1ZOGA

Crystal structure of protein kinase ck2 in complex with tbb-derivatives
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
325
structure length
325
Chain Sequence
b'SKARVYADVNVLRPKEYWDYEALTVQWGEQDDYEVVRKVGRGKYSEVFEGINVNNNEKCIIKILKPVKKKKIKREIKILQNLCGGPNIVKLLDIVRDQHSKTPSLIFEYVNNTDFKVLYPTLTDYDIRYYIYELLKALDYCHSQGIMHRDVKPHNVMIDHELRKLRLIDWGLAEFYHPGKEYNVRVASRYFKGPELLVDLQDYDYSLDMWSLGCMFAGMIFRKEPFFYGHDNHDQLVKIAKVLGTDGLNVYLNKYRIELDPQLEALVGRHSRKPWLKFMNADNQHLVSPEAIDFLDKLLRYDHQERLTALEAMTHPYFQQVRAAE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN KINASE CK2, alpha SUBUNIT
publication title Inspecting the structure-activity relationship of protein kinase CK2 inhibitors derived from tetrabromo-benzimidazole.
pubmed doi rcsb
source organism Zea mays
molecule tags Transferase
total genus 107
structure length 325
sequence length 325
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2005-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1zogA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1zogA02
4AW2A 3EQBA 3ODYX 4I5MA 4NJ3A 3TTJA 1M14A 2VO0A 3E87A 4M67A 5GZAA 4XBRA 2W1HA 4JDIA 3TNQB 3UPZA 3QQFA 1J1CA 2C30A 5FTQA 2LAVA 1SYKA 3QKKA 4FTOA 4YR8A 4G3FA 2WMAA 3RHXA 4YJRA 1JPAA 4NH1A 4RQKA 4C36A 3HZTA 3WIKA 5D11A 2WTJA 4XS2A 3RAWA 5LVOA 4CGAA 3HECA 3ZS5A 2VTNA 3RBWA 2C6EA 1OIRA 5AUZA 4A9YA 1M2QA 2QOBA 2YIXA 1OZ1A 3UVQA 1XH6A 3QTZA 4PV0A 1E1VA 4QYHA 1GAGA 2J0KA 2QHMA 2A19B 3EQCA 4F9CA 5CU6A 3QCYA 1ZYCA 1LR4A 4EH7A 4IX6A 1OL7A 4YJNA 2O5KA 5HOAA 3A7FA 4AOJA 4C4EA 4RJ3A 3AGMA 5KMOA 4OAUC 5EM7A 1ZXEA 4MK0A 2QNJA 4RJ7A 4WBOA 5AP0A 2F49A 3O71A 3KN6A 4ARKA 3FYJX 4M7IA 1U46A 2QU5A 5L2TA 1OMWA 3B8QA 3LXPA 4HGLA 2SRCA 3TN8A 4UXLA 3FPMA 5AJQA 3UIUA 3PY3A 1G8AA 5JEBA 5AX3A 2VD5A 1KV2A 3K54A 1YXXA 2ITOA 2QHNA 2UV2A 5DT0A 5HCYA 4FVQA 3RMFA 3LLAA 2CN5A 2XK9A 4FGBA 5C03A 5CASA 4O22A 3OTVA 1ZYLA 2HZNA 4BDBA 4QP6A 4GYIA 4EHEA 2PULA 4C35A 2F7ZE 2H96A 2ITPA 3ZEPA 2W0JA 3FLWA 1ZYJA 3QQKA 4W4YA 4WBBB 1KE5A 2VX1A 5DBXA 1H07A 5AP5A 4ZY5A 4LOOA 3DTWA 3L8SA 3NEWA 2EWAA 4E4XA 5KMNA 4BBEA 3PSBA 1UWHA 2OFUA 3DBEA 5EYKA 4M12A 2FO0A 5KMLA 3A7JA 4K9YA 4IFCA 2PUUA 4FL1A 1AQ1A 1W83A 2B1PA 3WZKA 1NVSA 4RIWA 4DEGA 4F7LA 4TKSA 3MH1A 4ENXA 4CKIA 3O96A 1FVTA 3QTWA 4TYHB 5CF6A 3NVMB 5JQ5A 2Y7JA 4J52A 4DYMA 2W06A 1WVWA 3WF8A 3TZ7A 4CEGA 3DK6A 4L7SA 2JDTA 4QMWA 3W2RA 2C6KA 1J7IA 5ETIA 3A60A 4R77A 2W96B 3HMPA 4FVPA 4IX4A 4CG9A 4MXXA 4I6FA 4WG5A 2XNGA 3WZDA 4AZVA 4YTFA 4OR5A 4FSYA 2WELA 4ZJIA 4KNBA 3QUPA 3UJGA 3UPXA 4G3DA 2UZOA 4IH8A 4IFGA 5C8NA 4QT1A 1ND4A 3FMJA 3G2FA 1E9HA 3I81A 4AA5A 4C37A 5LVNA 3GCPA 3B8RA 3FYKX 5CZHA 1FMKA 3A4OX 3SOCA 4PNIA 3TKIA 4N57A 5CEKA 3DLSA 4R78A 3VUDA 1CDKA 5CAUA 1J7LA 4WG4A 3QHRA 3V01A 4EQCA 3EQIA 3PIYA 4GCJA 3PIZA 3HGKA 3PUPA 4NTSA 1IAJA 2JBOA 4RIYA 4FT7A 4NM7A 3FC2A 4YZ9A 4LRKA 4ERKA 3Q2JA 4NWMA 3UO5A 3D9VA 2JKKA 3S95A 3RAKA 3ORPA 5IQGA 2FSLX 5I9XA 3F3WA 3KXZA 3LCSA 4EOJA 4GW8A 1OGUA 3P1AA 3QD0A 4RSSA 2WQEA 3A99A 5FBOA 5FQDC 4F6SA 3ZTXA 4U97A 4UMPA 1S9IA 4FTKA 4OTHA 3NW6A 4NJDA 4C57A 3ZLYA 4OUCA 1Q8WA 2RF9A 3HMOA 4LV5A 3R7OA 4ANBA 3EYHA 2HENA 3OCGA 1R0EA 2BMCA 3KK8A 3MH0A 3RAHA 5K9IA 5KBRA 3S0OA 3UC4A 5AFVA 3E63A 2V55A 1OUKA 3HUBA 2ZV8A 3FKLA 3LZBA 3BX5A 1VEBA 2NO3A 4KBCA 4XNEA 4EZ7A 4O7RA 4O7ZA 1YI3A 3LAUA 5KHXA 3IW6A 4ALVA 4AACA 3DDQA 2C4GA 1JAMA 4W8DA 3NGAA 4L53A 2YWVA 2WEIA 4BBFA 4DFXE 3DKOA 2BRNA 2ACXA 2JFMA 3I7CA 4BHZA 3TKUA 1WMKA 3BZ3A 2BPMA 2ERKA 4FTTA 5L8KA 1LEZA 4FTNA 3T9TA 5M08A 3EOCA 3NS9A 5LMKC 4FGRA 4ALUA 3FXXA 2QVSE 4BCQA 3CPCA 5EW3A 4HGTA 4BGQA 4CZYB 3NPCA 1H00A 2H34A 2HZ4A 3A62A 3CS9A 4TZRA 4XUFA 3MN3A 2Y4PA 3G0FA 4J8MA 4ZAUA 5K0KA 2QD9A 2ESMA 2UZTA 1V1KA 4LL0A 4XG7A 4Y5HA 5A46A 1H24A 3K5VA 5FM2A 4EOMA 3EYGA 1UKHA 2BRHA 4FKVA 2JDRA 2BVAA 5EKOA 4BZNA 4D5KA 5FUTA 3KXNA 3QTRA 2RFEA 1XBCA 4I20A 2I0HA 5C26A 2GU8A 3DV3A 3EQGA 1A06A 2AC3A 3MIYA 1NVQA 4HPUE 4KIKB 1M2PA 2YAAA 1PXNA 3HP2A 2ZDTA 1PJKA 4YC3A 5KX8A 1YOLA 4RQVA 2J5EA 1XJDA 2WIPA 4XBUA 3ZHPC 4DEDA 2ONLA 2P2IA 3KXXA 3RJCA 1GZOA 4B99A 1MRUA 3CXWA 4DGLC 3LLTA 2X2MA 2UW8A 3TNHA 4QRCA 4PUZA 2PK9A 2JDVA 5BVEA 1FVVA 3O0GA 4O84A 5EI8A 1XH8A 4JXFA 3NCGA 5AV1A 1NY3A 2GCDA 4PP7A 3UP7A 4HW7A 4N70A 4NTTA 4YP8A 3FHRA 3UIBA 3GC9A 5ANEA 3VBYA 1KV1A 3BU6A 4PDOA 3WF5A 2YM3A 3ZYAA 3WARA 2VWVA 3MVHA 4XG8A 5T6KA 5HTIA 3ZFYA 5HLWA 3MFSA 4PTCA 4C34A 3DZQA 1OVEA 4E4LA 2XBJA 3TM0A 4JG6A 1J1BA 3OWPA 5J9ZA 5L6PA 4O7WA 4WRGA 1OBDA 3BLQA 3RCDA 2WOUA 4CMTA 2E9OA 3KRLA 2JC6A 