3QAME

Crystal structure of glu208ala mutant of catalytic subunit of camp-dependent protein kinase
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
350
structure length
348
Chain Sequence
GNAAAAKKGSEQESVKEFLAKAKEDFLKKWETPSQNTAQLDQFDRIKTLGTGSFGRVMLVKHKESGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVAGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPAIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFTEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords cAMP-dependent protein kinase catalytic subunit alpha
publication title A conserved Glu-Arg salt bridge connects coevolved motifs that define the eukaryotic protein kinase fold.
pubmed doi rcsb
source organism Mus musculus
total genus 116
structure length 348
sequence length 350
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2011-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3qamE01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3qamE02
2QOQA 5LMAA 3LFFA 5FEQA 3FZPA 4FSWA 1URWA 3E3PA 5T6KA 3FLYA 1Q97A 4FZFB 4TY1A 1B39A 3R8UA 1CSNA 2X2LA 3PY3A 4UWYA 5TT7A 3WYYA 4D5HA 3S00A 2BHEA 2R3LA 3NWWA 1EH4A 2J90A 1WMKA 3O0GA 4CNHA 3FUPA 5LCKA 4DFLA 3F88A 1PXJA 2J0LA 3QXPA 3PSCA 2PZPA 2W1EA 4IE9A 4W9WA 3TV7A 4DE4A 3LW0A 4U45A 4PL4A 1Y6AA 3R7GA 4JBVA 2B4SB 5EK7A 4AF3A 4F09A 4WOVA 2QODA 4P5QA 4B0GA 3H9FA 2YCSA 4JDHA 4RFZA 3DDQA 4Y46A 2W1HA 3PVBA 4NU1A 5AAFA 5FDPA 2VWVA 3QCYA 3QC4A 3ORTA 4ARKA 3UOJA 2X1NA 3HYHA 5KKRB 5DR2A 2WQEA 1YDRE 5A4TA 3IW7A 3PIYA 1PW2A 3PG1A 3ORMA 4BIBA 3CEKA 4M14A 3R1NA 3ZRKA 1E1VA 1SMHA 1ZMVA 2DS1A 2VX3A 3KC3A 4HNFA 5CF5A 2ITWA 5JGAA 1H1PA 4QMVA 5JT2A 3BE9A 3EQIA 4YR8A 4G5PA 5CI7A 3UZTA 3UP7A 2VGPA 4JBOA 4K2RA 4MF0A 4O21A 4RG0A 4U41A 4UY9A 5JFWA 4GG5A 3EN4A 4PY1A 4ZXTA 3QUDA 3EN5A 4HJOA 4ZY6A 3ZSGA 3TUBA 2BVAA 4CFUA 4X7QA 2IZTA 3L8SA 4X2JA 3O7LB 5FD2A 2X7OA 4D1XA 3FEGA 4FTOA 1YXSA 2X0GA 4GJ2A 2OW3A 1XJDA 2O65A 2XF0A 3WIKA 3QX2A 4H3QA 3FY0A 4ASDA 4KBKA 2E9PA 3GOPA 3QQFA 5FEDA 1P14A 2H34A 3BGQA 5KMJA 2PE1A 3MIAA 2VU3A 3F5UA 3HMOA 2HELA 4LUDA 4BKZA 5LJJA 3D94A 3TEIA 3SGCA 1QPEA 4XS2A 3TL8A 4CZTA 1R78A 2E9UA 4NUSA 4S34A 4WG5A 2OFVA 3F3VA 4ONAA 3FSKA 3E8DA 2HOGA 4BCOA 2XA4A 3TDVA 3UZPA 2HYYA 4C34A 3WIGA 3LFSA 5IISA 4NM5A 4L8MA 2Y4IB 3EN9A 2G15A 3E92A 1OKWA 3GU7A 4FV7A 4HYSA 3CS9A 3NMUF 2BUJA 4NWMA 4BCMA 2NP8A 3C0GA 2R4BA 4GRBA 3FZTA 1UNGA 1YKRA 1ZYSA 4FZ7A 4UN0C 4XUFA 4RQKA 1GOLA 2GNFA 4KUJA 2XRUA 2VUWA 2Z7RA 4FNXA 3PPJA 4IC7A 3MFSA 4M97A 2X9EA 3PY0A 4DLJA 2OWBA 3PPKA 4FKPA 2ZB0A 4CEGA 3UQFA 5GIPE 1OUKA 1OGUA 1WCCA 3HLLA 4M0ZA 2J0JA 3AQVA 5F94A 3ZM4A 4Y8DA 3LAUA 1Z5MA 4RIXB 1NT2A 4GK3A 2WMWA 3C4CA 4EOPA 3AOXA 3A4OX 3H9RA 4YTHA 4NW6A 4IZ5A 2C47A 1P5EA 3UIMA 1VYZA 2CPKE 5E8VA 5A46A 3LXKA 3PIZA 4KKHA 4XP2A 4LGHA 4FKGA 4OR5A 5H8GA 1H08A 4DEGA 5IPJA 4DEDA 3IW8A 2W1GA 5E8SA 4EH9A 5K4JA 3CP9A 2LAVA 2QO7A 5AP1A 5AP3A 3W2SA 4ZZOA 3R22A 3CSVA 3BZ3A 4OGRA 3VO3A 4U8ZA 4RC3A 4FTJA 5HVYA 4DG0E 1XH5A 4XH6A 4OT6A 5FUTA 4HGTA 3SKCA 2VTHA 1J7UA 5HBJA 3LXPA 3MVJA 3FKLA 3ZFMA 4DFBA 4MNEA 3UYSA 3F2RA 2GTMA 3MFTA 4UMPA 3GEQA 2G01A 2ZOQA 2VTLA 3QTQA 4IM2A 1FOTA 3C4WA 4MHAA 4MKCA 4O7LA 3HUBA 4OTWA 4RRVA 2J0KA 4GVAA 3GBZA 4DN5A 5L8LA 2QR7A 5TF9A 3HVCA 5HX6A 4FMQA 1S9IA 4S32A 2V5QA 4HNIA 1ZY4A 3RP9A 4DCEA 3QRKA 4F7LA 5J79A 3F7ZA 1PKDA 4HPUE 4LG4A 4QTAA 4W4XA 2YISA 3AMBA 2ZMDA 3FXXA 3NW6A 3PP1A 4O82A 5HVJA 1I09A 3DXPA 2YHVA 2OH4A 3IOPA 5E1SA 4QP8A 4FIJA 4MEDA 3H4JA 3LFNA 3R7EA 5B2MA 3AD5A 3R28A 5LXMA 3CLYA 3OWJA 2NO3A 3IW6A 3MSSA 3NR9A 3PP0A 2X81A 4YO4A 4M12A 4E6QA 2R3MA 2GTNA 4MF1A 4AZSA 1WZYA 3DKFA 1AD5A 3PXYA 3U4WA 2BPMA 2XIXA 3BCEA 4CKIA 4PL5A 4IDTA 4DITA 4ZLOA 4ANQA 4AT4A 5EM6A 4CMOA 4MXAA 4EOJA 3R71A 2QNJA 4IWPA 4FYOA 5CTPA 4FSZA 5FBNC 4IVCA 4X21A 4KKEA 2CCHA 1PKGA 3R2BA 3PXKA 3QZIA 5CVGA 4DH7A 5JZJA 2XCHA 3RPSA 4RWIA 2ITZA 4IB3A 3H30A 3EOCA 2YCQA 3OEFX 3FY2A 5CX9A 2HW6A 4NTSA 3CE3A 4FL2A 4EOLA 4L46A 3UZRA 4AGWA 3OCSA 5KMMA 2G2HA 2XZSA 5CWZA 3CY2A 4U5JA 1PF8A 4NTTA 3D5XA 4O0WA 1PRYA 2QG5A 5DNRA 3G15A 4ZAUA 4L3JA 1SVHA 3Q96A 5DR6A 3PA5A 3LKMA 4EBVA 4FG8A 3Q6UA 4RWLA 4YC8A 3P23A 2WTKC 5CEMA 1NVSA 3OWLA 4EH5A 3NUXA 2XEZA 3MVHA 3P9JA 4KKGA 4ORKA 5AV4A 2NPQA 3ZCLA 3ZSHA 4PNIA 3TXOA 1YOLA 4YZBA 5AV3A 4JL9A 4CVAA 4NYEA 5BYZA 1MRYA 2SRCA 3TNHA 4ZJIA 3W2OA 4EH6A 3ZC5A 2ITTA 4ZJVA 2XH5A 4RWJA 1FQ1B 2WFYA 4FIEA 4BDEA 3R9RA 2VTOA 1ZOHA 2P4IA 3KQ7A 4Y95A 4FKIA 4EOKA 1V0PA 2CKOA 3O2MA 3JXWA 4PTEA 2ACXA 3R1QA 3UQCA 1WBNA 4DGNA 1WBTA 1M7QA 1DM2A 5BVFA 5CZHA 5IH4A 4MNFA 5HHWA 4FE2A 4DH8A 4DTBA 4WHZA 2PVJA 3QAME 2OG8A 2QQ7A 4O0YA 4MH7A 1DI9A 5AX9A 3SOAA 4ACMA 4DEHA 4FTIA 2XM9A 3DKGA 4WBBB 4ZOGA 5DBXA 3EMGA 2W4JA 3F3WA 3VULA 4O84A 3EQGA 5D9HA 2I0YA 3ZTXA 4G16A 4MXOA 4S33A 5J8IA 5CQUA 3RZBA 3BEGA 3F3ZA 3NUSA 3RK7A 5L2SA 1KUTA 5AV1A 3H0YA 5BX0A 2H8HA 3D5WA 1OL7A 4FC0A 4L52A 3CTQA 4V04A 4H36A 3UP2A 4E4MA 3N4VA 4TYHB 5FP6A 1JVPP 1Q24A 2UW4A 3NUNA 4OTIA 2RFEA 2R3QA 3OTUA 3HGKA 4R7HA 3IDPA 4BGGA 1X8BA 5KBRA 3D5UA 3HRFA 3OOGA 2REIA 3G0EA 4U97A 3QWKA 4PP9A 1YXVA 5AIRA 4O7WA 1PMNA 3FV8A 3FHRA 2C69A 5CAPA 4W4VA 2WQOA 1JSVA 