4QMWA

Mst3 in complex with pp-121, 1-cyclopentyl-3-(1h-pyrrolo[2,3-b]pyridin-5-yl)-1h-pyrazolo[3,4-d]pyrimidin-4-amine
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
287
structure length
286
Chain Sequence
GMQNLKADPEELFTKLEKIGKGSFGEVFKGIDNRTQKVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPYVTKYYGSYLKDTKLWIIMEYLGGGSALDLLEPGPLDETQIATILREILKGLDYLHSEKKIHRDIKAANVLLSEHGEVKLADFGVAGQLTDTQIKRNFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIELARGEPPHSELHPMKVLFLIPKNNPPTLEGNYSKPLKEFVEACLNKEPSFRPTAKELLKHKFILRNAKKTSYLTELIDRYKRWKAEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of Diverse Small-Molecule Inhibitors of Mammalian Sterile20-like Kinase 3 (MST3).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords SERINE/THREONINE-PROTEIN KINASE 24
total genus 96
structure length 286
sequence length 287
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2014-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4qmwA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4qmwA01
5HLPA 1IG1A 3ETAA 3PJ1A 4U9AA 3ORTA 5E4HA 3DB8A 3BHUA 4HVDA 4XRLA 3PZEA 5FGKA 5J87A 4J98A 3R8UA 5HGIA 2JFLA 2C47A 3VUIA 1H1RA 3EL8A 5HIBA 2VWIA 2WELA 2ZAZA 3FZPA 5EKOA 4U40A 3CPBA 3UOKA 2C30A 3VS5A 4CZYB 3A4PA 3FZRA 4MF0A 3FLZA 2G1TA 2CLXA 2YAAA 3Q60A 4M69A 4FSYA 5FTGA 2HWPA 3DZOA 2J7TA 5J1VA 5GIPE 1WVXA 5CU3A 4A07A 3LE6A 1OIUA 3FMDA 2QOBA 3FXZA 4E8AA 2R0IA 4KKEA 4Y72A 2FB8A 3UDBA 3ROCA 3DXNA 2E9OA 5AP0A 3RM7A 1ZMVA 4HZRA 3DBDA 3MIYA 4ZOGA 4FTUA 2FSMX 4KUJA 4BKYA 3NIZA 2ETKA 1VJYA 2PVYA 3V5WA 4Z7HA 4CFWA 3LFEA 3DBEA 2Z2WA 2O3PA 3ZXTA 2C6MA 2A4LA 2SRCA 3OWPA 2YZLA 2WHBA 1YI6A 4QMXA 4BGGA 1U54B 4A9UA 4BDGA 2OIDA 4G9CA 4CCUA 2R2PA 2XIXA 2YEXA 1LPUA 5IQCA 2ZYBA 3QRUA 1ZZ2A 2UW7A 2FO0A 3PIZA 2XK7A 3FI4A 5TOZA 1OL7A 1Q3WA 2YIRA 2JITA 4MEDA 5E8XA 2GDOA 4KS7A 4HOKA 2J0LA 5J7HA 4PV0A 3AT4A 2ITVA 3POZA 3Q9ZA 4KBAA 4NCTC 4YJQA 4Z9LA 1OKZA 1I44A 4MXZA 5K9IA 2JC6A 1U54A 3RNIA 4I93A 4N0SA 5BYZA 4IWOA 2XCHA 4FZAB 2Y4IB 4AOJA 3OCBA 3Q9WA 2OXDA 2R3HA 4YJNA 4CNHA 4D1SA 5KKRB 3OBJA 1BL7A 2C6KA 2P2IA 4Q5EA 4RIYB 1OBGA 3QTSA 5CSXA 4ASXA 5EQEA 3M2WA 3UJGA 3SAYA 2HY81 4WNOA 4YZMA 4D55A 5M56A 5LCJA 3T3VA 5BPYA 2ITXA 3P7BA 3DKGA 2BIYA 2HCKA 3OG7A 2QOOA 2XJ0A 2YIWA 2OSCA 3R83A 5AA8A 1OIRA 1YWNA 1BX6A 3GCSA 4BFMA 4E1ZA 2X4ZA 3QUEA 4RJ3A 3ZH8A 1R3CA 4ITJA 1R39A 5D12A 4F64A 4QTEA 3IGGA 4BI0A 4ZTMA 3FYKX 3CGOA 1VZOA 4OT6A 3KA0A 5E1SA 3UO5A 3ZU7A 1ZZLA 4FKOA 3OC1A 4C8BA 1U4DA 3F7ZA 4G3EA 1R0PA 4XLVA 1QPCA 3COMA 4NH1A 4UMQA 2X8IA 5CAUA 5HTCA 4TNDA 3MTFA 3FL5A 5L6OA 2F2UA 3MY1A 3QTQA 4I4EA 4AW1A 4M12A 4FIEA 4N70A 4YBJA 3QXPA 4Y85A 3UZRA 4Y83A 4O7NA 4U3ZA 3LCOA 4FTCA 4DAWA 2PZIA 4B4LA 4O7WA 1JSVA 3UG1A 3FMLA 4DEGA 2W1IA 4FEWA 1PMNA 4O91A 3A8WA 1H1WA 3D9VA 4IC7A 4FKIA 4I41A 4J99A 4YP8A 3W2RA 3EKNA 5AMNA 5DRBA 4F0FA 5AV4A 4IVCA 4FSQA 4JT3A 4KB8A 2RSVA 2OO8X 4LUDA 4X0MA 4YNOA 1I09A 2H6DA 4YJPA 3WIGA 4JI9A 3COKA 3G90X 3O23A 4HGLA 3K3JA 5CENA 3WYYA 1ZYJA 3HV7A 4DG0E 5AAGA 3LAUA 3C4WA 1APME 1M17A 4H3BA 1FPUA 3EN7A 3P79A 4FYOA 3VHEA 4DC2A 2BFYA 2GQRA 3RWPA 5CEIA 4CGAA 1K2PA 3GVUA 4QYEA 4BZOA 1QPEA 4IEBA 3PJCA 4LV8A 4YU2A 3D2IA 4RA4A 4RSSA 4AW5A 3HKOA 5DFPA 2RFNA 2ITZA 3F2AA 5GJGA 2Y4IC 4G1WA 3G6HA 5FEEA 3EWHA 4JR7A 3V6RA 4AUAA 3PDTA 4R8QA 3NNXA 4IZYA 1M2QA 3FKNA 3U55A 3MBLA 3R8MA 2WFYA 4C3RA 5J9LA 4MKCA 1OPJA 4O6LA 4LI5A 5AV3A 4AOIA 3BIZA 4UZHA 1K3AA 4WKQA 3LFFA 4LL5A 4AE6A 2FGIA 1CKJA 1E1VA 3D83A 3UOLA 2BFXA 5E1EA 2QHMA 3CIKA 3KGAA 4AGUA 2GSFA 4AP7A 3THBA 4HCTA 3QZFA 3E8EA 4I22A 1QMZA 2IW8A 3L9LA 3OCSA 2CLQA 5HORA 2QCSA 1FBNA 3R7EA 2AC3A 4L3PA 5EDPA 4BI1A 3C7QA 3OZ6A 2XKEA 4PRJA 3PPKA 1KV1A 4DTKA 2VTOA 4KIQA 2RFEA 4Z16A 3OEZA 2G2FA 4MQ2A 4FTAA 3ZTXA 4RWIA 3V5TA 4BDCA 2VWYA 5LWNA 4CFNA 3U9NA 1SYKA 5IA2A 4AWIA 4DFLA 4IAZA 5EYCA 2JIUA 2BAQA 4BCIA 4C2VA 4D2VA 4RZWA 3FKOA 3VWAA 5BNJA 4MNFA 4WG5A 3JXWA 5DI1A 1UNGA 5M51A 2OU7A 2HELA 2V7OA 2WTJA 2C5VA 3JY9A 4TTHB 4C7TA 1W7HA 4D5KA 1ZWSA 1WBOA 3NUXA 3MGYA 3POOA 5LVMA 2WXVA 3CY3A 4W4YA 1UWJA 3JVSA 5CSVA 4KIKA 3LLTA 2WMQA 3ZEPA 2CN8A 1YHSA 2DWBA 3RCJA 2R3RA 5IEXA 4C38A 3FLSA 3R01A 4FOBA 2VN9A 2WMSA 4A9SA 1JWHA 4F1OA 5F20A 4CRLA 4F7LA 1REJA 3BEGA 2XNNA 1PF8A 4HJOA 5G6VA 3L8SA 3E8DA 4GG5A 4PF4A 3ZFMA 2W06A 2UW4A 3OXTA 2YERA 3QHRA 5AP5A 3H3CA 3IKAA 1WBTA 2YCFA 4I6HA 4I5CA 4DITA 2VTRA 4IDTA 4X3FB 3NCGA 2QR7A 5IUIA 2QLQA 4XBRA 1BKXA 3U6IA 5CX9A 1JKLA 2ZM3A 4A9YA 2GCDA 4MXYA 4CRSA 2WOTA 4LOPA 4CV8A 3EH9A 5IEYA 3QLGA 2QO7A 5L6WL 5M4IA 2R3KA 2W0JA 4Q9ZA 2W7XA 3G15A 4A7CA 5AUXA 2OJIA 3TZ8A 4S33A 4FZFB 1OKYA 4F6WA 3DPKA 5HICA 3HNGA 4EOSA 3IG7A 3BRBA 3MPAA 4PQNA 1G3NA 2X8EA 3ZO3A 4FL2A 4NM5A 2ZV8A 4L01A 1OI9A 4AU8A 2J51A 4XJ0A 4O81A 4EYMA 3W16A 5JFSA 3HV3A 4ID7A 1OITA 3NW7A 4WNPA 4DFXE 4F7JA 3FI8A 3PVGA 3F5UA 3K54A 3QGYA 5HKMA 3VBYA 3ZMMA 4F9BA 3MSSA 3DNDA 4IW0A 3LXLA 2OXXA 1PXPA 4WBBB 4TYIA 2YFXA 5HG8A 1S9JA 4DCAA 3DK7A 2WTKC 3EB0A 4RJ7A 3CY2A 4IVAA 3RP9A 3RTPA 3ULZA 4USEA 5DYJA 3GC8A 1NXKA 1OL2A 1ZYDA 3ZUTA 3OHTA 1HOWA 1OIQA 4EH4A 3B2WA 4BWPA 1JKKA 4NKAA 4E4NA 3MYGA 3EZRA 4DEDA 4EKKA 3L1SA 1SZMA 4UB7A 5BVFA 