3QAME

Crystal structure of glu208ala mutant of catalytic subunit of camp-dependent protein kinase
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
350
structure length
348
Chain Sequence
GNAAAAKKGSEQESVKEFLAKAKEDFLKKWETPSQNTAQLDQFDRIKTLGTGSFGRVMLVKHKESGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVAGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPAIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFTEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cAMP-dependent protein kinase catalytic subunit alpha
publication title A conserved Glu-Arg salt bridge connects coevolved motifs that define the eukaryotic protein kinase fold.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase/transferase inhibitor
total genus 116
structure length 348
sequence length 350
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2011-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3qamE01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3qamE02
4KS8A 2FVDA 4FIGA 5HD7A 2RFDA 4PTEA 2R7BA 1UU9A 4QYEA 5DI1A 2WMTA 3RM7A 3G33A 2FSOX 4BGHA 4OR5A 3T8OA 1VYZA 3PVWA 1UU3A 4MBIA 3ROYA 5A4QA 4L7FA 5BVDA 2GNJA 5I9YA 2X8IA 4D28A 3LVPA 4D4SA 2YM7A 5K4JA 3D0EA 4K11A 3FE3A 2ITWA 3HMOA 4MF1A 3VQHA 1J3HA 4XG2A 1DS5A 1YDTE 3FLWA 4BDJA 3G5DA 2IWIA 2C6TA 2PVNA 1J7LA 1F5QA 4HJOA 5A6NA 4QO9A 4PX6A 3KK9A 4TPTA 4RFYA 3D9VA 3R21A 4GKHA 5E90A 5AP0A 3KGAA 2WFYA 3QTWA 3HV7A 3VBWA 4MWIA 5EI8A 3LMGA 5GJFA 4DG3E 3C13A 2VX3A 4H3PA 5E92A 2FSMX 3RALA 4NCTC 3ID6C 2B52A 4GEOA 4UZDA 1IAJA 4YHFA 5KMNA 3HKOA 3NUXA 5AP2A 2ONLC 2WU7A 4IZ7A 5DG5A 3RCJA 2X4ZA 5H8EA 3GU8A 4U40A 4JT3A 4R1VA 4O7NA 4DEEA 3DKOA 4S31A 4LGGA 1RQQA 2XCKA 1RDQE 1FQ1B 2ITOA 2AC5A 1DAWA 4EK3A 4RJ6A 3DZOA 2FB8A 5EW8A 3KCFA 4X2JA 4LRJA 2X2LA 3HNGA 3CTQA 4JG8A 4PL5A 5EK7A 4EEVA 4FL2A 3OFMA 4U5JA 2JEDA 2XIXA 3EQRA 3QRJA 1J91A 2RFSA 2ERKA 5F20A 3PY0A 3PA5A 5AV2A 5EYDA 1JKKA 4HCVA 3G6HA 1REJA 2OI4X 4CRSA 5IQDA 4PV0A 5HBHA 1PJKA 3UBDA 3WZUA 5ETAA 3GT8A 3OHTA 4Y85A 3RVGA 4FT3A 3ZDIA 3ZBFA 3OWKA 1XBAA 4XG4A 4BTJA 4E4XA 5A4EA 4FSQA 3TKIA 2FUMA 5FEQA 4K8AA 1R0PA 3R1SA 5AMNA 4EOOA 3Q9ZA 4I94A 3ZSGA 1OZ1A 2R64A 3FMMA 4L43A 2ITZA 5J1WA 4W4YA 2UW4A 4KABA 4F7JA 3ZH8A 2C6MA 4L6QA 2H8HA 3NYNA 3DV3A 4I4FA 3VUMA 1S9IA 3KKVA 4O2PA 5ANDA 3P4KA 5TR6A 2OJJA 3KXXA 1YXUA 3G51A 4XUFA 4QP8A 2J0JA 5ANOA 2QURA 4X7QA 2XIKA 3PJCA 4WG3A 4O2ZA 4QMVA 2BRMA 4N4SA 2HW6A 1H25A 2WTIA 4MYGA 1HOWA 4BKJA 2QR7A 2C6OA 4AFJA 5BYLA 3GU7A 3UNJA 2OK1A 3V8TA 2VWYA 1P5EA 1VEBA 3R1NA 4A06A 1DAYA 2GQGA 2F49A 3NNWA 1NA7A 2QKWB 3QC4A 4MWHA 4EH8A 1KOAA 3R8MA 2GNLA 4F9BA 2A2AA 2PUNA 2Y6OA 1URCA 1JKSA 3FPMA 3QQGA 2PMIA 2WPAA 4E4MA 3R7VA 5EYMA 4Q9SA 4YPDA 3T3VA 2XVDA 4F70A 4AZEA 4BCQA 2NPQA 5HICA 4IZ5A 4FVQA 3ACJA 2W1DA 5FP5A 4QMQA 5HOAA 4F0GA 1O6YA 4XRLA 3RPOA 3PA4A 4MNFA 3NEWA 4FNXA 5EI6A 1WAKA 4O86A 2Y8OA 5C8MA 2OIDA 2WHBA 2Q0NA 4Z7HA 3G6GA 3LKMA 4HVDA 3L9LA 5KHXA 4LQMA 1H1PA 1EH4A 3I79A 3QD4A 5DWRA 4MTAA 5HZNA 4RJ4A 2CSNA 4GYGA 4ALUA 4APPA 4IW0A 3NSZA 4PMPA 3LCOA 2YIWA 3F82A 4OLIA 4CFVA 5FTGA 4QMLA 4XHKB 1UKHA 4QTCA 4AN2A 5L4QA 3NWWA 2X8EA 4BDGA 2J5FA 3D5WA 3MVHA 3NNXA 3ORIA 4GRBA 4F9CA 3QQJA 4R8QA 3UP7A 2R3MA 1JSUA 3CD8A 4JRVA 4DCAA 3AC4A 3L8XA 2Q83A 2BAQA 4CMUA 5T68A 4LM5A 2W5AA 4V0GA 5CX9A 4JG6A 5FG8A 2VD5A 4EOIA 2XB7A 4RPVA 3UOJA 5FUTA 5CAUA 4L3PA 1SM2A 2EU9A 4L52A 3OCSA 3GB2A 3FL5A 4XP3A 1PMEA 4EWQA 3QRIA 2X2KA 2BIYA 2ZM4A 1IA9A 4CZTA 4EH3A 5EI2A 3V5TA 5K9IA 4NSTA 3NUSA 4KKHA 4QQ5A 4DN5A 4ASXA 3SRVA 3MTLA 4EH7A 4ZAUA 4HPUE 5CY3A 3M11A 4BGGA 2UV2A 3MY5A 4E7WA 3A4OX 4FV6A 5DR2A 4CKIA 3DXQA 5EDRA 2ZB0A 4MXOA 4FSTA 4U3YA 3MV5A 5AIRA 3V6SA 3ORZA 4IM0A 4FK6A 3PP0A 3PRIA 1H00A 3A8XA 2UZTA 4NM7A 4RRVA 4O0UA 5C4KA 3EFKA 1BUHA 4HVIA 2R5TA 3CGFA 4FV1A 4D5HA 2UVXA 1OKZA 3QGYA 2XYUA 3NNVA 3FV8A 4DFYA 2G15A 2YITA 1M14A 3R71A 4XX9A 3MWUA 3ZO2A 4ZJIA 5AAGA 5JN2A 3UOLA 2PUUA 4O7ZA 4FKGA 5IQEA 3R7GA 4EBWA 4OBPA 2UZOA 3UNZA 4NM0A 3KXGA 3KFAA 1YOJA 4YJTA 5IMXA 3LOKA 1Q97A 2R3KA 3DY7A 4FK3A 4EC8A 3UMWA 1FVVA 3KXMA 3AMYA 4DFXE 3U87A 3UIMA 5CEOA 2Y4IB 2B4SB 3KRWA 4IANA 1OIQA 4HGTA 5E8VA 3V8SA 2UZNA 2PMLX 3O51A 1OB3A 5J87A 4M3QA 5IF1A 2SRCA 3W8QA 4N6YA 4ZY6A 4X2FA 4QP4A 2VWUA 4QPAA 4QP9A 3PIZA 4AA5A 2QOIA 5CNOA 2R0IA 3Q2MA 4PTGA 4M14A 5EM8A 4NEUA 2XP2A 4FKTA 4WRGA 3RBWA 4LRMA 5EFQA 3ZEWA 2IVUA 4C33A 2C3JA 4EZ7A 5FTQA 3GGFA 3UOKA 3MFUA 5AP4A 2BTRA 3QF9A 4FT0A 2E9NA 5AV1A 1I09A 3UO4A 4RBLA 4F0FA 4S30A 3FBVA 4CKRA 2EVAA 1JOWB 1V0PA 3LZBA 2WOTA 2F7XE 3CQUA 4J7BA 3W2SA 1A9UA 4HYIA 3DDPA 4ZTRA 4AACA 2G2IA 3DXPA 3DDQA 1WBPA 3W33A 3V5LA 5F4NA 3C4ZA 4J96A 2OZOA 4KSPA 3UTOA 3RAKA 4CLJA 4N70A 4O0WA 4BCOA 3AOXA 4D2TA 1G8SA 3GFWA 4U6RA 3ORNA 5T3QA 2AYPA 3UZPA 4QTEA 5M44A 4G9RA 4M7IA 4YZ9A 4PPCA 4BDIA 5LVOA 5IQHA 1R1WA 5HI2A 4YSJA 2QU6A 1ZZ2A 4NZWB 2XJ2A 3EFLA 1ZYJA 3FY2A 4CCBA 2WO6A 3DGKA 2R3HA 3MIAA 3OCGA 3QXOA 2XJ0A 4PTCA 2EXMA 3RHXA 3S4QA 2W5BA 4JDKA 3POZA 5GZ9A 4E20A 5CQWA 3NYXA 4C2WA 5AR5A 5AV0A 4XG6A 3BQRA 4PNIA 1BL6A 3PJ8A 4GIIA 4HCTA 5EHOA 3DK7A 3EIDA 4E73A 2F7ZE 3SAYA 5CU6A 3ZFYA 3Q9XA 4CFNA 4YNOA 3CIKA 2XNNA 