4J95A 4M66A 1H01A 3ZHPC 4E1ZA 4YHFA 2A2AA 3QQUA 4RIXA 2WAJA 5TE0A 3IG7A 5C4LA 1A06A 2RKUA 2X4ZA 2WELA 3LM5A 4AZTA 4F64A 5HIEA 3EKKA 2WXVA 3NZ0A 5G1XA 2ITVA 4BBMA 1ZOGA 2OZOA 2GHGA 3DNDA 4QTDA 5EKNA 4BDFA 2VTPA 4P4CA 5DVRA 4L01A 1BYGA 4FIGA 3QD3A 4MXCA 4TYIA 3HMMA 4I5PA 5EI2A 3L9LA 4LRKA 4NT4A 3W2RA 5E90A 4HVDA 4FV0A 1NY3A 4J1RA 4MD8E 4E3CA 4XG6A 2J5FA 3DDPA 3DOGA 2ONLC 4QTCA 5HO8A 4BDJA 4D5KA 3IQ7A 4TYJA 4UMQA 2GS7A 4UXQA 5DHJA 2I0EA 2J51A 4EBWA 4FTCA 1LPUA 3DB6A 3ROYA 5DOSA 3V5PA 2J2IB 3K54A 4NCTA 3QCQA 2ZVAA 3UOKA 4K0YA 3CJGA 3DJ7A 4ENYA 3RPRA 1W82A 3ACJA 1H28A 2XB7A 3QKKA 2XK9A 2EXEA 2VNWA 4IDVA 2OIDA 4YZNA 1OMWA 4EK3A 1YQJA 4UMUA 4P5ZA 3DJ6A 3MWUA 3KRJA 3I5ZA 3R73A 4JDIA 4ALWA 4FSYA 3V3VA 4AU8A 3FI3A 3WI6A 3BYSA 4OUCA 4BWKA 2YDJA 1OKYA 3EQDA 1M14A 2YIRA 2BTRA 2QO2A 3DQXA 3QD0A 4YZ9A 5T3QA 4N57A 3QF9A 3ZLWA 2VWZA 1JQHA 2R3HA 4BCNA 4UYNA 2YIQA 4OAUC 2FSLX 3ZS5A 3R7IA 2BRBA 2XBAA 4GIIA 4IM3A 4O86A 1YW2A 4I41A 1XH8A 4FV5A 3TTJA 3R8PA 4DF3A 1GIIA 4II5A 2CLXA 3QQHA 3IGGA 2UUEA 4IAZA 5JMSA 1Z9XA 2BKKA 2BIYA 4UX9A 2YCFA 4Y83A 4X2KA 4N6ZA 2XYUA 2QONA 4G1WA 1YVJA 3VS1A 4L45A 4USDA 2W0JA 3BX5A 3ATSA 3N4TA 2W1FA 4O0UA 5TOZA 2ETRA 4AFEA 5EDQA 5CS6A 4CV9A 5D7VA 4YHTA 4IBMA 2Y4PA 2W5BA 3L8VA 1L3RE 3QZFA 3QKMA 4OTRA 4EEVA 4YPDA 5KHXA 3WE8A 4W4YA 1QCFA 4YZCA 3T3VA 5FBOA 3TNWA 2OKRA 5M51A 4IWOA 1BL7A 4CYJA 2YM8A 1JSTA 2YABA 4F9WA 4EQCA 3GU6A 3R9NA 4FUXA 2IW8A 5KKRC 2BFXA 2DWBA 2YAKA 4BGHA 4ZSAA 3R6XA 2VTRA 3ERKA 3L8XA 1JKKA 3FXWA 4E8AA 2PUIA 3SV0A 4G3DA 1ATPE 4HYIA 2X7FA 4X3FC 2YM7A 5AM7A 1ZLTA 1JSUA 3MA6A 3VUTA 2GQRA 3L9MA 3VUMA 1PMUA 4BHNA 4ALUA 2XKEA 3FL5A 2XK3A 5BUEA 4L43A 3KRLA 4QP3A 3EIDA 4QP4A 4H3BA 3U87A 4OW8A 5FRIA 2CJMA 1SVGA 5C8MA 4M15A 4ANNA 2PVNA 4OTQA 5FP5A 4CRSA 2I1MA 5EW3A 2ITNA 3GFEA 4WRSA 3IPHA 4CQGA 4IB5A 4M84A 3BPRA 3OROA 5H2UA 3FBVA 3O71A 3V8SA 4D58A 3LLTA 4D4YA 5DT3A 3GUBA 5KZ0A 4FTAA 1QL6A 5GINE 5CYIA 2WTDA 2QOOA 3LQ5A 3GCVA 5JFVA 1QMZA 3DV3A 4FSTA 3W8QA 4BDBA 4EH4A 3D83A 4FV9A 4AP7A 1YI6A 5CNNA 5HKMA 5IUHA 2BDWA 1Q3DA 3GC9A 4G31A 4U7ZA 2AC3A 2BZIB 3U6IA 4TT7A 2ITPA 4I6FA 3TZ8A 4O91A 5AR5A 1MQ4A 5B0XA 3P08A 4PV0A 2R3KA 3R1SA 2C6DA 4YJSA 5D7AA 4QP9A 4QQJA 3FZRA 3QALE 3EWHA 4FTQA 2UZWE 3CD3A 4FZAB 4IC8A 3W55A 5CEOA 1MRUA 3DXNA 2XIZA 4IZYA 5FM2A 4NM7A 1V0OA 5GZ9A 1LEZA 1RE8A 1KE8A 4TZRA 2Z7LA 5E8TA 1VEBA 3R9HA 2VNYA 2O64A 1GAGA 3BKBA 3AC1A 3BU6A 4ZTHA 3LVPA 4NM3A 4YHJA 2FB8A 5EI8A 3NVKI 2QU5A 3Q04A 4I5MA 2RG5A 5HNGA 5K5NA 4D4RA 5DE2A 4RSSA 3VBTA 2J6MA 3ZXTA 4AN9A 4XV1A 4ZP5A 1B6CB 4WO5A 2GNIA 1XH7A 2BIKB 2XK7A 3Q9ZA 3UQGA 4ID7A 3TTIA 4E26A 5CQWA 1UKHA 5LMKA 3Q53A 4FSMA 5HCZA 4Q2AA 4YNEA 1ND4A 3ZZEA 2QKRA 3PE2A 5L2TA 3VIDA 3EQHA 3TZ7A 1R1WA 3S3IA 3LCDA 3NCGA 5HU3A 4BIDA 5KMLA 3R63A 3TV4A 2Y0AA 3ZEWA 4D0XA 3MS9A 4FF8A 3OP5A 3KN6A 5AV2A 3KCFA 3G5DA 3RKBA 4ZMEA 2QI8A 4BDAA 4FV3A 5BVDA 1OKVA 2J0IA 2WNTA 4ZS0A 3A7HA 5JK3A 2BZHB 2WGJA 3OS3A 2O63A 4M67A 2B9FA 2OU7A 3E87A 4MQ2A 2CN8A 4AGDA 4CFVA 4TYEA 4AA4A 3W33A 3DU8A 3LJ2A 3DPKA 1OKZA 5IUGA 4G3GA 4HVSA 4AA0A 4XRJA 5AEPA 4QYEA 1ZMUA 3D5VA 4XG3A 4ZSJA 5E7RA 3P86A 5E8WA 5ACKA 2VTAA 3N51A 1REJA 4MD9E 1DAWA 4XLVA 2JBPA 3VJNA 4TWNA 5A6OA 1Q61A 3AT4A 4JNWA 5HO6A 3D7ZA 1FBNA 3ZXZA 1UU9A 3ZH8A 4EK6A 5AX3A 2R7BA 5CLPA 4EH2A 3FLSA 3OY1A 4ASZA 1ZZLA 4YU2A 1OBGA 2Z8CA 4B99A 2CNQA 5JEBA 4R5YA 1SZMA 2H96A 1GNGA 3FLQA 3QYZA 3Q32A 3PJCA 1PY5A 3UMWA 5K9IA 3I1AA 5LVNA 3LLAA 5JKGA 5CU2A 4G5JA 2R3IA 2VO6A 1DAYA 1V1KA 1REKA 2YM6A 3P79A 4X6RA 1ZY5A 2AUHA 3BU5A 4NZWB 5KHWA 2QVSE 2XKDA 2WMBA 4DTKA 4LMUA 3DCVA 3FMDA 3M42A 3CKWA 3U54A 5EM8A 2QU6A 3CTJA 1OPKA 2BZJA 3C4ZA 4X6QC 2B9HA 4AOJA 4BVUA 5FG8A 2P2IA 3TM0A 4O38A 1PYEA 2VX0A 2UZEA 5AUYA 5HD7A 2PVLA 4YTIA 2JC6A 1OZ1A 4HVIA 1AGWA 5CXHA 4D9TA 2B53A 4O7RA 3ORLA 1TQIA 4EHZA 3PVGA 3PXQA 5ANJA 2BRNA 3ELJA 1XBCA 2J0MB 3ACKA 4L53A 3MY0A 2IJMA 3FYKX 4K11A 3HMNA 5TR6A 4QMTA 5ANEA 2C0OA 3NUPA 3W18A 1BUHA 2JKQA 3KA0A 4PQNA 5BUIA 3EYGA 4BWXA 5AR7A 4FKVA 3SW7A 3NUYA 4LL5A 2HXLA 1PMVA 2CGXA 2QOLA 3EQPA 4IAYA 1XH9A 4MCVA 4QMWA 3SW4A 4C38A 5IA0A 4J8MA 5M06A 3E8NA 4R1VA 2O2UA 5EG3A 3LJ0A 2R7IA 1Y57A 1CKIA 3DAJA 3ROCA 3V5TA 1J7LA 3DAEA 1Q99A 2XCKA 1PXIA 3NAXA 2C6EA 2FSMX 4GG7A 3S0OA 5CAVA 3R7UA 1VYWA 5L2QA 5J7HA 3ZDUA 4TWOA 2HK5A 4BHZA 3O7LD 4IJPA 4JX3A 3ID6C 4DCAA 1OIRA 4MTAA 3FXZA 4R3RA 5CU4A 3LPBA 5AP0A 2UW3A 3PIXA 4AAAA 2IVUA 4C8BA 5HIDA 2YZAA 3TCPA 4C37A 3HAMA 3FZOA 3FAAA 4G6LA 5CSHA 1Q62A 3AMAA 4J71A 2GFSA 2FYSA 2UVZA 3QL8A 2HW7A 1CM8A 4M8TA 4L9IA 4RX9A 4UZHA 5IKWA 4D2VA 2C6TA 4I0TA 4DFZE 3RJCA 3PYYA 2BAQA 3D15A 4AZVA 3LFBA 5KMNA 3U8WA 3MJ1A 3QTZA 3QFVA 1DI8A 1T46A 4FX3A 4I0SA 2P55A 4BZOA 2WTJA 5L2WA 4ERKA 5KX8A 3BYOA 4AACA 2XS0A 4TW9A 2PVMA 3POOA 2A19B 3BIZA 4WD5A 3QQLA 4XBRA 3GVUA 1WVWA 2C6LA 2JIVA 2VTSA 3LJ1A 2W9ZB 3IS5A 3K5UA 3LCKA 3QRTA 4FVPA 5HNBA 5JFSA 1GIHA 2W4KA 4MAOA 5BVKA 2PUUA 3BRBA 4ALVA 3EZRA 5GZAA 2JDTA 2C3LA 1YDSE 2Z60A 2YZLA 3HNGA 5L6PA 4Z9LA 5CU6A 5HNIX 4CKJA 1JKSA 1Q5KA 3HP5A 1Y91A 3EFKA 3I7CA 3R02A 2PZ5A 3OCBA 4XP0A 4QOXA 4BY9E 1Y6BA 1YXTA 2GMXA 4D2RA 4AE6A 3QA8A 5DYJA 1YXXA 3O96A 1ZYLA 2J9MA 