5HGIA 3C0HA 2OWBA 4DH7A 3DTCA 3NYVA 5A6NA 4WIHA 3C51A 2R3LA 5AUWA 4UX9A 1UU9A 2HXQA 1J7UA 4X6QC 5AEPA 4DC2A 1FGIA 1UVRA 2WGJA 3FZRA 3NYXA 3O8PA 4IHPA 4YJVA 3A7IA 3DKGA 2OJGA 3MGYA 2R3KA 4IWOA 1GIHA 3ZM4A 5AP6A 4AGCA 2VGPA 3LFEA 5HNIX 3Q9WA 4FI1A 1SVGA 5LXMA 1ZOEA 4L43A 3UODA 3LJ2A 4E5AX 5CALA 2B4SB 3HV6A 4MTAA 4RIYB 2ZB0A 4TYIA 3SAYA 1Q24A 2BROA 3ALOA 3BU5A 5CF5A 3UMXA 4L52A 3CIKA 2BHEA 1R3CA 3FL4A 4BTMA 2DQ7X 5BQ0A 2NNWB 2Y8OA 3MI9A 2QO7A 2BZJA 2JLDA 4NKAA 3R30A 2Z7RA 4KIOA 2WTVA 2J0LA 3R9NA 4BCIA 1JLUE 3ERKA 3K3IA 4IW0A 5CT7A 3NMUF 5JT2A 3BHTA 3FPQA 1GZNA 3H9FA 4RWKA 4D58A 3F2RA 3PXFA 4F0IA 4L68A 3QZHA 2B9HA 4C2VA 3E7VA 3LCOA 4ZLZA 4R8QA 3IW4A 3UZPA 4IZYA 4ONAA 2DYLA 2ZJWA 2XIRA 2BZIB 3NNXA 4FV0A 3TIZA 2YLFA 4YJOA 3TT0A 5DRDA 5IQHA 1OECA 3F82A 3PG1A 5M07A 1H1WA 5A3XA 4F6WA 5HTCA 2R7IA 2C1BA 2ITUA 4F1TA 3ZFXA 2WXVA 3A4PA 2RFSA 4O0UA 4PWNA 4MXAA 3FL5A 5LMAA 3FHIA 4TWPA 3EN7A 5AUXA 3C5IA 4GH2A 4YBKA 3A8XA 1WBOA 2OXXA 2XM9A 2I0YA 4QMXA 5IA3A 1RDQE 2O64A 4C4GA 2R3NA 3CKXA 3SV0A 4XMOA 4EOPA 5AR2A 4Z7HA 2RGPA 5E4HA 4DCEA 1XH7A 4MXYA 5FXSA 4ZJVA 3OD6X 1YOMA 4BTJA 3QLGA 5D12A 4RGJA 4AGUA 5IA1A 3SLSA 3ETAA 4YZBA 3EQDA 3TV4A 3LFSA 2A1AB 3HKOA 5AWMA 3R8UA 2XUUA 4CSVA 3HP5A 4E20A 2FA2A 4KABA 4EKLA 5AX9A 1YXUA 1PMEA 5IKWA 3AD4A 4QPMA 4EH8A 5IMXA 2B9IA 4EH3A 4F0GA 3UQCA 4FX3A 4BCHA 3NWWA 3N4TA 3MSSA 3U9NA 4AS0A 3R02A 3JY9A 4EWHA 4PDSA 4F99A 3EWHA 3NCZA 2YERA 3BGPA 4D0WA 1YDRE 4XP0A 4EI4A 5HG8A 2G2FA 1Q99A 3TL8A 5HNGA 2CCHA 4S32A 4X2GA 3VBQA 4D28A 4FTAA 3R9HA 5FTGA 4D4SA 4MH7A 4I94A 1UWJA 2WD1A 5H2UA 4USFA 3TV7A 2ZM1A 4BCJA 4FEQA 3HNGA 2YM6A 4EHGA 3JR1A 1T46A 2YIWA 2CN8A 3PA3A 4B7TA 3L9PA 2Y6MA 4EBVA 3Q6WA 4RX5A 4LL5A 3HVCA 3F61A 4HYSA 3W16A 4AN9A 1SNUA 3NVKI 4GJ2A 4PPCA 3ZSGA 3VJNA 3ZUTA 3FBVA 3KGAA 3DNDA 4ZSAA 3R7YA 4L44A 2QKWB 1QMZA 4GVAA 3O50A 5DA3A 3V5TA 4OBOA 3LW0A 4O0WA 5JZJA 2BR1A 4O7SA 4IEBA 3S3IA 3IDCA 2WTCA 3LMGA 3ANQA 3NSZA 3VHKA 1K3AA 3BYOA 2UZVA 4R6VA 4I6QA 2V5QA 4IVBA 4QOXA 1ZRZA 3QWKA 4WNOA 4RA5A 3R8MA 1H08A 4JDHA 3N4UA 3FLSA 4DGNA 2XJ2A 2PU8A 5IA0A 3G51A 5EKNA 3H3CA 4RRVA 4EH9A 3ULIA 4EYJA 3NUNA 4OGRA 4TRLA 3ZLSA 4FNYA 3R9RA 4FKRA 3F9NA 1WVYA 4BDFA 3WILA 2VWWA 4UY9A 3VS0A 3DNEA 2F7XE 4NIFA 5DT4A 1KOAA 2OJJA 5AV0A 4CZUA 4KSQA 1PMNA 3GENA 4EL9A 4O38A 2Y4IB 2BIYA 3EFJA 2PMLX 4O7TA 2PVYA 3IPHA 4BWKA 3OFMA 2J2IB 4JLCA 4X7QA 4WNKA 2BTSA 3WE4A 4MD7E 4D55A 5FEDA 4DTKA 1ZMUA 4CKJA 1SM2A 3VF9A 4JAIA 3T8OA 2UZDA 1H1PA 2QOHA 4RJ4A 5C9CA 5DG5A 2PZIA 4H39A 4QMVA 3KXHA 3TTIA 4N6YA 2VWIA 2QONA 3F2AA 1YWVA 4G16A 4F7JA 3FXZA 3CEKA 4M0ZA 3RK9A 5L3AA 1P4FA 1FVRA 3CD8A 4FG8A 4C38A 2WU6A 4O0XA 3R7IA 2JKOA 3LVPA 5ACBC 1ZARA 5LQFA 4RG0A 3LFQA 4TWCA 5ETFA 2A4LA 2VTTA 5HESA 4IE9A 3OXTA 2YM5A 5AV2A 4QMTA 3V51A 4AOIA 2GSFA 4RWIA 3RWPA 3EFLA 2GHLA 5E8WA 3C4ZA 3OCBA 3VRYA 4EH6A 3MW1A 5KMKA 2R2PA 2AC5A 1LUFA 2W1IA 4FG7A 3DZOA 3F2NA 3Q52A 2OLCA 3OUKA 2ETRA 2WQBA 3H10A 3NUYA 4RVMA 4ZZMA 4KKGA 3PPKA 2HIWA 3Q4UA 4TN6A 2X4FA 4G17A 5J9LA 4C3FA 1B38A 5BVOA 4KKHA 4M84A 2E2BA 2UZLA 5AP7A 1PHKA 3QBNA 2X81A 3ENHA 4ZEGA 4D1ZA 1XO2B 3A8WA 2QU6A 4RBLA 3JYAA 4KIQA 4D4VA 3VULA 5BX0A 4PTGA 5A6OA 4DGOA 4USDA 3VO3A 2O2UA 2WMWA 3LFAA 2C3LA 2R3IA 4RVLA 2X39A 3EN4A 4JQEA 4R7IA 4BI2A 2JGZA 4YPDA 4PP9A 5EW9A 4ZTLA 5HBHA 4E73A 4A9TA 2QO9A 3TJDA 3EMGA 4FNXA 1QPDA 2PVJA 4BBMA 2ONLC 5EK7A 4AE9A 1DI8A 3PP1A 4D9UA 4E6DA 1NT2A 3B2TA 4HCUA 3HRCA 4A4OA 4WNPA 2BIKB 2JKQA 4JL9A 1OKZA 4QTEA 3KULA 5E1EA 5DH3A 5IUGA 4O0SA 3GEQA 2J9MA 3DXNA 4EZ5A 3NIZA 4A4XA 2XNEA 2IVTA 3NUPA 4BKYA 1WZYA 3NUAA 4ZK5A 2XB7A 3PA4A 5JRQA 2R3JA 4AP7A 3PDTA 1YXTA 4Q9SA 1B39A 4JBPA 4EK6A 1Q41A 4BKJA 2BAJA 2R3FA 3FSKA 5CU3A 4JBVA 4EQMA 1XBAA 2PMIA 5A4QA 4XP3A 4ZTNA 4GMYA 5GNKA 3E92A 4GK3A 3ZLWA 5BVWA 4GT3A 4AT4A 5FLFA 1OPJA 1NVRA 3DFCB 3RZFA 1KSWA 4TYGA 3LFFA 2W1DA 5GIPE 4APPA 3C4XA 3OBGA 2BCJA 3EKKA 3PFQA 4OTIA 5M55A 2LGCA 3V6SA 2WMVA 4ASZA 4A9RA 5BUEA 5C1QB 4FSNA 5HE0A 3VQUA 4E7WA 4ASDA 4EH4A 1PF8A 4JG7A 3RCJA 5LWNA 4FKTA 3SKCA 4AW1A 5CANA 2YWPA 4YNEA 4TYEA 5CYIA 4DH8A 2PZ5A 4Z55A 4II5A 4S31A 4NIFB 1XKKA 4FTJA 1M52A 4DTBA 5IDNA 5M06A 5E8YA 3N4VA 3NAYA 4O1PA 5CSWA 4ZTMA 3E8NA 4YUQA 2YZAA 5CWZA 4ZY4A 3DU8A 4WO5A 2QOIA 3L8PA 5HLPA 4EKKA 4ACMA 1MQBA 4E6QA 3BHYA 4EJ7A 3D7TB 3PY0A 2J51A 4RVTA 4C7TA 1ZZLA 4TYJA 4YC6A 5BPYA 3VUGA 4P5ZA 4RX8A 4BCPA 4HVIA 2WKMA 3ZDIA 3EL8A 1JSTA 4C61A 2XBAA 3V8TA 4Q9ZA 2QOLA 3RP9A 5M53A 1L8TA 4EOIA 5AAEA 3CCNA 4PDYA 3HLLA 5HG5A 3AOXA 3MPAA 3TNWA 5KMIA 1VYZA 3V5WA 