2O5KA 5JFWA 5L2TA 3HA6A 1SM2A 4D0WA 2Z7LA 1IEPA 4MBIA 5CSWA 3R7YA 3C51A 2WMRA 1ZOEA 3R21A 2R0UA 4JL9A 1WFCA 4AZSA 3PA4A 1UKIA 5T6KA 4O7YA 4IE9A 4EHEA 3KRJA 3PSBA 4IB0A 4EQCA 5IDPA 2QO2A 3TNWA 2PYWA 2H8HA 1MQ4A 4YZNA 5DEYA 4Z7GA 5JH6A 4EK3A 2BCJA 3DTWA 1ZOHA 2WD1A 2PK9A 5LMKA 3K5VA 1M52A 5KUPA 4C36A 2JDVA 4L00A 4E6CA 4D2SA 4J53A 1VEBA 4W8EA 5HVKA 3HMOA 4HVHA 5I9WA 3UQCA 5KZIA 3EN4A 3PP1A 4PPBA 4DT8A 4DYMA 1XHAA 2WU7A 3Q96A 1DI8A 2YCQA 3PXZA 3QQJA 2C0OA 2X0GA 2PHKA 4NJ3A 5IDNA 3EN5A 1P2AA 4X7QA 2JKMA 4KRCA 5J8IA 1TQPA 3MH3A 3VULA 5IEVA 1GZKA 1XBBA 2VTSA 4F63A 3QKLA 5ANIA 4FT5A 2QC6A 5FEQA 4AT3A 4GIIA 4G6LA 2UVZA 4K18A 2X6DA 2R3OA 4BIDA 4F0IA 1YXUA 3ZDIA 2ITWA 4O7SA 2P0CA 1UNHA 5ANJA 3EQGA 4DGMA 3RHKA 4U41A 1FOTA 4PPAA 4XG7A 3OWJA 4G3GA 4HYHA 4E4LA 3C0GA 4IZAA 2VO7A 2I6LA 3KK9A 4I5HA 4ONAA 2BZJA 4QMUA 4O7VA 3RPOA 3OXIA 4BDFA 3BEAA 5GHVA 3QD3A 3R8LA 4CTCA 3WF8A 5EOLA 4FTOA 3CP9A 3UE4A 4CXAA 4I0SA 4OBPA 5BYLA 3DQXA 3OXZA 5E8VA 4MK0A 4RFYA 3P7CA 1XH9A 4U8ZA 3VJNA 4AT5A 4B6LA 5IMXA 1IAJA 2ETMA 5F94A 5CEPA 5CU0A 2A27A 2UZOA 3W32A 4TYHA 4IM3A 4DEEA 3QTZA 3LKMA 1OL6A 1YWVA 3VAPA 4Q5HA 1CSNA 2ITOA 4K9YA 5ACBC 4E6AA 4F1MA 4BHZA 3UC3A 3DBQA 2C0TA 3NR9A 2R64A 4C3PA 2UZLA 2YAKA 3HZTA 4XG3A 3CXWA 4YMJA 4RLLA 3EQCA 2ONLC 3P0MA 3QHWA 1M2PA 2C6LA 4BCQA 4QO9A 3FJQE 3RKBA 4MXOA 3UYSA 5C9CA 3ZXZA 4AZFA 1PMEA 4X2GA 4C59A 5EDRA 4ASEA 3NW5A 3C5UA 3MS9A 1W98A 4BDKA 2WIHA 3IW7A 5C03A 3QAME 4FV3A 2VGOA 3DLZA 3FL4A 2VWXA 5AR8A 2GQGA 3Q9YA 2XNOA 4JIAA 5IQAA 3II5A 2PMOX 2LAVA 3VC4A 2WB8A 4GW8A 5E8TA 4TPTA 4TY1A 4E20A 2X39A 1Y8GA 4DLJA 4XP2A 2BDJA 4L3LA 4AG8A 2OIBA 5FXSA 4GK3A 2A19B 4PY1A 2C3LA 3UMWA 2I0VA 3FMNA 4C4IA 5AIRA 2CSNA 2J5FA 4C4EA 1GIHA 2R3QA 3QZGA 3VBWA 4CFMA 1ZXEA 4HYIA 2VWUA 4RC2A 4V04A 4XCUA 3R9HA 2R3NA 5CAQA 5DOSA 4EI4A 3FXXA 2Y8OA 3HECA 3LFCA 1BI7A 4E93A 5KMNA 1UU8A 2BRGA 4BCKA 3ZM9A 4E6DA 4DH8A 3UIUA 2YA9A 5CQUA 2BZIB 4KA3A 3IOKA 3FSKA 3V8TA 4QMOA 3EFJA 4X2JA 1PXKA 3E8CA 5TF9A 5HLNA 2PUUA 3AQVA 2PY3A 3O8UA 1PMUA 1CMKE 2CKPA 3LMHA 2BVAA 2PVJA 3ZCLA 5LMKC 2HYYA 4BL1A 4V0GA 5GIOE 4P4CA 1R1WA 3KL8A 1XH8A 3NW6A 3R8VA 3QD4A 5EYMA 2Y9QA 5EOBA 3LFNA 4BGQA 4QP3A 3QU0A 4FSZA 3BQCA 3FE3A 4YZDA 3NYXA 3BU3A 3EQBA 4JQEA 3L8VA 1YDRE 5EW9A 3FPQA 4AGCA 3LLAA 4JRVA 5IQFA 5D41A 5HE1A 2BZKB 1VR2A 1LUFA 2XA4A 4IXPA 4NM3A 3ZO2A 2C6DA 4ZLZA 3MB6A 4PMTA 4E5WA 2F7EE 3ZRKA 1WBNA 2J90A 3OT8A 4OTFA 2F57A 4A4LA 4O7ZA 4XG6A 3TZ7A 2RKUA 5GJDA 4NIFB 4EWHA 1GIIA 3F69A 2IVSA 3KN5A 3NAXA 2YITA 3EQDA 4FTRA 3MIAA 5AUTA 1P4OA 3RWQA 2R4BA 1ATPE 3NWWA 2VTPA 2Z60A 4IH8A 4M67A 3SG8A 3QQGA 3TDWA 2BALA 3RI1A 3HDMA 3MA3A 4NZWB 4R5SA 3NVKI 4MAOA 4GUBA 4J7BA 4C4JA 5LJJA 2JDRA 3REPA 3BYMA 4C33A 3SG9A 1H24A 1PXIA 2CGUA 3VRZA 4H3QA 4O1PA 4CYJA 3NX8A 2VNYA 3QKMA 4EH7A 5FXRA 2OIQA 2XEYA 5HZNA 5CU4A 3LFAA 4NW5A 2GFSA 3R9OA 5BVEA 3HGKA 3WF6A 2IZTA 3MB7A 4RC3A 3TWJA 2IZSA 1O6LA 3OOMA 2QONA 3LXKA 4XOYA 2ZOQA 2HZ4A 4QYHA 5AP6A 3PJ2A 1RQQA 2F7ZE 1IR3A 3OY1A 4FSWA 3PXKA 3N4TA 3BQRA 4M69B 2VU3A 4FTMA 3VRYA 4PTCA 3GGFA 4YTHA 4EZ7A 4GSBA 4ZY6A 5JSMA 2UVXA 4I5PA 3BU5A 1KV2A 3E8NA 3MA6A 4BCHA 4XG4A 3GFEA 3UG2A 2HK5A 4PP7A 4I1ZA 4JBPA 4BZNA 1XKKA 4ERWA 1FVTA 3BLRA 4EONA 4ZS4A 4CD0A 3AMAA 4ZY5A 1IASA 4AE9A 3KCKA 2PVKA 3O8TA 4DHFA 2J0JA 5JRSA 4RFZA 3G51A 3R1QA 4M14A 2WKMA 4ZLYA 2HOGA 4EJNA 2J6MA 5IPJA 3MTLA 1F3MC 3FHRA 2JDOA 1ZAOA 3OFMA 2XZSA 3PRFA 4F6SA 5EI6A 2BDFA 3D5UA 5KHWA 5TR6A 3R1SA 1NVQA 4BBMA 3RJCA 3AGLA 3KMMA 4FL1A 3TM0A 1DM2A 5AUVA 4R77A 3I7BA 3DQWA 5A4QA 5HIDA 4DH1A 3VS6A 4F1TA 1ZRZA 4GU6A 4MTAA 5T68A 4OTHA 3VUMA 4RVTA 1U5RA 4YZBA 5AUWA 3ZBFA 1U5QA 4DFZE 1P4FA 2UW0A 1OUYA 4BKZA 1GIJA 5BUEA 4FKSA 2GNIA 3RPRA 2HAKA 1W82A 3QRKA 4M3QA 2G01A 4QQ5A 1FVVA 2WMUA 4BCJA 3FMEA 2NO3A 4O0XA 1KSWA 2QOHA 3M11A 3DB6A 2OXYA 5AAEA 4C34A 1E9HA 4M15A 4OW8A 5DVRA 2VWWA 1B38A 3HA8A 2W5HA 2YLEA 3NCZA 4N4SA 3O50A 4A9TA 4AW2A 5D10A 2PMLX 4IM2A 2PMNX 5FWKK 2YIXA 5AWMA 4U44A 4WHZA 1ZARA 2BRHA 4ZP5A 4G31A 2ZDTA 1JAMA 1H08A 3DT1A 3NGAA 3RAKA 2YDJA 4JJRA 4NEUA 4L52A 2VUWA 2W5BA 4FKGA 4L68A 3NZ0A 1SVHA 4M0YA 3RAHA 3N9XA 2A1AB 5IU2A 1YOMA 4KKHA 4EOKA 4IM0A 3KMUA 2EB2A 2C1AA 3EZVA 3KEXA 4K11A 2J2IB 5H8GA 4FUYA 3TNHA 2X81A 3KY2A 5KNJA 1XBCA 3PG1A 3CD3A 4PUZA 4G3FA 3VS2A 3NS9A 3GI3A 3O8PA 4LQMA 4R3RA 4GKIA 4FV4A 2EB3A 3Q5ZA 2F2CB 5G1XA 3GU5A 4C57A 4IB5A 2J9MA 2UZBA 1MP8A 3ZLSA 4UN0C 1DS5A 1WBSA 2OF2A 3D4QA 3I5NA 4S34A 3WF5A 4C37A 3GC9A 4M0ZA 2DQ7X 2VO6A 2GHMA 5C8KA 3JR1A 3PWDA 4KRDA 3IO7A 2Q0NA 3G9LX 4BC6A 3FI3A 3N51A 5FTOA 3M42A 3V5PA 1FVRA 3DKFA 3R04A 3CJGA 4FKWA 4I6QA 2YN8A 4IAYA 5AR4A 3RZBA 4CMOA 5CSPA 4JG6A 3GCVA 4AXAA 2VO0A 3DNEA 5JN2A 4JX3A 3FQEA 1RDQE 5CXZA 3GBZA 3FZOA 4BIBA 4ANBA 4YNEA 3V8SA 4JNWA 4FIGA 4YHTA 4OTGA 3RHXA 5BX0A 4FKLA 5A4TA 5EDQA 5M4CA 3PSCA 3KREA 3EJ1A 4JG7A 3AD4A 2WTVA 4ACCA 2VTJA 4WNMA 2QQ7A 2YM8A 1CKIA 3F7WA 4IVBA 1WVWA 1XH4A 1V0OA 2YHVA 1G8SA 2X9EA 3A60A 3E5AA 4L3JA 4FYNA 2VTHA 2WU6A 2GU8A 4IB1A 2EU9A 4C62A 4FTJA 5CVGA 3EQPA 5HTBA 5JZNA 5J1WA 4O0WA 3ODZX 5M07A 4RBLA 1Y57A 1ZMUA 3Q5IA 3MI9A 2FSLX 1J7LA 4YUQA 2ZM1A 2PTKA 3A61A 4IX5A 2W99B 1BUHA 4YJTA 3R7UA 