4BYJA 3C9WA 2PVHA 4H39A 5E4HA 2HWPA 3R30A 4C02A 1GZOA 4WNOA 2EUFB 1KE7A 1OL6A 3RAWA 2HAKA 4QMQA 1JKTA 4ZZNA 5AUUA 5CAUA 1RQQA 3FMKA 3VRYA 3OT3A 4U79A 2C6KA 2R3JA 3EJ1A 4F99A 3R0TA 4FV2A 2XK4A 4NKAA 2PE0A 5DT4A 4NFNA 4GSBA 5HE3A 3A7IA 4OAVB 2JKOA 5AFVA 3NIZA 2I7QA 3RALA 1LR4A 3DS6A 3EHAA 2VN9A 1BL6A 2BCJA 3GP0A 4DT8A 4BCFA 3GENA 3TNQB 2ERKA 3OD6X 5BVWA 3R21A 4NKSA 2OLCA 3LMIA 4L3LA 3IGOA 3VRZA 5ITAA 1WVXA 4NSTA 4YSMA 3VUHA 4BYIA 2ZDUA 4CFMA 4FL1A 4BCPA 4Y5HA 4FTNA 2YERA 3W8LA 1MUOA 3QKLA 3MPTA 4L44A 4X3JA 2CNUA 1H4LA 2JDRA 2ESMA 3KMUA 4FBXA 2FSTX 4AUAA 4QMXA 4ANMA 3OXIA 3UVQA 3T3UA 5CF4A 2OJJA 3AT2A 1FVTA 4D2WA 4EWQA 3BV2A 3C0HA 5I4NA 3S4QA 4EJ7A 2JIUA 3KGAA 4YJQA 3THBA 5M44A 3HAVA 2QOIA 5EQEA 2ERZE 3ZDIA 4MBJA 4QYHA 3OT8A 4YGAA 4N0SA 4BF2A 3LXLA 4EHVA 4CYIA 3BBWA 4FT9A 4NJDA 4O6LA 4PTGA 4U9AA 5EHYA 4AW1A 5AAGA 4FTUA 3WZKA 5J1VA 4ZLZA 4RVMA 4KSQA 3GCUA 4YPSA 5D12A 2FO0A 3VBYA 5LVMA 3M11A 4C7TA 1PJKA 1W84A 1JKLA 5IQBA 3W1FA 3MH2A 1H1SA 4C57A 4E5WA 1ZXEA 3R83A 2UZLA 3CTHA 4HGLA 2QOCA 3B2TA 5AR8A 4C58A 3II5A 3UVRA 1UVRA 3EL8A 4I4FA 1FGKA 1NXKA 4EKKA 2JDSA 2C4GA 3OMVA 3JY9A 4AGUA 2XVDA 4FKJA 1K2PA 4I93A 4NEUA 3RHXA 4APPA 2E2BA 2Y6MA 5EYKA 2F9GA 2JEDA 2R0UA 2XP2A 4L68A 4V0GB 3ZUVA 4IWDA 4BB4A 1YXUA 3KKVA 5BUJA 3ODYX 3LZBA 4I21A 3L9PA 2CGUA 3VQUA 4CMTA 5BYYA 5FXQA 4K18A 5AR2A 2YIXA 1QPDA 3RNYA 3BGZA 3NLBA 5D10A 3COKA 3QYWA 4LGDA 1U4DA 3VWAA 3FPQA 5HG8A 3IONA 2IZUA 2HWOA 4GIHA 1CTPE 2RIOA 3QUPA 5M56A 3UC4A 2RSVA 3OG7A 3R1YA 3TACA 4EH8A 3Q3BA 3VAPA 4RX5A 5CENA 5CF6A 5J5SA 3AC3A 1H24A 3COHA 1Q8TA 3ODZX 3MIYA 4PPBA 4U44A 4Q9ZA 4GCJA 1KE9A 3P5KA 2WTIA 4QMYA 4HCTA 4YJTA 5IF1A 3R01A 5IZFA 3V6SA 3F9NA 5HEZA 3V51A 3ZEPA 5IA2A 3KRRA 4QMOA 2R3RA 5CXZA 5L8JA 4XYFA 3C4EA 3W16A 4C2WA 1Q8ZA 3W2QA 5CASA 4BCGA 4Q9SA 3IW5A 4FKQA 2XM8A 1UWHA 4G3EA 2C3KA 4OT5A 4PMPA 4JVGA 4XG2A 3BWJA 3M1SA 4KRCA 5AUXA 2RF9A 4F7JA 4LUEA 4O1OA 3UE4A 2VTQA 4FEUA 3FI4A 2V55A 2IZRA 3MI9A 1XKKA 3E5AA 3IK3A 2CLQA 3C4FA 4GT5A 2C0IA 3SA0A 4IIRA 4KBAA 5CZIA 4F0FA 3LMGA 4L7FA 3A4PA 4QP6A 4DINA 3FI2A 2PULA 2BAKA 4YJNA 5LVOA 1BI7A 4TPTA 3R7VA 4ANBA 3TN8A 2C5VA 1MP8A 4G34A 3W2CA 3QTUA 4Z7HA 2WTVA 4DH3A 4FSQA 3VC4A 3LFDA 1PXOA 3F3TA 3TZ9A 4OTPA 4ACCA 1IASA 4O1PA 2VTIA 4RA5A 4CFXA 2XIYA 2WPAA 4RJ4A 3DK7A 3EKNA 5BYLA 3HDMA 3QHWA 2E9NA 3MPMA 3QQGA 2XIKA 1WBOA 5HCYA 1H07A 5CALA 4ZTQA 2X6EA 1G8AA 1XR1A 2JFLA 3E7OA 2W5AA 4XMOA 4PDSA 5HZNA 2GHMA 4FGRA 2OK1A 3CIKA 2G2IA 2GS2A 4F7SA 3RAIA 3RMFA 2FA2A 1W0XC 5A14A 2OF2A 4EWHA 3H10A 5FM3A 3CQWA 4LFIA 4ZTRA 5M08A 2PL0A 4A4OA 5IDPA 3I4BA 3LMHA 3ORIA 5ANGA 1IAHA 4IB0A 5DH3A 3DZQA 3ULZA 2C68A 4BL1A 3UIUA 4BRXA 2G9XA 3O23A 3RK9A 3W10A 4A07A 4AQCA 3R7OA 2W99B 4YLJA 3PZHA 1FVRA 3ENHA 4M3QA 3FMJA 4R5SA 3RPOA 3V6RA 4CFNA 4Y5QA 3SRVA 2OXXA 5CT0A 1SNUA 1FINA 5JRSA 5IEYA 4GUBA 3ZO1A 4FZDB 3P7BA 4G9RA 5IA3A 3LIJA 3NX8A 4HYUA 5EM5A 4R3CA 5HE0A 4BDIA 5EQPA 5IQHA 2YWPA 4IMYA 3D9VA 4ZZMA 3ZM9A 2QOKA 4BFMA 3TG1A 3F5XA 4U3ZA 3TNPC 3MH3A 4FNWA 5L8KA 4FTTA 2JITA 3HV4A 3QX4A 5LOHA 2HZNA 2R9SA 5E91A 3ET7A 3ULIA 4IACA 3VS6A 4QMNA 1ZMWA 3TUCA 3FL4A 5IG1A 4GU9A 4WG4A 3PJ1A 2B9JA 2PHKA 4QP1A 5EHLA 4EYJA 3HX4A 5EDPA 2UW7A 4IW0A 3WF9A 2YAAA 4C36A 3GFWA 4PL3A 2YACA 3I5NA 5M4CA 3TJCA 1OI9A 4CD0A 2PMIA 5BNJA 5FGKA 3SX9A 2X8DA 3FLNC 3BV3A 4RVKA 4FOCA 3VS2A 4G9CA 2RFDA 2QLQA 3MW1A 4CMUA 3C5UA 4XOYA 4RIWA 1IAJA 3U6HA 4K9YA 1UA2A 4EJNA 4O6EA 1Y8GA 5KNJA 3RPVA 5H3QA 4EZ3A 1BX6A 1XO2B 2CKPA 3B8RA 3BYVA 1H0VA 1YRPA 2PWLA 4A9RA 2KULA 1OIQA 3SD0A 3R8VA 1JLUE 3UOLA 4CZUA 4HGEA 4V0GA 4R7IA 1M2RA 4JQ8A 4RLKA 4PMMA 3DLZA 4F1OA 1WBSA 2OO8X 1JBPE 4FGBA 4O0XA 1H26A 1LEWA 3QQJA 4RQVA 3ZRMA 4JOAA 2X2KA 5HE1A 2JAMA 3PXRA 4L67A 4B6LA 4JT3A 4RFYA 4FSUA 4OLIA 5A4EA 5IA5A 2WQBA 4MK0A 2F7EE 4HW7A 3AC8A 4ZSGA 5CANA 3EFJA 4O7VA 2C1BA 3QGWA 2F7ZE 5CI6A 5DRBA 4YJRA 5HLPA 4QPMA 5J9LA 4KA3A 4PDYA 3ZO2A 4IX3A 2GNHA 1Y8YA 4F6UA 5AAEA 2XNEA 2IG7A 1WBPA 4DGLC 4IADA 2C0TA 3UODA 3DK6A 3ZLSA 5CSVA 1J1BA 3DBDA 3FQHA 2I0HA 3NYXA 3FKOA 3QWJA 5CEIA 3COIA 5M4FA 3RAHA 3V04A 4M68A 5IA4A 1YWVA 2EVAA 3DBQA 2ZV8A 3FHIA 5I0BA 3W2PA 2O8YA 4FKLA 4IVDA 4YJOA 5CVHA 4C61A 2PMLX 2R3NA 4E73A 4U40A 4RVLA 3OCGA 4JIAA 1HCLA 4DEAA 3RTPA 4E4LA 5HO7A 3QRUA 2UW8A 3R9OA 4RLLA 3RM7A 1K3AA 4K1BA 3Q9WA 3BBTB 2Y8OA 1UV5A 2XBJA 4XOZA 3BEAA 3VS3A 3JR1A 5HG9A 2J50A 2C30A 1OITA 3SXRA 3PXZA 4E6CA 4AXAA 3R2YA 4BCKA 4L3PA 3DNEA 4C0TA 4FKWA 3GCQA 2F2UA 2GPHA 4CSVA 3GB2A 3VS7A 4CKRA 2WMUA 4ZTNA 3MV5A 1QPCA 5A4CA 3P7AA 4LOOA 5JQ8A 1K9AA 5AUWA 3DFAA 2QD9A 3QA0A 5J1WA 3EZVA 4CLJA 3UO5A 1TKIA 4O7SA 5D1JA 5E8ZA 4O0RA 4FA2A 5KE0A 4E4XA 4FZ6A 4BBEA 3RPYA 4CG8A 3KXHA 5DEWA 3GU8A 1OL2A 5LARA 4RA4A 3EL7A 3LQ8A 1CDKA 2ZM3A 4IXPA 3WE4A 2VZ6A 5KMIA 3BU3A 3P0MA 4YC3A 2OIQA 4O81A 4EYMA 5IUIA 3V8WA 2A1AB 5ACBC 4C4FA 3OZ6A 3PA4A 4QD6A 2QKWB 3F7WA 4FSRA 4TN6A 3VBXA 3Q2JA 3PJ2A 3FWQA 4GS6A 3O51A 4IFGA 1S9JA 2OJ9A 3BI6A 3DAKA 2WO6A 4FL3A 3TDWA 3D7TA 1JOWB 4RIYA 2WB8A 2YLFA 2YJRA 4IH8A 5I9ZA 2PPQA 1P2AA 3MESA 4J52A 2WMAA 2UZBA 2XKCA 5AUTA 4HZRA 5L3AA 1YI4A 4EONA 4RX8A 4F1TA 5TO8A 5I9WA 3SXSA 3ETAA 2A0CX 2YDIA 3BGPA 3LFCA 