5AV3A 2QR8A 4IWPA 3CQUA 3GFWA 2ITQA 2QG5A 4XLVA 5CNOA 2IVVA 3PJ2A 2W99B 3TUCA 4RFMA 2X9EA 4HYIA 2OICA 4JBOA 1DM2A 2BDJA 5EYDA 3PLSA 3ORKA 4S2ZA 3F7WA 4G6OA 3ORNA 4BF2A 2OK1A 4IJPA 2B9JA 3CTHA 5B0XA 5IISA 3D83A 2WMUA 5D1JA 3C9WA 3I60A 4HCVA 1CKIA 4NKSA 1PY5A 1QL6A 1R78A 1UA2A 3TNIA 2R3PA 4ANSA 2Z8CA 5L2SA 3UTOA 3NNVA 4AGWA 4J8NA 3P79A 1M17A 4FZ6A 3CBLA 5IEVA 3VS7A 5CEMA 4Y85A 3E3PA 3SRVA 3AT3A 3ITZA 3NRMA 5FG8A 3EN5A 5JRSA 1O6YA 3RHKA 2GQGA 1XHAA 2RFDA 5BNJA 1W7HA 3W2SA 3NIEA 3MIAA 3BLHA 4OTGA 5E8UA 4KKEA 4FZAB 5E8XA 5A4LA 5ACKA 4EK3A 5H3QA 5FP5A 1RQQA 1URWA 2V62A 4IZAA 5ANOA 5EQEA 4PX6A 4U44A 4B8LA 3QRKA 4U8ZA 5FEEA 3AGLA 2IW8A 3LKMA 2XIYA 3TV6A 3RPOA 3U6IA 3CTJA 4JNWA 2CLXA 4QMZA 5DRBA 3V04A 2G01A 4RIOA 1GIJA 5DR9A 3MB7A 5DFPA 3ZU7A 3KULB 1WCCA 3OS3A 5CI7A 5I4NA 5JKGA 3MH3A 2JEDA 2XEYA 5F95A 2C47A 2XKEA 5EM5A 4U0IA 3TG1A 4E6CA 2V7AA 3P78A 2QOCA 4DGGA 4O7LA 1F0QA 4YHTA 3DPKA 4H1MA 5FP6A 2QI8A 4BIBA 1JBPE 4EOOA 5AAFA 3ZDUA 1YRPA 4EOSA 3BHUA 3QTQA 3HV5A 4FK3A 4JX7A 2WMTA 5AUVA 2B0QA 4KUJA 2P4IA 2CDZA 3FLZA 3VBTA 5LCJA 3ZBFA 3QD3A 4KRCA 5M57A 5GJFA 4F9AA 4X2KA 2V0DA 3OT8A 1P2AA 3DXPA 2PVKA 4M8TA 4EK5A 1FMOE 5ANGA 3LOKA 5HIDA 1OL2A 1VJYA 3SX9A 3UZRA 4DAWA 3A7GA 3IGOA 5IPJA 4I23A 4FIJA 4BDAA 3V5PA 4IMYA 4DEBA 4FNZA 3JXWA 4HNFA 5E8ZA 2HWPA 3HDNA 2RKUA 2ZYBA 4LGGA 3WOWA 4C2WA 4HPTE 5IQEA 3SW4A 4FV4A 3TWJA 3TDWA 4GG7A 4G6NA 4LYNA 3VHEA 2E9VA 3S4QA 4FMQA 3MESA 5CXHA 4R1YA 2E9NA 3GGFA 3LCKA 4AXAA 2QO2A 3A61A 3DAJA 5C8KA 3BU3A 5ANKA 1G3NA 3LCDA 4HVSA 2WNTA 5AAGA 5M4UA 3EN6A 3GCVA 3I0QA 5HTBA 4KIKA 3VF8A 3BEAA 2AYPA 3FY0A 3L1SA 4K6ZA 3ATTA 1A9UA 3IKAA 3VUTA 2Z7SA 3KC3A 2GNJA 4TXCA 4BGGA 2Z7LA 4FK6A 3BWJA 4RIXA 1PRYA 4F64A 4IX5A 4FF8A 3DB8A 3F5UA 4J7BA 5KZ0A 1JKLA 1YDSE 2I0VA 2PHKA 3FQEA 4MXZA 5JQ8A 3F88A 2YFXA 4EYMA 3F3UA 2Z7QA 1KE9A 4O7VA 2WMXA 1WFCA 4O6EA 1H1QA 4ZTQA 4EZ3A 3AC5A 4X21A 4LUEA 3R01A 5K5NA 4ZMEA 3UQFA 3ZONA 3FAAA 5AP3A 1AGWA 4RFZA 3QGWA 4DG2E 4M69A 3QCQA 2ITTA 2BFYA 2XIKA 5C01A 1KE7A 5IQCA 3AQVA 4MWIA 2REIA 5IQAA 1O6KA 4I0TA 4EH2A 4FUYA 2FUMA 4V0GB 5ANJA 1Q3WA 2X8DA 4FSUA 3GQIA 4G9RA 4XYFA 4PMPA 4PPAA 2YJSA 3SRVB 1WVXA 2X2KA 1W98A 2DUVA 3CGOA 4X0MA 4KSPA 5AR7A 4FG9A 1R0PA 3VVHA 4OLIA 4FR4A 5JFXA 3QRIA 3VS1A 4E6AA 3TEIA 4F9BA 2ITYA 4MF1A 2YAKA 3THBA 2CGXA 4XG2A 3BHVA 3NW7A 3UE4A 4DFNA 4IAAA 1JNKA 4NW6A 2QOQA 2B53A 4GFOA 3DJ6A 2R7BA 3MVLA 3D94A 1Q8TA 3FMKA 4JRVA 1DI9A 4JIKA 4E5BA 4NEUA 3AMBA 3ORZA 3KRWA 3II5A 2EXCX 5GIOE 3KCKA 4FV6A 2GS6A 2FVDA 2XIXA 3PE2A 4FIHA 4JOAA 4YZDA 3LM0A 4YC8A 5D9HA 3UO6A 3VN9A 3ZZWA 4DF3A 5TF9A 3ZRKA 2W1EA 2YISA 2UZUE 3FKNA 3OWKA 4MBIA 4HZRA 3FMDA 1APME 5IU2A 2CJMA 3RVGA 1HOWA 2VTHA 3KXMA 3LQ5A 4GK2A 1YI6A 4HGSA 4J95A 4IB0A 4XV2A 4FOCA 5LVPA 3HMNA 1G5SA 3EQHA 4LMUA 3BGQA 5H8GA 3M42A 3QUDA 2O63A 4FODA 4KS7A 3EQRA 4EHZA 4KRDA 4QYFA 1I44A 2V7OA 3VBVA 4MD8E 4YJTA 2OZAB 5AR5A 5FM3A 1HCKA 4GIIA 2WIHA 3NUSA 3M11A 5HVJA 5CSPA 4FVRA 5GHVA 3GNIB 3R21A 3CE3A 4KD1A 3P7BA 5FXRA 2BDFA 3QKMA 5HX6A 3ODZX 5EG3A 3P23A 3RM6A 2C6TA 2GQRA 3FZOA 3AC2A 4P4CA 4RZWA 4CXAA 3QX4A 4B8MA 4DLJA 3C13A 2YDKA 3QQJA 3PVUA 2VTSA 5JK3A 1AD5A 2RIOA 2ZV2A 2B9FA 1UKIA 2PZRA 2UUEA 4CT1A 5LWMA 4IAYA 1SMHA 3DJ7A 4DHFA 3LMIA 4MKCA 4EK8A 1U54A 2QOKA 4R3CA 1BI8A 4A9SA 4O0YA 4JX3A 5AR8A 1Q62A 3WI6A 5C4LA 4EH5A 1ZYSA 5HIBA 5EOBA 3QC9A 3OBJA 2F7EE 2JBPA 4J1RA 1E1XA 3GC7A 1FINA 2VX3A 3BELA 3E8EA 3RK5A 5CF8A 1FPUA 2QQ7A 3D5VA 4JRNA 4MEDA 4AG8A 3MFUA 4JR7A 4D2RA 2PVFA 3R2YA 4I5CA 5HO6A 5KE0A 3RAIA 5CEPA 4RIXB 4DG0E 2YA9A 1H1SA 3QCSA 3PYYA 2UVZA 2PMNX 2P3GX 2RG5A 4QNYA 2HZ0A 2J4ZA 2YACA 5CAQA 1P14A 2ITXA 4CLIA 1UNLA 2C0TA 3IS5A 5FWKK 4ZSJA 1GIIA 4A9UA 4IVCA 2VNYA 3H9RA 1OL6A 5DOSA 4EBWA 4F1MA 1YWNA 2YIQA 3C4CA 3UVPA 4FSTA 2ITWA 3TACA 4G5PA 4ITIA 2XJ0A 4N6ZA 3NW5A 3R28A 4JBQA 4OBQA 2FB8A 1IA9A 2YIRA 3OCTA 1NA7A 4M69B 4O86A 2GTMA 3DK3A 4XRJA 3QD2B 3VW6A 4WUNA 2C0IA 2WTWA 5AP2A 3KA0A 3MB6A 2CKQA 3BV2A 3QQHA 5M4CA 2PVNA 4FSQA 1PYXA 3BYVA 3PRIA 3QC4A 1W0XC 3CY2A 2XYNA 5BVKA 2BKKA 3PXZA 2C6IA 2OG8A 3G33A 1UU3A 4X2JA 4FBXA 3R8LA 2YZLA 3TIYA 4FTLA 1DS5A 4ANLA 4BDJA 2W5BA 3ZO4A 2JAMA 3UNZA 3DA6A 3N9XA 3F6XA 2CMWA 2DS1A 3KEXA 1H28A 4DCAA 4MD9E 1QPEA 3KKVA 3G15A 2PL0A 4ORKA 4U3ZA 2ZB1A 3VS3A 1OPKA 2G9XA 2OZOA 2GMXA 3I5NA 3LM5A 2VWBA 3GOPA 4TW9A 5AP1A 4BWXA 3PY1A 3BQCA 4CRLA 4LUDA 4EK4A 4ASXA 5AUUA 3VRZA 5HU3A 3ANRA 2F57A 4LRMA 1ZYDA 4RC3A 1WBPA 3SVVA 4CV9A 3R7UA 5DLSA 1U5RA 4BCKA 5G1XA 5CEIA 5CEQA 5K4JA 5HORA 2EVAA 4MAOA 4ZTHA 1ZMWA 2VGOA 