3F3UA 4GIHA 4Y5QA 2J5EA 4BYJA 3Q52A 4WA9A 2CGWA 3SOAA 4FK6A 4ZTSA 3QRJA 2XIZA 5DG5A 3TNPC 5KMIA 3PA5A 2XNEA 4XG2A 5HBHA 4QMPA 2NP8A 2CGXA 3F6XA 4CQGA 3LM5A 3TIYA 5GJFA 4EBWA 4IAKA 4XV3A 4ZZNA 3AC5A 1KE6A 2W4OA 3VUDA 3ANRA 4ZJVA 2XNBA 2GTNA 1XQZA 3C4EA 5AM7A 5KBRA 3O17A 5CEMA 3L9NA 3F9NA 4FODA 4FX3A 2OBJA 3R71A 4L8MA 4EYJA 2XKDA 3BYSA 3FLQA 3HRCA 2YABA 4EOJA 3DXPA 4FGRA 3I1AA 2XNMA 4ZY4A 2HZIA 4QP6A 4FV2A 4ENXA 5DR2A 2EVAA 5K0KA 4TYJA 1W0XC 2XRUA 1YXVA 3NRMA 1PYXA 3QC4A 4NTSA 4EL9A 4YGAA 1GZ8A 1KE7A 4CMUA 4C4GA 4CG8A 4E5BA 1IAHA 3QUDA 3U6HA 3I60A 3KKVA 2QU5A 2ESMA 2DS1A 2V62A 2BRBA 3HL7A 5K5NA 4ZTNA 2PZPA 4JS8A 4O0VA 5CF6A 5IQHA 3EFWA 5IG1A 4HVIA 3PA3A 3TL8A 3SXSA 3ORMA 4PNKA 3UVPA 3ET7A 4CCBA 4EZ3A 2J0MB 2CNUA 1LEZA 3A4OX 4ZJJA 4MD8E 3BGPA 4OUCA 3WF9A 4I3ZA 4XEYA 4L9IA 5IA1A 2IZRA 3U87A 5C01A 5I9VA 4RX5A 4KAOA 3NNVA 2PUPA 4JBQA 5M4UA 4AGWA 4YLJA 5IQIA 2C5YA 2RF9A 3C0IA 4GS6A 1OL5A 3R7GA 4FGBA 3E63A 2IVUA 4FNXA 3EN6A 4RFMA 4RT7A 5FBNC 2IO6A 3T9TA 3UQGA 3B8RA 4IB3A 3S00A 1SNXA 3HLLA 3KXZA 5A4EA 1ZYCA 4CTBA 5BUJA 1Q8TA 3ORKA 3EOCA 4QMVA 3SW4A 4O83A 3HMPA 5L8JA 2Y0AA 1TKIA 2GS6A 1B39A 2WEVA 4FUXA 1JBPE 5ANKA 3MH0A 4EK8A 4RIYA 3PY3A 5LVLA 2REIA 3TTIA 5CI6A 4BWKA 2WQBA 3P5KA 3V3VA 2I0YA 4E6QA 4EOQA 5LXMA 2G15A 2WTWA 3DFAA 1H1SA 4WSQA 3MVJA 5JGBA 4I92A 2Z7QA 1OIYA 2IVTA 5JT2A 3BWFA 1Q97A 2Y6OA 2QI8A 1Q8ZA 2QOLA 3I5ZA 3R1NA 1YXSA 5TT7A 4BTJA 4XLIA 3UOJA 2JKOA 2I7QA 3LOKA 2XEZA 4XOZA 1T45A 4DH7A 3NUAA 3UYTA 4CG9A 2XP2A 2EWAA 4EC8A 5CVFA 3R8PA 4FV8A 2UZNA 3VN9A 5ICPA 2BMCA 4AT4A 2WTIA 4RC4A 5HO8A 1WBVA 2IW9A 3GU7A 2PUNA 1NY3A 4I23A 3WE8A 4X3JA 4C2WA 2XJ2A 2BPMA 3S1HA 3NDMA 3NNUA 3QZIA 2OLCA 1ZLTA 4PMSA 3P9JA 3W33A 3C0HA 4J95A 2VO3A 4GEOA 3NSZA 4B8LA 3QCQA 3PVBA 5F95A 4O86A 4GH2A 2CCIA 5HI2A 4F7SA 5GZAA 3KVXA 3QCSA 1MRYA 2VTAA 4EH6A 4FBXA 4CKIA 4UMPA 5E90A 2C0IA 3EN9A 1OL1A 2VTNA 1JNKA 4JIKA 5E92A 1GOLA 3H9FA 2GQSA 3HMMA 4O82A 4BDBA 5J5TA 5A14A 4IQ6A 1PW2A 5FXQA 3E64A 4YO4A 1NVSA 3BHHA 3R6XA 3LJ2A 2F49A 4FV9A 3MY5A 3QTXA 1PJKA 5JZJA 4ORKA 2QU6A 2XKFA 2W1CA 4YPSA 4MNEA 3UGCA 1A06A 1OBDA 4CKRA 4NFNA 4QMTA 3RALA 3UO4A 4QQTA 2CKEA 4LG4A 2WO6A 4TXCA 5KMJA 3V04A 1UNLA 3RPYA 3IECA 4J52A 1H26A 2JGZA 2X7FA 3LCKA 3RPVA 3W2OA 2J50A 3HV6A 2F7XE 4HCUA 3NYVA 4NKSA 3V6SA 4FEQA 5LOHA 2ONLA 5IZFA 4IAFA 3E3PA 2BRMA 4UV0A 4JDHA 3VF9A 3W2SA 1DI9A 1ERKA 2ZV9A 4QPSA 3FMKA 3SLSA 4CLIA 4EKLA 3RPSA 4FSMA 3RAWA 3UVQA 4GJ2A 2UZTA 3WILA 4IAIA 4TYGA 4F08A 4F9WA 3Q2JA 2DYLA 4TW9A 3F5GA 3QC9A 3ACKA 3W8QA 5I3RA 4B7TA 2CMWA 5E91A 3KB7A 3KCFA 3IQ7A 4NIFA 4ZXTA 3VS3A 4EK5A 3WZDA 2UZWE 2W9FB 4XP0A 4ALWA 4EJ7A 1MRUA 4GFOA 3ALNA 2Q83A 4LUEA 5FTQA 4P5ZA 3CTJA 1A48A 4Q9SA 3FHIA 3R9RA 3MFSA 4CZTA 2WMAA 4ASZA 4EZ5A 2BHEA 4R3PA 2C3JA 4QTBA 3W2QA 2JEDA 3V51A 4KIPA 2CNVA 3F3VA 2OJGA 3OWLA 3TCPA 3ZOSA 3DK3A 3SXRA 2R3FA 1AQ1A 4W4VA 4U3YA 4EK4A 1GZNA 3AD5A 2XM9A 5AX9A 4E73A 3LJ0A 4RQVA 2C6IA 2HIWA 4L43A 5AV1A 4DFUA 3K2LA 3MVLA 4H1MA 4RVMA 2PL0A 4QMSA 4PDSA 5A6NA 4I5MA 3R8ZA 3HRFA 5ETFA 2ZB1A 4IAAA 3LMIA 2F9GA 3I0OA 4LM5A 5DT0A 4HW7A 4NK9A 4ZMEA 2OGVA 4JX7A 4AZWA 3ZO1A 1EH4A 2XK8A 5B7VA 1BLXA 4ZSGA 2Y6MA 4UZDA 4IIRA 3T8OA 3UO6A 3QWKA 5HG5A 1T46A 5AR3A 5L2SA 3TKIA 2B9HA 5DWRA 3ALOA 3MJ2A 4UMUA 5CNOA 5IA5A 2CHLA 1OPLA 4FOCA 2CJMA 4LMNA 3UNJA 1Q41A 3MDYA 3OUNB 5IUHA 4DGNA 2GNJA 4QNYA 4R7HA 2YDKA 2O65A 3ACJA 3BX5A 3FYJX 5HEZA 3LCTA 2UW8A 3O7LD 4MX9A 3S2PA 3PXFA 4NW6A 5LVPA 5AR7A 2OICA 4GFMA 4HPUE 4KABA 3K3IA 3D7ZA 3CKWA 4DH3A 2WTDA 4JOAA 2WQMA 3E88A 1CKPA 4CFFA 3DS6A 3AGMA 4AACA 3TZ9A 5AV2A 3EL7A 1PKDA 4FKTA 2QLUA 4QMMA 4RVLA 3BU6A 3LJ1A 4FVRA 4ALVA 3NYNA 3KF4A 1JSTA 1PXMA 4WG3A 1O6KA 3VS4A 4G16A 4WIHA 4TYEA 3WE4A 4YJUA 5CZHA 4GCJA 2YACA 1U46A 3C50A 3SV0A 3NUYA 3MW1A 3RAIA 5IA4A 2NRYA 5AX3A 4DA5A 4CZUA 4TYHB 1M7NA 4QYYA 5EHLA 3OBGA 5L2IA 4O7RA 3LMGA 4JXFA 1LR4A 4KBCA 4MHAA 4KD1A 1JVPP 2R7BA 4QMYA 2C6EA 4BCNA 5L3AA 3CE3A 3QD0A 4GVAA 4USDA 5ANEA 3OUKA 4K77A 5HNIX 1WCCA 4FT9A 4BBEA 3TV6A 4PX6A 5JRQA 2W05A 4O22A 3SGCA 4JQ8A 4UEUA 5DIAA 2BROA 5LCKA 3RK5A 3KXNA 1V1KA 3TKHA 1GY3A 2VTMA 1F0QA 5CEQA 5IA3A 4YLKA 3QA0A 4RX8A 5EFQA 3DZQA 1OUKA 4BKJA 2W1ZA 4ANSA 3KMWA 4OTQA 3SD0A 4AN3A 3CPCA 5M55A 4C02A 1YDTE 2UW3A 4WBOA 5EI8A 4FZ7A 4H3PA 3VUGA 4D9UA 2ERKA 3QKKA 1J91A 3F82A 4Q2AA 3FZ1A 2UW9A 4YJSA 3ENHA 3H30A 2W17A 4ZK5A 4UYNA 3O51A 2B0QA 5HIEA 5AP7A 2PVHA 2W5AA 5IA0A 1CDKA 1FMKA 1H1PA 3KXXA 5DLSA 5HO7A 1OPKA 4FIHA 4L46A 5JGDA 3HAVA 3Q4ZA 4LGGA 3BZ3A 4CYIA 3BKBA 3W10A 2QNJA 2B9JA 4PPCA 1UVRA 4LGHA 4F9YA 3D2KA 4EEVA 5CEKA 4D2WA 4DF3A 4DLIA 3QQLA 4O38A 1JKSA 4E5AX 3VS7A 4QQCA 5HBJA 1M14A 4BDEA 5J9YA 3TV7A 5DT3A 3PZHA 4GL9A 2HW7A 4L6QA 4O7LA 5IMEA 4HYUA 4FG9A 2Z7RA 3K5UA 3EQRA 2WQEA 4J96A 3S4QA 3PLSA 5EYDA 4G5PA 2C5NA 3RCDA 4DGGA 4FL3A 3SDJA 5BVKA 3QBNA 4DFBA 2E9UA 1YXTA 3ZFYA 1TQIA 3ZLYA 3BLHA 2JBOA 1STCE 4LL0A 3ZDUA 4BWXA 2PULA 3KXGA 4P5QA 2PUIA 4PWNA 3GU6A 2R3IA 4KS8A 2W1HA 3TJDA 2B52A 2HWOA 4WO5A 4LRKA 5CANA 4E7WA 3F3WA 5I9YA 3U4WA 5FM2A 3TXOA 5JFVA 3BLQA 3AC1A 5AIKA 3HUBA 4NM7A 1ZOGA 2YISA 3P1AA 4HNIA 3VQUA 5EQYA 3E62A 1H8FA 2JDSA 2PMIA 4JVGA 4MYGA 3U6JA 