2YLEA 4H1JA 4O7YA 5F95A 4EKLA 3AXWA 4FTMA 2YM5A 2V62A 3DFCB 2Y4IC 4Z3VA 1RJBA 4W4WA 4JG8A 4RPVA 4Y85A 3QLGA 4DYMA 1O6YA 4BICA 4FT5A 4AWIA 4LV5A 4IAAA 4H1MA 5K0KA 4IQ6A 4YJPA 3Q4CA 2OJIA 3KF4A 3Q4TA 4GK2A 4F7NA 2OSCA 1YOJA 1P4FA 3Q5ZA 2GQSA 4TL0A 5M53A 5IQAA 3KRWA 2PVKA 4U3YA 3H9OA 1O6LA 1UU3A 3ZUTA 2XRWA 3I0OA 4BBFA 4OTHA 5B2KA 4B7TA 1STCE 2PUPA 3RCDA 3DKOA 3V8TA 5C9CA 5H8BA 2WOTA 3UG1A 1H00A 1O6KA 4FEWA 4OBPA 3NYNA 2OXYA 3FDNA 2QO9A 3W32A 2BRHA 2KTYA 3CQEA 4PWNA 5J95A 4BN1A 4R6VA 1JAMA 1OL5A 3WZUA 4U0IA 4EUTA 5IQIA 4A06A 4HGSA 4S30A 2UW6A 4R1YA 5EYDA 1URCA 2PVFA 4D28A 4A9UA 2QURA 3EQCA 2Q0NA 2X9FA 4FEVA 3UDBA 3VBVA 5HX8A 3C5IA 2FVDA 1CKPA 4KD1A 3OUKA 4EI4A 1M17A 2EXCX 1H1QA 2GNLA 2ZYBA 2R64A 4YC6A 4JQEA 4NCTC 2XNOA 5DG5A 2W05A 3EN7A 4TKSA 3FE3A 3RGFA 4DH1A 5E9EA 3KCKA 3HKOA 4F6WA 3QRIA 3NAYA 4X2NA 5ETCA 5B7VA 3G51A 4JDJA 2J5EA 3BLHA 5DN3A 4DEIA 3NSZA 3JS2A 3A7GA 4S31A 3VUGA 4XG4A 3GGFA 4IJ9A 2A4LA 3QTWA 2WTKB 4WA9A 4BC6A 4DTAA 2UV2A 5E8YA 5EKOA 1UU8A 3DA6A 4BCQA 3SG8A 4KIKA 1CMKE 5EYMA 3HV3A 4F63A 4K33A 3U9CA 5DA3A 3BE2A 3EB0A 4RZWA 4M0YA 3RNIA 4DFYA 3F61A 3A99A 4UYAA 1NVQA 2DQ7X 5DI1A 4PMTA 5F4NA 3C13A 2HZIA 3Q2MA 2W9FB 4DC2A 3PLAE 4RWKA 4KNBA 5IMXA 2V22A 3AG9A 3NNXA 1YWRA 4I5CA 1WBVA 3QTXA 4KABA 2ZV9A 3NW7A 4YUQA 3GQLA 4RJ6A 5AA8A 1TVOA 4FODA 4JRNA 3LQ3A 4O0SA 3MY1A 4AW0A 3WILA 1P4OA 4ENXA 3LE6A 3BHVA 1R39A 3DLSA 5ANOA 3NEWA 3NYOA 2ITQA 3GC8A 2B9IA 5JH6A 2FGIA 3RZFA 4XG9A 4ZSLA 5BMMA 2XNMA 5KUPA 3VS5A 2XK8A 3GC0A 4DGGA 2W1IA 4EOSA 4QT1A 5G6VA 3ZC6A 4DA5A 3VBWA 3QLFA 3JVSA 4LL0A 1GZ8A 4IAFA 4EOOA 4H3PA 2YEXA 5DGZA 3TIZA 3PRIA 4M13A 2VD5A 3CJFA 3WYXA 4MVFA 3MDYA 4D0WA 3F5GA 1R3CA 5BQ0A 2CN5A 3FI8A 4YBKA 2ZAZA 3FMLA 5DRDA 3AD4A 2Z2WA 3FC1X 3MYGA 5JZNA 4UMRA 4PTCA 1G8SA 2WMXA 1L8TA 3KK9A 1W7HA 4WKQA 4E93A 4F4PA 5CSWA 2BAJA 2NRYA 4CLIA 4HZSA 4QMSA 1ZARA 5AADA 5HG5A 3A61A 3RK5A 2WTCA 1O9UA 5E8XA 1NVRA 4ANLA 4L6QA 3N9XA 4Z16A 4F9CA 3MFUA 5L2IA 4IHPA 4NIFB 2RGPA 5ANKA 2BTSA 2UZUE 4BDGA 3Q4UA 3ZO3A 4EK5A 3WOWA 2JAVA 3F82A 5K0XA 2R3PA 3ALNA 4RC4A 5L6WL 2UVXA 4F9AA 3PFQA 1OPLA 3T9TA 4TXCA 4HPTE 2CKQA 3DBEA 4CZYB 1M52A 4K77A 5IQCA 4CFWA 3SQQA 3VUDA 3HRBA 5EYCA 4ZEGA 3DBCA 3F2AA 2B54A 2PYWA 4GK4A 4LGGA 1YOMA 2ITXA 5C27A 5CSXA 4E6AA 2BHHA 5FLFA 5HIBA 4C2VA 2RG6A 3R00A 3ZONA 5IU2A 2AYPA 4EH3A 1UNHA 4TWCA 5HCXA 2BRMA 3MJ2A 3SOCA 5HORA 2E9VA 3E62A 2Q83A 4DBXA 2UZNA 2CGWA 2WMVA 3T8OA 4FKTA 4WT6A 3MH0A 1FMKA 4UBAA 3FZ1A 4RMZA 3UPZA 3MBLA 5DWRA 5HTIA 1M2PA 3E63A 4AZFA 4BDCA 4F0GA 1OVEA 3VUIA 3MVMA 3LHJA 2OH0E 4FTLA 2OZAA 3D14A 1YDTE 3L9NA 4MXYA 1VJYA 4PX6A 3SC1A 4A9TA 2W4OA 3NS9A 3O8PA 4KB8A 1ZRZA 3HL7A 3PSDA 4YURA 4IVAA 5A54A 1W98A 4D2SA 4HVHA 1KV1A 3VS0A 4BCJA 1T45A 3CKXA 5F1ZA 5ANDA 4XRLA 1U54B 2C5NA 4FIFA 5KZIA 4AW2A 4FV6A 5LWNA 4PRJA 3K2LA 4JBPA 5M4IA 4I6QA 1BMKA 3FMEA 2ZV7A 5HG7A 2CHLA 2WTWA 2OFUA 1Z57A 4LRJA 4WNKA 4QMUA 2C6OA 4QYYA 5C26A 3QQKA 3UO6A 5HTCA 3UPXA 5M07A 3DGKA 2DUVA 2OBJA 3B8QA 2PUNA 3WF7A 2ZM1A 2C5YA 3UBDA 3U55A 3TZMA 5L4QA 3DZOA 5EI6A 3PVWA 5LMKC 4CT1A 3C50A 4JAIA 2FUMA 2XUUA 3KL8A 2BR1A 5CVFA 5LVPA 3SLSA 3OCTA 2Y6OA 2DYLA 2J7TA 3ZZWA 4QMZA 4BWPA 3BQCA 4FIIA 2IPXA 3OTVA 4X2GA 4KIOA 3WF6A 4OTFA 3DJ5A 4O0VA 4KWPA 2CMWA 3MN3A 1YHSA 3V5QA 3ZLXA 4XV2A 4O2ZA 4BI1A 4MBIA 4HCVA 2VO7A 4B4LA 4I23A 4X3FB 3SRVB 2YM4A 2CNVA 5KO1A 5IH6A 2QHMA 3BLQA 4R3PA 3O17A 4BDDA 3PJ3A 1OM1A 4AZWA 3HZTA 4FT7A 4JBQA 2F57A 4B8MA 1PMEA 4JX7A 3N4UA 5EH0A 2WKMA 2JIIA 2VWYA 5F20A 2IZSA 3Q60A 4UZDA 4BIEA 4DH5A 2WU7A 4G3FA 5DEYA 4H05A 3FMMA 1XHAA 4KIQA 4F6SA 4E6DA 4BTMA 3NCZA 5I3OA 3U6JA 3VHKA 1WVYA 4D55A 4PDPA 3I60A 3NYVA 2QC6A 2R0IA 5DIAA 3CC6A 2YFXA 4WG3A 4WIHA 3BHHA 3SXFA 2P0CA 2GDOA 2GNGA 3VQHA 4PUZA 4FV8A 4J7BA 4ITJA 2EB3A 3R7YA 3UNKA 1OECA 2JDOA 5ETFA 3P7CA 3JPVA 2GCDA 5IDNA 3SG9A 4E4NA 4QQTA 3VJOA 3UJGA 3OF0A 3KXNA 3QTRA 3GXLA 1PYXA 2B55A 3DBFA 4G17A 5HI2A 4K8AA 3FLZA 4UWCA 5JGDA 4HCUA 4GUEA 5A6NA 4DGOA 3GQIA 4BI2A 4EQMA 4DG2E 4YNOA 5D41A 4IB1A 5LVLA 5GNKA 3CCNA 4AA5A 1YWNA 4BZNA 3HP2A 4PPAA 4RIWB 2J4ZA 4YTCA 5M57A 4PF4A 3QHRA 4BKYA 1OBDA 5FXSA 2WU6A 3AD6A 5CAQA 5HE2A 2P3GX 3O8TA 4ASEA 3MB6A 4B8LA 4QTBA 4GKHA 3IW4A 3UVPA 5DLSA 1J1CA 4QYGA 5CU3A 4H58A 4F1MA 2JDVA 5TKDA 1M2QA 1OIUA 4CQEA 4DHFA 4FICA 4M69B 2C3IB 4HVGA 3WZEA 4U6RA 5GZ8A 3ZUUA 2XNPA 2C3JA 3PXFA 1KV2A 4FSNA 4KSPA 1QPJA 3JY0A 1B38A 4AW5A 4ZY4A 3G90X 4NIFA 4UEUA 3PWDA 3R8LA 3SDJA 4USFA 4Z55A 3HV7A 1PXMA 4APCA 5C03A 2UZDA 4Q5HA 4QP2A 4V01A 2BMCA 2HY81 4ITIA 4V05A 4AT3A 4AFJA 5FWKK 3SHEA 2YN8A 2H6DA 3V5JA 4IWQA 2B52A 3IDBA 4JG6A 4K6ZA 2ZDTA 3I79A 3ZFYA 4EH7A 5M55A 4E20A 3A8XA 4F65A 4KIPA 4FTKA 4G6OA 2QHNA 5EM7A 2ONLA 5T68A 3D2IA 1AQ1A 5K3YA 5LCJA 1JNKA 4YJUA 4F9BA 1VR2A 2ZMCA 2JBOA 4IANA 1Q8WA 4RFMA 4UV0A 4WUAA 4USEA 4YP8A 2V0DA 4DT9A 2WIHA 3PUPA 3E8EA 2CDZA 2XEYA 4HOKA 1NW1A 2NRUA 4F08A 4JRVA 5CEPA 3F69A 2X7GA 3DK3A 4JDKA 1IG1A 2VX1A 5IQEA 3T9IA 3OOMA 4GYGA 3QU0A 3ORXA 1ZZ2A 3ORKA 4L7SA 3TJDA 4GT4A 3DQWA 4GYIA 2X8IA 4FV4A 3PG3A 4D2PA 5AR4A 5GJDA 3RHKA 4UXLA 3U9NA 3ORPA 3REPA 4IZAA 4YZDA 2QR8A 1J3HA 2OXDA 3ENMA 3AT3A 4D9UA 4YSJA 1FMOE 4YBJA 