3HDNA 2BTSA 1OIUA 2X2MA 3KN5A 4X6QC 4Q9ZA 3BYVA 4JQ8A 4QP3A 2UVZA 4LV5A 3ZEPA 3NS9A 4MBJA 5HIDA 1YDRE 5C03A 2HCKA 4EH5A 5CU0A 5IU2A 3N51A 2GCDA 4R1YA 4AF3A 3IECA 2ITNA 4QQCA 3MVJA 5KMLA 3D7ZA 2CLQA 4FG8A 4NT4A 3NYVA 4D4YA 5AX9A 4BN1A 4JAJA 4HNFA 1G5SA 1YKRA 1ERKA 4F99A 1CKIA 1OECA 2GDOA 3B8RA 3OEZA 4U9AA 3C4XA 3W16A 4RMZA 3FI4A 2BRBA 3E88A 2VTRA 3PA3A 4PDPA 2QOLA 5GZ8A 1XKKA 5M4IA 3HECA 3OTVA 3POOA 2HWPA 5HTIA 3IDBA 4RZVA 5HVYA 4LI5A 4QMMA 3RPVA 3SC1A 4BRXA 4R7IA 3QYZA 4V0GB 5HHWA 3QQKA 3EMGA 4I0TA 1PKGA 3BHUA 4TWCA 3UODA 4G6NA 3ZHPC 4Y73A 4FTMA 4NJDA 4IX5A 2UZBA 4QT1A 5AP5A 4BCPA 1XH8A 2ITYA 4FTOA 4O38A 4IQ6A 2DUVA 4AP7A 5DA3A 4J71A 4QOXA 4FIFA 5FGKA 2QO2A 2VV9A 3CS9A 3L9NA 3RAIA 3BKBA 3ZLXA 3A7HA 3NYOA 3SRVB 5E9EA 3G9LX 5J9LA 4L8MA 3MPAA 5CEMA 4FKRA 4DTAA 1ZOGA 1OL2A 4BF2A 3EKKA 5CI7A 5F95A 4H58A 1U59A 2WMVA 4GVAA 4QMWA 1BLXA 3QBNA 4DITA 3FKLA 4BTMA 2JKQA 4KKEA 4AA4A 3I60A 4AOIA 3FMEA 4UB7A 2PZYA 1SNXA 5E8SA 2C0IA 4NK9A 3W2CA 4A7CA 4U79A 4CV8A 3MH0A 4RX9A 3FI3A 3WE4A 4C3PA 4CXAA 2R3GA 4B7TA 4QYGA 5ICPA 2CJMA 2JDOA 2CNQA 3G0FA 1YXTA 4RJ8A 4ID7A 3L8PA 2WU6A 4F4PA 4KBKA 2PULA 3TNIA 2C1BA 4LRKA 3P79A 3HVCA 3MFTA 4GSBA 1XBBA 2C30A 2VTAA 3FC1X 1QMZA 5E7RA 2WOUA 2Y9QA 2A4LA 2JIUA 2I1MA 3FSFA 1AGWA 1H0WA 4MXCA 5CWZA 2PE0A 3QCXA 4QP2A 3HAMA 2VTOA 4EH4A 5BPYA 2G2HA 2I7QA 3ZM9A 4IVAA 4RVMA 3EQHA 2IZTA 2XZSA 3V04A 1FGIA 5JT2A 3LMHA 4R77A 3GCVA 4YTCA 4EKLA 3U54A 2BDWA 5B2KA 3RCDA 2W96B 4ANQA 3G9NA 4DYMA 4DT9A 3BHTA 5CSXA 2BHHA 2BMCA 4TT7A 1CM8A 5LMBA 3RK7A 3UIXA 4W9XA 4UZHA 4CQGA 4RVTA 4E8AA 3S95A 4FTTA 5HU3A 3ZO4A 5DGZA 2ITQA 3DT1A 3FDNA 3SX9A 4PRJA 3D5UA 4UXQA 3TT0A 3HUBA 4I6BA 4O91A 3SLSA 4RZWA 2XNOA 4RC3A 2WMUA 3BZ3A 4X0MA 4D1XA 4FEQA 3CPCA 3QQLA 4C2VA 4YZDA 4MEDA 2BFXA 3FUPA 3TV4A 5KMJA 4QMZA 2REIA 3SG9A 5E8WA 2J2IB 3I6WA 1FINA 2OGVA 2F2UA 4BWKA 4UN0C 3GU5A 4FGBA 2Z2WA 1K3AA 5HIBA 5L2WA 4YZNA 3FKOA 3BV2A 4ANMA 2IVTA 3VRYA 4IWPA 4I4EA 3ANQA 2QOCA 3R7IA 4I92A 2GNFA 5J79A 1Y8YA 3FMLA 4JR3A 4X3JA 4C35A 1GJOA 3U8WA 3MH2A 3OG7A 4O7SA 4BR3A 4WG4A 4ALWA 5KBQA 4XS2A 3TV6A 5IUIA 1T46A 1ZZLA 4I93A 3GXLA 4ZTHA 5BYZA 4ALVA 4FEVA 3D5VA 2RKUA 4BTFA 4WIHA 4FT7A 2PMOX 3I6UA 4K2RA 4QMPA 4ZTSA 3ENHA 5M06A 4FL1A 5HU9A 3GENA 4FC0A 3CD3A 5KX8A 2HOGA 3TXOA 4BKZA 4I5MA 1QPJA 4AFEA 3OY3A 4O0TA 4CVAA 3KXZA 1URWA 2JAMA 4FKOA 2QR8A 2GU8A 4EBVA 5GJDA 5EOLA 4DCEA 1Q8WA 4GYIA 3C51A 3QX4A 1OL5A 5L6OA 1YXVA 2JFLA 2J51A 4OBOA 3VBYA 3VS3A 4O22A 4H3BA 4W4VA 3ORPA 2QG7A 3QWJA 3ZXZA 5DYJA 1M17A 4BCHA 4RWKA 2F57A 5AR2A 2Z60A 2Z7SA 2OJFE 4N6ZA 4A9YA 3LM0A 2Z02A 3GBZA 2VO0A 3I81A 3LW0A 3P5KA 4I24A 5IKWA 4L53A 2Y7JA 2B9FA 4X2NA 3ZONA 5LVMA 4ZZOA 2HW7A 2OW3A 3PWYA 4JLCA 5AR8A 3UJGA 4BCKA 2YWVA 4IVDA 4CMTA 1Y57A 5TOZA 3I0OA 4D4VA 5HVJA 2RSVA 5EQYA 3H9FA 3C4EA 3GI3A 3VS7A 5B7VA 2WQNA 4FSYA 4HGLA 5TKDA 3OBJA 3L9MA 5CAVA 2BZHB 3QYWA 1KE8A 3R28A 4RX7A 3GC8A 3KRXA 3ZO1A 4I0SA 3OBGA 5AAFA 4UMRA 2DS1A 3EKNA 3V51A 4DEHA 2AUHA 2KTYA 3BEGA 4FIHA 4Q5EA 4L00A 2VWIA 5TE0A 1XR1A 3BGPA 3EJ1A 3M42A 3UNKA 2O5KA 1OI9A 3SXSA 4KKGA 3V8WA 3VULA 3MI9A 3ACKA 4KINA 3TN8A 3TDVA 3JUHA 4I0RA 4KB8A 3HV3A 3R9RA 1FMKA 4GT5A 3KK8A 3DKFA 3R73A 4BKYA 3R7YA 4AGWA 2E9UA 4AZSA 3UZTA 5HE2A 4KIKA 4MXAA 3L1SA 5LVLA 4XEYA 3A7FA 3CGOA 4BICA 1MQ4A 4OTQA 4RJ7A 4UY9A 4TN6A 3CE3A 4I5CA 3V5QA 5HLNA 3D2IA 4U8ZA 4DGNA 4FUYA 3VWAA 4EZ3A 1PYXA 3WF6A 4C36A 3HA6A 3WF5A 3FXWA 3IDCA 5AA8A 1ZLTA 4E6DA 3W1FA 5AAEA 2VTHA 2J0MB 4C3RA 3PXKA 2VWXA 3QTIA 2QI8A 4ZMEA 2J4ZA 2C6KA 4GUEA 5AP1A 5HNIX 1YI6A 4I3ZA 4FKUA 4F6UA 5AUXA 4B8MA 4USEA 2X81A 5BQ0A 4AGDA 2CLXA 3C4WA 3KF7A 3TZ9A 4DT8A 3PVGA 4CFXA 3VUDA 4M0ZA 1PXJA 3F61A 4FT9A 5J9ZA 2R4BA 3QD2B 2VRXA 3DB8A 2A19B 2W4JA 3Q53A 5J8IA 3U4WA 3BE2A 5J5TA 2OF2A 3QTQA 2WTJA 4RQVA 3NAYA 3EN6A 1H08A 3P08A 3P7CA 3U55A 4ZSLA 5CSVA 5F94A 1BKXA 3HMMA 2JKOA 4Q2AA 2XK4A 4CMOA 4WUNA 3GP0A 1Q3DA 3TKUA 4IB0A 3VS4A 3HRBA 4XG7A 5EW3A 1PKDA 5EYKA 2R3OA 3R7UA 1JNKA 3WF9A 5ETCA 1YVJA 2PL0A 5CAOA 3PSCA 3RWPA 4HYHA 2XA4A 4WO5A 2UW9A 3FMNA 5HO6A 4BDHA 4CLIA 2GFCA 2ZMCA 3MJ1A 2OJIA 3PRFA 4U97A 2XKCA 3GFEA 4WUAA 3F88A 5H8BA 3RTPA 3QD3A 3VO3A 5EW9A 3ZXTA 1Q8YA 4OW8A 3C7QA 2C6DA 3A7GA 4AGCA 2IG7A 1Q41A 3JPVA 5ANGA 3IGOA 4AN9A 5I5ZA 3LQ5A 2OFUA 5KUPA 2WMWA 3SW7A 2XCHA 1OL1A 2OSCA 2QO7A 5LQFA 1PXIA 5CSPA 2EWAA 4BZNA 4DEIA 2OWBA 4DH8A 4JOAA 2PTKA 3TM0A 5K0KA 5JFVA 1L3RE 3LLTA 4O7RA 4PDYA 4R7BA 5AUYA 5IDPA 3HRFA 4WBBB 1UNHA 3ZTXA 4I20A 4ZZNA 1OKWA 4LL0A 1J1BA 3AD4A 3F2AA 3QCQA 2YDKA 1YDSE 4JNWA 3IW5A 2IW8A 3TJDA 3OW3A 4CCUA 1YQJA 5AEPA 3E8CA 1ZOHA 2OH0E 2OG8A 4XG9A 3HYHA 3R02A 5HO8A 3NW6A 4YURA 3F2NA 4ZZMA 4EI4A 5CEIA 3GCUA 2PVRA 3FLQA 4IMYA 3DBEA 3EN5A 4TYHA 5CEKA 4DFZE 1DI9A 3UZRA 3QKLA 5EOBA 3LPBA 5AUZA 3QU0A 3TIZA 2C5YA 4YZBA 2YISA 3OF0A 4IC8A 2R0UA 4YLLA 2P0CA 4ANLA 5M08A 2GS7A 3QLFA 3PIYA 3DJ7A 3GC9A 2F7EE 1OPJA 4ZS0A 5E1EA 5HKMA 3W2PA 4C4EA 3DCVA 3F3WA 5B0XA 3FZSA 3B8QA 4YC8A 3P78A 3VS6A 1K2PA 1OIYA 4B8LA 1ZMVA 2HZIA 3MA3A 4C4GA 3KMMA 4IB5A 4PMMA 1ZWSA 2PE2A 3FMKA 4LUDA 5EHYA 4D5KA 4DINA 4ZY5A 5HD4A 4DH7A 4MBLA 4QP6A 3H3CA 4C59A 4F64A 3NCGA 1OPLA 4WHZA 5IA0A 3EQCA 3UYTA 