5DMZA 4EOMA 5ANDA 2BHHA 4IHPA 5EI2A 4EHZA 4DG2E 1H00A 3NUUA 5DBXA 5JFXA 1X8BA 1RJBA 5DE2A 3P86A 3GU8A 3A7HA 4F6UA 3C9WA 5AA9A 3R1YA 5HE0A 2G2IA 2I40A 3D14A 1ZMWA 2XBAA 4RX7A 4D4SA 3WZUA 5GZ8A 5C4KA 1KOBA 3GQLA 4U43A 4D28A 5L6PA 4G17A 4NYEA 4YO6A 1YDSE 3OTVA 4NCTA 3EHAA 4TWPA 3DJ7A 1YOJA 4D9TA 1YXXA 1Y8YA 3KRWA 4LRJA 3UMXA 4DFYA 4II5A 3SXFA 2UW5A 3W1FA 4BI2A 3PRIA 2PPQA 3U54A 5DR6A 2KTYA 1XR1A 3W2PA 4X6QC 3KXMA 3P08A 3R28A 4X2KA 3SVVA 3UQFA 3QZHA 3MV5A 1YHVA 3D15A 3PP0A 4QD6A 3FMMA 3RZFA 3W2CA 5DH3A 4RPVA 3QRTA 2XYUA 3NMUF 1F5QA 4EOLA 2IG7A 2ACXA 2GTMA 4CV9A 5BQ0A 5K5XA 3LXPA 4L44A 3OY3A 3IK3A 4ERKA 3HMIA 5M53A 2W1DA 1W84A 3UIXA 4M8TA 4H36A 2JDTA 2VWZA 5HVYA 4AS0A 4FSTA 5IH6A 4ZZMA 3DDQA 3ZO4A 4YTIA 2QVSE 4FEVA 1W83A 2WGJA 3FQSA 3DOGA 4A9RA 4CFUA 5H3QA 1E1XA 4CKJA 5D7VA 4O27B 3F88A 5DA3A 2V22A 2VRXA 2YCSA 4UWYA 4ZSEA 3QX4A 3IGOA 4RWLA 5AV0A 3UBDA 1KOAA 3IONA 4I0RA 4IJ9A 5IISA 4FV0A 5L8KA 2P2HA 1O6YA 2DUVA 3HP2A 4KNBA 1WAKA 1PHKA 3PVWA 3MVHA 2RG6A 4S2ZA 4Y46A 1H1QA 4FZDB 3WIKA 4IWDA 3ITZA 4QTAA 5CU6A 4MF1A 4BDIA 4S31A 5I9ZA 2XNPA 2YJRA 2ZV7A 4LOOA 5CNNA 5EG3A 4B8MA 3ERKA 3A99A 4PP9A 4XV9A 4KKGA 4ARKA 1OB3A 2WQNA 4FNWA 4A4OA 1FMOE 1S9IA 3FBVA 4FT3A 5HE2A 4M84A 4Y8DA 3NAYA 4J8MA 3Q4UA 3HYHA 5A4LA 2BKZA 4L45A 5HU9A 4Z55A 3MWUA 5CWZA 3A7IA 4LMUA 3EKKA 3S3IA 4RLKA 3SRVB 3T9IA 2OF4A 3LFDA 4MXAA 3GQIA 4FV5A 4RVKA 4EOPA 5IH5A 5I9UA 3UNZA 1GJOA 3NLBA 5E8ZA 4H58A 5CF8A 4IACA 4Z3VA 3A7GA 5AJQA 4F9AA 4EH5A 2Y7JA 2X2KA 3MPMA 1XJDA 3S0OA 5HX8A 4MXCA 3KC3A 3WOWA 5LVOA 5CZIA 4RIWA 4GU9A 3GCPA 4QMQA 4XS2A 2OJJA 4GT4A 4QP9A 5L4QA 3C4CA 4K0YA 4D2RA 4O96A 3VF8A 4QPAA 1H0WA 4AX8A 4TWOA 5A4CA 1QPJA 3MJ1A 2QURA 3G9NA 3QTRA 5J9ZA 4WOVA 3PWYA 4TWCA 1NVRA 3ZYAA 5KKRC 3R22A 1IRKA 3TV4A 2XIRA 1FINA 4MH7A 1QCFA 3N4UA 3PJ8A 3VVHA 1M2RA 2B55A 2B9IA 2H9VA 3R73A 4FVQA 4OR5A 4BF2A 4PMPA 4QYGA 4BYIA 2GHGA 3LFQA 3VJOA 1URWA 2C3IB 2XK4A 3AG9A 3DJ6A 3ZM4A 5HU3A 1KE5A 4RQKA 3JPVA 3PE2A 2BDWA 3VBTA 4RJ4A 3CCNA 1QPDA 4EQUA 3QA8A 4LGDA 3VQHA 2QG5A 2JIIA 4FR4A 2JAMA 2P55A 3AOXA 3OF0A 3QL8A 2CDZA 4PL4A 2UZDA 5DR9A 4AZTA 1J1CA 5M08A 2NNWB 5ANOA 3C4ZA 2OFUA 4I24A 5AR2A 4W9XA 2C1BA 5AP4A 4U7ZA 3KXHA 3TT0A 3BHYA 3F5PA 3WZEA 5C26A 2X7GA 4ACDA 2CKQA 2B1PA 3QLFA 1WMKA 4FE2A 3KN6A 4H39A 1TVOA 3PSDA 4RIXB 3TACA 1G5SA 3EYHA 2IZUA 4HNFA 2HENA 1U59A 4DFNA 3ORPA 4QMWA 1MQBA 4NSTA 4BTFA 4KINA 4ANLA 5AM6A 4WUNA 4IJPA 2B4SB 3FV8A 4FF8A 2VWBA 3S95A 5KHXA 3PIYA 4GK2A 4OAVB 1J7UA 3LCSA 3CD8A 4MBLA 4FTQA 1ZYLA 2EXCX 2C69A 2EXMA 4LV5A 1YI3A 4ANNA 3PY1A 3TKUA 4FMQA 5IH4A 1BL6A 1W8CA 4LFIA 5BUIA 3I79A 2E9PA 1GZOA 2VZ6A 4YR8A 1SNUA 2QOQA 3FXWA 3HV4A 3GT8A 4R7IA 4TWNA 4Y5HA 5J7BA 4FKJA 5H9BA 2GNFA 2UW6A 3NIEA 5GNKA 3ZZEA 3G33A 3E87A 3HRBA 5EW3A 4DEAA 4GV1A 4NL0A 5JEBA 2CN5A 4YLLA 4PMMA 2C3KA 4MWHA 3GU4A 1JQHA 4FTIA 4G6NA 2P33A 3ZHPC 5K3YA 5CQWA 2G9XA 5CU2A 3IDPA 4EOOA 4YTFA 3ZRLA 3BBWA 3CTHA 3OTUA 3FKLA 3H0ZA 3B8QA 5DRDA 4C4HA 4TNBA 3NVMB 4P2KA 2FUMA 4JAJA 4LOQA 4FKQA 5JQ8A 3EQIA 4WT6A 4PTGA 4RGJA 3Q53A 3MH2A 4YURA 3LCDA 5HO6A 3RGFA 3AT2A 4UWBA 2HW6A 2JKQA 2XH5A 3E7VA 4YJRA 1H27A 3VW6A 4EOIA 4QMLA 3GC0A 3KRRA 5KMLA 4OLIA 3DJ5A 4J71A 4DCEA 3UIMA 3LFSA 5FEDA 4DTAA 3FAAA 1GAGA 5HD4A 2GS7A 4IX4A 4UXQA 5FDPA 5HVJA 2XB7A 1UU9A 3U8WA 2UUEA 3ORZA 4FI1A 4APCA 3Q4CA 5H8EA 1JPAA 3P4KA 3I0QA 3U4UA 4XG9A 4HGSA 5I0BA 4AA5A 4OT5A 3A8XA 5FP5A 1WBWA 5JMSA 2PVNA 1BMKA 2VTQA 3AC4A 4OBOA 4ZTRA 3OCTA 3VBQA 2OJFE 4C0TA 2IW6A 5CY3A 1FGIA 4YTCA 2X1NA 4U80A 4XH6A 2A2AA 2WMXA 4HVSA 4HPTE 4K8AA 5F4NA 3DLSA 4D0XA 5M4FA 2IWIA 3SKCA 2V5QA 4DGLC 2QOCA 2J0IA 5FRIA 4EHVA 4I94A 1Z9XA 4QTCA 4ZTLA 5CASA 4RMZA 4WSYA 2I0EA 3PUPA 5IQEA 4FEUA 4O2ZA 3GUBA 3QXOA 4RRVA 4BBFA 3CQUA 3V5QA 2E9VA 1UU7A 2WMVA 2ZJWA 4XG8A 2AYPA 3F3ZA 4L42A 3I6WA 1DAWA 4GVJA 4RA5A 5LARA 5ITAA 1YI4A 4BICA 3MH1A 3MFRA 4O21A 4GFGA 5DHJA 3Q6UA 5E8YA 5LMAA 4AN2A 4QMNA 5LVNA 1H0VA 3R02A 4RIOA 3ZSGA 3PTGA 2PE1A 1UWHA 4XV2A 4AF3A 4A06A 1BYGA 4IZ7A 1Y91A 3HV5A 3G6GA 3FMJA 1YRPA 4OAUC 5E8SA 2B54A 5T3QA 3TI1A 5I9XA 3KRXA 2GNLA 1NA7A 2XS0A 4DH5A 1YQJA 3LM0A 5AAFA 3DA6A 1UU3A 1TQMA 2PVMA 4KIOA 4ZLOA 2XM8A 2YM6A 3H10A 3ID6C 3TG1A 1FGKA 1KWPA 3TNIA 3F66A 5L2QA 5JQ5A 3Q04A 4IX6A 3AXWA 3PYYA 4X21A 4DBNA 2WZJA 4OTIA 3IPHA 3G0FA 5FLFA 5TE0A 2XBJA 4FTNA 1YHWA 4GMYA 4FKPA 3W18A 5BYYA 4E26A 4MCVA 3AC3A 4E3CA 4U42A 1UKHA 1OMWA 4NM0A 1JOWB 3E7OA 4HYSA 5ETIA 4EH3A 3QWJA 4XP3A 4FSUA 5ETCA 3FEGA 1V0BA 3NNWA 1XH5A 5AP2A 2ITTA 4YSJA 4MBJA 3H0YA 5FDXA 3BYOA 4BGHA 5M06A 1Q99A 3C13A 3L8PA 3TDVA 4FV1A 3Q2MA 4I6FA 4BCPA 4RIXA 4FZ6A 2BRNA 2OW3A 2PZYA 4AA4A 4ACGA 3PIXA 5FG8A 3R7VA 2PWLA 3BV3A 1JKTA 2PSQA 3P7AA 4YZ9A 1A9UA 4K33A 2X9FA 5H8BA 4O0UA 4BCOA 4K1BA 4BDJA 3MY0A 5AADA 4BZDA 2YM7A 2IVVA 3VUTA 3D7TB 5KO1A 4O6EA 4XX9A 2RFSA 5I3OA 5EQPA 2YIYA 1Z5MA 4M13A 3VHKA 2PZRA 3UP7A 1QL6A 4UX9A 4IWPA 2QHNA 2OKRA 3HEGA 4FSRA 5EM8A 3C4XA 4HZSA 2WPAA 1NW1A 1Q8UA 2BILB 2FH9A 2XK9A 3QQFA 3UTOA 2GNGA 3BBTB 3HP5A 4FTTA 4JDJA 2PVFA 4Y73A 5GZ9A 3MVMA 5HG9A 4GUEA 3UP2A 1P14A 3OP5A 3UPZA 4U79A 5IQBA 2ZMDA 3QD2B 4RX9A 5LWMA 4QP1A 3BV2A 2W1EA 3FLWA 3ORNA 3FZTA 3G2FA 4G6OA 