2VAGA 3HRFA 2OSCA 3LCTA 1YHWA 3SG8A 4I5PA 4IAIA 5F4NA 3ZO3A 1OL1A 2H6DA 4H3PA 3R9DA 3OC1A 3KY2A 5F20A 4K18A 3OG7A 3BLRA 4PDPA 4R5SA 3O8UA 5HG9A 3UNJA 4ITJA 3OWJA 3D14A 5IF1A 2IJMA 4WD5A 2UW6A 3ZC5A 4ENYA 1ZOHA 3ZCLA 3Q4ZA 4L3JA 4O91A 2YN8A 3BYMA 5LVLA 2R0IA 2ZV7A 3DT1A 4PL4A 4F4PA 3I0OA 4KBKA 5EM8A 4DGMA 4HVDA 4I93A 3CJFA 3QUEA 1JSUA 5CU2A 4EOQA 3HL7A 3COIA 1BLXA 2JDSA 4YTCA 3R2BA 3LIJA 3MDYA 4L00A 3FE3A 1KOBA 1L3RE 5HO8A 4BDDA 5FBNC 4KS8A 4F09A 2UW0A 5JMSA 3R8ZA 3TCPA 1W8CA 2WTIA 1VYWA 5I3OA 3R9OA 4E5WA 2RL5A 5I9WA 2W5AA 4MQ2A 4YJUA 5L8JA 4U5JA 3R6XA 3R71A 3F3ZA 5FEQA 4TTHB 1HCLA 3KMMA 4EONA 2WMQA 2X0GA 3F5PA 2C6LA 4JS8A 3LFBA 4S30A 3DK7A 1SNXA 2GHGA 3H4JA 3TNPC 3QZGA 2VO3A 4QQTA 1U54B 3FUPA 2CNVA 1JKKA 1SVHA 3HV4A 3DLZA 3KVXA 5IG1A 2CKPA 2Z02A 4RZVA 4X2NA 4UN0C 1J3HA 2GNIA 3R73A 3GOKA 4NW5A 5IA5A 3PSDA 3IG7A 4QTCA 2W5HA 3RM7A 3QWJA 5E8VA 3H9OA 3PXKA 3LMHA 3KL8A 3GVUA 2Y6OA 3OROA 3FKOA 3O8TA 3G90X 3REPA 4RFYA 5J8IA 4M3QA 1W82A 4K77A 4WOVA 3QKLA 4P90A 2J0JA 2PTKA 3FLNC 3QTIA 4CCUA 3AD5A 4FSRA 5H9BA 3W33A 4DITA 1JQHA 3C0GA 4KINA 4IWQA 1UNGA 3DAEA 5EHLA 4UV0A 1X8BA 2OU7A 3Q9YA 4HCTA 3DKFA 3EQPA 4O82A 3W2CA 1PKGA 3QAME 4AW0A 1LP4A 2VO6A 3P7CA 5BMSA 3QTUA 1R39A 5E91A 3M1SA 1QPJA 1VR2A 4RVKA 3CPBA 4HVGA 3Q4TA 3IW8A 3PJ3A 5LCKA 1FBNA 2G1TA 1JOWB 4NCTA 2I7QA 4I24A 2KTYA 3OEFX 4CQGA 2B55A 4QMOA 1FOTA 2I40A 2O3PA 2X7FA 3C4WA 4O21A 3GC8A 3IW7A 3OHTA 4RC4A 5IUHA 3GU4A 3I6UA 2HWOA 2VWYA 1SVEA 3Q4CA 4DFZE 2YEXA 4DFUA 4CVAA 4PL5A 4L7FA 4PTEA 2NRUA 5EDRA 4AA4A 3BHHA 2FSOX 2NP8A 5CX9A 4D5HA 3UQGA 4TNBA 4N4SA 1BYGA 2C3JA 2EXMA 2ZMDA 3BRBA 2XIZA 3C50A 4IZ7A 4B9DA 3V6RA 3L9LA 4C0TA 2IW6A 2JIIA 1FQ1B 3HMIA 4Q5EA 5DHJA 5B7VA 2OJ9A 4Z16A 4B0GA 4L42A 4L3PA 1PXKA 5EYMA 3KQ7A 1O6LA 1OPLA 2VTAA 3PXRA 2WU7A 3QU0A 2NRYA 4QMLA 4AOTA 2CGUA 3ORMA 3OW3A 3KMUA 4YO6A 4ZLYA 2F2UA 4PQNA 3SD0A 4QMNA 3BWFA 5IEXA 3QALE 4NFNA 5M4IA 3PPJA 3MS9A 3G0EA 3VBXA 3UZTA 4FKWA 1I09A 3QQGA 4Y73A 2OIDA 3CY3A 3OMVA 4J99A 3RALA 2J0MB 5KHWA 3TJCA 2GS7A 3HEGA 4YSJA 2H8HA 3E8CA 3LPBA 2UZEA 5JN2A 1WBWA 4JAJA 5EYCA 3JVRA 3D7TA 4FSWA 4NU1A 2IG7A 2YCSA 4Y95A 3TXOA 5HD7A 4L67A 3F7ZA 5CENA 4BCOA 4OTFA 2YM7A 5CLPA 4X3JA 5HVKA 2R64A 5IQDA 4QTDA 4MCVA 5AV4A 2GS2A 2PVRA 3E5AA 4IWDA 4DEAA 2BTRA 3FMHA 1DAYA 2WO6A 3K5UA 2G2IA 4HOKA 4QP2A 4UZHA 4PNKA 3RNIA 2VUWA 4DE4A 2YCFA 2BAKA 3GQLA 4DLIA 3FI8A 2ITNA 3A2CA 4YLJA 4BY9E 4QYYA 4NL0A 1F5QA 3U55A 2PMOX 4D2SA 3KMWA 4HVHA 2VTMA 5J79A 2JD5A 3PE1A 4XP2A 4CT2A 2YCRA 4GKIA 5A14A 4XX9A 4JQ7A 4DH3A 3C4FA 3KF7A 3MWUA 4O2PA 1REJA 1OBGA 2FH9A 4MNFA 4DT9A 1K9AA 4C4JA 2IZUA 3U8WA 4FYNA 4BZOA 3GCQA 5FTOA 4QMYA 3HAVA 3KRXA 3QRUA 4L46A 3R7VA 4E4NA 1J91A 4GL9A 3P9JA 3AC1A 3R00A 5BYZA 4JVGA 3BYUA 1O9UA 3O7LB 3MY1A 4NM0A 5FGKA 4BDCA 4F7SA 3QF9A 2C6OA 4AA0A 5F9EA 5LOHA 1PXLA 3PZEA 1IRKA 3ZRMA 2ETKA 3ZH8A 4QYGA 3OEZA 3DKCA 3QFVA 5AM6A 4D2VA 3AC3A 3CP9A 3ATSA 3E64A 4GJ3A 5C27A 3W8LA 5KBQA 4ZS4A 4KB8A 4HGEA 5K5XA 3I1AA 4C4IA 4FEWA 1Y6BA 5TR6A 4LOQA 2EB3A 3Q32A 3BPRA 4R5YA 2YITA 3Q5IA 4MVFA 4QPSA 5M51A 5KO1A 1BL6A 4RJ5A 4IVDA 5TKDA 4GT5A 5HNBA 4C4HA 1IG1A 2R4BA 2XNMA 4FL2A 3SQQA 4C58A 3QQUA 4AWIA 4O7NA 3UGCA 3EZRA 4R3PA 3DBDA 3FDNA 4GFMA 2BKZA 4UWBA 3LXNA 4W8EA 3ZSIA 5EHYA 4UWCA 5CI6A 2OXYA 3UP2A 3BE9A 3O7LD 1SZMA 4GK4A 2ZAZA 2XNNA 4J96A 4HJOA 4OW8A 4AFEA 2B7AA 5DN3A 4ZIMA 1H25A 2IVUA 2XS0A 2P0CA 5EQPA 2GNHA 2QR7A 4XV1A 3ZO2A 1WBSA 4FKIA 5AA9A 3D5UA 4FOBA 3MY5A 5KMMA 4I22A 2HY81 3DDPA 2XKFA 4X2FA 3VUHA 3GU7A 4GUEA 3ULZA 4XCUA 2XNPA 2HOGA 3MPTA 4ZP5A 4FKUA 4O7YA 3EB0A 3I4BA 3QXPA 2IVSA 4GFGA 3MTFA 4YTIA 4D0XA 1MQ4A 3K3JA 2CKOA 3QCXA 4UYNA 2PZYA 2W7XA 4QMPA 2IN6A 4XHKB 1YOJA 5HE3A 3RK7A 3ZXZA 5LMKA 4BCMA 4XV9A 5T3QA 3GB2A 4DINA 5EOLA 4JG8A 1V0BA 4JQ8A 4YLLA 3DCVA 2EB2A 1GNGA 4F63A 2C5XA 2C0OA 3FLQA 3PXQA 5C8MA 4F9YA 1YW2A 2X8IA 2ZMCA 2JKMA 4AX8A 5CVFA 3KF4A 3AG9A 4U6RA 3FXWA 5CAPA 3EFKA 1BX6A 5CU4A 5DGZA 4ZTSA 1ZAOA 2Y4IC 1IR3A 3IGGA 1IASA 4WSQA 2UZWE 4IVAA 4DH5A 3R7GA 2DWBA 3W2OA 4G6LA 4Y83A 5FXQA 5CAVA 5IZFA 4GKHA 4WG3A 3SG9A 3AC4A 5ITAA 4FV1A 4UALA 4CFNA 4KBAA 3OT3A 4XJ0A 1YWRA 4YLKA 3PJ8A 3RPSA 2AUHA 4ZMFA 1F3MC 2CKEA 5IDPA 4IAZA 3M2WA 3UG1A 1STCE 4I6HA 3C1XA 1MRYA 1OITA 2VZ6A 2R3MA 1NXKA 3NYNA 3Q9XA 4TNDA 3ZMMA 5J9YA 1H27A 3WBLA 3UIMA 5L2QA 3CR0A 3HV3A 2VNWA 4AQCA 4U41A 1TQMA 3D0EA 4BDIA 5M4FA 3KFAA 4ZS0A 3FEGA 1BUHA 3PWYA 4IB3A 3R1QA 3FZ1A 4AZFA 4S33A 3DFAA 4YZCA 4GG5A 4BTFA 4MWHA 3L9NA 1PYEA 4L3LA 3FI4A 4GUBA 3QTSA 4C59A 4QMQA 5HU9A 1PW2A 