2WIHA 1XH6A 5EM6A 5B2MA 4MKCA 3FHRA 2W4OA 3I7CA 4FVPA 4NKAA 4U42A 4RSSA 3U6IA 2UZVA 2GSFA 5D41A 2BRGA 3U51A 3VC4A 3PYYA 4MCVA 1UV5A 4OAUC 3R01A 4P5ZA 2WMQA 4G3DA 4W4WA 1GY3A 2W06A 1M2QA 4BYIA 4XBRA 3DLZA 4EQUA 5IUGA 4OTWA 4BWPA 4J8NA 5CNNA 3ZFMA 5E8YA 4X3FA 4AU8A 4ACDA 5C8NA 4ZLZA 4ACMA 2O65A 4JQ7A 1YWVA 3BLRA 3D2KA 3FLSA 5M51A 4WA9A 2JDSA 4H39A 3PJ3A 4HZSA 5LJJA 2C6LA 4BHNA 4DH1A 4O1OA 3OROA 3HAVA 2XM9A 3VBVA 2E2BA 2C3KA 4M68A 3ZC5A 2WEVA 4J99A 3PE2A 4ARKA 3D15A 2YJSA 3E92A 4KIKB 3SOCA 3VJOA 5A6OA 4RA4A 3N4TA 4D2RA 4Z7GA 1FOTA 1J7UA 3A4PA 3ENMA 3MY0A 3A8WA 5HBEA 4QYYA 3VS2A 4ZS4A 1P4FA 4F08A 4RIYA 3GC0A 3F7ZA 2B9JA 1XO2B 2XKFA 2C68A 3OWJA 2Q0BA 2ZV2A 2YDIA 3VUIA 3COMA 4XH6A 3LXLA 5GNKA 5JFXA 3QZHA 3MH3A 2OJGA 4M12A 2WZJA 3HV4A 3WYYA 5B2LA 3OS3A 1SMHA 4RJ3A 4QQJA 1OVEA 4PL4A 4YHJA 4BCJA 3U6JA 1Y8GA 3UVQA 4G5JA 4Y46A 2PVFA 3F2RA 5HVKA 2CKOA 2ZOQA 4FTRA 2KULA 2O8YA 3EN4A 5A4LA 5KMMA 1YXXA 4LYNA 2GTNA 1IASA 4RT7A 2ESMA 4FICA 4J1RA 2W5HA 4R3PA 4TYEA 1XH9A 4FTLA 4UYNA 3HGKA 5T6KA 4BZDA 1H26A 3MY1A 2WAJA 4GG7A 4PDOA 4XMOA 5BUIA 3EN7A 4UX9A 3BBWA 2I0VA 2WQOA 3F5PA 2OU7A 4BI1A 2GS6A 5ANJA 2XS0A 3MDYA 3BHYA 4FNYA 4WKQA 3G2FA 4RIWA 3Q9YA 2ZB1A 5ANEA 3QZIA 2FSLX 3EHAA 3KMWA 2VU3A 4DA5A 4GIHA 4XCUA 2BZIB 3PDTA 1ZYLA 1GZKA 2WIPA 1KE7A 4FVRA 3GOKA 5FEEA 5IEXA 2EB2A 1U4DA 4G31A 4IBMA 3A61A 4HVSA 2FA2A 4WRSA 2WMRA 4ERKA 3WE8A 3NW5A 3VN9A 2J0LA 3VQUA 2PYWA 1M2PA 1W0XC 3DAJA 5HG8A 4K1BA 3U6HA 3IK3A 3IW4A 3LQ8A 2YZAA 2F4JA 4S32A 4MF0A 3RNYA 4Z16A 4N0SA 3D83A 2HIWA 3RZFA 4PMTA 3OWPA 4YO6A 1H1QA 3SQQA 5AUTA 1H24A 2EUFB 2QONA 1O9UA 3IDPA 5JZJA 4JVGA 1QPDA 3QTSA 4TNBA 4I6HA 4EJ7A 4FKPA 1ZXEA 5C1QB 4KRCA 3AXWA 3QWKA 3PUPA 2R3PA 2BRNA 2YJRA 5FXRA 3OXIA 1P4OA 2X4FA 4L01A 4QTDA 2C4GA 5LMKA 3QHRA 4Y8DA 1GZ8A 3EQBA 5CF6A 2O63A 3QL8A 3CQWA 3ZCLA 3LFQA 3F5GA 4NCTA 2UW6A 3RAHA 4HYUA 4TYHB 5IPJA 2BDJA 5HNBA 1E1VA 4RA5A 5EM7A 5GINE 4YGAA 5M4FA 4AUAA 4C34A 2JIVA 2C5XA 4XLVA 1PXKA 3T9IA 3Q5IA 4DTKA 2VX0A 3FZOA 2VTLA 3C4CA 4IJ9A 3SXFA 4JRNA 5AWMA 3GQIA 4O82A 4L42A 4R3CA 4I5HA 1XH5A 3AT3A 3R00A 3FWQA 3MJ2A 4EL9A 3DU8A 4FA2A 1U5QA 3AMAA 4CTCA 5IA1A 3W2QA 4CT2A 4FIEA 5HLPA 3BGQA 3OP5A 2OJ9A 4S2ZA 4W9WA 2W1ZA 1MRVA 4MNEA 2W17A 3G90X 5EKOA 3OUNB 3QAME 4IE9A 4QNYA 4WG5A 3BWFA 1CTPE 2QOFA 3H0YA 2XNEA 4AT4A 3MBLA 4F63A 2X7GA 4BBEA 2F2CB 4EONA 2C3IB 5JZNA 4C4HA 4KIQA 4QP7A 4TZRA 3LFDA 1FMOE 4GT3A 5AA9A 4UMPA 3FPQA 3KREA 1OIRA 4ZSEA 4J53A 5HNGA 3VBQA 2YCQA 4WD5A 3UQFA 4IIRA 3UE4A 2OXXA 4PDSA 2OF4A 4UWCA 2VWBA 3VS1A 5IA3A 2QLQA 4YU2A 4X3FB 3CP9A 1H28A 3B2WA 4BI2A 3E7VA 4GFGA 4IXPA 4BCIA 5CLPA 3BPRA 3FYJX 4S34A 5CSHA 4NW5A 3DB6A 4DGMA 4YJOA 5L8LA 2CNVA 2YIQA 2HZ4A 4GS6A 2WQMA 5E8UA 3FXZA 3AT4A 3DQXA 4A9SA 3KRRA 2YIXA 3ZUUA 3W10A 5LCJA 4F9YA 4FV7A 5AP6A 5AP7A 1Q5KA 3KA0A 4GJ2A 5A4TA 4FZ7A 1Y6BA 5CVFA 4RIYB 4O21A 4DGGA 4F7LA 2A1AB 3DTWA 2F9GA 2PZPA 4EOSA 3DFCB 1NXKA 2QODA 3UG1A 2PVJA 4B99A 3OTUA 5DEWA 1OPKA 4TY1A 4GH2A 5CAPA 5BMSA 3PVUA 3F69A 4BCMA 2BR1A 5FQDC 4ASDA 3CPBA 4HYSA 2VWVA 3H30A 3NCZA 3HP2A 1R39A 4A4LA 3V5PA 1BMKA 4XP0A 1XH7A 4X2GA 3SV0A 3PG1A 2BKZA 3DZQA 3SD0A 3MVMA 4A07A 1NVSA 4YTIA 1F3MC 5JGAA 3N4VA 4MD7E 4LOQA 2YWPA 5K5XA 5DMZA 2FO0A 1V1KA 3QA8A 4Z55A 4M15A 2B53A 4R5YA 4RIWB 4ZK5A 2VUWA 2HENA 2ZDTA 5HORA 4X21A 3RPRA 2IVSA 4XOZA 5EDQA 3HMNA 3TUCA 3O7LB 4G3FA 4EOLA 3HLLA 4D9TA 2QQ7A 5DVRA 4IAZA 2B7AA 4AXAA 3PY1A 1Q99A 2YHVA 2PVYA 4FKJA 2Y6MA 4MAOA 4Y83A 1CMKE 4UYAA 4IM3A 4YSMA 3BU5A 2QO9A 4JBQA 3UPZA 3COIA 4M84A 4RJ5A 2QOHA 5GJGA 4AW5A 3QLGA 4ZLYA 4FZFB 1GZOA 4IX4A 3CKWA 5DT4A 4ACHA 2QOQA 3M1SA 4YLKA 3DQWA 2GNIA 4ACCA 4XV1A 3AD5A 4OTHA 3RM6A 4BFMA 5ETIA 5LOHA 3ZLSA 5DFPA 4WNPA 3MN3A 4QMUA 3CSVA 3ORLA 3VF8A 2XF0A 5DR9A 4GG5A 4EZ5A 4WBOA 2GNHA 2XBAA 3WYXA 2OXDA 4HNIA 4A9UA 5J7HA 5I9WA 5KBRA 3LE6A 2W1HA 1MRUA 2XKDA 3HX4A 5JGDA 3F5UA 3FKNA 3RK9A 3C5IA 1H07A 1WVXA 1ZY4A 2IZRA 4EHGA 2YCSA 2PZRA 1QL6A 3TCPA 4IFGA 4DG2E 4DE4A 4NWMA 3VRZA 5EM5A 5DT3A 2NRYA 5KZ0A 4USFA 2XJ1A 4BDAA 2NRUA 4E4NA 2HZ0A 3PXZA 3ZMMA 3ALOA 4O1PA 3S2PA 2VTQA 5I9UA 2R3QA 2Z7QA 5JRQA 4QQTA 1PMVA 2YIRA 3TI1A 2XH5A 2GQRA 5DHJA 3OT3A 5LVPA 2UW0A 1BL7A 1O6LA 2YDJA 3LHJA 4DGOA 5J9YA 3DBFA 4YUQA 5M4UA 1IA8A 3FMHA 4AZVA 4IB3A 4BI0A 3QZFA 3P23A 2UZEA 2WGJA 4FIJA 4GFMA 5TT7A 1KOBA 3H0ZA 3ZUTA 4O7WA 2OIQA 3W32A 5CANA 2C3LA 4NM3A 4FKLA 4F6WA 2OBJA 3BU3A 2W1CA 3BGZA 5JH6A 1M52A 3BELA 4MNEB 4AAAA 4LGDA 4CG8A 3NNUA 4JBOA 1RW8A 3A62A 4DTBA 1SVHA 4MD8E 5CEPA 1UNLA 2ZM1A 3KXNA 3WILA 5H2UA 2UW7A 2C5NA 4GT4A 3R8ZA 3O8PA 4CZYB 3TIYA 1K9AA 3L8VA 1QPCA 4IX6A 4KBCA 2V55A 1U54A 2V7AA 4OTFA 3VUKA 3D7TA 4G2FA 3OCBA 5F1ZA 4C4JA 4NW6A 2J7TA 5L6WL 1GIJA 4O0XA 4KIPA 4GK4A 5KMKA 3SOAA 5IQIA 1XH4A 2YFXA 3EL7A 1Z5MA 1SYKA 5JSMA 4WT6A 4OAVB 3OY1A 4DFUA 2XIRA 4FG9A 3R2BA 2O2UA 1ZYSA 4NIFA 4ZSGA 3Q5ZA 4AQCA 2I0YA 4UWYA 3RI1A 4RX5A 3QGWA 4K6ZA 1B38A 4RC4A 1JVPP 2JGZA 4FTIA 5KCVA 3HL7A 3NLBA 4D55A 2BKKA 4TYIA 4MXZA 4G1WA 1S9JA 3PJ1A 4I6FA 4EHVA 1FVRA 1NVQA 2FYSA 4GJ3A 4DH3A 4L67A 4MQ1A 3Q96A 2BAJA 4XLIA 3LLAA 1OKYA 4U41A 3CY3A 1AQ1A 5H9BA 3UP2A 3GU4A 4RQKA 4YJSA 2JDVA 4AW2A 2W99B 4CQEA 