4EUTA 3SX9A 2R9SA 3SQQA 4FV7A 2R5TA 1VYZA 3R30A 1ZY5A 4RJ8A 4D1ZA 5IUGA 5B2KA 4MVFA 4QYFA 3F5XA 5E7RA 3L9MA 1J7IA 3UOHA 1YKRA 1IA9A 3G0EA 4JBVA 4UMRA 4N57A 3R7OA 5A54A 3GC7A 2W96B 2JLDA 1K9AA 5KMKA 4F09A 4IZ5A 1B6CB 1RE8A 2H34A 3ZLWA 5L8LA 3FI2A 1PY5A 3ELJA 4USFA 3TUCA 4I6BA 4L67A 4R1YA 3ZUUA 4RIWB 3UZPA 3R9DA 4I4FA 3FLYA 5DT4A 4G9RA 3CKXA 3F2NA 4O2PA 4R78A 3N4VA 4W8DA 3BGQA 4I0TA 3PG3A 2C5OA 5EYKA 2O0UA 3QF9A 4TL0A 2XUUA 4YPDA 3RINA 2FVDA 3BE2A 4CFXA 2ZB0A 3EQFA 3LFBA 3WBLA 3EFKA 5AP1A 2CPKE 4ZIMA 3RNYA 5BVDA 4BN1A 3TTJA 2OZAA 2JFMA 1PYEA 2X2MA 3W55A 2OI4X 3KULA 3V8WA 3LQ5A 1GNGA 4ZEGA 4OTDA 1R0EA 5CS6A 3L8XA 3KF7A 2A0CX 2HZNA 4WNKA 5KZ0A 1HCKA 1OVEA 2W9ZB 1HCLA 3OT3A 4AN9A 5EHYA 2ZM4A 5HE3A 5CF4A 2PZ5A 3UVRA 5JGAA 4I21A 4KSPA 4R3CA 2Z7SA 2CNQA 2VX1A 3U9CA 2FYSA 5KE0A 3EMGA 4O0SA 5HD7A 1Y6BA 3RBWA 5CAOA 5M09A 1REKA 2ZVAA 2J0KA 2XKCA 2C6TA 2QODA 2AUHA 3E92A 4CT1A 3DXQA 4IC8A 4E4MA 4ZAUA 4ZSLA 2VX3A 3GB2A 4NUSA 4O0YA 1DAYA 4V01A 4L53A 5E8UA 4QNAA 4YC6A 2KULA 4D1XA 3QYZA 4OTWA 2XRWA 4DBXA 3U51A 4I20A 2E9NA 3OOGA 5DN3A 5DNRA 2XJ1A 2PE2A 4FICA 3COIA 4UMTA 4CFVA 1OZ1A 2HXLA 2I0HA 1WZYA 2YM3A 3CQEA 4D5HA 4A4XA 4EC9A 3QQHA 4KIKB 4ITHA 2ZV2A 4ANOA 3JUHA 2WNTA 3GFWA 1XBAA 3F61A 2C4GA 4KWPA 4XHKB 4W4XA 4ACMA 3R00A 3Q6WA 4CMTA 1JLUE 4ACHA 3R2YA 4C58A 4CT2A 3QUPA 4DEIA 2X2LA 2IPXA 3BPRA 2XIYA 2O8YA 3MN3A 2YWPA 3I7CA 4AOTA 5KMMA 4FV6A 4O7TA 3O96A 2V7AA 3E3BX 4C35A 3DBCA 5B2LA 3QFVA 4V0GB 3HX4A 4JDIA 4KSQA 3HDNA 4F0GA 1XWSA 2R3LA 4TZRA 2HY0A 3ZSIA 4PL3A 2YLFA 4FKRA 4X3FC 3DY7A 3B2TA 4IDVA 4QMZA 5A3XA 3Q3BA 3LQ8A 4HGTA 4J97A 4PL5A 4DN5A 2HXQA 2W4KA 2JAVA 3WF7A 3PXQA 2JBPA 4FK3A 4ZTHA 5AR5A 4AAAA 4BRXA 1Y6AA 3ZLXA 3IW4A 5E9EA 4EH2A 4ZTQA 2AC5A 4JAIA 2OZOA 2VV9A 3GEQA 5A46A 2BUJA 3OMVA 3C1XA 4BCMA 3QCXA 1UA2A 3D5XA 3GOPA 4WUAA 3RVGA 5K0XA 4YHFA 4BDAA 4QPMA 2WQOA 4GG7A 3ATSA 3MESA 5J95A 2V55A 4DG3E 3JYAA 2H96A 5HCXA 5BVOA 5KCVA 5F1ZA 4IWQA 3TUDA 2PVRA 1R78A 3FQHA 4QRCA 1AGWA 3FDNA 4F7NA 5KX8A 2UZEA 3FSFA 4G2FA 4OBQA 3RK9A 5FUTA 4PDOA 4R6VA 2QKWB 5BVWA 4TT7A 4FKVA 4FG8A 3HMNA 2O63A 3H9OA 4Y95A 3SW7A 4WD5A 5CVHA 5CAVA 3C5IA 4IX3A 3L9PA 2BZHB 1Q62A 5D1JA 5HHWA 3BHVA 4K2RA 1G8AA 4PDPA 3QGWA 2LGCA 3QYWA 2R3PA 3VS0A 1XH6A 4V05A 3DBFA 2R3JA 2W4JA 4JG8A 4DINA 3GENA 2I1MA 4GKHA 2VTIA 5EK7A 4LRMA 2PE0A 4R1VA 5C8MA 5K4IA 4C3FA 3IOPA 5EH0A 2O64A 3BCEA 3IW8A 4O0RA 2RGPA 4P7EA 1FQ1B 3CQWA 2YJSA 4FTKA 5FM3A 4DGOA 5HQ0A 4AGDA 1CM8A 2WIPA 4M66A 5HNGA 4U5JA 2PVLA 5L2WA 1LEWA 5CLPA 1VYWA 4ANQA 4EH9A 4B0GA 1OKVA 5CTPA 1XH7A 4JR3A 4QP4A 1L3RE 2YWVA 3WI6A 3QCYA 3HVCA 3ZEWA 4DEBA 2WTKB 4LYNA 5A9UA 4RWJA 3ZZWA 3CEKA 2WAJA 3DAEA 4EK6A 1OM1A 3A62A 3KVWA 3NUNA 1Q4LA 4U0IA 3VS1A 3JY0A 2Z02A 5CT7A 3QQUA 1SVGA 2ITUA 3BE9A 2GMXA 4NU1A 3VBVA 2ERZE 2GFCA 2UVYA 3COHA 3I6UA 2FA2A 5C8NA 2VGPA 3SOCA 3PLAE 4JBOA 1Q3DA 3MPTA 4O84A 4K6ZA 3O0GA 1PXLA 1WVYA 3ROYA 3TEIA 3R9NA 3E93A 5KMOA 4YC8A 2OZAB 1UV5A 3LPBA 3ZONA 4OTRA 2Z8CA 1SMHA 4O0TA 2WTCA 2IN6A 3SC1A 3OW4A 4NT4A 3GOKA 3QTUA 2V0DA 4NFMA 5H2UA 3D5VA 5HCZA 4ZMFA 3LVPA 5EM5A 4F65A 3CLYA 5HCYA 4E4XA 3D94A 1KE8A 4OTPA 4G5JA 2BTSA 3FC2A 3P78A 5I4NA 4YZCA 1NT2A 3OW3A 1OKWA 2QD9A 3A7JA 4EH8A 4IADA 5DPVA 2XF0A 2XMYA 3VUHA 3H9RA 5D11A 3GNIB 2GS2A 2G2HA 4XNEA 3KK8A 4IMYA 1PKGA 4QQJA 3JS2A 3MFUA 3BELA 4L7SA 5IF1A 4FEXA 3TN8A 2RIOA 2CKOA 2XCKA 4G3DA 5HESA 3PPJA 1ND4A 2X4FA 3CGFA 4FNYA 3SA0A 1URCA 3OWKA 3TUBA 5FD2A 4D2TA 2NRUA 4R5YA 5B0XA 3V01A 5AEPA 4TN6A 2R3GA 3LIJA 2YM4A 4YC3A 3ZC5A 5GINE 4N6ZA 5CXHA 3RMFA 4GYIA 4DE4A 1CTPE 3FZSA 5CAPA 4BY9E 5HLWA 1H4LA 2W1FA 3AC8A 1LP4A 4FG7A 3W8LA 1H25A 3ORLA 4BHNA 4CQEA 4RG0A 1Q61A 3UZTA 2F4JA 3Q9XA 2GNHA 5C1QB 4KBKA 5EW8A 2VWVA 4MXXA 2OK1A 3PY0A 3R0TA 4GYGA 5E8WA 4AQCA 5A6OA 3LHJA 4MWIA 4BR3A 4YJVA 4AZVA 4RJ6A 2UZUE 3ATTA 3PE1A 3LW0A 3QTWA 2QG7A 2RG5A 2BTRA 4U97A 1PXJA 4TKSA 1H28A 4ENYA 3UIBA 4JDKA 2XK3A 3H4JA 4FIFA 3ULIA 4H05A 2ITNA 4ZS0A 3G5DA 3DFCB 5AP3A 5CALA 4R7BA 2WMWA 3QX2A 2P3GX 2W1GA 3CJFA 2FSOX 3M1SA 4XYFA 3V5LA 3FPMA 2QOIA 4XRJA 4FIJA 4UWCA 3ZBXA 2Y4PA 5M44A 2OWBA 4FSNA 3QRIA 4J8NA 4GT3A 4UXLA 5CF5A 4EQMA 5TO8A 4C61A 2B9FA 3FUPA 4W9WA 3DCVA 2C5XA 3BGZA 3AMYA 3ZC6A 3NUSA 3FC1X 5HTIA 2X6EA 4YBKA 1XO2B 4ZJIA 3PXRA 2BR1A 4MD7E 2ZDUA 1H07A 4IFGA 2PU8A 3F3TA 4IBMA 2ITPA 1Q5KA 4HVGA 4X3FA 5C4LA 3OCGA 5ACKA 5EKNA 3FLNC 3QALE 4QP2A 1P5EA 2UZVA 3DTCA 2OJ9A 3EYGA 3LZBA 4BB4A 1AD5A 1ZY4A 3KFAA 2EXEA 4WRSA 5I5ZA 4UALA 4EWQA 1PRYA 2YM5A 5IQDA 3LQ3A 1KE9A 4CVAA 5IQGA 5F9EA 4UYAA 4H1JA 4IVDA 4MNEB 5EM6A 3UC4A 3RK7A 3PPZA 3C4FA 2X8DA 1YWRA 3ENMA 3OD6X 3SHEA 3OVVA 5BMSA 3D0EA 5J5SA 5LMBA 2QOFA 3O2MA 3PJ3A 1H01A 1ZYSA 3FY2A 4FNZA 4MD9E 4U45A 4AFEA 4F4PA 4FT7A 3LXNA 3NPCA 3O7LB 4ITIA 2JD5A 4PDYA 4JQ7A 5DGZA 4APPA 3SRVA 3GCUA 1Z57A 3GCQA 3FMHA 3KRLA 4S32A 5HBEA 2EUFB 5J79A 3DAJA 3CTQA 5IKWA 2XVDA 4GRBA 1J1BA 4B9DA 5HNBA 3OROA 3R2BA 2JKKA 4BDDA 4UBAA 2QKRA 3R63A 2GHLA 3DAKA 3HAMA 4M97A 2XK6A 4F9CA 1MRVA 1RW8A 1PXOA 2VAGA 4QT1A 3DGKA 1YVJA 4NJDA 2RL5A 1JSUA 4S30A 5FBOA 3F2RA 3EFLA 4EORA 4JRNA 3UPXA 3WZKA 3QTIA 3TZMA 4X6RA 4CSVA 1O9UA 3FY0A 4BCFA 4FVPA 4QTDA 4BCGA 1PMVA 