YLEA 3F5PA 3L8VA 3W0SA 4C7TA 2CPKE 2ETRA 3FLSA 4QPAA 4I41A 2ZJWA 4S2ZA 3RGFA 3C4ZA 4O0YA 3DLZA 4CMUA 3Q4TA 1CMKE 2UZBA 3BRBA 3QCXA 4O2PA 5KCVA 2F2UA 2XK7A 1PMVA 5A4EA 2PPQA 4NFMA 3ZO4A 2JEDA 2W5HA 4F7JA 4AW5A 3ZO2A 4RWKA 3FBVA 4QP3A 4BCIA 2YM8A 3HMIA 1J7UA 5LARA 4N6ZA 2CGXA 4OW8A 1KE8A 3FPMA 3ZO3A 3GFEA 2XCKA 3QCQA 4I0RA 3UDBA 4XG6A 4U45A 1F0QA 2YAKA 1FGIA 1JSUA 3ZLXA 4F4PA 4R7BA 5HBHA 3SQQA 2UVXA 4C59A 2VTPA 1F3MC 5E8SA 1Q3DA 3NS9A 3KC3A 2G15A 4QD6A 4RMZA 5E1EA 2O8YA 3BCEA 4DLIA 4E6DA 4ZZNA 5I0BA 3NIEA 4GSBA 5E90A 5I9WA 3R01A 2REIA 2ETMA 2VWWA 2WFYA 4G5JA 4BF2A 3EB0A 4BYJA 4IVAA 3WILA 3MFSA 1JKKA 1GIHA 1LP4A 3OS3A 4IAKA 4UYNA 3VBTA 4WBBB 3O71A 2DS1A 2EWAA 4U8ZA 5JT2A 5CI6A 2GDOA 2YDKA 3KXZA 1OIQA 3UYTA 4FX3A 3I79A 1IR3A 2F2CB 3BHYA 2C5XA 4CZUA 4ZY4A 4QP1A 1STCE 3QGYA 1H25A 4XV2A 5F1ZA 4O84A 2R9SA 4ALVA 3SHEA 2WMAA 4QMYA 4ACGA 3O8TA 4EHEA 3EYHA 4XUFA 4AE9A 2O63A 1BLXA 3EZVA 3RPOA 3HAMA 3KL8A 4YUQA 4V0GB 4X2FA 3SOAA 4FNXA 1BI8A 2GNHA 4GMYA 3OUKA 1KUTA 2RFDA 4RBLA 4MD8E 3LFCA 4RA4A 3TIYA 4BIEA 3MYGA 4WG4A 2W5AA 1M14A 3ZUUA 4IWDA 4ID7A 5DT3A 2WTIA 2DYLA 5HBEA 3D5WA 2OJJA 5I3OA 3G6GA 4EORA 2Q0BA 4FT9A 2E9NA 3P78A 2YWVA 2GHMA