4IACA 4HW7A 3BCEA 4TWPA 5BVFA 1VJYA 3ZC6A 2C0OA 3FLNC 5BYYA 1Z57A 3PJ2A 1IG1A 1JSTA 4MD9E 3W2RA 3GU6A 3MGYA 3ZSIA 2ZV8A 4RLKA 2VO7A 2C1AA 4P2KA 2VNYA 4QYFA 4NFNA 5M57A 2XNBA 2J9MA 2QOOA 3LFCA 4KNBA 4NTSA 5EYCA 3RKBA 4F65A 4ZTMA 4I21A 3E8EA 5I9VA 5LMAA 5C26A 4D2WA 5LVNA 4B6LA 3I1AA 1SVEA 2G1TA 1NY3A 4E6QA 4X2KA 2YABA 4BDFA 2OICA 2RFEA 5IMEA 5AM6A 3R30A 1OBDA 2ITTA 4FOCA 3DNEA 4F1OA 4M8TA 4G3CA 1U5RA 3BI6A 2WTKB 3RZBA 2WMSA 1W7HA 4BDBA 1G8AA 2R3RA 2B54A 2UZLA 3WOWA 4I41A 3WARA 3TNHA 4KD1A 4J52A 5A46A 3OVVA 4IVBA 3C0GA 4LGHA 3V6RA 3MFRA 5LWMA 3TUDA 3IOPA 2GS2A 1JBPE 3DPKA 1YOLA 4FV2A 5GHVA 5L2TA 4AE6A 4YHTA 2PUPA 1PXOA 2LGCA 2QNJA 2OZAA 4V01A 4XJ0A 4GFOA 4L46A 3RWQA 3IQ7A 4G9CA 5CEQA 4AA0A 5DIAA 4E26A 3ATSA 4HVGA 2QCSA 2V0DA 2CKQA 3O0GA 3KEXA 3QUDA 4TYGA 4KSQA 1FPUA 4RFMA 4KWPA 2ZAZA 4E1ZA 3LFFA 1PRYA 1GZNA 3FY0A 4IB1A 2OLCA 3ORMA 4FTJA 4MX9A 5K5NA 3EB0A 3EQIA 5BVNA 3NVMB 3THBA 5L2QA 1YHVA 3DNDA 4C58A 5AR7A 3QKMA 3PZEA 4AT5A 2CHLA 2JITA 4E4LA 4NKSA 2C6IA 4Q5HA 4C37A 4C02A 3VHKA 2VGOA 2UVYA 3LQ3A 2H9VA 2WNTA 3BYMA 5H3QA 3UQCA 4RX8A 5IA2A 2DQ7X 2ETRA 4ITIA 2BCJA 4U43A 3UC3A 2B55A 2PE1A 1ZY5A 4PL3A 3F3UA 4M0YA 2HWOA 5BNJA 4YPSA 1SNUA 4OTDA 4D0WA 2A27A 3VS0A 3Q4ZA 1W98A 4FSWA 4LUEA 4XG3A 5DNRA 2IZUA 5HCYA 4GVJA 5HTBA 4O83A 2Z7LA 3KL8A 2HELA 2QC6A 3BRBA 3FQSA 5HG9A 2WD1A 1M7NA 2VTPA 2IW6A 2W1GA 4HPTE 4JDHA 4KRDA 5DBXA 1IR3A 4WNKA 5IH6A 3I7BA 5AR4A 4F6SA 2PPQA 5GZAA 2HXQA 2IVVA 1CKJA 2W9FB 3FHIA 4EOPA 2VTTA 3TL8A 4C62A 5LXMA 2CGXA 4GU6A 3Q6UA 2XIZA 3TNPC 4IWQA 4UXLA 3H9OA 3UGCA 4WNMA 3I5ZA 4EHZA 2YAKA 2X0GA 5AM7A 5AADA 2WKMA 4U7ZA 3ELJA 3F3TA 3R8VA 3NIZA 4PQNA 3ZU7A 1IRKA 2H34A 2W7XA 3UVPA 4FV3A 4D1SA 3F9NA 4JDIA 1U54B 2HK5A 3DKCA 4RWLA 4OTRA 4NJ3A 5BMMA 3PXRA 3D7TB 1OUYA 5GIPE 3C9WA 4BCNA 2WTVA 5CVHA 3ORXA 3KVWA 4QD6A 1WBVA 3EQDA 3RGFA 3LFBA 4NIFB 3UOHA 5TO8A 1Q3WA 3QALE 1H1WA 4YTFA 5C01A 3QUEA 3LXKA 4EYJA 1M7QA 4ZTNA 4TWNA 1A48A 4GUBA 4E93A 4H05A 4CFUA 3DTCA 3MVLA 2VO3A 2VWWA 3LJ2A 4CEGA 3R04A 5IQBA 4U0IA 4M66A 5JQ5A 1Z9XA 5E1SA 3R6XA 3WI6A 4D2VA 4FEXA 4W4XA 5GIOE 2CPKE 2Y4IC 3FQEA 3L9PA 2GMXA 3PFQA 2VTMA 2WXVA 4YLJA 3ZOSA 2RG5A 2J5EA 4D2PA 4E5WA 5EQEA 3E3BX 3TZMA 3D14A 3R2YA 4MVFA 1PXNA 3WBLA 5JQ8A 3WIGA 3DA6A 2R3LA 1Y91A 1Q4LA 4NH1A 5I9ZA 3CJFA 4I5PA 4IDTA 2HY0A 4ORKA 2P2HA 4MK0A 3PXYA 4DBXA 3A7JA 5ACBC 4AWIA 5I3RA 2VN9A 4LV8A 4TKSA 3OXTA 3F6XA 4OTGA 4YP8A 5E8TA 4ZXTA 4CG9A 4I6QA 2BRHA 3JS2A 5H8GA 2HYYA 2O0UA 4PP7A 3KVXA 4EK4A 4LMUA 5HO7A 4FV0A 3WF8A 3E5AA 5JGBA 2YIYA 3GVUA 3FC2A 3OOMA 2VAGA 2YCFA 4JAIA 3TACA 3VBTA 5JFWA 2VTJA 4XV3A 3JY9A 3AGMA 4XV2A 1YOMA 2JKKA 4Z3VA 4NM5A 4FF8A 4EC9A 2J6MA 3SGCA 4D2SA 5AV4A 1WBTA 3KMUA 3FMJA 3QKKA 5TF9A 3AC3A 2V7OA 5ANKA 1PY5A 2G9XA 2PVKA 3R8PA 3NMUF 3C4FA 3R0TA 4OBQA 1ZMWA 2EXCX 4IAIA 3R83A 2XNGA 3BX5A 3F3VA 3UO5A 4UV0A 1P2AA 3HMIA 1KUTA 5E4HA 3VIDA 5DRDA 1HCLA 3JR1A 2OZAB 3P7AA 4IZAA 2Y0AA 4HZRA 5J5SA 2CGVA 4PPBA 2PVMA 4IAFA 4F7NA 2XK9A 3CXWA 4GW8A 2W0JA 3ALNA 4IDVA 4GCJA 4BC6A 5ANIA 4BL1A 3I5NA 4CNHA 4DBNA 3REPA 4RIOA 2WEIA 3NUYA 3PSBA 3LM5A 3OUKA 4WNOA 1ND4A 4KBAA 3VUHA 5D1JA 5BUEA 4CFWA 5K0XA 1Q61A 2IJMA 4CRLA 3PLSA 4FL3A 4W8DA 3NUUA 1GOLA 5CF5A 1NT2A 3RPYA 4FTQA 5CU3A 4FT5A 5DLSA 3EFWA 5HG5A 2HAKA 4AN3A 3V5WA 3BBTB 5AR3A 2WQBA 1KSWA 3P0MA 2BILB 4Y72A 4YNEA 3UC4A 2CGWA 3FL4A 1LPUA 1MUOA 3ZBXA 2XMYA 4M69A 1KV2A 4G16A 2ZVAA 3R1QA 2XEYA 3D94A 3RK5A 2WTWA 3NPCA 3HA8A 1JKTA 4EJNA 3AG9A 5A9UA 3EQPA 5IA5A 3CBLA 5CZHA 5A3XA 2E9OA 4APCA 4RVLA 5LMKC 3GQLA 4GK2A 4AT3A 3IW6A 4ENYA 2ITPA 1L8TA 2PK9A 3ODYX 5K4IA 4OGRA 4CFFA 3FXXA 5AV3A 2RGPA 3GC7A 4JIAA 2CN8A 5CF8A 3QZGA 3EL8A 4HGEA 3CQEA 4H1MA 2YA9A 1ZMUA 5IDNA 4ANNA 5IEYA 5AUWA 2O3PA 4EORA 3R9NA 4J95A 4YJQA 4FUXA 4FV5A 4JI9A 4OTIA 4CSVA 2IN6A 1NW1A 5CU4A 5FDXA 2XKEA 3T3UA 3UYSA 3ORKA 4QMOA 5FTOA 4EUTA 4XBUA 4LG4A 3A99A 1XQZA 2X39A 3HV5A 3EZRA 4FKSA 4J98A 4NU1A 1OBGA 2C69A 3S0OA 3E62A 4XRJA 4FZ6A 4K18A 1UWJA 4F9AA 3UPXA 4LL5A 3DBDA 1JPAA 3R9OA 3AC2A 2VTSA 5CENA 3FZTA 3UQGA 3PXQA 1CSNA 4JX7A 4BTKA 5HCZA 5CYIA 4FSUA 1NVRA 1KV1A 2J0KA 3HUCA 1Q24A 4JXFA 1A06A 2J0IA 5E8XA 3WZJA 2OO8X 5LCKA 3LCTA 2AC3A 4QMSA 4F1MA 3NGAA 4JR7A 3BYOA 4DEDA 1JLUE 1QPEA 2JLDA 2QOBA 3PWDA 4IWOA 3AT2A 2JAVA 5CXHA 5CAQA 1PXMA 4I22A 4C4IA 3QRTA 4ACGA 5A14A 4CFMA 4CYJA 1OUKA 3ETAA 4ITJA 2YEXA 4M67A 4ANBA 4NUSA 2HXLA 4EK6A 2ETKA 3I4BA 1LEWA 4UMUA 2B9HA 1J1CA 3UIUA 4IC7A 4EKKA 4YR8A 4ZLOA 3Q04A 3NUPA 4YJPA 2VWZA 1LUFA 4OUCA 4XNEA 3DAEA 3IKAA 3N4UA 3OXZA 2RIOA 2UUEA 1RE8A 2ZMDA 1B39A 4L68A 4R7HA 4BIDA 4AOJA 3EOCA 4XG8A 4IM2A 3EWHA 3VW6A 5IG1A 3OCTA 4ASZA 1B6CB 4BDCA 4ZTQA 2RL5A 3P86A 5C27A 4BBMA 4FNZA 2IW9A 3LCKA 4UMTA 2UW5A 2XYNA 3QRKA 4NTTA 5IISA 1ZRZA 2YERA 5EQPA 4LOPA 2ZJWA 4KS7A 2BALA 3V5JA 4TW9A 1WFCA 3DLSA 4O7VA 4WOVA 3QC9A 3W8LA 5CZIA 3BQCA 3QTXA 4O0YA 4QNAA 4D9UA 2YACA 2BDFA 5BVKA 2XEZA 5D7AA 4BDKA 1APME 4BB4A 4BHZA 1T45A 3FQHA 3RPSA 2HY81 5KKRB 2BROA 5AIKA 1Q8TA 3C1XA 3CC6A 3R22A 4V05A 2X7OA 1KE6A 4P4CA 4E5BA 4O7LA 4TL0A 3TJCA 4IAKA 4G3EA 1Q62A 2XK6A 3AD6A 3FLZA 3WZEA 1XWSA 2JDTA 2W05A 4CTBA 5L2IA 4YJNA 5CT7A 4PWNA 5J7BA 1PMNA 4O0SA 