4WG4A 3NUPA 3BWJA 2CCHA 4XV1A 4BVUA 5JKGA 2UV2A 4RJ5A 2XIKA 3O71A 4QP8A 3BYUA 3AMBA 3HUCA 4RZVA 2BAKA 4QOXA 4DEHA 1OECA 3UODA 3CSVA 5D7AA 5HX6A 2C6OA 3TNQB 1BI8A 3TJCA 3VIDA 3Q32A 4D2PA 4P90A 5EM7A 3WZJA 4YSMA 2YCRA 4ZSJA 5AUYA 4N6YA 2B53A 2OFVA 3EIDA 4U6RA 2OG8A 3NEWA 1IA8A 4J1RA 3ZUVA 4CEGA 1KUTA 2QOKA 5BMMA 3ZRMA 5FP6A 3D5WA 5KBQA 4UY9A 2ETRA 4DTBA 2QO9A 2BIKB 4FIIA 4FT0A 4FKUA 5C27A 3WYXA 2Q0BA 3DU8A 4FA2A 4D58A 4DT9A 5M57A 2VD5A 3TIZA 3DV3A 2ITYA 2E2BA 2R3MA 3AC2A 4BTKA 4IANA 4XUFA 3R7IA 5HOAA 3KQ7A 3FWQA 3VW8A 4ASDA 1J3HA 5AUUA 2P4IA 3KU2A 4QP7A 3ORXA 3ODYX 3BYVA 4C4FA 1PXNA 4GJ3A 4D4YA 4PNIA 4CLJA 3DKOA 3PVUA 3UNKA 1Q8YA 4YJOA 5FQDC 3IS5A 3OS3A 4NWMA 3V5JA 3AD6A 4G3CA 3VNTA 2WMTA 4AZEA 3A2CA 3JVRA 3Q4TA 1SVEA 4ZSAA 2VNWA 4O1OA 5CSHA 3DDPA 3GXLA 3P23A 4RWKA 3MFTA 5CT0A 5BVNA 2CGVA 2WOUA 3IW6A 1YW2A 1Q24A 2VX0A 4EHGA 2WMBA 4L7FA 4BIEA 4W4WA 2QR8A 2VTTA 4X2FA 2BKKA 2X7OA 4ZZOA 5DEWA 3ZFXA 1Q8WA 3DK6A 4HGEA 5AFVA 5JK3A 3OEFX 1YOLA 4XMOA 4HCVA 3VO3A 3WARA 2R7IA 3BHTA 5CI7A 2B7AA 1MUOA 2ZMCA 3IW5A 2WEIA 2YDIA 5ANGA 4F70A 4NTTA 2O2UA 5K4JA 4ALUA 1V0PA 4U81A 3CBLA 4IFCA 2HZ0A 1M7QA 2OH0E 3CC6A 4GK4A 3ZS5A 5EHOA 3I4BA 5AUZA 4EBVA 1OGUA 3PXYA 2NPQA 2OH4A 3NYOA 4ANMA 4G34A 4M68A 2IJMA 5D9HA 4GT5A 2YZAA 3KULB 2JIVA 3IDBA 5ETAA 3ANQA 4M7IA 4AA0A 3IDCA 4X2NA 4AFJA 2BAJA 3CR0A 1L8TA 5CYIA 4YHJA 4B99A 2ITQA 3ZSHA 4BDHA 4TRLA 3GP0A 2XNGA 3T3UA 2GPHA 3AT3A 3D7TA 4FTLA 3RM6A 5HG7A 3VBXA 1WBPA 2XYNA 5CEOA 2FSTX 3DKCA 5TKDA 4AW0A 5B2MA 2VTLA 4FC0A 3A7FA 3ORIA 4MQ1A 3I81A 4PTEA 4BTMA 4WRGA 2J4ZA 2RFDA 2YIQA 4EUUA 3CS9A 3QQKA 3EQHA 5LQFA 4D4VA 4OGRA 4JLCA 4F99A 3BI6A 2C68A 4XBUA 4D4RA 3VUKA 3PFQA
chains in the Genus database with same CATH superfamily
5HLPA 1IG1A 3ETAA 3PJ1A 4U9AA 3ORTA 5E4HA 3DB8A 3BHUA 4HVDA 4XRLA 3PZEA 5FGKA 5J87A 4J98A 3R8UA 5HGIA 2JFLA 2C47A 3VUIA 1H1RA 3EL8A 5HIBA 2VWIA 2WELA 3AKJA 2ZAZA 3FZPA 5EKOA 4U40A 3CPBA 3UOKA 2C30A 3VS5A 4CZYB 3A4PA 3FZRA 4MF0A 3FLZA 2G1TA 2CLXA 2YAAA 3Q60A 4M69A 4FSYA 5FTGA 2HWPA 3DZOA 2J7TA 5J1VA 5GIPE 1WVXA 5CU3A 4A07A 3LE6A 1OIUA 3FMDA 2QOBA 3FXZA 4E8AA 2R0IA 4KKEA 4Y72A 2FB8A 3UDBA 3ROCA 3DXNA 2E9OA 5AP0A 3RM7A 1ZMVA 4HZRA 3DBDA 4AQKA 3MIYA 4ZOGA 4FTUA 2FSMX 4KUJA 4BKYA 3NIZA 2ETKA 1VJYA 2PVYA 3V5WA 4Z7HA 4CFWA 3LFEA 3DBEA 2Z2WA 2O3PA 3ZXTA 2C6MA 2A4LA 2SRCA 3OWPA 2YZLA 2WHBA 1YI6A 4QMXA 4BGGA 1U54B 4A9UA 4BDGA 2OIDA 4G9CA 4O4EA 4CCUA 2R2PA 2XIXA 2YEXA 1LPUA 5IQCA 2ZYBA 3QRUA 1ZZ2A 2UW7A 2FO0A 3PIZA 2XK7A 3FI4A 5TOZA 1OL7A 1Q3WA 2YIRA 2JITA 4MEDA 5E8XA 2GDOA 4KS7A 4HOKA 2J0LA 5J7HA 4PV0A 3AT4A 2ITVA 3POZA 3Q9ZA 4KBAA 4NCTC 4YJQA 4Z9LA 1OKZA 1I44A 4MXZA 5K9IA 2JC6A 1U54A 3RNIA 4I93A 4N0SA 5BYZA 4IWOA 2XCHA 4FZAB 2Y4IB 4AOJA 3OCBA 3Q9WA 2OXDA 2R3HA 4YJNA 4CNHA 4D1SA 5KKRB 3OBJA 1BL7A 2C6KA 2P2IA 4Q5EA 4RIYB 1OBGA 3QTSA 5CSXA 4ASXA 5EQEA 3M2WA 3UJGA 3SAYA 2HY81 4WNOA 4YZMA 4D55A 5M56A 5LCJA 3T3VA 5BPYA 2ITXA 3P7BA 3DKGA 2BIYA 1W2FA 2HCKA 3OG7A 2QOOA 3KIOC 2XJ0A 2YIWA 2OSCA 3R83A 5AA8A 1OIRA 1YWNA 1BX6A 4O4FA 3GCSA 4BFMA 4E1ZA 2X4ZA 3QUEA 4RJ3A 3ZH8A 1R3CA 4ITJA 1R39A 5D12A 4F64A 4QTEA 3IGGA 4BI0A 4ZTMA 3FYKX 3CGOA 1VZOA 4OT6A 3KA0A 5E1SA 3UO5A 3ZU7A 1ZZLA 4FKOA 3OC1A 4C8BA 1U4DA 3F7ZA 4G3EA 1R0PA 4XLVA 1QPCA 2XAMA 3COMA 4NH1A 4UMQA 2X8IA 5CAUA 5HTCA 4TNDA 3MTFA 3FL5A 5L6OA 2F2UA 3MY1A 3QTQA 4I4EA 4AW1A 4M12A 4FIEA 4N70A 4YBJA 3QXPA 4Y85A 3UZRA 4Y83A 4O7NA 4U3ZA 3LCOA 4FTCA 4DAWA 2PZIA 4B4LA 4O7WA 1JSVA 3UG1A 3FMLA 4DEGA 2W1IA 4FEWA 1PMNA 4O91A 3A8WA 1H1WA 3D9VA 4IC7A 4FKIA 4I41A 4J99A 4YP8A 3W2RA 3EKNA 5AMNA 5DRBA 4F0FA 5AV4A 4IVCA 4FSQA 4JT3A 4KB8A 2RSVA 2OO8X 4LUDA 4X0MA 4YNOA 1I09A 2H6DA 4YJPA 3WIGA 4JI9A 3COKA 3G90X 3O23A 4HGLA 3K3JA 5CENA 3WYYA 1ZYJA 3HV7A 4DG0E 5AAGA 3LAUA 3C4WA 1APME 1M17A 4H3BA 1FPUA 3EN7A 3P79A 4FYOA 3VHEA 4DC2A 2BFYA 2GQRA 3RWPA 5CEIA 4CGAA 1K2PA 3GVUA 4QYEA 4BZOA 1QPEA 4IEBA 3PJCA 4LV8A 4YU2A 3D2IA 4RA4A 4RSSA 4AW5A 3HKOA 5DFPA 2RFNA 2ITZA 3F2AA 5GJGA 2Y4IC 4G1WA 3G6HA 5FEEA 3EWHA 4JR7A 3V6RA 4AUAA 3PDTA 4R8QA 3NNXA 4IZYA 1M2QA 3FKNA 3U55A 3MBLA 3R8MA 2WFYA 4C3RA 5J9LA 4MKCA 1OPJA 4O6LA 4LI5A 5AV3A 4AOIA 3BIZA 4UZHA 1K3AA 4WKQA 3LFFA 4LL5A 4AE6A 2FGIA 1CKJA 1E1VA 3D83A 3UOLA 2BFXA 5E1EA 2QHMA 3CIKA 3KGAA 4AGUA 2GSFA 4AP7A 3THBA 4HCTA 3QZFA 3E8EA 4I22A 1QMZA 2IW8A 3L9LA 3OCSA 2CLQA 5HORA 2QCSA 1FBNA 3R7EA 2AC3A 4L3PA 5EDPA 4BI1A 3C7QA 3OZ6A 2XKEA 4PRJA 3PPKA 1KV1A 4DTKA 2VTOA 4KIQA 2RFEA 4Z16A 3OEZA 2G2FA 4MQ2A 4FTAA 3ZTXA 4RWIA 3V5TA 4BDCA 2VWYA 5LWNA 4CFNA 3U9NA 1SYKA 5IA2A 4AWIA 4DFLA 4IAZA 5EYCA 2JIUA 2BAQA 4BCIA 4C2VA 4D2VA 4RZWA 3FKOA 3VWAA 5BNJA 4MNFA 4WG5A 3JXWA 5DI1A 1UNGA 5M51A 2OU7A 2HELA 2V7OA 2WTJA 2C5VA 3JY9A 4TTHB 4C7TA 1W7HA 4D5KA 1ZWSA 1WBOA 3NUXA 3MGYA 3POOA 5LVMA 2WXVA 3CY3A 4W4YA 1UWJA 3JVSA 5CSVA 4KIKA 3LLTA 2WMQA 3ZEPA 2CN8A 1YHSA 2DWBA 3RCJA 2R3RA 5IEXA 4C38A 3FLSA 3R01A 4FOBA 2VN9A 2WMSA 4A9SA 1JWHA 4F1OA 5F20A 4CRLA 4F7LA 1REJA 3BEGA 2XNNA 1PF8A 4HJOA 5G6VA 3L8SA 3E8DA 4GG5A 4PF4A 3ZFMA 2W06A 2UW4A 3OXTA 2YERA 3QHRA 5AP5A 3H3CA 3IKAA 1WBTA 2X0OA 2YCFA 4I6HA 4I5CA 4DITA 2VTRA 4IDTA 4X3FB 3NCGA 2QR7A 