3P1AA 3R04A 4WUNA 2F49A 5CEKA 4N6YA 4AX8A 3ITZA 1H25A 1E9HA 3VN9A 4EOMA 2YCRA 4FIHA 1Q8UA 4R78A 2HCKA 1H1WA 4FT3A 1U54A 1F0QA 5LQFA 4RBLA 3FMNA 4FVQA 4TWPA 4D2TA 3U4UA 2B7AA 2VRXA 1UKIA 2QOBA 4KAOA 2CGVA 3BYMA 1UU7A 4XV3A 3IECA 1SVEA 3D0EA 2Q0BA 5L6OA 1HCKA 4LRMA 3R8MA 3TT0A 1J7IA 4FKSA 2GU8A 1IEPA 3B2WA 2VTJA 3FC2A 4LOQA 3WF5A 3OEZA 1ZYJA 3I6UA 4GV1A 4DLIA 2OJFE 3AMYA 4PPCA 3TUDA 4CV8A 4IAIA 2WOUA 3NPCA 4G3CA 4G6NA 3WBLA 1U5RA 4E5BA 4XP3A 5AIKA 3OHTA 4MWIA 3UC3A 2X6DA 4BZDA 5KCVA 3PA3A 5AM6A 4WRGA 2PVYA 3CGOA 4FNYA 5J7BA 1J91A 4BR3A 3CPCA 4QPSA 4EHGA 3FZSA 4L00A 2ZB1A 3FKNA 4JXFA 4AS0A 5DR9A 5HBEA 1VZOA 2O3PA 3QZHA 4ZIMA 4MBLA 1GIJA 3MTFA 1APME 3OC1A 4RJ7A 4BTKA 2YIWA 3GNIB 3G0FA 4IZ7A 3JYAA 3OUNB 1UWJA 3D7TB 1BI8A 4FYNA 5EOBA 3DT1A 4U80A 3MH1A 4RIYB 5A9UA 4AG8A 5CAOA 4GFMA 1WAKA 3QGYA 4J97A 3OW4A 3CD8A 4KRDA 4X3FA 1V0BA 2VTMA 4IFCA 3MA3A 1YI3A 3KRXA 3NNUA 3UIBA 4C35A 5HLNA 4FNZA 1IA8A 2BFYA 3ZSIA 3I81A 4I1ZA 4C33A 4TYGA 5CF8A 3KF7A 2W17A 2WIPA 4U43A 2W7XA 3ANRA 4YLLA 3KULB 2XNBA 4I20A 2JLDA 1FGIA 1RDQE 3A8WA 4XX9A 1H27A 5H9BA 4MD7E 3ZFXA 4QTEA 3KB7A 3KXMA 1IR3A 5CT7A 2B0QA 3A62A 2FSOX 5EW9A 3QC9A 3Q52A 4JJRA 4DFUA 3LM0A 5HICA 3ZO4A 5AV0A 4UB7A 4P90A 4FKOA 5HBHA 1SM2A 2VV9A 4EOIA 4F0IA 4N4SA 3FPMA 5K4IA 3NVMB 2OIBA 2BRGA 3TKIA 4O0TA 3TI1A 3FQSA 5LWMA 4W8DA 2CCIA 5E8UA 5AJQA 4BGQA 5I9UA 3AC4A 3UIXA 3G33A 1A9UA 1FVVA 4C3RA 2WMTA 2BDFA 4ZTSA 2AC5A 3HMIA 3VW6A 5B2LA 4RVTA 4EK4A 4IX5A 2OJGA 1PXLA 2WZJA 3FYJX 3TWJA 5J9YA 4P7EA 5CEQA 3H0ZA 4ACDA 4AOTA 4ANSA 2R5TA 4M7IA 3ZBFA 4JG7A 5IA1A 4UWBA 2VGOA 4FEQA 2XK6A 3O50A 1XH6A 3EQBA 4EC8A 4KBCA 3NGAA 4EC9A 3SVVA 4J98A 4NL0A 2GQGA 3BELA 3E3BX 4BI0A 2RFNA 3UYTA 3PTGA 3RM6A 4XG7A 3IKAA 5GJFA 5FQDC 4M69A 1KE6A 4FUYA 1H0WA 1GJOA 1PXKA 2XNNA 3PDTA 4CG9A 2FH9A 4WNPA 3S2PA 4YTFA 3KMMA 4XBUA 5M09A 2QLUA 3POZA 2QOHA 4TTHB 2WMRA 5FTOA 3ZMMA 2UW0A 4NW5A 5EFQA 4EORA 1GY3A 1SNXA 1ZOEA 2IWIA 3UNJA 4FKUA 4RX7A 1F5QA 3ANQA 3VBQA 2VO3A 4NH1A 5HESA 2W1CA 3V5WA 2QOFA 1Q3WA 3HA6A 2H9VA 4X0MA 2GHLA 2HZ0A 2UZTA 4R7BA 2C6IA 4XLIA 4JAJA 3QTIA 4QO9A 2UVYA 3KXZA 3MGYA 5EW8A 3TV6A 2PSQA 5CY3A 4QNAA 3LCOA 3VF9A 3I6WA 3GCSA 4KIKB 1ZYDA 4XNEA 4AT5A 3CQUA 2V7AA 3NNWA 4BKJA 3U51A 3Q9YA 2XIRA 5FEEA 2I40A 2A27A 3BYUA 4AE9A 2YM3A 2YIYA 2ITUA 3MY5A 2EU9A 4OTGA 3UTOA 2ZV2A 3DXQA 3HMPA 4GL9A 4KS8A 4MXZA 3PY1A 1G3NA 1U59A 3E93A 3C4XA 4BCHA 2RFSA 4A4LA 5AMNA 3OVVA 5LMBA 2YITA 3I0QA 3KMWA 3NIEA 3QUEA 1OUYA 2P2HA 3NUAA 2Z7SA 4AZEA 1XWSA 3PWYA 2GNJA 3HRCA 4RIOA 4FOBA 3ZYAA 4A9YA 4GVJA 2QCSA 4X2FA 3VW8A 3MVLA 3NUUA 4BTJA 4EOQA 3DKCA 1UNLA 4GT3A 1JPAA 5BVEA 2PZIA 4A7CA 2Y7JA 4MQ1A 2EWAA 1Q41A 4FV1A 3C51A 4F70A 4IEBA 2C1AA 2F4JA 5AUVA 3LFAA 2R3OA 4O7NA 1W83A 2PZRA 4WSYA 4YJVA 3G9NA 4LI5A 4YO6A 1GZNA 5E1EA 4C3PA 4WBOA 5EOLA 3A7FA 3C0IA 3ORZA 5I9YA 3F2NA 3L8PA 4O27B 4GU6A 1GZKA 5I5ZA 4FI1A 2B1PA 3UO4A 3BLRA 4ANOA 1OL1A 1KOAA 4XHKB 4C4EA 5IEXA 1PHKA 4FK6A 1F3MC 3F6XA 4TNBA 3QCXA 2F2CB 3KU2A 4QYFA 4O7TA 2PTKA 1KOBA 4U81A 4JIKA 4JLCA 5FXRA 2PMNX 3R8ZA 4N70A 3RWQA 4EZ7A 5KMKA 2OGVA 2R3FA 3JVRA 4DEEA 3UMXA 4PNKA 4DEBA 4JR3A 3NRMA 4D1ZA 2BALA 3GU4A 5M4UA 4GMYA 1I44A 4OTDA 4CFFA 4NFMA 5EHOA 2F7XE 3F5PA 4DFNA 5D11A 4I94A 3PE1A 2IW6A 2BKZA 3KN5A 4P2KA 5AP4A 4DAWA 2XMYA 2OICA 3PPZA 3DB8A 3A60A 2C6MA 5C8NA 1FPUA 5HLWA 4E5AX 2WD1A 3UG2A 3QZGA 3UOHA 3EFLA 4Z7GA 4DBNA 4LQMA 4R8QA 4EL9A 3EH9A 3QXOA 2C5XA 5JGBA 3BHUA 3AC2A 1Q8YA 4GW8A 5A4LA 3VS4A 2OI4X 5CSPA 4QQ5A 3OXTA 4QP7A 3ZOSA 4TRLA 3QD4A 4U42A 5I9VA 3FLWA 3IDCA 3BWFA 4WSQA 4CGAA 1LP4A 5ICPA 2OF4A 3LCTA 3P4KA 3AC5A 1BKXA 3E88A 4RC2A 5J87A 3V5LA 4C4HA 4ZJJA 4ASXA 2VWXA 4CRLA 5AA9A 2WQMA 3KULA 1IA9A 1NA7A 4XCUA 3TKUA 1JWHA 2WQNA 3F66A 3FQEA 4GFGA 4W9XA 1OPJA 4CCBA 2UZOA 5HD4A 4YMJA 5F9EA 4NM0A 2OZAB 2VAGA 4QMLA 3GCPA 4BTFA 5JRQA 4AN3A 4UALA 3QCSA 2YJSA 3ZLYA 4EZ5A 4GKIA 4ZSEA 5IQFA 1ERKA 4RZVA 3OW3A 5J5TA 1ZYCA 4G2FA 4L42A 5IH5A 2ITOA 3WZDA 4EUUA 3KK8A 3K5VA 3VVHA 3K3IA 5DT0A 5K5XA 1LUFA 4NK9A 2R2PA 4C3FA 4OBQA 4C4GA 4O7ZA 2VWBA 1MQBA 4QMMA 2G1TA 3GC7A 4J96A 3O8UA 5AP5A 4EK8A 4D1SA 5JQ5A 3EQRA 5BVOA 3ATTA 3G9LX 4C4IA 4W8EA 5A3XA 3AGLA 3FJQE 5HU9A 4RJ8A 3QTSA 3CGFA 2W5HA 2XKFA 4O96A 3D4QA 3NNVA 3H3CA 3EFWA 4TYHA 2IW9A 3VUKA 3ZBXA 3R9DA 1HOWA 3ALOA 3QD2B 3CR0A 4XEYA 5BVNA 4FR4A 1PXNA 4E7WA 4FTRA 3V01A 1E1XA 5JFXA 3TIYA 2IVVA 3K3JA 3LFQA 4EHEA 5DMZA 1CKJA 4IVBA 2YDKA 4I0RA 4ZMFA 2HY0A 3PVUA 4O2PA 1ZAOA 5DPVA 4FKRA 2GS6A 2G2FA 5H8EA 2Z02A 4CCUA 1OIYA 3CBLA 2BZKB 3E8CA 4I6BA 2VWUA 4QNYA 2BROA 4AGCA 3KXGA 2UW9A 5HGIA 3MPAA 3GI3A 3NDMA 5JN2A 4J99A 2NNWB 2XJ1A 4TNDA 3RVGA 2O0UA 3UNZA 1KSWA 3KXXA 3CPBA 2VTTA 1U46A 2JD5A 3WARA 5IQDA 2XJ2A 2YA9A 2XYNA 2VWIA 3FSFA 1G5SA 4QRCA 2YWVA 3PJ8A 4RGJA 5HQ0A 4O83A 3MTLA 5A4QA 2R3GA 5HTBA 3NW5A 4IAKA 3LOKA 4YLKA 4UMTA 3ZRLA 2X2MA 4I22A 4J53A 2PU8A 3F3UA 4RJ5A 4BDKA 1W8CA 4LM5A 2W06A 3EYHA 3QRJA 3HEGA 3COMA 4GJ3A 3MFRA 3RAKA 4ACGA 5C4KA 3KVWA 2W1ZA 4DGMA 3WZJA 4BCIA 3OBGA 4JI9A 5EDRA 4EQUA 5IEVA 1DS5A 1MRVA 3Q9XA 3DTCA 3E64A 4ZK5A 4ERWA 2ETKA 5GHVA 4IX6A 3G6GA 3TNIA 1A48A 5GJGA 2X8EA 5KBQA 2WMQA 3HV5A 2PMOX 4A4XA 5FTGA 