2NO3A 2B1PA 4IH8A 2W1IA 4K77A 4YBKA 4I23A 1OITA 2WTDA 2X1NA 3V01A 2ONLA 2WTKC 2RG6A 2I0HA 2R3IA 2V5QA 3QQFA 3UMXA 1WMKA 4N57A 5J95A 4ZSAA 1YWRA 2GHLA 4G17A 3MSSA 1TQIA 2BHEA 4ITHA 4FEWA 3GCPA 3KQ7A 4JBVA 2W1EA 3BE9A 3QTZA 3BYUA 2IPXA 4TYJA 4QMXA 3U4UA 1MRYA 5J1VA 1PXPA 2ERZE 2I40A 3BU6A 3TKHA 3GUBA 4BY9E 3NVKI 2X6EA 3K3IA 4L9IA 4E3CA 4O7TA 1YRPA 3DFAA 3O96A 2BIKB 2IZSA 1JSVA 2XUUA 3COKA 3EQGA 3JVRA 3Q4UA 2GQSA 3SDJA 4ANOA 2IO6A 4G5PA 3NR9A 4Y5HA 2NP8A 2ITVA 2DWBA 2UW3A 3OD6X 3PVBA 3AC5A 4HGSA 4R5SA 3ROCA 3C5UA 3Q9WA 3QX2A 1H01A 4XOYA 4ANSA 3K3JA 4EH6A 5A4CA 2UZUE 4MHAA 4EH2A 2JDRA 2ZV7A 5A54A 4M69B 2PMNX 3TUBA 4UMQA 2VO6A 3KN6A 4D4RA 3TZ8A 3Q52A 4FOBA 4JDJA 2ITXA 3U9CA 4CT1A 3ZM4A 1VYWA 3QRUA 2JC6A 2JBPA 3ZUVA 5C8KA 5KMOA 3IW8A 3BHVA 3PXFA 4B0GA 3EYHA 3QHWA 1YI4A 4PUZA 1WBSA 4L3JA 3DKGA 5HGIA 3WZKA 3S00A 1BI7A 4F7SA 2BFYA 4FSNA 4W8EA 3IS5A 3TNQB 3LCSA 3VVHA 1VR2A 2C5OA 3LCDA 5I4NA 4PY1A 4C7TA 5DE2A 2E9VA 2FSTX 5HG7A 1WBWA 2Z8CA 3NAXA 3DJ5A 2XNMA 4M13A 3KULA 4QRCA 4BVUA 1ZYCA 4DC2A 2UZDA 1SZMA 1H1RA 4RIXA 4L3LA 1CKPA 4K0YA 5HCXA 4DGLC 3B2TA 4ZEGA 3LXNA 1PW2A 2OFVA 3E8NA 5HBJA 5FBNC 2R7IA 4EOMA 1YHWA 4AW1A 4YZCA 4R78A 3DBQA 3CLYA 4CYIA 4NFMA 4FGRA 3O17A 3OC1A 3NIEA 3PTGA 5DR6A 5G6VA 5L8KA 3Q4CA 5KNJA 4C3FA 2QOKA 3NZ0A 4AGUA 3RNIA 1XBCA 1TQPA 3DJ6A 4II5A 4EOJA 4JQEA 3O23A 2O64A 4J8MA 5EDPA 2NNWB 1UNGA 1H27A 1YHSA 1E1XA 2DYLA 3FZPA 3NRMA 3U9NA 2QG5A 3ZYAA 5I0BA 4OT5A 3QTRA 2YZLA 5KHWA 2ZYBA 3M2WA 1V0OA 3KCKA 4XYFA 5DH3A 3W55A 2YCRA 1KE5A 4QYHA 1LEZA 2P33A 4C38A 4DLIA 2CDZA 2OIBA 4FZAB 3F5XA 4IWDA 4TWOA 2H6DA 4IJPA 5EG3A 4C57A 4USDA 3QCYA 5HQ0A 4RWIA 1W84A 4HCUA 4MXYA 2VNWA 2C5VA 3MW1A 4FTAA 4YZMA 5BVEA 3MFSA 1UKIA 1LR4A 3HDMA 4KIOA 4RGJA 4ZP5A 1GNGA 5CALA 4RVKA 3Q2JA 4GMYA 2XIYA 4A9RA 3E63A 3R1YA 2ZV9A 4R6VA 3TZ7A 2PWLA 4PPAA 4P90A 3LAUA 2PHKA 4DHFA 1DI8A 1WZYA 4FV4A 1WBOA 2P3GX 4CKJA 1OGUA 1V0BA 4RLLA 5DT0A 3TTJA 3VUGA 5HESA 3DBCA 3JVSA 3O7LD 2J50A 3QCSA 3RMFA 4KAOA 5CVGA 4AS0A 5FRIA 5IH5A 5M07A 2GFSA 4IFCA 3Q3BA 4YO4A 1H0VA 1TVOA 3BEAA 1OL6A 3QQHA 3EQFA 3CKXA 1TKIA 3TDWA 2FH9A 1WCCA 2QLUA 3OT8A 4JJRA 4UEUA 4XV9A 2XK8A 3P7BA 2JIIA 4QTAA 4YJUA 4BGQA 3DK3A 1FBNA 1ATPE 5AJQA 5CF4A 3ATTA 2W9ZB 2WMBA 3V3VA 3D5XA 5FM3A 3VS5A 5HEZA 4GK3A 2ZM3A 3RJCA 3MIYA 1OMWA 3PPKA 4ONAA 3MTFA 4G6OA 4FKIA 3ZRMA 1JKLA 1W83A 3QA0A 2X8DA 2R9SA 3BV3A 2JBOA 4FMQA 4MQ2A 3TNWA 2RFNA 3LXPA 5IA4A 1UU7A 4H36A 4UWBA 3TG1A 4FNWA 3ITZA 4ZJJA 4GU9A 5IEVA 1JAMA 2PVLA 5EH0A 1ZARA 3R9HA 4K9YA 5HX8A 1H1SA 1TQMA 3AMBA 3BHHA 3PE1A 4GL9A 4ZJVA 5KO1A 2I6LA 3JXWA 5CS6A 3ET7A 4BDDA 3E64A 1UWHA 2H96A 4Y95A 4Z9LA 5HE3A 5D7VA 3R7OA 3MB7A 4O0VA 4E6CA 2HZNA 4O81A 5K3YA 3GCQA 4A9TA 4CGAA 4FKVA 4L7SA 4P5QA 4DLJA 4BDEA 1LP4A 4MH7A 2PUIA 4PNKA 4DEGA 3K5UA 2GTMA 4FTCA 4TRLA 2VTIA 2XNPA 4TTHB 1UVRA 3KXHA 5LWNA 2R3JA 1YW2A 2R2PA 3HEGA 4FV8A 1X8BA 3KY2A 1IAHA 4I1ZA 2ETMA 3PLAE 3OMVA 4TXCA 3ZLWA 4QMNA 2QHNA 2JFMA 3COHA 3ANRA 3BYSA 4FX3A 4UALA 2GHGA 1PF8A 2YM4A 3VJNA 4ZTLA 4EH9A 2OXYA 4FSRA 4E5AX 3NW7A 5E91A 3Q60A 2YM5A 3R7EA 3ERKA 1PXLA 3DK6A 4IAYA 5D11A 3A2CA 4RWJA 1OL7A 2W1FA 3N9XA 5DN3A 4U3ZA 5FLFA 2WB8A 3O71A 4BYJA 2P4IA 3QFVA 1KE9A 3ZFXA 1O6KA 1BYGA 4Y5QA 3FYKX 5JRSA 2WQEA 3KRJA 3F66A 5KZIA 4DH5A 3G0EA 3QQUA 2X7FA 1UU8A 2Y4PA 3IO7A 3O8UA 3GEQA 3NUNA 1MQBA 1SVGA 5IQFA 4EHEA 3PIXA 5AUVA 1YWNA 4BIBA 4FI1A 5IQGA 2QD9A 1YI3A 2CKEA 2B9IA 3EYGA 3KULB 1W82A 3E8DA 4RFZA 2WMAA 3QD0A 4RG0A 4ZOGA 4RIXB 5JFSA 3G15A 1KWPA 5HE0A 2X9EA 3DAKA 3O8TA 5CT0A 3P9JA 5I3OA 4JS8A 4HVHA 3KU2A 3UO6A 1BX6A 2X9FA 3C0IA 4L45A 4FSZA 1F0QA 3SHEA 4FIIA 4S33A 5C9CA 4EYMA 3HZTA 3PPJA 3C0HA 5FXSA 4G6LA 5CASA 3CTHA 2G2FA 3S1HA 2BZJA 1P14A 3PY3A 3BLHA 3S3IA 1IEPA 1ZAOA 3DS6A 5D12A 5ITAA 4K33A 4NYEA 3E3PA 3AC1A 4B4LA 3ZRKA 4F0IA 2YLFA 3FLYA 3I0QA 4U80A 5DOSA 3VAPA 5IZFA 5IQAA 2B0QA 1J7IA 3AC8A 4RC2A 3LMIA 1R3CA 3RP9A 3R9DA 4EQCA 5M53A 3E93A 4FTUA 4D58A 4DAWA 1GIHA 5IQCA 2CCIA 3O50A 5M09A 4FE2A 4L44A 4FZDB 3LFEA 2EB3A 5KE0A 5FD2A 2OH4A 3BIZA 3K54A 3VW8A 5LARA 3D4QA 3W2OA 4C4FA 5L3AA 4A4OA 1R78A 4G34A 1I44A 1XJDA 4FKWA 3F7WA 1OKVA 3ZRLA 2BAKA 2QVSE 3ULIA 4F9WA 4BIEA 2XRWA 3PP1A 4PF4A 2BUJA 1ZYDA 3FJQE 3IPHA 5CTPA 5AX3A 3FZ1A 4AZFA 5IUHA 2QU5A 2W4KA 3IGGA 3BWJA 4U45A 2E9PA 2V62A 4JBPA 2J90A 5I9XA 5M55A 2BVAA 3TTIA 1PHKA 3VF9A 3ZS5A 4FG7A 5DEYA 3FI2A 3MH1A 4YTHA 3EFJA 1OM1A 3A60A 2G01A 4YC3A 4IX3A 2CKPA 1WVWA 3EH9A 4OTPA 4PMSA 5ETFA 4FV9A 2PZIA 3OOGA 1W8CA 4H3QA 2XK7A 4AZWA 3PSDA 3ODZX 4EWHA 2YM3A 4F09A 4FYNA 1STCE 4CZUA 3PPZA 5BVWA 3SVVA 2FGIA 4U44A 2BZKB 1WVYA 3O2MA 3CJGA 2GNGA 1G3NA 2ZDUA 4O6LA 1JWHA 4GKIA 4ZSJA 3DXNA 3R63A 4JX3A 3CY2A 4YMJA 3Q32A 4F1TA 3MPMA 2YLEA 3ORTA 5FP6A 1XHAA 3EZVA 5CSWA 5E8ZA 4EK8A 4QMTA 5KKRC 2P2IA 5JEBA 4AOTA 3VHEA 3FEGA 3HP5A 3MS9A 4LOOA 3VNTA 4YC6A 4OT6A 3QXPA 4YBJA 4O7YA 1QCFA 3LFSA 5M56A 4JL9A 2VZ6A 4YJRA 3A7IA 2CCHA 2CGUA 2PZ5A 3CCNA 4QPMA 3MESA 4ZMFA 4FYOA 4WSYA 1FVTA 3H4JA 5DRBA 4FSMA 3GCSA 2QKRA 3E87A 3IOKA 4B9DA 4DG0E 3FI8A 5ACKA 2PSQA 1GIIA 1PYEA 1BI8A 2UW8A 2XK3A 1UA2A 2Z7RA 4QMYA 1HCKA 4D1ZA 4NL0A 2RF9A 2GHMA 3CR0A 2PVHA 4IVCA 1AD5A 