5IUIA 2QLQA 4XBRA 1BKXA 3U6IA 5CX9A 1JKLA 2ZM3A 4A9YA 2GCDA 4MXYA 4CRSA 2WOTA 4LOPA 4CV8A 3EH9A 5IEYA 3QLGA 2QO7A 5L6WL 5M4IA 2R3KA 2W0JA 4Q9ZA 2W7XA 3G15A 4A7CA 5AUXA 2OJIA 3TZ8A 4S33A 4FZFB 1OKYA 4F6WA 3DPKA 5HICA 3HNGA 4FRFA 4EOSA 3IG7A 3BRBA 3MPAA 4PQNA 1G3NA 2X8EA 3ZO3A 4FL2A 4NM5A 2ZV8A 4L01A 1OI9A 4AU8A 2J51A 4XJ0A 4O81A 4EYMA 3W16A 5JFSA 3HV3A 4ID7A 1OITA 3NW7A 4WNPA 4DFXE 4F7JA 3FI8A 3PVGA 3F5UA 3K54A 3QGYA 5HKMA 3VBYA 3ZMMA 4F9BA 3MSSA 3DNDA 4IW0A 3LXLA 2OXXA 1PXPA 4WBBB 4TYIA 2YFXA 5HG8A 1S9JA 4DCAA 3DK7A 2WTKC 3EB0A 4RJ7A 3CY2A 4IVAA 3RP9A 3RTPA 3ULZA 4USEA 5DYJA 3GC8A 1NXKA 1OL2A 1ZYDA 3W0MA 3ZUTA 3OHTA 1HOWA 1OIQA 4EH4A 3B2WA 4BWPA 1JKKA 4NKAA 4E4NA 3MYGA 3EZRA 4DEDA 4EKKA 3L1SA 1SZMA 4UB7A 5BVFA 2O5KA 5JFWA 5L2TA 3HA6A 1SM2A 4D0WA 2Z7LA 1IEPA 4MBIA 5CSWA 3R7YA 3C51A 2WMRA 1ZOEA 3R21A 2R0UA 4JL9A 1WFCA 4AZSA 3PA4A 1UKIA 5T6KA 4O7YA 4IE9A 4EHEA 3KRJA 3PSBA 4IB0A 4EQCA 5IDPA 2QO2A 3TNWA 2PYWA 2H8HA 1MQ4A 4YZNA 5DEYA 4Z7GA 5JH6A 4EK3A 2BCJA 3PUFC 3DTWA 1ZOHA 2WD1A 2PK9A 5LMKA 3K5VA 1M52A 5KUPA 4C36A 2JDVA 4L00A 4E6CA 4D2SA 4J53A 1VEBA 4W8EA 5HVKA 3HMOA 4HVHA 5I9WA 3UQCA 5KZIA 3EN4A 3PP1A 4PPBA 4DT8A 4DYMA 1XHAA 2WU7A 3Q96A 1DI8A 2YCQA 3PXZA 3QQJA 2C0OA 2X0GA 2PHKA 4NJ3A 5IDNA 3EN5A 1P2AA 4X7QA 2JKMA 4KRCA 5J8IA 1TQPA 3MH3A 3VULA 5IEVA 1GZKA 1XBBA 2VTSA 4F63A 3QKLA 5ANIA 2XARA 4FT5A 2QC6A 5FEQA 4AT3A 4GIIA 4G6LA 2UVZA 4K18A 2X6DA 2R3OA 4BIDA 4F0IA 1YXUA 3ZDIA 2ITWA 4O7SA 2P0CA 1UNHA 5ANJA 3EQGA 4DGMA 3RHKA 4U41A 1FOTA 4PPAA 4XG7A 3OWJA 4G3GA 4HYHA 4E4LA 3C0GA 4IZAA 2VO7A 2I6LA 3KK9A 4I5HA 4ONAA 2BZJA 4QMUA 4O7VA 3RPOA 3OXIA 4BDFA 3BEAA 5GHVA 3QD3A 3R8LA 4CTCA 3WF8A 5EOLA 4FTOA 3CP9A 3UE4A 4CXAA 4I0SA 4OBPA 5BYLA 3DQXA 3OXZA 5E8VA 4MK0A 4RFYA 3P7CA 1XH9A 4U8ZA 3VJNA 4AT5A 4B6LA 5IMXA 1IAJA 2ETMA 5F94A 3AKLA 5CEPA 5CU0A 2A27A 2UZOA 3W32A 4TYHA 4IM3A 4DEEA 3QTZA 3LKMA 1OL6A 1YWVA 3VAPA 4Q5HA 1CSNA 2ITOA 4K9YA 5ACBC 4E6AA 4F1MA 4BHZA 3UC3A 3DBQA 2C0TA 3NR9A 2R64A 4C3PA 2UZLA 2YAKA 3HZTA 4XG3A 3CXWA 4YMJA 4RLLA 3EQCA 2ONLC 3P0MA 3QHWA 1M2PA 2C6LA 4BCQA 4QO9A 3FJQE 3RKBA 4MXOA 3UYSA 5C9CA 3ZXZA 4AZFA 1PMEA 4X2GA 4C59A 5EDRA 4ASEA 3NW5A 3C5UA 3MS9A 1W98A 4BDKA 2WIHA 3IW7A 5C03A 3QAME 4FV3A 2VGOA 3DLZA 3FL4A 2VWXA 5AR8A 2GQGA 3Q9YA 2XNOA 4JIAA 5IQAA 3II5A 2PMOX 2LAVA 3VC4A 2WB8A 4GW8A 5E8TA 4TPTA 4TY1A 4E20A 2X39A 1Y8GA 4DLJA 4XP2A 2BDJA 4L3LA 4AG8A 2OIBA 5FXSA 4GK3A 2A19B 4PY1A 2C3LA 3UMWA 2I0VA 3FMNA 4C4IA 5AIRA 2CSNA 2J5FA 4C4EA 1GIHA 2R3QA 3QZGA 3VBWA 4CFMA 1ZXEA 4HYIA 2VWUA 4RC2A 4V04A 4XCUA 3R9HA 2R3NA 5CAQA 5DOSA 4EI4A 3FXXA 2Y8OA 3HECA 3LFCA 1BI7A 4E93A 5KMNA 1UU8A 2BRGA 4BCKA 3ZM9A 4E6DA 4DH8A 3UIUA 2YA9A 5CQUA 2BZIB 4KA3A 3IOKA 3FSKA 3V8TA 4QMOA 3EFJA 4X2JA 1PXKA 3E8CA 5TF9A 5HLNA 2PUUA 3AQVA 2PY3A 3O8UA 1PMUA 1CMKE 2CKPA 3LMHA 2BVAA 2PVJA 3ZCLA 5LMKC 2HYYA 4BL1A 4V0GA 5GIOE 4P4CA 1R1WA 3KL8A 1XH8A 3NW6A 3R8VA 3QD4A 5EYMA 2Y9QA 5EOBA 3LFNA 4BGQA 4QP3A 3QU0A 4FSZA 3BQCA 3FE3A 4YZDA 3NYXA 3BU3A 3EQBA 4JQEA 3L8VA 1YDRE 5EW9A 3FPQA 4AGCA 3LLAA 4JRVA 5IQFA 5D41A 5HE1A 2BZKB 1VR2A 1LUFA 2XA4A 4IXPA 4NM3A 3ZO2A 2C6DA 4ZLZA 3MB6A 4PMTA 4E5WA 2F7EE 3ZRKA 1WBNA 2J90A 3OT8A 4OTFA 2F57A 4A4LA 4O7ZA 4XG6A 3TZ7A 1XMLA 2RKUA 5GJDA 4NIFB 4EWHA 1GIIA 3F69A 2IVSA 3KN5A 3NAXA 2YITA 3EQDA 4FTRA 3MIAA 5AUTA 1P4OA 3RWQA 2R4BA 1ATPE 3NWWA 2VTPA 2Z60A 4IH8A 4M67A 3SG8A 3QQGA 3TDWA 2BALA 3RI1A 3HDMA 3MA3A 4NZWB 4R5SA 3NVKI 4MAOA 4GUBA 4J7BA 4C4JA 5LJJA 2JDRA 3REPA 3BYMA 4C33A 3SG9A 1H24A 1PXIA 2CGUA 3VRZA 4H3QA 4O1PA 4CYJA 3NX8A 2VNYA 3QKMA 4EH7A 5FXRA 2OIQA 2XEYA 5HZNA 5CU4A 1G8KA 3LFAA 4NW5A 2GFSA 3R9OA 5BVEA 3HGKA 3WF6A 2IZTA 3MB7A 4RC3A 3TWJA 2IZSA 1O6LA 3OOMA 2QONA 3LXKA 4XOYA 2ZOQA 2HZ4A 4QYHA 5AP6A 3PJ2A 1RQQA 2F7ZE 1IR3A 3OY1A 4FSWA 3PXKA 3N4TA 3BQRA 4M69B 2VU3A 4FTMA 3VRYA 4PTCA 3W0RA 3GGFA 4YTHA 4EZ7A 4GSBA 4ZY6A 5JSMA 2UVXA 4AAYA 4I5PA 3BU5A 1KV2A 3E8NA 3MA6A 4BCHA 4XG4A 3GFEA 3UG2A 2HK5A 4PP7A 4I1ZA 4JBPA 4BZNA 1XKKA 4ERWA 1FVTA 3BLRA 4EONA 4ZS4A 4CD0A 3AMAA 4ZY5A 1IASA 4AE9A 3KCKA 2PVKA 3O8TA 4DHFA 2J0JA 5JRSA 4RFZA 3G51A 3R1QA 4M14A 2WKMA 4ZLYA 2HOGA 4EJNA 2J6MA 5IPJA 3MTLA 1F3MC 3FHRA 2JDOA 1ZAOA 3OFMA 2XZSA 3PRFA 4F6SA 5EI6A 2BDFA 3D5UA 5KHWA 5TR6A 3R1SA 1NVQA 4BBMA 3RJCA 3AGLA 3KMMA 4FL1A 3TM0A 1DM2A 5AUVA 4R77A 3I7BA 3DQWA 5A4QA 5HIDA 4DH1A 3VS6A 4F1TA 3NFGB 1ZRZA 4GU6A 4MTAA 5T68A 4OTHA 3VUMA 4RVTA 1U5RA 4YZBA 5AUWA 3ZBFA 1U5QA 4DFZE 1P4FA 2UW0A 1OUYA 4BKZA 1GIJA 5BUEA 4FKSA 2GNIA 3RPRA 2HAKA 1W82A 3QRKA 4M3QA 2G01A 4QQ5A 2XANA 1FVVA 2WMUA 4BCJA 3FMEA 2NO3A 4O0XA 1KSWA 2QOHA 3M11A 3DB6A 2OXYA 5AAEA 4C34A 1E9HA 4M15A 4OW8A 5DVRA 2VWWA 1B38A 3HA8A 2W5HA 2YLEA 3NCZA 4N4SA 3O50A 4A9TA 4AW2A 5D10A 2PMLX 4IM2A 2PMNX 5FWKK 2YIXA 5AWMA 4U44A 4WHZA 1ZARA 2BRHA 4ZP5A 4G31A 2ZDTA 1JAMA 1H08A 3DT1A 3NGAA 3RAKA 2YDJA 4JJRA 4NEUA 4L52A 2VUWA 2W5BA 4FKGA 4L68A 3NZ0A 1SVHA 4M0YA 3RAHA 3N9XA 2A1AB 5IU2A 1YOMA 4KKHA 4EOKA 4IM0A 3KMUA 2EB2A 2C1AA 3EZVA 3KEXA 4K11A 2J2IB 5H8GA 4FUYA 3TNHA 2X81A 3KY2A 5KNJA 1XBCA 3PG1A 3CD3A 4PUZA 4G3FA 3VS2A 3NS9A 3GI3A 3O8PA 4LQMA 4R3RA 4GKIA 4FV4A 2EB3A 3Q5ZA 