2EU9A 3FMLA 4V0GA 3OOMA 3PIXA 4UMTA 4XV3A 5K0XA 4QNAA 2VWXA 4IC7A 4KA3A 1M7QA 5HCXA 4ANOA 3TUBA 5E90A 5J87A 4ZSEA 4Q2AA 1UV5A 2VTOA 4ZZNA 4IADA 4DH1A 4FZ7A 5TT7A 4FEVA 4YJPA 4FIFA 2VTLA 4KWPA 3R1YA 3QRJA 4FT0A 4FKPA 5EW8A 2UW4A 4G3EA 4FV2A 4LGHA 5CSXA 4YHFA 2WB8A 4U43A 2PVLA 2UZBA 2VN9A 2BHHA 2OXDA 5TE0A 2EUFB 4CV8A 4P5QA 2OH4A 2OH0E 3QYZA 4U79A 1YHVA 3W2QA 1REKA 3KRRA 2CGVA 2XK4A 4O6LA 4DG3E 5A9UA 1OIUA 4QP3A 3ZSHA 3HA8A 4IZ5A 4QTBA 1WAKA 5HE2A 4O2ZA 5CQUA 5CSVA 4PMTA 4P7EA 4CTCA 5HD4A 4LI5A 3OP5A 4GRBA 4YJSA 3UOLA 5JFSA 4EC8A 3ROYA 4EEVA 4C33A 2W05A 5DNRA 4ZTRA 5E9EA 4L01A 1Q5KA 2HCKA 4PPBA 2VTIA 5F94A 1FGKA 3TZ8A 3E88A 3VBWA 3HA6A 3D5WA 3IK3A 1H01A 3MFRA 4GEOA 5AUYA 3TZ9A 2X9FA 2PY3A 3NUUA 2UW9A 5AADA 5E8TA 2BAQA 4RC2A 4NCTC 2QKRA 5AUTA 4RA4A 3W55A 4FC0A 5IMEA 4UMUA 3ZRLA 2XA4A 3QLFA 4CNHA 1XR1A 3GI3A 3MBLA 1PXOA 3FV8A 4IQ6A 2OZAA 2X6DA 4IJ9A 3UMWA 3GU5A 4FTUA 4CG8A 2UW7A 4JIAA 3U9CA 4LFIA 4W4VA 4CKRA 2ZDUA 4AW5A 5AM7A 4DFLA 1PMVA 4E1ZA 2QC6A 2CNQA 1RE8A 3HX4A 4IM0A 4CZTA 3ZUUA 3BBWA 5HVYA 4ZY6A 1OB3A 2FYSA 4G1WA 3RWQA 4FKSA 3R8VA 1V0PA 5LARA 2XK7A 3VW8A 2BILB 3IONA 4U9AA 3POOA 2I0EA 4XRLA 4O1OA 4ZOGA 3MVJA 2P2HA 3OXIA 4BHNA 4JT3A 4G3GA 5ICPA 5J1VA 3P08A 2UW5A 5EI2A 4QQCA 5IH6A 2IO6A 3CGFA 1ZY5A 2QLQA 4YZNA 1Q61A 1K2PA 5HI2A 3OXZA 4FZFB 4J53A 4R1VA 3MJ1A 2GNLA 1TVOA 2VWZA 3R8PA 2WEVA 3GCUA 4M13A 2QOOA 3TDVA 4RX7A 1YKRA 2WQOA 3JY0A 5IA2A 2UVXA 4U7ZA 3VAPA 4TWOA 3ORLA 2YM4A 3LJ0A 5KZIA 2C6DA 2Z60A 3NLBA 4WA9A 5BVNA 3S1HA 2IZTA 1R1WA 3PVGA 4OTDA 4OTRA 2J90A 5DPVA 4ZSGA 4ZLOA 3HAMA 3PWDA 4QPAA 5EQYA 4RWJA 3DB6A 3A7HA 3DBFA 1Z57A 4QQ5A 2UVYA 5B2MA 4FUXA 4NZWB 4FTIA 4G34A 3NZ0A 5AP4A 3B2WA 2R9SA 3W8QA 2J5FA 4MHAA 2OIBA 3GC0A 3MA6A 4UXQA 4BGHA 2PVHA 3Q60A 4C62A 4FICA 4X3FA 4I6BA 3W2PA 4PMMA 4R7HA 4YGAA 2BRGA 4C02A 3ZC6A 3Q2MA 1CM8A 4MF0A 1TKIA 4RMZA 2YABA 4WNMA 5JGDA 3U51A 4XOZA 3OY3A 4HNIA 3S00A 5C4KA 1H26A 5T68A 4CFVA 3KN5A 5J5TA 5B2LA 3PLAE 3H0ZA 5IH4A 4I0RA 1WBTA 2R3GA 4FYOA 5E7RA 1KUTA 3KRJA 4RWLA 5ETCA 2ZOQA 2CCIA 5JGBA 1KE8A 4OBPA 5AIKA 1PXMA 3R83A 4MBJA 4DEIA 4QD6A 2BZHB 4D2PA 2YLEA 5JFWA 4H36A 2P33A 3F3VA 3UG2A 1G8SA 5FD2A 3BBTB 3I7BA 3COKA 4NK9A 1GY3A 2RSVA 4PY1A 3I6WA 4BL1A 1WBNA 5AR4A 3RZBA 4U81A 3FMNA 2PUNA 3LFNA 2XKCA 2CGWA 4G9CA 4IX3A 2Q0NA 5TO8A 5M44A 2W1FA 4HYUA 2WAJA 2X7GA 1XBBA 3BKBA 3MJ2A 3R63A 5H8BA 1B6CB 3SC1A 4BYIA 3UYSA 2BZKB 1QCFA 1H0VA 1UNHA 1VZOA 3GUBA 4AZTA 4CRSA 2BRBA 1XH4A 3EH9A 3MVMA 3PZHA 3ENMA 4JI9A 2RFNA 3CQWA 2R5TA 4EUTA 3QZFA 4YURA 1OKYA 5DT3A 2WFYA 3VS5A 2OJIA 3HYHA 3WZUA 4UB7A 4EOLA 3QQLA 3GU8A 3IOPA 5EFQA 4XEYA 2OGVA 4IDTA 2WTDA 3R04A 4FEUA 2WMBA 2QLUA 3WF6A 4E8AA 5HLNA 4BR3A 3GBZA 2OJFE 4BIDA 4EWQA 5J1WA 4YHJA 4DBNA 2IZSA 4O83A 3PTGA 4K0YA 4BN1A 2XKDA 4IM3A 2J7TA 2WQMA 3FZSA 3CTQA 4AF3A 3W1FA 1WBVA 4XG4A 5JSMA 3WF9A 4QTAA 1Q3DA 3KXGA 2C3KA 2OKRA 4IB1A 5HKMA 2XZSA 4RLKA 5HG7A 2HAKA 1BKXA 4GT4A 5AMNA 4ID7A 3QL8A 4AN2A 2F9GA 4G31A 4FKGA 4WUAA 2WMRA 3UC3A 5DMZA 4QP8A 3SW7A 3QYWA 5CVGA 2XCHA 2JDOA 4FSMA 4IIRA 4Z9LA 4YU2A 4BDEA 4YNOA 1NW1A 5KUPA 4ANQA 2YCQA 4ITHA 1U4DA 3E8DA 4F65A 5I3RA 2Y0AA 2R3QA 5CT0A 4O0VA 3ZZEA 5JFVA 1OIQA 3QX2A 4H3QA 3QZIA 4NSTA 3FQHA 3FI3A 4M66A 4MXCA 3PA5A 5CVHA 4BCGA 5BYLA 4FA2A 4E26A 2XP2A 4YJQA 4ZSLA 5BUJA 3EZVA 4A4LA 4NFMA 4CMUA 3FMMA 3D2KA 2HZIA 2RG6A 3P5KA 4U42A 1YHSA 2XNOA 3TZMA 3AC8A 3LXKA 3ZOSA 3LQ3A 3KB7A 3K2LA 4YZMA 3PXYA 3ZFMA 5AA8A 4Y72A 2PE0A 4CFUA 3FZPA 2R3RA 3VQHA 2W1ZA 3TI1A 2XVDA 3D5XA 2WHBA 1Q8ZA 4JDJA 4MYGA 5D7AA 4CMOA 4BVUA 5IA4A 5KCVA 2PVMA 4FV5A 3SGCA 3FMEA 5L2IA 3ET7A 2XM8A 3IO7A 4JJRA 5ANDA 5IUIA 4KAOA 3RPYA 4TL0A 4X3FB 2Y9QA 4FE2A 3ZXTA 3D2IA 1YXSA 2HW6A 4PL3A 5K3YA 4ANMA 3E7OA 4DFYA 3U4UA 2YIYA 2HYYA 3OUNB 1ATPE 3UYTA 1GZ8A 4AN3A 4AT5A 1A48A 3VUIA 3RPRA 4IC8A 5HO7A 1KE6A 5IH5A 2VTRA 1XWSA 3OZ6A 1S9JA 2H9VA 2X1NA 4Q5HA 2GTNA 3VUMA 5GINE 1CKJA 4ZXTA 3G6GA 4BYJA 4EUUA 5EDQA 2PSQA 2C3IB 4GU6A 1CMKE 4MBLA 4RIWB 3HV7A 3F3TA 5ANIA 3ROCA 3DBQA 4J98A 2X4ZA 4EQUA 3E3BX 4FKJA 1H4LA 3S2PA 3PVBA 5I9ZA 2BALA 4V05A 4FTRA 1Q8YA 2XYUA 4D1XA 4FTMA 3DBCA 3FZTA 1GOLA 4FTCA 2BUJA 3BIZA 3G5DA 3QA0A 4PF4A 4B4LA 4CTBA 1TQIA 3D15A 4E3CA 2CLQA 2UW3A 1RJBA 2HW7A 2YDJA 4AU8A 3TKHA 4FIEA 2KULA 3O17A 2GHMA 4OT5A 4NM5A 3LQ8A 5HBJA 5EHOA 3UO4A 4MQ1A 5KMJA 5DYJA 1Y91A 2JITA 2W1CA 3I5ZA 4WKQA 5BYYA 3QHWA 4XLIA 3O51A 3PG3A 3FC1X 3OF0A 4I4FA 3ACKA 5CNNA 4ZJJA 2QCSA 1OL5A 2WPAA 3EIDA 2W17A 4XOYA 5D10A 4QP4A 3DS6A 2ITVA 4QMUA 3RPVA 4OT6A 4ACGA 4UEUA 4RPVA 2HY0A 