4P7EA 2ITUA 5JK3A 3BLQA 3ZSHA 3OEFX 2XBJA 3JYAA 1MP8A 2I0EA 4CV9A 4EOKA 4FEUA 3PZHA 2JD5A 2BPMA 3WIKA 4QP1A 5HE1A 5AUUA 5HIEA 4LFIA 3SKCA 3FAAA 3SW4A 4R3RA 3ZZEA 5JKGA 5AP3A 5BUJA 1FGKA 3QUPA 1JQHA 2C6EA 4QTBA 5CU2A 5L8JA 4DFBA 3DOGA 4WSQA 3WF7A 2XM8A 3FZRA 4D0XA 4ENXA 3MYGA 5G1XA 2CN5A 4DEAA 3P1AA 3RAWA 1GAGA 3PG3A 3NUAA 1H8FA 2VX1A 4YJVA 3R8UA 5FBOA 5HX6A 5D10A 3UG2A 2YN8A 2LAVA 4U81A 4X3FC 3UDBA 5CI6A 2PU8A 4O27B 4AX8A 4BCGA 4DFLA 5FXQA 4IHPA 4TNDA 2WTCA 5EKNA 2P55A 4QPSA 3QTUA 5FM2A 4BCFA 1YXSA 3T9TA 1WBNA 3K5VA 3K2LA 4CD0A 4JG7A 3RINA 2JKMA 4DFNA 3LFAA 1H4LA 3RHKA 1Q8UA 3FSKA 3NDMA 4X6RA 2YM8A 1U46A 3KRLA 5L6PA 5BX0A 4IEBA 2YM6A 2GPHA 3MA6A 1RJBA 4C0TA 4C61A 2CMWA 2WMXA 3SA0A 4FR4A 2XRUA 4HOKA 3R8LA 4KUJA 4O96A 4BBFA 4V04A 3UVRA 3IW7A 5IH4A 3KC3A 5AFVA 4IZYA 5EHLA 2CNUA 4EQMA 4FTNA 1ZOEA 1E9HA 1REKA 4H1JA 4KA3A 3LFNA 2R3FA 3AGLA 3VBXA 2UZWE 3W18A 3EN9A 4E6AA 4ERWA 3NX8A 5HTCA 3FMDA 4O6EA 3SG8A 5D9HA 3ZO3A 4BWXA 3H9RA 4ZY4A 4EK5A 3IONA 4FODA 1Y6AA 3C50A 2C0TA 3ZDUA 4G3GA 4O0RA 5CXZA 5C4LA 2VTNA 3L8SA 3Q6WA 4FTKA 4ZIMA 1VZOA 3VUTA 4A4XA 3OZ6A 2QHMA 3AQVA 5FDPA 5L2SA 4PP9A 5F9EA 3CEKA 4J97A 4C8BA 2A0CX 3LJ1A 3JY0A 5HLWA 4IADA 3II5A 2OKRA 3F3ZA 3HMPA 4AW0A 3HV6A 3IG7A 3ULZA 5DPVA 3TV7A 3MB6A 4DEBA 4EUUA 5KMIA 3KF4A 1R0EA 3E7OA 3HRCA 3Q4TA 5CQUA 2PY3A 2X6DA 3TWJA 4AE9A 3H10A 3GOPA 4FBXA 4UBAA 3MPTA 2ACXA 3GNIB 1M2RA 1DM2A 3ZLYA 5JMSA 2YAAA 4MXXA 5BVOA 4M97A 4AG8A 1PMUA 4GV1A 3WZDA 4XP2A 3CTJA 5FEDA 3KB7A 3TEIA 4AZTA 4FKQA 3LJ0A 5FWKK 5M4CA 3OWLA 4EOQA 2EXEA 3LIJA 3SXRA 2R3NA 2V22A 2WELA 4O84A 4IAAA 4JIKA 2C47A 4ASEA 1Q8ZA 1CDKA 3ZZWA 4BZOA 4LMNA 4DF3A 2VGPA 3OW4A 3UIBA
chains in the Genus database with same CATH superfamily
4KS8A 2FVDA 4FIGA 5HD7A 2RFDA 4PTEA 2R7BA 1UU9A 4QYEA 5DI1A 2WMTA 3RM7A 3G33A 2FSOX 4BGHA 4OR5A 3T8OA 1VYZA 3PVWA 1UU3A 4MBIA 3ROYA 5A4QA 4L7FA 5BVDA 2GNJA 5I9YA 2X8IA 4D28A 3LVPA 4D4SA 2YM7A 5K4JA 3D0EA 4K11A 3FE3A 2ITWA 3HMOA 4MF1A 3VQHA 1J3HA 4XG2A 1DS5A 1YDTE 3FLWA 4BDJA 3G5DA 2IWIA 2C6TA 2PVNA 1J7LA 1F5QA 4HJOA 5A6NA 4QO9A 4PX6A 3KK9A 4TPTA 4RFYA 3D9VA 3R21A 4GKHA 5E90A 5AP0A 3KGAA 2WFYA 3QTWA 3HV7A 3VBWA 4MWIA 5EI8A 3LMGA 5GJFA 4DG3E 3C13A 2VX3A 4H3PA 5E92A 2FSMX 3RALA 4NCTC 3BLAA 3ID6C 1W2FA 2B52A 4GEOA 3W0RA 4UZDA 1IAJA 4YHFA 5KMNA 3HKOA 3NUXA 5AP2A 2ONLC 2WU7A 4IZ7A 5DG5A 3RCJA 2X4ZA 5H8EA 3GU8A 4U40A 4JT3A 4R1VA 4O7NA 4DEEA 3DKOA 4S31A 4LGGA 1RQQA 2XCKA 1RDQE 1FQ1B 2ITOA 2AC5A 1DAWA 4EK3A 4RJ6A 3DZOA 2FB8A 5EW8A 3KCFA 4X2JA 4LRJA 2X2LA 3HNGA 3CTQA 4JG8A 4PL5A 5EK7A 4EEVA 4FL2A 3OFMA 4U5JA 2JEDA 2XIXA 3EQRA 3QRJA 1J91A 2RFSA 2ERKA 5F20A 3PY0A 3PA5A 5AV2A 5EYDA 1JKKA 4HCVA 3G6HA 1REJA 2OI4X 4CRSA 5IQDA 4PV0A 5HBHA 1PJKA 3UBDA 3WZUA 5ETAA 3GT8A 3OHTA 4Y85A 3RVGA 4FT3A 3ZDIA 3ZBFA 3OWKA 1XBAA 4XG4A 4BTJA 4E4XA 5A4EA 4FSQA 3TKIA 2FUMA 5FEQA 4K8AA 1R0PA 3R1SA 5AMNA 4EOOA 3Q9ZA 4I94A 3ZSGA 1OZ1A 2R64A 3FMMA 4L43A 2ITZA 5J1WA 4W4YA 2UW4A 4KABA 4F7JA 3ZH8A 2C6MA 4L6QA 2H8HA 3NYNA 3DV3A 4I4FA 3VUMA 1S9IA 3KKVA 4O2PA 5ANDA 3P4KA 5TR6A 2OJJA 3KXXA 1YXUA 3G51A 4XUFA 4QP8A 2J0JA 5ANOA 2QURA 4X7QA 2XIKA 3PJCA 4WG3A 4O2ZA 4QMVA 2BRMA 4AXEA 4N4SA 2HW6A 1H25A 2WTIA 4MYGA 1HOWA 4BKJA 2QR7A 2C6OA 4AFJA 5BYLA 3GU7A 3UNJA 2OK1A 3V8TA 2VWYA 1P5EA 1VEBA 3R1NA 4A06A 1DAYA 2GQGA 2F49A 3NNWA 1NA7A 2QKWB 3QC4A 4MWHA 4EH8A 1KOAA 3R8MA 2GNLA 4F9BA 2A2AA 2PUNA 2Y6OA 1URCA 1JKSA 3FPMA 3QQGA 2PMIA 2WPAA 4E4MA 3R7VA 5EYMA 4Q9SA 4YPDA 3T3VA 2XVDA 4F70A 3W0PA 4AZEA 4BCQA 2NPQA 5HICA 4IZ5A 4FVQA 3ACJA 2W1DA 5FP5A 4QMQA 5HOAA 4F0GA 1O6YA 4XRLA 3RPOA 3PA4A 4MNFA 3NEWA 4FNXA 5EI6A 1WAKA 4O86A 2Y8OA 5C8MA 2OIDA 2WHBA 2Q0NA 4Z7HA 3G6GA 3LKMA 4HVDA 3L9LA 5KHXA 4LQMA 1H1PA 1EH4A 3I79A 3QD4A 5DWRA 4MTAA 5HZNA 4RJ4A 2CSNA 4GYGA 4ALUA 4APPA 4IW0A 3NSZA 4PMPA 3LCOA 2YIWA 3F82A 4OLIA 4CFVA 5FTGA 4QMLA 4XHKB 1UKHA 4QTCA 4AN2A 5L4QA 3NWWA 2X8EA 4BDGA 4DHZA 2J5FA 3D5WA 3MVHA 3NNXA 3ORIA 4GRBA 4F9CA 3QQJA 4R8QA 3UP7A 2R3MA 1JSUA 3CD8A 4JRVA 4DCAA 3AC4A 3L8XA 2Q83A 2BAQA 4CMUA 5T68A 4LM5A 2W5AA 4V0GA 5CX9A 4JG6A 5FG8A 2VD5A 4EOIA 2XB7A 4RPVA 3UOJA 5FUTA 5CAUA 4L3PA 1SM2A 2EU9A 4L52A 3OCSA 3GB2A 3FL5A 4XP3A 1PMEA 4EWQA 3QRIA 2X2KA 2BIYA 2ZM4A 1IA9A 4CZTA 4EH3A 5EI2A 3V5TA 5K9IA 4NSTA 3NUSA 4KKHA 4QQ5A 4DN5A 4ASXA 3SRVA 3MTLA 4EH7A 4ZAUA 4HPUE 5CY3A 3M11A 4BGGA 2UV2A 3MY5A 4E7WA 3A4OX 4FV6A 5DR2A 4CKIA 3DXQA 5EDRA 2ZB0A 4MXOA 4FSTA 4U3YA 3MV5A 5AIRA 3V6SA 3ORZA 4IM0A 4FK6A 3PP0A 3PRIA 1H00A 3A8XA 2UZTA 4NM7A 4I6LA 4RRVA 4O0UA 5C4KA 3EFKA 1BUHA 4HVIA 2R5TA 3CGFA 4FV1A 4D5HA 2UVXA 1OKZA 3QGYA 2XYUA 3NNVA 3FV8A 4DFYA 2G15A 2YITA 1M14A 3R71A 4XX9A 3MWUA 3ZO2A 4ZJIA 5AAGA 5JN2A 3UOLA 2PUUA 4O7ZA 4FKGA 4JMQA 5IQEA 3R7GA 4EBWA 4OBPA 2UZOA 3UNZA 4NM0A 3KXGA 3KFAA 1YOJA 4YJTA 5IMXA 3LOKA 1Q97A 2R3KA 3DY7A 4FK3A 4EC8A 3UMWA 1FVVA 3KXMA 3AMYA 4DFXE 3U87A 3UIMA 5CEOA 2Y4IB 2B4SB 3KRWA 4IANA 1OIQA 4HGTA 5E8VA 3V8SA 2UZNA 2PMLX 3O51A 4F78A 1OB3A 5J87A 4M3QA 5IF1A 2SRCA 3W8QA 4N6YA 4ZY6A 4X2FA 4QP4A 2VWUA 4QPAA 4QP9A 3PIZA 4AA5A 2QOIA 5CNOA 2R0IA 3Q2MA 4PTGA 4M14A 1XMLA 5EM8A 4NEUA 2XP2A 4DDIA 4FKTA 4WRGA 3RBWA 4LRMA 