2F2CB 5G1XA 4F78A 3GU5A 4C57A 4IB5A 2J9MA 2UZBA 1MP8A 3ZLSA 4UN0C 1DS5A 1WBSA 2OF2A 3D4QA 3I5NA 4S34A 3WF5A 4C37A 3GC9A 4M0ZA 2DQ7X 2VO6A 2GHMA 5C8KA 3JR1A 3PWDA 4KRDA 3IO7A 4BJJB 2Q0NA 3G9LX 4BC6A 3FI3A 3N51A 5FTOA 3M42A 3V5PA 1FVRA 3DKFA 3R04A 3CJGA 4FKWA 4I6QA 2YN8A 4IAYA 5AR4A 3RZBA 4CMOA 5CSPA 4JG6A 3GCVA 4AXAA 2VO0A 3DNEA 5JN2A 4JX3A 3FQEA 1RDQE 5CXZA 3GBZA 3FZOA 4BIBA 4ANBA 4YNEA 3V8SA 4JNWA 4FIGA 4YHTA 4OTGA 3RHXA 5BX0A 4FKLA 5A4TA 5EDQA 5M4CA 3PSCA 3KREA 3EJ1A 4JG7A 3AD4A 2WTVA 4ACCA 2VTJA 4WNMA 2QQ7A 2YM8A 1CKIA 3F7WA 4IVBA 1WVWA 1XH4A 1V0OA 2YHVA 1G8SA 2X9EA 3A60A 3E5AA 4L3JA 4FYNA 2VTHA 2WU6A 2GU8A 4IB1A 2EU9A 4C62A 4FTJA 5CVGA 3EQPA 5HTBA 5JZNA 5J1WA 4O0WA 3ODZX 5M07A 4RBLA 1Y57A 1ZMUA 3Q5IA 3MI9A 2FSLX 1J7LA 3UDSA 4YUQA 2ZM1A 2PTKA 3A61A 4IX5A 2W99B 1BUHA 4YJTA 3R7UA 3F3UA 4GIHA 4Y5QA 2J5EA 4BYJA 3Q52A 4WA9A 2CGWA 3SOAA 4FK6A 4ZTSA 3QRJA 2XIZA 5DG5A 3TNPC 5KMIA 3PA5A 2XNEA 4XG2A 5HBHA 4QMPA 2NP8A 2CGXA 3F6XA 4CQGA 3LM5A 3TIYA 5GJFA 4EBWA 4IAKA 4XV3A 4ZZNA 3AC5A 1KE6A 2W4OA 3VUDA 3ANRA 4ZJVA 2XNBA 2GTNA 1XQZA 3C4EA 5AM7A 5KBRA 1OGYA 3O17A 5CEMA 3L9NA 3F9NA 3TMOA 4FODA 4FX3A 2OBJA 3R71A 4L8MA 4EYJA 2XKDA 3BYSA 3FLQA 3HRCA 2YABA 4EOJA 3DXPA 4FGRA 3I1AA 2XNMA 4ZY4A 2HZIA 4QP6A 4FV2A 4ENXA 5DR2A 4DHJA 2EVAA 5K0KA 4TYJA 1W0XC 2XRUA 1YXVA 3NRMA 1PYXA 3QC4A 4NTSA 4EL9A 4YGAA 1ST4A 1GZ8A 1KE7A 4CMUA 4C4GA 4CG8A 4E5BA 1IAHA 3QUDA 3U6HA 3I60A 3KKVA 2QU5A 2ESMA 2DS1A 2V62A 2BRBA 3HL7A 5K5NA 4ZTNA 2PZPA 4JS8A 4O0VA 5CF6A 5IQHA 3EFWA 5IG1A 4HVIA 3PA3A 3TL8A 3SXSA 3ORMA 4PNKA 3UVPA 3ET7A 4CCBA 4EZ3A 2J0MB 2CNUA 1LEZA 3A4OX 4ZJJA 4MD8E 3BGPA 4OUCA 3WF9A 4I3ZA 4XEYA 4L9IA 5IA1A 2IZRA 3U87A 5C01A 5I9VA 4RX5A 4KAOA 3NNVA 2PUPA 4JBQA 5M4UA 4AGWA 4YLJA 5IQIA 2C5YA 2RF9A 3C0IA 4GS6A 1OL5A 3R7GA 4FGBA 3E63A 2IVUA 4FNXA 3EN6A 4RFMA 4RT7A 5FBNC 2IO6A 3T9TA 3UQGA 3B8RA 4IB3A 3S00A 1SNXA 3HLLA 3KXZA 5A4EA 1ZYCA 4CTBA 5BUJA 1Q8TA 3ORKA 3EOCA 4QMVA 3SW4A 4O83A 3HMPA 5L8JA 2Y0AA 1TKIA 2GS6A 1B39A 2WEVA 4FUXA 1JBPE 5ANKA 3MH0A 4EK8A 4RIYA 3PY3A 5LVLA 2REIA 3TTIA 5CI6A 4BWKA 2WQBA 3P5KA 3V3VA 2I0YA 4E6QA 4EOQA 5LXMA 2G15A 2WTWA 3DFAA 1H1SA 4WSQA 3MVJA 5JGBA 4I92A 2Z7QA 1OIYA 2IVTA 5JT2A 3BWFA 3W0SA 1Q97A 2Y6OA 2QI8A 1Q8ZA 2QOLA 3I5ZA 3R1NA 1YXSA 5TT7A 4BTJA 4XLIA 3UOJA 2JKOA 2I7QA 3LOKA 2XEZA 4XOZA 1T45A 4DH7A 3NUAA 3UYTA 4CG9A 2XP2A 2EWAA 4EC8A 5CVFA 3R8PA 4FV8A 2UZNA 3VN9A 5ICPA 2BMCA 4AT4A 2WTIA 4RC4A 5HO8A 1WBVA 2IW9A 3GU7A 2PUNA 1NY3A 4I23A 3WE8A 4X3JA 4C2WA 2XJ2A 2BPMA 3S1HA 3NDMA 3NNUA 3QZIA 2OLCA 1ZLTA 4PMSA 3P9JA 3W33A 3C0HA 4J95A 2VO3A 4GEOA 3NSZA 4B8LA 3QCQA 3PVBA 5F95A 4O86A 4GH2A 2CCIA 5HI2A 4F7SA 5GZAA 3KVXA 3QCSA 1MRYA 2VTAA 4EH6A 4FBXA 4CKIA 4UMPA 5E90A 2C0IA 3EN9A 1OL1A 2VTNA 1JNKA 4JIKA 5E92A 1GOLA 3H9FA 2GQSA 3HMMA 4O82A 4BDBA 5J5TA 5A14A 4IQ6A 1PW2A 5FXQA 3E64A 4YO4A 1NVSA 3BHHA 3R6XA 3LJ2A 2F49A 4FV9A 3MY5A 3QTXA 1PJKA 5JZJA 4ORKA 2QU6A 2XKFA 2W1CA 4YPSA 4MNEA 3UGCA 1A06A 1OBDA 4CKRA 4NFNA 4QMTA 3RALA 3UO4A 4QQTA 2CKEA 4LG4A 2WO6A 4TXCA 5KMJA 3V04A 1UNLA 3RPYA 3IECA 2AEGA 4J52A 1H26A 2JGZA 2X7FA 3LCKA 3RPVA 3W2OA 2J50A 3HV6A 2F7XE 4HCUA 3NYVA 4NKSA 3V6SA 4FEQA 5LOHA 2ONLA 5IZFA 4IAFA 3E3PA 2BRMA 4UV0A 4JDHA 3VF9A 3W2SA 1DI9A 1ERKA 2ZV9A 4QPSA 3FMKA 3SLSA 4CLIA 4EKLA 3RPSA 4FSMA 3RAWA 3UVQA 4GJ2A 2UZTA 3WILA 4IAIA 4TYGA 4F08A 4F9WA 3Q2JA 2DYLA 4TW9A 3F5GA 3QC9A 3ACKA 3W8QA 5I3RA 4B7TA 2CMWA 5E91A 3KB7A 3KCFA 3IQ7A 4NIFA 4ZXTA 3VS3A 4EK5A 3WZDA 2UZWE 2W9FB 4XP0A 4ALWA 4EJ7A 1MRUA 4GFOA 3ALNA 2Q83A 4LUEA 5FTQA 4P5ZA 3CTJA 1A48A 4Q9SA 3FHIA 3R9RA 3MFSA 4CZTA 2WMAA 4ASZA 4EZ5A 2BHEA 4R3PA 2C3JA 4QTBA 3W2QA 2JEDA 3V51A 4KIPA 2CNVA 3F3VA 2OJGA 3OWLA 3TCPA 3ZOSA 3DK3A 3SXRA 2R3FA 1AQ1A 4W4VA 4U3YA 4EK4A 1GZNA 3AD5A 2XM9A 5AX9A 4E73A 3LJ0A 4RQVA 2C6IA 2HIWA 4L43A 5AV1A 4DFUA 3K2LA 3MVLA 4H1MA 4RVMA 2PL0A 4QMSA 4PDSA 5A6NA 4I5MA 3R8ZA 2X0QA 3HRFA 2ZB1A 4IAAA 5ETFA 3LMIA 2F9GA 3I0OA 4LM5A 5DT0A 4O4CA 4HW7A 4NK9A 4ZMEA 2OGVA 4JX7A 4AZWA 3ZO1A 1EH4A 2XK8A 5B7VA 1BLXA 4ZSGA 2Y6MA 4UZDA 4IIRA 3T8OA 3UO6A 3QWKA 5HG5A 3P5JC 1T46A 5AR3A 5L2SA 3TKIA 2B9HA 5DWRA 3ALOA 3MJ2A 4UMUA 5CNOA 5IA5A 2CHLA 1OPLA 4FOCA 2CJMA 4LMNA 3UNJA 1Q41A 3MDYA 3OUNB 5IUHA 4DGNA 2GNJA 4QNYA 4R7HA 4QDVA 2YDKA 2O65A 3ACJA 3BX5A 3FYJX 5HEZA 3LCTA 2UW8A 3O7LD 4MX9A 3S2PA 3PXFA 4NW6A 5LVPA 5AR7A 2OICA 4GFMA 4HPUE 4KABA 3K3IA 3D7ZA 3CKWA 4DH3A 2WTDA 4JOAA 2WQMA 3E88A 1CKPA 4CFFA 3PFYA 3DS6A 3AGMA 4AACA 3TZ9A 5AV2A 3EL7A 1PKDA 4FKTA 2QLUA 4QMMA 4RVLA 3BU6A 3LJ1A 4FVRA 4ALVA 3NYNA 3KF4A 1JSTA 1PXMA 4WG3A 1O6KA 3VS4A 4G16A 4AXCA 4WIHA 4TYEA 3WE4A 2AQXA 4YJUA 5CZHA 4GCJA 2YACA 1U46A 3C50A 3SV0A 3NUYA 3MW1A 3RAIA 5IA4A 2NRYA 5AX3A 4DA5A 4CZUA 4TYHB 1M7NA 4QYYA 5EHLA 3OBGA 5L2IA 4O7RA 4BJJA 3LMGA 4JXFA 1LR4A 4KBCA 4MHAA 4KD1A 1JVPP 4AXDA 2R7BA 4QMYA 2C6EA 4BCNA 5L3AA 3CE3A 3QD0A 4GVAA 4USDA 5ANEA 3OUKA 4K77A 5HNIX 1WCCA 4FT9A 4BBEA 3TV6A 4PX6A 5JRQA 2W05A 4O22A 3SGCA 4JQ8A 4UEUA 5DIAA 2BROA 5LCKA 3RK5A 3KXNA 1V1KA 3TKHA 1GY3A 2VTMA 1F0QA 5CEQA 5IA3A 4YLKA 3QA0A 4RX8A 5EFQA 3DZQA 1OUKA 4BKJA 2W1ZA 4ANSA 3KMWA 4OTQA 3SD0A 4AN3A 3CPCA