2BFXA 2IWIA 5HE1A 4U40A 2IPXA 2PZPA 2HXLA 3ID6C 2JIVA 4M15A 4ACCA 3KVWA 3ZEWA 4FTQA 4XH6A 4X6RA 4XG6A 3VC4A 1CTPE 4D1SA 5A4EA 2OI4X 2C69A 2E9UA 3NUXA 3EJ1A 1V0OA 3N51A 4L9IA 2CNUA 4C8BA 5CF4A 2R3OA 4IXPA 3Q6UA 4FKOA 2XK8A 4Y5QA 3UNKA 3IQ7A 3P7AA 4RT7A 5J5SA 3WZEA 4DFBA 3MY0A 4A07A 4ZZOA 5J7BA 1OM1A 4OAVB 2YDIA 1H8FA 1MRVA 1OKVA 5J95A 3G9LX 3V8WA 4DTAA 3ZO1A 3GT8A 4D9TA 1U5QA 2VTPA 3NNUA 1JKSA 2R0UA 4FKQA 3T9IA 3DXQA 4R7BA 2JAVA 3OY1A 4FV7A 1U59A 4FT5A 3JVSA 4V04A 5LJJA 1JWHA 3BQRA 3V5QA 2FSTX 3DQWA 3WF7A 3FWQA 4J97A 3PP0A 2J6MA 3DQXA 4L45A 2XMYA 4YO4A 3FJQE 3OWLA 2V22A 3ORXA 2XRWA 3VNTA 5I0BA 4GYGA 4AT3A 3DAKA 4FIIA 1KWPA 3V5LA 4C3RA 4CFFA 4F7NA 4W9XA 5FRIA 5EM6A 1Y6AA 1Z9XA 5I9VA 4BDKA 1Z5MA 4QQJA 3EN9A 4Y46A 5IQFA 3CQEA 5DWRA 3OOGA 1OUYA 2XF0A 4LGDA 3T3UA 4AFJA 5IEYA 4K11A 3JUHA 4Z3VA 4K8AA 3U87A 4ERWA 2WQNA 3FY2A 4W4WA 4LM5A 3SXSA 5HICA 4FZDB 4F6UA 3KU2A 4R3RA 4YBJA 4EOKA 2PE1A 4BCFA 3ZBXA 5HEZA 3F69A 2J0IA 3F5GA 4ASEA 2VO7A 4YPSA 4AZSA 3GFEA 3KK9A 2R3HA 4IM2A 1JSVA 4H05A 3E93A 4WRSA 3RINA 5IQIA 4CYIA 3W10A 2XNBA 4G3CA 3RTPA 3OVVA 3FI2A 3NAXA 5TOZA 1W84A 2QURA 4J71A 2OO8X 3SA0A 3IDBA 2VTQA 3Q53A 3ELJA 3VIDA 3ALNA 5AIRA 1GZKA 4X3FC 1LEWA 4I5HA 4DEHA 1QPCA 3ORIA 3SDJA 2PYWA 5E8SA 4A06A 4BFMA 5CQWA 3ZM9A 1UU7A 2ETMA 4V01A 4O0TA 4M0YA 4TT7A 3U6HA 4QYEA 2XRUA 3BGZA 3SOAA 4OTQA 2B52A 3G6HA 3COMA 3C7QA 3EHAA 3QXOA 3DOGA 3OW4A 4GSBA 3ORTA 3PVWA 4O0RA 4EORA 3VS2A 2OIQA 5CTPA 4CFMA 4FKLA 4GIHA 1GJOA 4I41A 4OTWA 5HIEA 3EKNA 5KKRB 4H58A 3U6JA 3BCEA 2BDWA 1JVPP 2O8YA 5DE2A 5E92A 4AZEA 4CQEA 2Q83A 5D41A 4MNEA 4G2FA 3VUKA 2C1AA 5L8LA 5AR3A 3HDMA 3P4KA 2WOTA 1P4OA 1M7NA 4U3YA 1URCA 3JS2A 5DIAA 4IBMA 3D4QA 3QRTA 4D4RA 3V8SA 3W18A 3F66A 5BVFA 3BI6A 4CYJA 1BI7A 3P86A 4DBXA 5DR6A 2QOFA 2C5VA 3QD4A 3LFCA 5EDPA 3L9MA 2GNGA 2I1MA 3RKBA 3DY7A 1ZZ2A 2HELA 4F0FA 4BC6A 5BMMA 4AUAA 3R1SA 4FSZA 5FDPA 5BVDA 2FGIA 4L8MA 3R7EA 3UIXA 2OW3A 4GS6A 4APCA 3ACJA 4CFWA 5JH6A 4O96A 4BI0A 2C68A 3BV3A 2VX0A 4UWYA 2W9ZB 1XQZA 5L6OA 1T45A 4IDVA 4LOPA 5D7VA 3C5UA 2NPQA 2W4OA 2GDOA 4F9WA 4B6LA 3VJOA 2J50A 4I4EA 2G15A 3LHJA 4AAAA 1DAWA 3FSFA 4S34A 4CD0A 2XK3A 5L6WL 4ACHA 1ZMVA 4TY1A 4F70A 5HQ0A 2OFVA 3CKWA 2C5YA 3BE2A 3IDPA 3PRFA 4QP9A 3EFWA 4F08A 2P55A 3UBDA 1H0WA 1Q4LA 4P2KA 4LQMA 1OIYA 5GZ9A 3ZUVA 1ERKA 2WZJA 2ZVAA 2C5NA 2C6MA 1Q97A 4W9WA 5DVRA 1P5EA 4I3ZA 5L2WA 1RW8A 2HK5A 2WTKB 3H30A 4Z7GA 4YSMA 4FT9A 3V5JA 3GXLA 2CSNA 2JIUA 4BI1A 3DGKA 4BCNA 3UOJA 3Q96A 2VWUA 5A4TA 1YQJA 4QO9A 4AZWA 3EL7A 4BTKA 2CPKE 3CSVA 5I9YA 1JKTA 3NYOA 2QODA 3W32A 3QGYA 1TQPA 5LMBA 4XG3A 1OI9A 2X8EA 4QMMA 1LPUA 3IOKA 2YJRA 4G5JA 4C4FA 2UZNA 1IEPA 1PMUA 2A2AA 4I92A 4JR3A 4RJ6A 4XG9A 5CY3A 5BUIA 3AMYA 3NR9A 4JDKA 4TWNA 4OTPA 2PE2A 3DJ5A 2E9PA 1ZY4A 2F2CB 2O0UA 3LJ1A 4UBAA 5H8EA 3L8XA 2ZV9A 5CSHA 5CZIA 3CJGA 3FLYA 5B2KA 4USEA 2GFCA 3AD6A 3V3VA 5I5ZA 3RNYA 4NM3A 2XJ1A 4LRJA 1CKPA 3MTLA 3PSCA 2W4KA 1ZWSA 4AE6A 5M09A 1EH4A 3UOHA 2A0CX 4MXOA 5EH0A 3O23A 1OKWA 4K1BA 3MV5A 4CFXA 3UVRA 4FEXA 3WE8A 5JZNA 3UDBA 4PRJA 4QP1A 3NX8A 4RX9A 4FV9A 5CXZA 1M2RA 1IAHA 4BDGA 2PPQA 3GU6A 3KCFA 3O2MA 4E4MA 3EQFA 2PUPA 2QG7A 3WYXA 3OTUA 4BICA 1BMKA 5KNJA 4BRXA 3U4WA 1ZOGA 4FIGA 4MNEB 4BDHA 1YI4A 4DEEA 4Y8DA 4BKZA 3HMMA 3WYYA 2VRXA 5IQBA 3D7ZA 1BL7A 3KREA 3CC6A 4UMQA 2I6LA 5FDXA 3P0MA 1YVJA 4EHVA 3AMAA 2B54A 5DEYA 3CLYA 3CD3A 4IAKA 3QA8A 5KKRC 3COHA 2WMSA 2XEZA 5K4IA 3NDMA 4E93A 4DT8A 4GV1A 4ACDA 5M56A 4FT3A 3VS4A 3NNWA 1YDTE 2ZM3A 4BB4A 4IANA 4GVJA 3GCSA 4O81A 3L8VA 3HUCA 5EI6A 5CS6A 3WIGA 1PXJA 4M14A 2OBJA 3U54A 2JFLA 3E62A 3OCSA 4BWPA 2W4JA 1MUOA 4BIEA 3VS6A 3QTXA 4KIPA 4AGDA 2IW9A 5L4QA 3JPVA 5JGAA 4H1JA 3HRBA 2YHVA 4UYAA 5HHWA 3RGFA 2VTJA 4RJ8A 5I9UA 1Q8UA 5HCZA 4F1OA 3BYSA 2PWLA 4FV3A 4M68A 2VV9A 2ZM4A 2GPHA 3G9NA 4MX9A 3LFDA 2X7OA 4W4XA 4WT6A 4IACA 2ERZE 1YXVA 2W9FB 4N0SA 5GJDA 2G2HA 4RLLA 4IB5A 4C3PA 4CCBA 3UOKA 4H3BA 2A27A 2IZRA 2OF4A 3MH2A 4K33A 3C4EA 4O27B 3SXRA 1IA8A 5J7HA 3SXFA 4QMSA 5CEOA 4K2RA 5A4CA 3MYGA 4D4YA 4DN5A 2XCKA 3PJ1A 4HYHA 4BZDA 4UMRA 3Q3BA 3AT4A 3AT2A 3WZJA 5G6VA 4ALWA 4I1ZA 2X2LA 4TPTA 4NUSA 4FL3A 4LV8A 1XH5A 4TYHA 2X6EA 5GJGA 4FV8A 4U80A 3R0TA 5CU0A 3MPMA 5A54A 3VWAA 4YMJA 2YM8A 3MA3A 3F5XA 4I21A 5DI1A 3LXLA 1MP8A 1Y8YA 2EXEA 2OF2A 5ETAA 2GQSA 1H1RA 1PXIA 1CSNA 4LMNA 4EC9A 2ITZA 2C5OA 4GU9A 4U45A 1PXPA 2CHLA 5F1ZA 4HZSA 5HBEA 2BRMA 4D2WA 1ZLTA 1Y8GA 4I0SA 2WTKC 4EJNA 2GFSA 3MFTA 5DEWA 4YTHA 2GNFA 2F4JA 5HX8A 1Y57A 2Z2WA 4M97A 3H0YA 5E1SA 3SHEA 5HZNA 5LVMA 4NYEA 3C0IA 4ANNA 3AXWA 3TUDA 4FNWA 3RI1A 3R22A 4DA5A 3T3VA 3Q5ZA 3PPZA 4LG4A 3GP0A 4PMSA 3Q04A 4WSYA 2FSMX 2VU3A 4A7CA 2O65A 5GZ8A 1XH9A 5DR2A 4UZDA 3I79A 3LE6A 3POZA 2XK6A 3Q9ZA 1UU8A 4IAFA 4L6QA 2W1GA 2PUIA 3FQSA 3IW5A 3R1NA 4WHZA 4NT4A 4CLJA 3PJCA 4D2TA 1PKDA 3BEGA 5CAOA 2Q0BA 3IECA 3ZLXA 4QP7A 2XH5A