5EFQA 3ZEWA 2IVUA 4C33A 2C3JA 4EZ7A 5FTQA 3GGFA 3UOKA 3MFUA 5AP4A 2BTRA 3QF9A 4FT0A 2E9NA 5AV1A 1I09A 3UO4A 4RBLA 4F0FA 4S30A 3FBVA 4CKRA 2EVAA 1JOWB 1V0PA 3LZBA 2WOTA 2F7XE 3CQUA 4J7BA 3W2SA 1A9UA 4HYIA 3DDPA 4ZTRA 4AACA 2G2IA 3DXPA 3DDQA 1WBPA 3W33A 3V5LA 5F4NA 3C4ZA 4J96A 2OZOA 4KSPA 3UTOA 3RAKA 4CLJA 4O4DA 4N70A 4O0WA 4BCOA 3AOXA 4D2TA 1G8SA 3GFWA 4U6RA 3ORNA 5T3QA 3TYKA 2AYPA 3UZPA 4QTEA 5M44A 4G9RA 4M7IA 4YZ9A 4PPCA 4BDIA 5LVOA 5IQHA 1R1WA 5HI2A 4YSJA 2QU6A 1ZZ2A 4NZWB 2XJ2A 3EFLA 1ZYJA 3FY2A 4CCBA 2WO6A 3DGKA 2R3HA 3MIAA 3OCGA 3QXOA 2XJ0A 4PTCA 2EXMA 3RHXA 3S4QA 2W5BA 4JDKA 3POZA 5GZ9A 4E20A 5CQWA 3NYXA 4C2WA 5AR5A 5AV0A 4XG6A 3BQRA 4PNIA 1BL6A 3PJ8A 4GIIA 4HCTA 5EHOA 3DK7A 3EIDA 4E73A 2F7ZE 3SAYA 5CU6A 3ZFYA 3Q9XA 4CFNA 4YNOA 3CIKA 2XNNA 3HDNA 2BTSA 1OIUA 2X2MA 3KN5A 4X6QC 4Q9ZA 3BYVA 4JQ8A 4QDEA 4QP3A 2UVZA 4LV5A 3ZEPA 3NS9A 4MBJA 5HIDA 1G8JA 1YDRE 5C03A 2HCKA 2IEWA 4EH5A 5CU0A 5IU2A 3N51A 2GCDA 4R1YA 4AF3A 3IECA 2ITNA 4QQCA 4LDTA 3MVJA 4AXDA 5KMLA 3D7ZA 2CLQA 4FG8A 4NT4A 3NYVA 4D4YA 5AX9A 4BN1A 4JAJA 4HNFA 1G5SA 1YKRA 1ERKA 4F99A 1CKIA 1OECA 2GDOA 3B8RA 3OEZA 4U9AA 3C4XA 3W16A 4RMZA 3FI4A 2BRBA 3E88A 2VTRA 3PA3A 4PDPA 2QOLA 5GZ8A 1XKKA 5M4IA 3HECA 3OTVA 3POOA 2HWPA 5HTIA 3IDBA 4RZVA 5HVYA 4LI5A 4QMMA 3RPVA 3SC1A 4BRXA 4R7IA 3QYZA 4V0GB 5HHWA 3AKLA 3QQKA 3EMGA 4I0TA 1PKGA 3BHUA 4TWCA 3UODA 4G6NA 3ZHPC 4Y73A 4FTMA 4NJDA 4IX5A 2UZBA 4QT1A 5AP5A 4BCPA 1XH8A 2ITYA 4FTOA 4O38A 4IQ6A 2DUVA 4AP7A 5DA3A 4J71A 4QOXA 4FIFA 5FGKA 2QO2A 2VV9A 3CS9A 3L9NA 3RAIA 3BKBA 3AKKA 3ZLXA 3A7HA 3NYOA 3SRVB 4AXFA 5E9EA 3G9LX 5J9LA 4L8MA 3MPAA 5CEMA 4FKRA 4DTAA 1ZOGA 1OL2A 4BF2A 3EKKA 5CI7A 5F95A 4H58A 1U59A 2WMVA 4GVAA 4QMWA 1BLXA 3QBNA 4DITA 3FKLA 4BTMA 2JKQA 4KKEA 4AA4A 3I60A 4AOIA 3FMEA 4UB7A 2PZYA 1SNXA 5E8SA 2C0IA 4NK9A 3W2CA 4A7CA 4U79A 4CV8A 3MH0A 4RX9A 3FI3A 3WE4A 4C3PA 4CXAA 2R3GA 4B7TA 4QYGA 5ICPA 2CJMA 2JDOA 2CNQA 3G0FA 1YXTA 4RJ8A 4ID7A 3L8PA 2WU6A 4F4PA 4KBKA 2PULA 3TNIA 2C1BA 4LRKA 3P79A 3HVCA 3MFTA 4GSBA 1XBBA 2C30A 2VTAA 3FC1X 1QMZA 5E7RA 2WOUA 2Y9QA 2A4LA 2JIUA 2I1MA 3FSFA 1AGWA 1H0WA 4MXCA 5CWZA 2PE0A 3QCXA 4QP2A 3HAMA 2VTOA 4EH4A 5BPYA 2G2HA 2I7QA 3ZM9A 4IVAA 4RVMA 3EQHA 2IZTA 2XZSA 3V04A 1FGIA 5JT2A 3LMHA 3ML1A 4R77A 3GCVA 4YTCA 4EKLA 3U54A 2BDWA 5B2KA 3RCDA 2W96B 4ANQA 3G9NA 4DYMA 4DT9A 3BHTA 5CSXA 2BHHA 2BMCA 4TT7A 1CM8A 5LMBA 3RK7A 3UIXA 4W9XA 4UZHA 4CQGA 4RVTA 4E8AA 3S95A 4FTTA 5HU3A 3ZO4A 5DGZA 2ITQA 3DT1A 3FDNA 3SX9A 4PRJA 3D5UA 4UXQA 3TT0A 3HUBA 4I6BA 4O91A 3SLSA 4RZWA 2XNOA 4RC3A 2WMUA 3BZ3A 4X0MA 4D1XA 4FEQA 3CPCA 3QQLA 4C2VA 4YZDA 4MEDA 2BFXA 3FUPA 3TV4A 5KMJA 4QMZA 2REIA 3SG9A 5E8WA 2J2IB 3I6WA 1FINA 2OGVA 2F2UA 4BWKA 4UN0C 3GU5A 4FGBA 2Z2WA 1K3AA 5HIBA 5L2WA 4YZNA 3FKOA 3BV2A 4ANMA 2IVTA 3VRYA 4IWPA 4I4EA 3ANQA 2QOCA 3R7IA 4I92A 2GNFA 5J79A 1Y8YA 3FMLA 4JR3A 4X3JA 4C35A 1GJOA 3U8WA 3MH2A 3OG7A 4O7SA 4BR3A 4WG4A 4ALWA 5KBQA 4XS2A 3TV6A 5IUIA 1T46A 1ZZLA 4I93A 3GXLA 4ZTHA 5BYZA 4ALVA 2XAOA 4FEVA 4DDGA 3D5VA 2RKUA 4BTFA 4WIHA 4FT7A 2PMOX 3I6UA 4K2RA 4QMPA 4ZTSA 3ENHA 5M06A 4FL1A 5HU9A 3GENA 4FC0A 3CD3A 5KX8A 2HOGA 3TXOA 4BKZA 4I5MA 1QPJA 4AFEA 3OY3A 4O0TA 4CVAA 3KXZA 1URWA 2JAMA 4FKOA 2QR8A 2GU8A 4EBVA 5GJDA 5EOLA 4DCEA 1Q8WA 4GYIA 3C51A 3QX4A 1OL5A 5L6OA 1YXVA 2JFLA 2J51A 4OBOA 3VBYA 3VS3A 4AXCA 4O22A 4H3BA 4W4VA 3ORPA 2QG7A 3QWJA 3ZXZA 5DYJA 1M17A 4BCHA 4RWKA 2F57A 5AR2A 5BV3A 2Z60A 2Z7SA 2OJFE 4N6ZA 4A9YA 3LM0A 2Z02A 3GBZA 2VO0A 3I81A 3LW0A 3P5KA 4I24A 5IKWA 4L53A 2Y7JA 2B9FA 4X2NA 3ZONA 5LVMA 4ZZOA 2HW7A 2OW3A 3PWYA 4JLCA 5AR8A 3UJGA 4BCKA 2YWVA 4IVDA 4CMTA 1Y57A 5TOZA 3I0OA 4D4VA 5HVJA 2RSVA 5EQYA 3H9FA 3C4EA 3GI3A 3VS7A 5B7VA 2WQNA 4FSYA 4HGLA 5TKDA 3OBJA 3L9MA 5CAVA 4QDVA 2BZHB 3QYWA 1KE8A 3R28A 4RX7A 3GC8A 3KRXA 3ZO1A 4I0SA 3OBGA 5AAFA 4UMRA 2DS1A 3EKNA 3V51A 4DEHA 2AUHA 2KTYA 3BEGA 4FIHA 4Q5EA 4L00A 2VWIA 5TE0A 1XR1A 3BGPA 3EJ1A 3M42A 3UNKA 2O5KA 1OI9A 3SXSA 4KKGA 3V8WA 3VULA 3MI9A 3ACKA 4KINA 3TN8A 3TDVA 3JUHA 4I0RA 4KB8A 3HV3A 3R9RA 1FMKA 4GT5A 3KK8A 3DKFA 3R73A 3P5JC 4BKYA 3R7YA 4AGWA 2E9UA 4AZSA 3UZTA 5HE2A 4KIKA 4MXAA 3L1SA 5LVLA 4XEYA 3A7FA 3CGOA 4BICA 1MQ4A 4OTQA 4RJ7A 4UY9A 4TN6A 3CE3A 4I5CA 3V5QA 5HLNA 3D2IA 4U8ZA 4DGNA 4FUYA 4O4EA 3VWAA 4EZ3A 1PYXA 3WF6A 4C36A 3HA6A 3WF5A 3FXWA 3IDCA 5AA8A 1ZLTA 2NYAA 4E6DA 3W1FA 5AAEA 2VTHA 2J0MB 4C3RA 3PXKA 2VWXA 3QTIA 2QI8A 4ZMEA 2J4ZA 2C6KA 4GUEA 2XAMA 5AP1A 5HNIX 1YI6A 4I3ZA 4FKUA 4F6UA 5AUXA 4B8MA 4USEA 2X81A 5BQ0A 4AGDA 2CLXA 3C4WA 3KF7A 3TZ9A 4DT8A 3PVGA 4CFXA 3VUDA 4M0ZA 1PXJA 3F61A 4FT9A 5J9ZA 2R4BA 3QD2B 2VRXA 3DB8A 2A19B 2W4JA 3Q53A 5J8IA 3U4WA 3BE2A 5J5TA 2OF2A 3QTQA 2WTJA 4RQVA 3NAYA 3EN6A 1H08A 3P08A 3P7CA 3U55A 4ZSLA 5CSVA 5F94A 1BKXA 3HMMA 2JKOA 4Q2AA 2XK4A 4CMOA 4WUNA 3GP0A 1Q3DA 3TKUA 4IB0A 3VS4A 2A98A 3HRBA 4XG7A 5EW3A 1PKDA 5EYKA 2R3OA 3R7UA 1JNKA 3WF9A 5ETCA 1YVJA 2PL0A 5CAOA 3PSCA 3RWPA 4HYHA 2XA4A 4WO5A 2UW9A 3FMNA 5HO6A 4BDHA 4CLIA 2GFCA 2ZMCA 3MJ1A 2OJIA 3PRFA 4U97A 2XKCA 3GFEA 4WUAA 3F88A 5H8BA 3RTPA 3QD3A 3VO3A 5EW9A 3ZXTA 1Q8YA 4OW8A 3C7QA 2C6DA 3A7GA 4AGCA 2IG7A 1Q41A 3JPVA 5ANGA 