2PY3A 3KEXA 5E92A 4ZS4A 2ZJWA 4FK3A 3KY2A 5AUZA 2ITYA 3OY3A 3M2WA 3FMHA 2WEVA 3Q4ZA 4FVRA 2I6LA 4CTBA 4ZLYA 5HOAA 2IVTA 5GIOE 5HVKA 1XBBA 2BDJA 3P78A 4XJ0A 3A2CA 3I7BA 3OBJA 4LMNA 4C4JA 5AP7A 4GEOA 3VHEA 1H1RA 2PK9A 5JSMA 2RL5A 3OWKA 3S95A 2CKEA 2VTNA 3HV6A 3RI1A 2VWWA 5J9ZA 4ZTLA 2JFMA 2E9OA 2V7OA 3CY3A 4ITHA 4FT0A 5EQYA 4JQ7A 1Q4LA 1XQZA 4O22A 5CNOA 3EQFA 5ETAA 1TQPA 1WFCA 3D2KA 2EB2A 3DTWA 1KE5A 3E7VA 5ANIA 1PXPA 4I92A 4MYGA 4GFOA 5AR3A 4FEXA 3PZEA 3OXZA 4BDHA 4DG3E 3GOKA 4I5HA 3LCSA 4C59A 4MX9A 4ACHA 3GT8A 5FDXA 1U5QA 1KWPA 1RW8A 2HXQA 4MWHA 4NJ3A 4JS8A 2UZVA 4PDOA 3BHTA 4QMPA 5BPYA 3C7QA 4S2ZA 2C5OA 3OWPA 3TKHA 3SAYA 5ETIA 2I0VA 2PZYA 2LGCA 2W1DA 3MB7A 4FG9A 2WMSA 4KINA 4B9DA 4QPAA 3UGCA 3KVXA 2EXMA 1WBWA 3RBWA 3BQRA 4D4SA 3VF8A 3EN6A 3RINA 2X39A 2W96B 2UW5A 5C8KA 3IOKA 4CTCA 4PP7A 2WHBA 4QQCA 4F9YA 3ORNA 4I3ZA 2JKMA 1R0PA 4KS7A 5AWMA 1R0EA 1M7NA 2ZM4A 4DFXE 1BLXA 5I9XA 4PMSA 4ZTMA 4XV9A 2JGZA 3S1HA 2IO6A 2O5KA 3PRFA 1ZWSA 4IM0A 1SYKA 1XH4A 2XNGA 3RCJA 1YHWA 4LYNA 4D4VA 3PSBA 1TQMA 2P33A 3JUHA 4MNEB 5AP2A 4I6HA 5BMSA 3KFAA 4Y73A 3L1SA 4HYHA 4LOPA 2X4FA 3PLSA 4A9SA 1YHVA 5C1QB 1IRKA 3HDNA 2HENA 2GSFA 4R77A 2HIWA 3VNTA 4AN2A 4Y72A 3WF8A 4LV8A 2JKKA 5I3RA 3Q6WA 4CT2A 1XBAA 3Q5IA 3HUCA 3HA8A 5AP6A 1OB3A 2WEIA 3QBNA 4J8NA 4OBOA 5KMOA 3BHYA 5IQGA 4XG8A 3RWPA 3CXWA 3DY7A 4C62A 2ETMA 2IN6A 3C1XA 2XJ0A 5DFPA 4I24A 2VO0A 2PE2A 3OFMA 4IX4A 2IVSA 4RT7A 2Z7QA 2GFCA 4I4EA 4GH2A 4AOIA 3KREA 3AGMA 3IO7A 2HZ4A 4WNMA 4CXAA 5IMEA 3A7JA 2BILB 5FTQA 4ZY5A 4MXXA 4RJ3A 1H8FA 3LFEA 3LXNA 5CU0A 2QG7A 2CSNA 3G2FA 4FG7A 4JR7A 3ZU7A 3HECA 2PVRA 4YZMA 3GU5A 2Y9QA 4Q5EA 5C01A 3G6HA
chains in the Genus database with same CATH superfamily
2QOQA 5LMAA 3LFFA 5FEQA 3FZPA 4FSWA 1URWA 3E3PA 5T6KA 3FLYA 1Q97A 4FZFB 4TY1A 1B39A 3R8UA 1CSNA 2X2LA 3PY3A 4UWYA 5TT7A 3WYYA 4D5HA 3S00A 2BHEA 2R3LA 3NWWA 1EH4A 2J90A 1WMKA 3O0GA 4CNHA 3FUPA 5LCKA 4DFLA 3F88A 1PXJA 2J0LA 3QXPA 3PSCA 2PZPA 2W1EA 4IE9A 4W9WA 3TV7A 4LDTA 3LW0A 4U45A 4PL4A 1Y6AA 3R7GA 4JBVA 2B4SB 5EK7A 4AF3A 4F09A 4WOVA 2QODA 4P5QA 3W0QA 4B0GA 3H9FA 2YCSA 4JDHA 4RFZA 3DDQA 4Y46A 2W1HA 3PVBA 4NU1A 5AAFA 5FDPA 2VWVA 3QCYA 3QC4A 3ORTA 4ARKA 3UOJA 2X1NA 3HYHA 5KKRB 5DR2A 2WQEA 1YDRE 5A4TA 3IW7A 3PIYA 1PW2A 3PG1A 3ORMA 4BIBA 3CEKA 4M14A 3R1NA 3ZRKA 1E1VA 1SMHA 1ZMVA 2DS1A 2VX3A 3KC3A 4HNFA 5CF5A 2ITWA 5JGAA 1H1PA 4QMVA 5JT2A 3BE9A 3EQIA 4YR8A 4G5PA 5CI7A 3UZTA 3UP7A 2VGPA 4JBOA 4K2RA 4MF0A 4O21A 4RG0A 4U41A 4UY9A 5JFWA 4GG5A 3EN4A 4PY1A 4ZXTA 3QUDA 3EN5A 4HJOA 4ZY6A 3ZSGA 3TUBA 2BVAA 4O4DA 4CFUA 4X7QA 2IZTA 3L8SA 4X2JA 3O7LB 5FD2A 2X7OA 4D1XA 3FEGA 4FTOA 1YXSA 2X0GA 4GJ2A 2OW3A 1XJDA 2O65A 2XF0A 3WIKA 3QX2A 4H3QA 3FY0A 4ASDA 4KBKA 2E9PA 3GOPA 3QQFA 5FEDA 1P14A 2H34A 3BGQA 5KMJA 2PE1A 3MIAA 2VU3A 3F5UA 3HMOA 2HELA 4LUDA 4BKZA 5LJJA 3D94A 3TEIA 3SGCA 1QPEA 4XS2A 3TL8A 4CZTA 1R78A 2E9UA 4NUSA 4O4BB 4S34A 2OFVA 3F3VA 4WG5A 3W0MA 4ONAA 3FSKA 3E8DA 2HOGA 4BCOA 2XA4A 3TDVA 3UZPA 2HYYA 4C34A 3WIGA 3LFSA 5IISA 4NM5A 4L8MA 2Y4IB 3EN9A 2G15A 3E92A 1OKWA 3GU7A 4FV7A 4HYSA 3CS9A 3NMUF 2BUJA 4NWMA 4BCMA 2NP8A 3C0GA 2R4BA 4GRBA 3FZTA 1UNGA 1YKRA 1ZYSA 4FZ7A 4UN0C 4XUFA 4RQKA 1GOLA 2GNFA 4KUJA 2XRUA 2VUWA 2Z7RA 4FNXA 3PPJA 4IC7A 3MFSA 4M97A 2X9EA 3PY0A 4DLJA 2OWBA 3PPKA 4FKPA 2ZB0A 4CEGA 3UQFA 5GIPE 1OUKA 1OGUA 1WCCA 3HLLA 4M0ZA 2J0JA 3AQVA 5F94A 3ZM4A 4Y8DA 3LAUA 1Z5MA 4RIXB 1NT2A 4GK3A 2WMWA 3C4CA 4EOPA 3AOXA 3A4OX 3H9RA 4YTHA 4NW6A 4IZ5A 2C47A 1P5EA 3UIMA 1VYZA 2CPKE 3O5AA 5E8VA 5A46A 3LXKA 3PIZA 4KKHA 4XP2A 4LGHA 4FKGA 4OR5A 5H8GA 1H08A 4DEGA 5IPJA 4DEDA 3IW8A 2W1GA 5E8SA 4EH9A 5K4JA 3CP9A 2LAVA 2QO7A 5AP1A 5AP3A 3W2SA 4ZZOA 3R22A 3CSVA 3BZ3A 4OGRA 3VO3A 4U8ZA 4RC3A 4FTJA 5HVYA 4DG0E 1XH5A 4XH6A 4OT6A 5FUTA 4HGTA 3SKCA 2VTHA 1J7UA 5HBJA 3LXPA 3MVJA 3FKLA 3ZFMA 2XAOA 4DFBA 4MNEA 3UYSA 3F2RA 2GTMA 3MFTA 4UMPA 3GEQA 2G01A 2ZOQA 3UDZA 2VTLA 3QTQA 4IM2A 1FOTA 3C4WA 4MHAA 4MKCA 4O7LA 3HUBA 4OTWA 4RRVA 2J0KA 4GVAA 3GBZA 4DN5A 5L8LA 2QR7A 5TF9A 3HVCA 5HX6A 4FMQA 1S9IA 4S32A 2V5QA 4HNIA 1ZY4A 2AQXA 3RP9A 3QRKA 4DCEA 4F7LA 5J79A 3F7ZA 1PKDA 4HPUE 4LG4A 4QTAA 4W4XA 2YISA 3AMBA 2ZMDA 3FXXA 3NW6A 3PP1A 4O82A 5HVJA 1I09A 3DXPA 2YHVA 2OH4A 3IOPA 5E1SA 4QP8A 4FIJA 4MEDA 3H4JA 3LFNA 3R7EA 5B2MA 3AD5A 3R28A 5LXMA 3CLYA 3W0RA 3OWJA 2NO3A 3IW6A 3MSSA 3NR9A 3PP0A 2X81A 4YO4A 4M12A 4E6QA 2R3MA 2GTNA 4MF1A 4AZSA 1WZYA 3DKFA 1AD5A 3PXYA 3U4WA 2BPMA 2XIXA 3BCEA 4CKIA 4PL5A 4IDTA 4DITA 4ZLOA 4ANQA 4AT4A 5EM6A 4CMOA 4MXAA 4O4CA 4EOJA 3R71A 2QNJA 4IWPA 4FYOA 5CTPA 4FSZA 5FBNC 4IVCA 4X21A 4KKEA 2CCHA 1PKGA 3R2BA 3PXKA 3QZIA 5CVGA 4DH7A 5JZJA 2XCHA 3RPSA 4RWIA 2ITZA 4IB3A 3H30A 3EOCA 2YCQA 3OEFX 3FY2A 5CX9A 2HW6A 4NTSA 3CE3A 4FL2A 4EOLA 4L46A 3UZRA 4AGWA 3OCSA 5KMMA 2G2HA 2XZSA 5CWZA 3CY2A 4U5JA 1PF8A 4NTTA 3D5XA 4O0WA 1PRYA 2QG5A 5DNRA 3G15A 4ZAUA 4L3JA 1SVHA 3Q96A 5DR6A 3PA5A 3LKMA 4EBVA 4FG8A 3Q6UA 4RWLA 4O4EA 4YC8A 3P23A 2WTKC 5CEMA 1NVSA 3OWLA 4EH5A 3NUXA 2XEZA 3MVHA 3P9JA 4KKGA 4ORKA 5AV4A 2NPQA 3ZCLA 3ZSHA 4PNIA 3TXOA 1YOLA 4YZBA 5AV3A 4JL9A 4CVAA 4NYEA 5BYZA 1MRYA 2SRCA 3TNHA 4ZJIA 3W2OA 