chains in the Genus database with same CATH superfamily
4AW2A 3EQBA 3ODYX 4I5MA 4NJ3A 3TTJA 1M14A 2VO0A 3E87A 4M67A 5GZAA 4XBRA 2W1HA 2IF8A 4JDIA 3TNQB 3UPZA 3QQFA 4DDGA 1J1CA 2C30A 5FTQA 2LAVA 1SYKA 3QKKA 4FTOA 4YR8A 4G3FA 2WMAA 3RHXA 4YJRA 4JMQA 1JPAA 4NH1A 4RQKA 4C36A 3HZTA 3WIKA 5D11A 2WTJA 4XS2A 3RAWA 5LVOA 4CGAA 3HECA 3ZS5A 2VTNA 3RBWA 2C6EA 1OIRA 5AUZA 4A9YA 1M2QA 2QOBA 2YIXA 1OZ1A 3UVQA 1XH6A 3QTZA 4PV0A 1E1VA 4QYHA 1GAGA 2J0KA 2QHMA 2A19B 3EQCA 4F9CA 5CU6A 3QCYA 1ZYCA 1LR4A 4EH7A 4IX6A 1OL7A 4YJNA 2O5KA 5HOAA 3A7FA 4AOJA 4C4EA 4RJ3A 3AGMA 3UDZA 5KMOA 4OAUC 5EM7A 1ZXEA 4MK0A 2QNJA 4RJ7A 4WBOA 5AP0A 2F49A 3O71A 3KN6A 4ARKA 3FYJX 4M7IA 1U46A 2QU5A 5L2TA 1OMWA 3B8QA 3LXPA 4HGLA 2SRCA 3TN8A 4UXLA 3FPMA 5AJQA 3UIUA 3PY3A 1G8AA 5JEBA 5AX3A 2VD5A 1KV2A 3K54A 1YXXA 2ITOA 2QHNA 2UV2A 5DT0A 5HCYA 4FVQA 3RMFA 3LLAA 2CN5A 2XK9A 4FGBA 5C03A 5CASA 4O22A 3OTVA 1ZYLA 2HZNA 4BDBA 4QP6A 4GYIA 4EHEA 2PULA 1G8KA 4C35A 2F7ZE 2H96A 2ITPA 3ZEPA 2W0JA 3FLWA 1ZYJA 3QQKA 4W4YA 4WBBB 1KE5A 2VX1A 5DBXA 1H07A 5AP5A 4ZY5A 4LOOA 3DTWA 3L8SA 3NEWA 2EWAA 4E4XA 5KMNA 4BBEA 3PSBA 1UWHA 2OFUA 3DBEA 5EYKA 4M12A 2FO0A 5KMLA 3A7JA 4K9YA 4IFCA 2PUUA 4FL1A 1AQ1A 1W83A 2B1PA 3WZKA 1NVSA 4RIWA 4DEGA 4F7LA 4TKSA 3MH1A 4ENXA 4CKIA 3O96A 1FVTA 3QTWA 4TYHB 5CF6A 3NVMB 5JQ5A 2Y7JA 4J52A 4DYMA 2W06A 1WVWA 3WF8A 3TZ7A 4CEGA 3DK6A 4L7SA 2JDTA 4QMWA 3W2RA 2C6KA 1J7IA 5ETIA 3A60A 4R77A 2W96B 3HMPA 4FVPA 4IX4A 4CG9A 4MXXA 4I6FA 4WG5A 2XNGA 3WZDA 4AZVA 4YTFA 4OR5A 3W0QA 4FSYA 2WELA 4ZJIA 4KNBA 3QUPA 3UJGA 3UPXA 4G3DA 2UZOA 4IH8A 4IFGA 5C8NA 4QT1A 1ND4A 3FMJA 3G2FA 1E9HA 3I81A 4AA5A 4C37A 5LVNA 3GCPA 3B8RA 3FYKX 5CZHA 1FMKA 3A4OX 3SOCA 4PNIA 3TKIA 4N57A 5CEKA 3DLSA 4R78A 3VUDA 1CDKA 5CAUA 1J7LA 4WG4A 3QHRA 3V01A 4EQCA 3EQIA 3PIYA 4GCJA 3PIZA 3HGKA 3PUPA 4NTSA 1IAJA 2JBOA 4RIYA 4FT7A 4NM7A 3FC2A 4YZ9A 4LRKA 4ERKA 3Q2JA 4NWMA 3UO5A 3D9VA 2JKKA 3S95A 3RAKA 3ORPA 5IQGA 2FSLX 5I9XA 3F3WA 3KXZA 3LCSA 4EOJA 4GW8A 1OGUA 3P1AA 3QD0A 4RSSA 2WQEA 3A99A 5FBOA 5FQDC 4F6SA 3ZTXA 4U97A 4UMPA 1S9IA 4FTKA 4OTHA 3NW6A 4NJDA 4C57A 3ZLYA 4OUCA 1Q8WA 2RF9A 3HMOA 4LV5A 3R7OA 4ANBA 3EYHA 2HENA 3OCGA 1R0EA 2BMCA 3KK8A 3MH0A 3RAHA 5K9IA 5KBRA 3S0OA 3UC4A 5AFVA 3E63A 2V55A 1OUKA 3HUBA 2ZV8A 3FKLA 3LZBA 3BX5A 1VEBA 2NO3A 4KBCA 4XNEA 4EZ7A 4O7RA 4O7ZA 1YI3A 3LAUA 5KHXA 3IW6A 4ALVA 4AACA 3DDQA 2C4GA 1JAMA 4W8DA 3NGAA 4L53A 2YWVA 2WEIA 4BBFA 4DFXE 3DKOA 2BRNA 2ACXA 2JFMA 3I7CA 4BHZA 3TKUA 1WMKA 3BZ3A 2BPMA 2ERKA 4FTTA 5L8KA 1LEZA 4FTNA 3T9TA 5M08A 3EOCA 3NS9A 5LMKC 4FGRA 4ALUA 3FXXA 2QVSE 4BCQA 3CPCA 5EW3A 4HGTA 4BGQA 4CZYB 3NPCA 1H00A 2H34A 2HZ4A 3A62A 3CS9A 4TZRA 4XUFA 3MN3A 2Y4PA 3G0FA 4J8MA 4ZAUA 5K0KA 2QD9A 2ESMA 2UZTA 1V1KA 4LL0A 4XG7A 4Y5HA 5A46A 1H24A 3K5VA 5FM2A 4EOMA 3EYGA 1UKHA 2BRHA 4FKVA 2JDRA 2BVAA 5EKOA 4BZNA 4D5KA 5FUTA 3KXNA 3QTRA 2RFEA 1XBCA 4I20A 2I0HA 5C26A 2GU8A 3DV3A 3EQGA 1A06A 2AC3A 3MIYA 1NVQA 4HPUE 4KIKB 1M2PA 2YAAA 1PXNA 3HP2A 2ZDTA 1PJKA 4YC3A 5KX8A 1YOLA 4RQVA 2J5EA 1XJDA 2WIPA 4XBUA 3ZHPC 4DEDA 2ONLA 2P2IA 3KXXA 3RJCA 1GZOA 4B99A 1MRUA 3CXWA 4DGLC 3LLTA 2X2MA 2UW8A 1TFFA 3TNHA 4QRCA 4PUZA 2PK9A 2JDVA 5BVEA 1FVVA 3O0GA 4O84A 5EI8A 1XH8A 4JXFA 3NCGA 5AV1A 1NY3A 2GCDA 4PP7A 3UP7A 4HW7A 4N70A 4NTTA 4YP8A 3FHRA 3UIBA 3GC9A 5ANEA 3VBYA 1KV1A 3BU6A 4PDOA 3WF5A 2YM3A 3ZYAA 3WARA 2VWVA 3MVHA 4XG8A 5T6KA 5HTIA 3ZFYA 5HLWA 3MFSA 4PTCA 4C34A 3DZQA 1OVEA 4E4LA 2XBJA 3TM0A 3W0NA 4JG6A 1J1BA 3OWPA 3ML1A 5J9ZA 5L6PA 4O7WA 4WRGA 1OBDA 3BLQA 3RCDA 2WOUA 4CMTA 2E9OA 3KRLA 2JC6A 5HGIA 3C0HA 2OWBA 4DH7A 3DTCA 3NYVA 5A6NA 4WIHA 3C51A 2R3LA 4O4FA 5AUWA 4UX9A 1UU9A 2HXQA 1J7UA 4X6QC 5AEPA 4DC2A 1FGIA 1UVRA 2WGJA 3FZRA 3NYXA 3O8PA 4IHPA 4YJVA 3A7IA 3DKGA 2OJGA 3MGYA 2R3KA 4IWOA 1GIHA 3ZM4A 5AP6A 4AGCA 2VGPA 3LFEA 5HNIX 3Q9WA 4FI1A 1SVGA 5LXMA 1ZOEA 4L43A 3UODA 3LJ2A 4E5AX 5CALA 2B4SB 3HV6A 4MTAA 4RIYB 2ZB0A 4TYIA 3SAYA 1Q24A 2BROA 3ALOA 3BU5A 5CF5A 3UMXA 4L52A 3CIKA 2BHEA 1R3CA 3FL4A 4BTMA 2DQ7X 2A98A 5BQ0A 2NNWB 2Y8OA 3MI9A 2QO7A 2BZJA 2JLDA 4NKAA 3R30A 2Z7RA 4KIOA 2WTVA 2J0LA 3R9NA 4BCIA 1JLUE 3ERKA 3K3IA 4IW0A 5CT7A 3NMUF 5JT2A 3BHTA 3FPQA 1GZNA 3H9FA 4RWKA 4D58A 3F2RA 3PXFA 