3IGOA 4AN9A 5I5ZA 3LQ5A 2OFUA 5KUPA 2WMWA 3SW7A 2XCHA 1OL1A 2OSCA 2QO7A 5LQFA 1PXIA 5CSPA 2EWAA 4BZNA 4DEIA 2OWBA 4DH8A 4JOAA 2PTKA 3TM0A 5K0KA 5JFVA 3TMOA 1L3RE 3LLTA 4O7RA 4PDYA 4R7BA 5AUYA 5IDPA 3HRFA 4WBBB 1UNHA 3ZTXA 4I20A 4ZZNA 1OKWA 4LL0A 1J1BA 3AD4A 3F2AA 3QCQA 2YDKA 1YDSE 4JNWA 3IW5A 2IW8A 3TJDA 3OW3A 4CCUA 1YQJA 5AEPA 3E8CA 1ZOHA 2OH0E 2OG8A 4XG9A 3UDTA 3HYHA 3R02A 5HO8A 3NW6A 4YURA 3F2NA 4ZZMA 4EI4A 5CEIA 3GCUA 2PVRA 3FLQA 4IMYA 3DBEA 3EN5A 4TYHA 5CEKA 4DFZE 1DI9A 3UZRA 3QKLA 5EOBA 3LPBA 5AUZA 3QU0A 3TIZA 2C5YA 4YZBA 2YISA 3OF0A 4IC8A 2R0UA 4YLLA 2P0CA 4ANLA 5M08A 2GS7A 3QLFA 3PIYA 3DJ7A 3GC9A 2F7EE 1OPJA 4ZS0A 5E1EA 5HKMA 3W2PA 4C4EA 3DCVA 3F3WA 5B0XA 3FZSA 3B8QA 4YC8A 3P78A 3VS6A 1K2PA 1OIYA 4B8LA 1ZMVA 2HZIA 3MA3A 4C4GA 3KMMA 4IB5A 4PMMA 1ZWSA 2PE2A 3FMKA 4LUDA 5EHYA 4D5KA 4DINA 4ZY5A 5HD4A 4DH7A 4MBLA 4QP6A 3H3CA 4C59A 4F64A 3NCGA 1OPLA 4WHZA 5IA0A 3EQCA 3UYTA 2WIHA 1XH6A 5EM6A 5B2MA 4MKCA 3FHRA 2W4OA 3I7CA 4FVPA 4NKAA 4U42A 4RSSA 3U6IA 2UZVA 2GSFA 5D41A 2BRGA 3U51A 3VC4A 3PYYA 4MCVA 1UV5A 4OAUC 3R01A 4P5ZA 2WMQA 4G3DA 4W4WA 1GY3A 2W06A 1M2QA 4BYIA 4XBRA 3DLZA 4EQUA 5IUGA 4OTWA 4BWPA 4J8NA 5CNNA 3ZFMA 5E8YA 4X3FA 4AU8A 4ACDA 5C8NA 4ZLZA 4ACMA 1OGYA 2O65A 4JQ7A 1YWVA 3BLRA 3D2KA 3FLSA 5M51A 4WA9A 2JDSA 4H39A 3PJ3A 4HZSA 5LJJA 2C6LA 4BHNA 4DH1A 4O1OA 3OROA 3HAVA 2XM9A 3VBVA 1VLRA 2E2BA 3BL7A 2C3KA 4M68A 3ZC5A 2WEVA 4J99A 3PE2A 4ARKA 3D15A 2YJSA 3E92A 4KIKB 3SOCA 3VJOA 5A6OA 4RA4A 3N4TA 4D2RA 4Z7GA 1FOTA 1J7UA 3A4PA 3ENMA 3MY0A 3A8WA 5HBEA 4QYYA 3VS2A 4ZS4A 1P4FA 4F08A 4RIYA 3GC0A 4DHJA 3F7ZA 2B9JA 1XO2B 2XKFA 2C68A 3OWJA 2Q0BA 2ZV2A 2YDIA 3VUIA 3COMA 4XH6A 3LXLA 4MUQA 5GNKA 5JFXA 3QZHA 3MH3A 2OJGA 4M12A 2WZJA 3HV4A 3WYYA 5B2LA 3OS3A 1SMHA 4RJ3A 4QQJA 1OVEA 4PL4A 4YHJA 4BCJA 3U6JA 1Y8GA 3UVQA 4G5JA 4Y46A 2PVFA 3F2RA 5HVKA 2CKOA 2ZOQA 4FTRA 2KULA 2O8YA 3EN4A 5A4LA 5KMMA 1YXXA 4LYNA 2GTNA 1IASA 4RT7A 2ESMA 4FICA 4J1RA 2W5HA 4R3PA 4TYEA 1XH9A 4FTLA 4UYNA 3HGKA 5T6KA 4BZDA 1H26A 3MY1A 2WAJA 4GG7A 4PDOA 4XMOA 5BUIA 3EN7A 4UX9A 3BBWA 2I0VA 2WQOA 3F5PA 2OU7A 4BI1A 2GS6A 5ANJA 2XS0A 3MDYA 3BHYA 4FNYA 4WKQA 3G2FA 4RIWA 3Q9YA 2ZB1A 5ANEA 3QZIA 2FSLX 3EHAA 3KMWA 2VU3A 4DA5A 4GIHA 4XCUA 2BZIB 3PDTA 1ZYLA 1GZKA 2WIPA 1KE7A 4FVRA 3BL9A 3GOKA 5FEEA 5IEXA 2EB2A 1U4DA 4G31A 4IBMA 3A61A 4HVSA 2FA2A 4WRSA 2WMRA 4ERKA 3WE8A 3NW5A 3VN9A 2J0LA 3VQUA 2PYWA 1M2PA 1W0XC 3DAJA 5HG8A 4K1BA 3U6HA 3IK3A 3IW4A 3LQ8A 2YZAA 2F4JA 4S32A 4MF0A 3RNYA 4Z16A 4N0SA 3D83A 2HIWA 3W0OA 3RZFA 4PMTA 3OWPA 4YO6A 1H1QA 3SQQA 5AUTA 1H24A 2EUFB 2QONA 1O9UA 3IDPA 5JZJA 4JVGA 1QPDA 3QTSA 4TNBA 4I6HA 4EJ7A 4FKPA 1ZXEA 5C1QB 4KRCA 3AXWA 3QWKA 3PUPA 2R3PA 2BRNA 2YJRA 5FXRA 3OXIA 1P4OA 2X4FA 4L01A 4QTDA 2C4GA 5LMKA 3QHRA 4Y8DA 1GZ8A 3EQBA 5CF6A 2O63A 3QL8A 3CQWA 3ZCLA 3LFQA 3F5GA 4NCTA 2UW6A 3RAHA 4HYUA 4TYHB 5IPJA 2BDJA 5HNBA 1E1VA 4RA5A 5EM7A 5GINE 4YGAA 5M4FA 4AUAA 4C34A 2JIVA 2C5XA 4XLVA 1PXKA 3T9IA 3Q5IA 4DTKA 2VX0A 3FZOA 2VTLA 3C4CA 4IJ9A 3SXFA 4JRNA 5AWMA 3GQIA 4O82A 4L42A 4R3CA 4I5HA 1XH5A 3AT3A 3R00A 3FWQA 3MJ2A 3W0MA 4EL9A 3DU8A 4FA2A 1U5QA 3AMAA 4CTCA 5IA1A 3W2QA 4CT2A 4FIEA 5HLPA 3BGQA 3OP5A 2OJ9A 4S2ZA 4W9WA 2W1ZA 1MRVA 4MNEA 2W17A 2IF8A 3G90X 5EKOA 3OUNB 3QAME 4IE9A 4QNYA 4WG5A 3BWFA 1CTPE 2QOFA 3H0YA 2XNEA 4AT4A 3MBLA 4F63A 2X7GA 4BBEA 2F2CB 4EONA 2C3IB 5JZNA 4C4HA 4KIQA 4QP7A 4TZRA 3LFDA 1FMOE 4GT3A 5AA9A 4UMPA 3FPQA 3KREA 1OIRA 4ZSEA 4J53A 5HNGA 3VBQA 2YCQA 4WD5A 3UQFA 4IIRA 3UE4A 2OXXA 4PDSA 2OF4A 4UWCA 2VWBA 3VS1A 5IA3A 2QLQA 4YU2A 4X3FB 3CP9A 1H28A 3B2WA 4BI2A 3E7VA 4GFGA 4IXPA 4BCIA 5CLPA 3BPRA 3FYJX 4S34A 5CSHA 4NW5A 3DB6A 4DGMA 4YJOA 5L8LA 2CNVA 2YIQA 2HZ4A 4GS6A 3PFYA 2WQMA 5E8UA 3FXZA 3AT4A 3DQXA 4A9SA 3W0NA 3KRRA 2YIXA 3ZUUA 3W10A 5LCJA 4F9YA 4FV7A 5AP6A 5AP7A 1Q5KA 3KA0A 4GJ2A 5A4TA 4FZ7A 1Y6BA 3W0SA 5CVFA 4RIYB 4O21A 4DGGA 4F7LA 2A1AB 3DTWA 2F9GA 2PZPA 4EOSA 3DFCB 1NXKA 2QODA 3UG1A 2PVJA 4B99A 3OTUA 5DEWA 1OPKA 4TY1A 4GH2A 5CAPA 5BMSA 3PVUA 3F69A 4BCMA 2BR1A 5FQDC 4ASDA 3CPBA 4HYSA 2VWVA 3H30A 3NCZA 3HP2A 1R39A 4A4LA 3V5PA 1BMKA 4XP0A 1XH7A 4X2GA 3SV0A 3PG1A 2BKZA 3DZQA 3SD0A 3MVMA 4A07A 1NVSA 4YTIA 1F3MC 5JGAA 3N4VA 4MD7E 4LOQA 2YWPA 5K5XA 5DMZA 2FO0A 1V1KA 3QA8A 4Z55A 4M15A 2B53A 4R5YA 4RIWB 4ZK5A 2VUWA 2HENA 2ZDTA 5HORA 4X21A 3RPRA 2IVSA 4XOZA 5EDQA 3HMNA 3TUCA 3O7LB 4G3FA 4EOLA 3HLLA 4D9TA 2QQ7A 5DVRA 4IAZA 2B7AA 4AXAA 3PY1A 1Q99A 2YHVA 2PVYA 4FKJA 2Y6MA 4MAOA 4Y83A 1CMKE 4UYAA 4IM3A 4YSMA 3BU5A 2QO9A 4JBQA 3UPZA 3COIA 4M84A 4RJ5A 2QOHA 5GJGA 4AW5A 3QLGA 4ZLYA 4FZFB 1GZOA 4IX4A 3CKWA 5DT4A 4ACHA 2QOQA 3M1SA 4YLKA 3DQWA 2GNIA 4ACCA 4XV1A 3AD5A 4OTHA 3RM6A 4BFMA 5ETIA 5LOHA 3ZLSA 5DFPA 4WNPA 3MN3A 4QMUA 3CSVA 3ORLA 3VF8A 2XF0A 5DR9A 4GG5A 4EZ5A 4WBOA 2GNHA 2XBAA 3WYXA 2OXDA 4HNIA 4A9UA 5J7HA 5I9WA 5KBRA 3LE6A 2W1HA 1MRUA 2XKDA 3HX4A 5JGDA 3F5UA 3FKNA 3RK9A 3C5IA 1H07A 1WVXA 1ZY4A 2IZRA 4EHGA 2YCSA 2PZRA 1QL6A 3TCPA 4IFGA 4DG2E 4DE4A 4NWMA 3VRZA 5EM5A 5DT3A 2NRYA 5KZ0A 4USFA 2XJ1A 4BDAA 2NRUA 4E4NA 2HZ0A 3PXZA 3ZMMA 3ALOA 4O1PA 3S2PA 2VTQA 5I9UA 2R3QA 2Z7QA 5JRQA 4QQTA 1PMVA 2YIRA 3TI1A 2XH5A