4EH6A 3ZC5A 2ITTA 4ZJVA 2XH5A 4RWJA 1FQ1B 2WFYA 4FIEA 4BDEA 3R9RA 2VTOA 1ZOHA 2P4IA 3KQ7A 4Y95A 4FKIA 4EOKA 1V0PA 2CKOA 3O2MA 3JXWA 4PTEA 2ACXA 3R1QA 3UQCA 1WBNA 4DGNA 1WBTA 1M7QA 1DM2A 5BVFA 5CZHA 5IH4A 4MNFA 5HHWA 4FE2A 4DH8A 2XAMA 4WHZA 2PVJA 3QAME 4DTBA 2OG8A 2QQ7A 4O0YA 4MH7A 1DI9A 5AX9A 3SOAA 4ACMA 4DEHA 4FTIA 2XM9A 3DKGA 4WBBB 4ZOGA 5DBXA 3EMGA 2W4JA 3F3WA 3VULA 4O84A 3EQGA 5D9HA 2I0YA 3ZTXA 4G16A 4MXOA 4S33A 5J8IA 5CQUA 3RZBA 3BEGA 3F3ZA 3NUSA 3RK7A 5L2SA 1KUTA 5AV1A 3H0YA 5BX0A 2H8HA 3D5WA 1OL7A 4FC0A 4L52A 3CTQA 4V04A 4H36A 3UP2A 4E4MA 3N4VA 4TYHB 5FP6A 1JVPP 1Q24A 2UW4A 3NUNA 4OTIA 2RFEA 2R3QA 3OTUA 3HGKA 4R7HA 3IDPA 4BGGA 1X8BA 5KBRA 3D5UA 3HRFA 3OOGA 2REIA 3G0EA 4U97A 3QWKA 4PP9A 1YXVA 5AIRA 4O7WA 1PMNA 3FV8A 3FHRA 2C69A 5CAPA 4W4VA 2WQOA 1JSVA 4J95A 4M66A 1H01A 3ZHPC 4E1ZA 4YHFA 2A2AA 3QQUA 4RIXA 2WAJA 5TE0A 3IG7A 5C4LA 1A06A 2RKUA 2X4ZA 2WELA 3LM5A 4AZTA 4F64A 5HIEA 3EKKA 2WXVA 3NZ0A 5G1XA 2ITVA 4BBMA 1ZOGA 2OZOA 2GHGA 3DNDA 4QTDA 5EKNA 4BDFA 2VTPA 4P4CA 5DVRA 4L01A 1BYGA 4FIGA 3QD3A 4MXCA 4TYIA 3HMMA 4I5PA 5EI2A 3L9LA 4LRKA 4NT4A 3W2RA 5E90A 4HVDA 4FV0A 1NY3A 4J1RA 4MD8E 4E3CA 4XG6A 2J5FA 3DDPA 3DOGA 2ONLC 4QTCA 5HO8A 4BDJA 4D5KA 3IQ7A 4TYJA 4UMQA 2GS7A 4UXQA 5DHJA 2I0EA 3UDSA 2J51A 4EBWA 4FTCA 1LPUA 3DB6A 3ROYA 5DOSA 3V5PA 2J2IB 3K54A 4NCTA 3QCQA 2ZVAA 3UOKA 4K0YA 3CJGA 3DJ7A 4ENYA 3RPRA 1W82A 3ACJA 1H28A 2XB7A 3QKKA 2XK9A 2EXEA 2VNWA 4IDVA 2OIDA 4YZNA 1OMWA 4EK3A 1YQJA 4UMUA 4P5ZA 3DJ6A 3MWUA 3KRJA 3I5ZA 3R73A 4JDIA 4ALWA 4FSYA 3V3VA 4AU8A 3FI3A 3WI6A 3BYSA 4OUCA 4BWKA 2YDJA 1OKYA 3EQDA 1M14A 2YIRA 2BTRA 2QO2A 3DQXA 3QD0A 4YZ9A 5T3QA 4N57A 3QF9A 3ZLWA 2VWZA 1JQHA 2R3HA 4BCNA 4UYNA 2YIQA 4OAUC 2FSLX 3ZS5A 3R7IA 2BRBA 2XBAA 4GIIA 4IM3A 4O86A 1YW2A 4I41A 1XH8A 4FV5A 3TTJA 3R8PA 4DF3A 1GIIA 4II5A 2CLXA 3QQHA 3IGGA 2UUEA 4IAZA 5JMSA 1Z9XA 2BKKA 2BIYA 4UX9A 2YCFA 4Y83A 4X2KA 4N6ZA 2XYUA 2QONA 4G1WA 1YVJA 3VS1A 4L45A 4USDA 2W0JA 3BX5A 3ATSA 3N4TA 2W1FA 4O0UA 5TOZA 2ETRA 4AFEA 5EDQA 5CS6A 4CV9A 5D7VA 4YHTA 4IBMA 2Y4PA 2W5BA 3L8VA 1L3RE 3QZFA 3QKMA 4OTRA 4EEVA 4YPDA 5KHXA 3WE8A 4W4YA 1QCFA 4YZCA 3T3VA 5FBOA 3TNWA 2OKRA 5M51A 4IWOA 1BL7A 4CYJA 2YM8A 1JSTA 2YABA 4F9WA 4EQCA 3GU6A 3R9NA 4FUXA 2IW8A 5KKRC 2BFXA 2DWBA 2YAKA 4BGHA 4ZSAA 3R6XA 3W0OA 1G8KA 2VTRA 3ERKA 3L8XA 1JKKA 3FXWA 4E8AA 2PUIA 3SV0A 3NFFB 4G3DA 1ATPE 4HYIA 2X7FA 3TMOA 4X3FC 2YM7A 5AM7A 1ZLTA 1JSUA 3MA6A 3VUTA 2GQRA 3L9MA 3VUMA 1PMUA 4BHNA 4ALUA 2XKEA 3FL5A 2XK3A 5BUEA 4L43A 3KRLA 4QP3A 3EIDA 4QP4A 4H3BA 3U87A 4OW8A 5FRIA 2CJMA 1SVGA 5C8MA 4M15A 4ANNA 2PVNA 4OTQA 5FP5A 4CRSA 2I1MA 5EW3A 2ITNA 3GFEA 4WRSA 3IPHA 4CQGA 4IB5A 4M84A 3BPRA 3OROA 5H2UA 3FBVA 3O71A 3V8SA 4D58A 3LLTA 4D4YA 5DT3A 3GUBA 5KZ0A 4FTAA 1QL6A 4DHIB 5GINE 5CYIA 2WTDA 2QOOA 3LQ5A 3GCVA 5JFVA 1QMZA 3DV3A 4FSTA 3W8QA 4BDBA 4EH4A 3D83A 4FV9A 4AP7A 1YI6A 5CNNA 5HKMA 5IUHA 2BDWA 1Q3DA 3GC9A 4G31A 4U7ZA 2AC3A 2BZIB 3U6IA 4TT7A 2ITPA 4I6FA 3TZ8A 4O91A 5AR5A 1MQ4A 5B0XA 3P08A 4PV0A 2R3KA 3R1SA 2C6DA 4YJSA 5D7AA 4QP9A 4QQJA 3FZRA 3QALE 3EWHA 4FTQA 2UZWE 3CD3A 4FZAB 4IC8A 3W55A 5CEOA 1MRUA 3DXNA 2XIZA 4IZYA 5FM2A 4NM7A 1V0OA 5GZ9A 1LEZA 1RE8A 1KE8A 4TZRA 2Z7LA 5E8TA 1VEBA 3R9HA 2VNYA 2O64A 1GAGA 3BKBA 3AC1A 3BU6A 4ZTHA 3LVPA 4NM3A 4YHJA 2FB8A 5EI8A 3NVKI 2QU5A 3Q04A 4I5MA 2RG5A 5HNGA 5K5NA 4D4RA 5DE2A 4RSSA 3VBTA 2J6MA 3ZXTA 4AN9A 3KIOC 4XV1A 4ZP5A 1B6CB 4WO5A 2GNIA 1XH7A 2BIKB 2XK7A 3Q9ZA 3UQGA 4ID7A 3TTIA 4E26A 5CQWA 1UKHA 5LMKA 3Q53A 4FSMA 5HCZA 4Q2AA 4YNEA 1ND4A 3ZZEA 2QKRA 3PE2A 5L2TA 3VIDA 3EQHA 3TZ7A 1R1WA 3S3IA 3LCDA 3NCGA 5HU3A 4BIDA 5KMLA 3R63A 3TV4A 2Y0AA 3ZEWA 4D0XA 3MS9A 4FF8A 3OP5A 3KN6A 5AV2A 3KCFA 3G5DA 3RKBA 4ZMEA 2QI8A 4BDAA 4FV3A 5BVDA 1OKVA 2J0IA 4QDEA 2WNTA 4ZS0A 3A7HA 5JK3A 2BZHB 2WGJA 3OS3A 2O63A 4M67A 2B9FA 2OU7A 3E87A 4MQ2A 2CN8A 4AGDA 4CFVA 4TYEA 2X0OA 4AA4A 3W33A 3DU8A 3LJ2A 3DPKA 1OKZA 5IUGA 4G3GA 4HVSA 4AA0A 4XRJA 5AEPA 4QYEA 1ZMUA 3D5VA 4XG3A 4ZSJA 5E7RA 3P86A 5E8WA 5ACKA 2VTAA 3N51A 1REJA 4MD9E 1DAWA 4XLVA 2JBPA 3VJNA 4TWNA 5A6OA 1Q61A 3AT4A 4JNWA 5HO6A 3D7ZA 1FBNA 3ZXZA 1UU9A 3ZH8A 4EK6A 5AX3A 2R7BA 5CLPA 4EH2A 3FLSA 3OY1A 4ASZA 1ZZLA 4YU2A 1OBGA 2Z8CA 4B99A 2CNQA 5JEBA 4R5YA 1SZMA 2H96A 1GNGA 3FLQA 3QYZA 3Q32A 3PJCA 1PY5A 3UMWA 5K9IA 3I1AA 5LVNA 3LLAA 5JKGA 5CU2A 4G5JA 2R3IA 2VO6A 1DAYA 1V1KA 1REKA 2YM6A 3P79A 4X6RA 1ZY5A 2AUHA 3BU5A 4NZWB 5KHWA 2QVSE 2XKDA 2WMBA 4DTKA 4LMUA 3DCVA 3FMDA 3M42A 3CKWA 3U54A 5EM8A 2QU6A 3CTJA 1OPKA 2BZJA 3C4ZA 4X6QC 2B9HA 4AOJA 4BVUA 5FG8A 2P2IA 3TM0A 4O38A 1PYEA 2VX0A 2UZEA 5AUYA 5HD7A 2PVLA 4YTIA 2JC6A 1OZ1A 4HVIA 1AGWA 5CXHA 4D9TA 2B53A 4O7RA 3ORLA 1TQIA 4EHZA 1W2FA 3PVGA 3PXQA 5ANJA 2BRNA 3ELJA 1XBCA 2J0MB 3ACKA 4L53A 3MY0A 2IJMA 3FYKX 4K11A 3HMNA 5TR6A 4QMTA 5ANEA 2C0OA 3NUPA 3W18A 1BUHA 2JKQA 3KA0A 4PQNA 5BUIA 3EYGA 4BWXA 5AR7A 4FKVA 3SW7A 3NUYA 2AEGA 4LL5A 2HXLA 1PMVA 2CGXA 2QOLA 3EQPA 4IAYA 1XH9A 4MCVA 4QMWA 3SW4A 4C38A 5IA0A 4J8MA 5M06A 3E8NA 4R1VA 2O2UA 5EG3A 3LJ0A 2R7IA 1Y57A 1CKIA 3DAJA 3ROCA 3V5TA 1J7LA 3DAEA 1Q99A 2XCKA 1PXIA 3NAXA 2C6EA 2FSMX 4GG7A 3S0OA 5CAVA 3R7UA 1VYWA 5L2QA 5J7HA 3ZDUA 4TWOA 2HK5A 4BHZA 3O7LD 4IJPA 4JX3A 3ID6C 4DCAA 1OIRA 4MTAA 3FXZA 4R3RA 5CU4A 3LPBA 5AP0A 2UW3A 3PIXA 3AKJA 4AAAA 2IVUA 4C8BA 5HIDA 2YZAA 3TCPA 4C37A 3HAMA 3FZOA 3FAAA 4G6LA 5CSHA 1Q62A 3AMAA 4J71A 2GFSA 2FYSA 2UVZA 4AXDA 3QL8A 2HW7A 1CM8A 4M8TA 4L9IA 4RX9A 4UZHA 5IKWA 4D2VA 2C6TA 4I0TA 4DFZE 3RJCA 3PYYA 3PFYA 2BAQA 3D15A 4AZVA 3LFBA 5KMNA 3U8WA 3MJ1A 3QTZA 3QFVA 1DI8A 1T46A 4LV7A 4FX3A 4I0SA 2P55A 4BZOA 2WTJA 5L2WA 4ERKA 5KX8A 3BYOA 4JMQA 2X0QA 2XS0A 4AACA 4TW9A 2PVMA 3POOA 2A19B 3BIZA 4WD5A 3QQLA 4XBRA 3GVUA 1WVWA 2C6LA 2JIVA 2VTSA 3LJ1A 2W9ZB 3IS5A 3K5UA 3LCKA 3QRTA 4FVPA 5HNBA 5JFSA 1GIHA 2W4KA 4MAOA 5BVKA 2PUUA 3BRBA 4ALVA 3EZRA 5GZAA 2JDTA 2C3LA 1YDSE 2Z60A 2YZLA 3HNGA 5L6PA 4Z9LA 5CU6A 5HNIX 4CKJA 1JKSA 1Q5KA 3HP5A 1Y91A 3EFKA 3I7CA 3R02A 2PZ5A 3OCBA 4XP0A 4QOXA 4BY9E 1Y6BA 1YXTA 2GMXA 4D2RA 4AE6A 3QA8A 5DYJA 1YXXA 3O96A 1ZYLA 2J9MA 4BYJA 3C9WA 2PVHA 4H39A 5E4HA 2HWPA 3R30A 4C02A 1GZOA 4WNOA 2EUFB 1KE7A 1OL6A 3RAWA 2HAKA 4QMQA 1JKTA 4ZZNA 5AUUA 5CAUA 1RQQA 3FMKA 3VRYA 3OT3A 4U79A 2C6KA 2R3JA 3EJ1A 4F99A 3R0TA 4FV2A 2XK4A 4NKAA 2PE0A 5DT4A 4NFNA 4GSBA 5HE3A 3A7IA 4OAVB 2JKOA 5AFVA 3NIZA 2I7QA 3RALA 1LR4A 3DS6A 3EHAA 2VN9A 1BL6A 2BCJA 3GP0A 4DT8A 4BCFA 3GENA 3TNQB 2ERKA 3OD6X 5BVWA 3R21A 4NKSA 1W2CA 2OLCA 4L3LA 3LMIA 3IGOA 3VRZA 5ITAA 4BJJB 1WVXA 4NSTA 4YSMA 3VUHA 4BYIA 2ZDUA 4CFMA 4FL1A 4BCPA 4Y5HA 4FTNA 2YERA 3W8LA 1MUOA 3QKLA 3MPTA 4L44A 4X3JA 2CNUA 1H4LA 2JDRA 2ESMA 3KMUA 4FBXA 2FSTX 4AUAA 4QMXA 4ANMA 3OXIA 3UVQA 3T3UA 5CF4A 2OJJA 3AT2A 1FVTA 4D2WA 4EWQA 3BV2A 3C0HA 5I4NA 3S4QA 4EJ7A 2JIUA 3KGAA 4YJQA 3THBA 5M44A 3HAVA 2QOIA 5EQEA 1VLRA 2ERZE 3ZDIA 4MBJA 4QYHA 3OT8A 4YGAA 4N0SA 4BF2A 3LXLA 4EHVA 4CYIA 3BBWA 4FT9A 4NJDA 4O6LA 4PTGA 4U9AA 5EHYA 4AW1A 5AAGA 4FTUA 3WZKA 5J1VA 4ZLZA 4RVMA 4KSQA 3GCUA 4YPSA 5D12A 2FO0A 4MUQA 3VBYA 5LVMA 3M11A 4C7TA 1PJKA 1W84A 1JKLA 5IQBA 3W1FA 3MH2A 1H1SA 4C57A 4E5WA 1ZXEA 3R83A 2UZLA 3CTHA 4HGLA 2QOCA 3B2TA 5AR8A 4C58A 3II5A 3UVRA 1UVRA 3EL8A 4I4FA 1FGKA 1NXKA 4EKKA 2JDSA 2C4GA 3OMVA 3JY9A 4AGUA 2XVDA 4FKJA 1K2PA 4I93A 4NEUA 3RHXA 4APPA 2E2BA 2Y6MA 5EYKA 2F9GA 2JEDA 2R0UA 2XP2A 4L68A 4V0GB 3ZUVA 4IWDA 4BB4A 1YXUA 3KKVA 5BUJA 3ODYX 3LZBA 4I21A 3L9PA 2CGUA 3VQUA 4CMTA 5BYYA 5FXQA 4K18A 5AR2A 2YIXA 1QPDA 3RNYA 3BGZA 3AKKA 3NLBA 5D10A 3COKA 3QYWA 4LGDA 1U4DA 3VWAA 3FPQA 5HG8A 3IONA 2IZUA 2HWOA 4GIHA 1CTPE 2RIOA 3QUPA 5M56A 3UC4A 2RSVA 3OG7A 3R1YA 3TACA 4EH8A 3Q3BA 3VAPA 4RX5A 5CENA 5CF6A 5J5SA 3AC3A 1H24A 3COHA 1Q8TA 3ODZX 3MIYA 4PPBA 4U44A 4Q9ZA 4GCJA 1KE9A 3P5KA 2WTIA 4QMYA 4HCTA 4YJTA 5IF1A 3R01A 5IZFA 3V6SA 3F9NA 5HEZA 3V51A 3ZEPA 5IA2A 3KRRA 4QMOA 2R3RA 5CXZA 5L8JA 4XYFA 3C4EA 3W16A 4C2WA 1Q8ZA 3W2QA 5CASA 4BCGA 4Q9SA 3IW5A 4FKQA 2XM8A 1UWHA 4G3EA 2C3KA 4OT5A 4PMPA 4JVGA 4XG2A 3BWJA 3M1SA 4KRCA 5AUXA 2RF9A 4F7JA 4LUEA 3UDTA 4O1OA 3UE4A 2VTQA 4FEUA 3FI4A 2V55A 2IZRA 3MI9A 1XKKA 3E5AA 3IK3A 2CLQA 3C4FA 4GT5A 2C0IA 3SA0A 4IIRA 4KBAA 5CZIA 4F0FA 3LMGA 4L7FA 3A4PA 4QP6A 4DINA 3FI2A 2PULA 2BAKA 4YJNA 5LVOA 1BI7A 4TPTA 3R7VA 4ANBA 3TN8A 2C5VA 1MP8A 4G34A 3W2CA 3QTUA 4Z7HA 2WTVA 4DH3A 4FSQA 3VC4A 3LFDA 1PXOA 3F3TA 3TZ9A 4OTPA 4ACCA 1IASA 4O1PA 2VTIA 4RA5A 4CFXA 2XIYA 2WPAA 4RJ4A 3DK7A 3EKNA 5BYLA 3HDMA 3QHWA 2E9NA 3MPMA 3QQGA 2XIKA 1WBOA 5HCYA 1H07A 5CALA 4ZTQA 2X6EA 1G8AA 1XR1A 2JFLA 3E7OA 2W5AA 4XMOA 4PDSA 5HZNA 2GHMA 4FGRA 2OK1A 3CIKA 2G2IA 2GS2A 4F7SA 3RAIA 3RMFA 2FA2A 1W0XC 5A14A 2OF2A 4EWHA 3H10A 5FM3A 3CQWA 4LFIA 4ZTRA 5M08A 2PL0A 4A4OA 5IDPA 3I4BA 3LMHA 3ORIA 5ANGA 1IAHA 4IB0A 5DH3A 3DZQA 3ULZA 2C68A 4BL1A 3UIUA 4BRXA 2G9XA 3O23A 3RK9A 3W10A 4A07A 4AQCA 3R7OA 2W99B 4YLJA 3PZHA 1FVRA 3ENHA 4M3QA 3FMJA 4R5SA 3RPOA 3V6RA 4CFNA 4Y5QA 3SRVA 4BJJA 2OXXA 5CT0A 1SNUA 1FINA 5JRSA 5IEYA 4GUBA 3ZO1A 4FZDB 3P7BA 4G9RA 5IA3A 3LIJA 3NX8A 4HYUA 5EM5A 4R3CA 5HE0A 4BDIA 5EQPA 5IQHA 2YWPA 4IMYA 3D9VA 4ZZMA 3ZM9A 2QOKA 4BFMA 3TG1A 3F5XA 4U3ZA 3TNPC 3MH3A 4FNWA 5L8KA 4FTTA 2JITA 3HV4A 3QX4A 5LOHA 2HZNA 2R9SA 5E91A 3ET7A 3ULIA 4IACA 3VS6A 4QMNA 1ZMWA 3TUCA 3FL4A 5IG1A 4GU9A 4WG4A 3PJ1A 2B9JA 2PHKA 4QP1A 5EHLA 4EYJA 3HX4A 5EDPA 4DDIA 2UW7A 4IW0A 3WF9A 2YAAA 4C36A 3GFWA 4PL3A 2YACA 3I5NA 4FRFA 5M4CA 3TJCA 1OI9A 4CD0A 2PMIA 5BNJA 5FGKA 3SX9A 2X8DA 3FLNC 3BV3A 4RVKA 4FOCA 3VS2A 4G9CA 2RFDA 2QLQA 3MW1A 4CMUA 3C5UA 4XOYA 4RIWA 1IAJA 3U6HA 4K9YA 1UA2A 4EJNA 4O6EA 1Y8GA 5KNJA 3RPVA 5H3QA 4EZ3A 4DDGA 1BX6A 1XO2B 2CKPA 3B8RA 3BYVA 1H0VA 1YRPA 2PWLA 4A9RA 2KULA 1OIQA 3SD0A 3R8VA 1JLUE 3UOLA 4CZUA 4HGEA 4V0GA 4R7IA 1M2RA 4JQ8A 4RLKA 4PMMA 3DLZA 4F1OA 4I6LA 1WBSA 2OO8X 1JBPE 4FGBA 4O0XA 4AAYA 1H26A 1LEWA 3QQJA 4RQVA 3ZRMA 4JOAA 2X2KA 5HE1A 2JAMA 3PXRA 4L67A 4B6LA 4JT3A 4RFYA 4FSUA 4OLIA 5A4EA 5IA5A 2WQBA 4MK0A 2F7EE 4HW7A 3AC8A 4ZSGA 5CANA 3EFJA 4O7VA 2C1BA 3QGWA 4DHJA 2F7ZE 5CI6A 5DRBA 4YJRA 5HLPA 4QPMA 5J9LA 4KA3A 4PDYA 3ZO2A 4IX3A 2GNHA 1Y8YA 4F6UA 5AAEA 2XNEA 2IG7A 1WBPA 4DGLC 4IADA 2C0TA 3UODA 3DK6A 3ZLSA 5CSVA 1J1BA 3DBDA 3FQHA 2I0HA 3NYXA 3FKOA 3QWJA 5CEIA 3COIA 5M4FA 3RAHA 3V04A 4M68A 5IA4A 1YWVA 2EVAA 3DBQA 2ZV8A 3FHIA 5I0BA 3W2PA 2O8YA 4FKLA