4F0IA 4L68A 3QZHA 2B9HA 4C2VA 3E7VA 3LCOA 4ZLZA 4R8QA 3IW4A 3UZPA 4IZYA 4ONAA 2DYLA 2ZJWA 2XIRA 2BZIB 3NNXA 4FV0A 3TIZA 2YLFA 4YJOA 3TT0A 5DRDA 3PFYA 5IQHA 1OECA 3F82A 3PG1A 5M07A 1H1WA 5A3XA 4F6WA 5HTCA 2R7IA 2C1BA 2ITUA 4F1TA 3ZFXA 2WXVA 3A4PA 2RFSA 4O0UA 4PWNA 4MXAA 3FL5A 5LMAA 3FHIA 4TWPA 3EN7A 5AUXA 3C5IA 3W0SA 4GH2A 4YBKA 3A8XA 1WBOA 2OXXA 2XM9A 2I0YA 4QMXA 5IA3A 1RDQE 2O64A 4C4GA 2R3NA 3CKXA 3SV0A 4XMOA 4EOPA 5AR2A 4Z7HA 2RGPA 4LV7A 5E4HA 4DCEA 1XH7A 4MXYA 5FXSA 4ZJVA 3OD6X 1YOMA 4BTJA 3QLGA 5D12A 4RGJA 4AGUA 5IA1A 3SLSA 3ETAA 4YZBA 3EQDA 3TV4A 3LFSA 2A1AB 3HKOA 5AWMA 3R8UA 2XUUA 4CSVA 3HP5A 4E20A 2FA2A 4KABA 4EKLA 5AX9A 1YXUA 1PMEA 5IKWA 3AD4A 4QPMA 4EH8A 5IMXA 2B9IA 4EH3A 4F0GA 3UQCA 4FX3A 4BCHA 3NWWA 3N4TA 3MSSA 3U9NA 4AS0A 3R02A 3JY9A 4EWHA 4PDSA 4F99A 3EWHA 3NCZA 2YERA 3BGPA 4D0WA 1YDRE 4XP0A 4EI4A 5HG8A 2G2FA 1Q99A 3TL8A 5HNGA 2CCHA 4S32A 4X2GA 3VBQA 4D28A 4FTAA 3R9HA 5FTGA 4D4SA 4MH7A 4I94A 1UWJA 2WD1A 5H2UA 4USFA 3TV7A 2ZM1A 4BCJA 4FEQA 3HNGA 2YM6A 4EHGA 3JR1A 1T46A 2YIWA 2CN8A 3PA3A 4B7TA 3L9PA 2Y6MA 4EBVA 3Q6WA 4RX5A 4LL5A 3HVCA 3F61A 4HYSA 3W16A 3W0MA 4AN9A 1SNUA 3NVKI 4GJ2A 4PPCA 3ZSGA 3VJNA 3ZUTA 3FBVA 3KGAA 3DNDA 4ZSAA 3R7YA 4L44A 2QKWB 1QMZA 4GVAA 3O50A 5DA3A 3V5TA 4OBOA 3LW0A 4O0WA 5JZJA 2BR1A 4O7SA 4IEBA 3S3IA 3IDCA 2WTCA 3LMGA 3ANQA 4AXEA 3NSZA 3VHKA 1K3AA 3BYOA 2UZVA 4R6VA 4I6QA 2V5QA 4IVBA 4QOXA 1ZRZA 3QWKA 4WNOA 4RA5A 3R8MA 1H08A 4JDHA 3N4UA 3FLSA 4DGNA 2XAOA 2XJ2A 2PU8A 5IA0A 3G51A 5EKNA 3H3CA 4RRVA 4EH9A 3ULIA 4EYJA 3NUNA 4OGRA 4TRLA 3ZLSA 4FNYA 3R9RA 4FKRA 3F9NA 1WVYA 4BDFA 3WILA 2VWWA 4UY9A 3VS0A 3DNEA 2F7XE 4NIFA 5DT4A 1KOAA 2OJJA 5AV0A 4CZUA 4KSQA 1PMNA 3GENA 4EL9A 4O38A 2Y4IB 2BIYA 3EFJA 2PMLX 4O7TA 2PVYA 3IPHA 4BWKA 3OFMA 2J2IB 4JLCA 4X7QA 4WNKA 2AEGA 2BTSA 3WE4A 4MD7E 4D55A 5FEDA 4DTKA 1ZMUA 4CKJA 1SM2A 3VF9A 4JAIA 3T8OA 2UZDA 1H1PA 2QOHA 4RJ4A 5C9CA 5DG5A 2PZIA 4H39A 4QMVA 3KXHA 3TTIA 4N6YA 2VWIA 2QONA 3F2AA 1YWVA 4G16A 4F7JA 3FXZA 3CEKA 4M0ZA 3RK9A 5L3AA 1P4FA 1FVRA 3CD8A 4FG8A 4C38A 2WU6A 4O0XA 3R7IA 2JKOA 3LVPA 5ACBC 1ZARA 5LQFA 4RG0A 3LFQA 4TWCA 5ETFA 2A4LA 2VTTA 5HESA 4IE9A 3OXTA 2YM5A 5AV2A 4QMTA 3V51A 4AOIA 2GSFA 4RWIA 3RWPA 3EFLA 2GHLA 5E8WA 3C4ZA 3OCBA 3VRYA 4EH6A 3MW1A 5KMKA 2R2PA 2AC5A 1LUFA 2AQXA 2W1IA 4FG7A 3DZOA 3F2NA 3Q52A 2OLCA 3OUKA 2ETRA 2WQBA 3H10A 3NUYA 4RVMA 4ZZMA 3AKKA 4KKGA 3UDTA 3PPKA 2HIWA 3Q4UA 4TN6A 2X4FA 4G17A 5J9LA 4C3FA 1B38A 5BVOA 4KKHA 4M84A 2E2BA 2UZLA 5AP7A 1PHKA 3QBNA 2X81A 3ENHA 4ZEGA 4D1ZA 1XO2B 3A8WA 2QU6A 4RBLA 3JYAA 4KIQA 4D4VA 3VULA 5BX0A 4PTGA 5A6OA 4DGOA 4USDA 3VO3A 2O2UA 2WMWA 3LFAA 2C3LA 2R3IA 4RVLA 2X39A 3EN4A 4JQEA 4R7IA 4BI2A 2JGZA 4YPDA 4PP9A 5EW9A 4ZTLA 5HBHA 4E73A 4A9TA 2QO9A 3TJDA 3EMGA 4FNXA 1QPDA 2PVJA 4BBMA 2ONLC 5EK7A 4AE9A 1DI8A 3PP1A 4D9UA 4E6DA 1NT2A 3B2TA 4HCUA 3HRCA 4A4OA 4WNPA 2BIKB 2JKQA 4JL9A 1OKZA 4QTEA 3KULA 5E1EA 5DH3A 5IUGA 4O0SA 3GEQA 2J9MA 3DXNA 4EZ5A 3NIZA 4A4XA 2XNEA 2IVTA 3NUPA 4BKYA 1WZYA 3NUAA 4ZK5A 2XB7A 3PA4A 5JRQA 2R3JA 4AP7A 3PDTA 1YXTA 4Q9SA 1B39A 4JBPA 4EK6A 1Q41A 4BKJA 2BAJA 2R3FA 3FSKA 5CU3A 4JBVA 4EQMA 1XBAA 2PMIA 5A4QA 4XP3A 4ZTNA 4GMYA 5GNKA 3E92A 4GK3A 3ZLWA 5BVWA 4GT3A 4AT4A 5FLFA 1OPJA 1NVRA 3DFCB 3RZFA 1KSWA 4TYGA 3LFFA 2W1DA 5GIPE 4APPA 3C4XA 3OBGA 2BCJA 3EKKA 3PFQA 4OTIA 5M55A 2LGCA 3V6SA 2WMVA 4ASZA 4A9RA 5BUEA 5C1QB 4FSNA 5HE0A 3VQUA 4E7WA 4ASDA 4EH4A 1PF8A 4JG7A 3RCJA 5LWNA 4FKTA 3SKCA 4AW1A 5CANA 2YWPA 4YNEA 4TYEA 5CYIA 4DH8A 2PZ5A 4Z55A 4II5A 4S31A 4NIFB 1XKKA 4FTJA 1M52A 4DTBA 2XARA 5IDNA 5M06A 5E8YA 3N4VA 3NAYA 4O1PA 5CSWA 4ZTMA 3E8NA 4YUQA 2YZAA 5CWZA 4ZY4A 3DU8A 4WO5A 2QOIA 3L8PA 5HLPA 4EKKA 4ACMA 1MQBA 4E6QA 3BHYA 4EJ7A 3D7TB 3PY0A 2J51A 4RVTA 4C7TA 1ZZLA 4TYJA 4YC6A 5BPYA 2ZFYA 3VUGA 4P5ZA 4RX8A 4BCPA 4HVIA 2WKMA 3ZDIA 3EL8A 1JSTA 4C61A 2XBAA 3V8TA 4Q9ZA 2QOLA 3RP9A 5M53A 1L8TA 4EOIA 5AAEA 3CCNA 4PDYA 3HLLA 5HG5A 3AOXA 3MPAA 3TNWA 5KMIA 1VYZA 3V5WA 5AV3A 2QR8A 4IWPA 3CQUA 3GFWA 2ITQA 2QG5A 4XLVA 5CNOA 2IVVA 3PJ2A 2W99B 3TUCA 4RFMA 2X9EA 4HYIA 2OICA 4JBOA 1DM2A 2BDJA 5EYDA 3PLSA 3ORKA 4S2ZA 3F7WA 4G6OA 3ORNA 4BF2A 2OK1A 4IJPA 2B9JA 3CTHA 5B0XA 5IISA 3D83A 2WMUA 5D1JA 3C9WA 3I60A 4HCVA 1CKIA 4NKSA 1PY5A 1QL6A 1R78A 1UA2A 3TNIA 2R3PA 4ANSA 2Z8CA 5L2SA 3UTOA 3NNVA 4AGWA 4J8NA 3P79A 1M17A 4FZ6A 3CBLA 5IEVA 3VS7A 5CEMA 4Y85A 3E3PA 3SRVA 3AT3A 3ITZA 3NRMA 5FG8A 3EN5A 5JRSA 1O6YA 3RHKA 2GQGA 1XHAA 2RFDA 5BNJA 1W7HA 3W2SA 3NIEA 3MIAA 3BLHA 4OTGA 5E8UA 4KKEA 4FZAB 5E8XA 5A4LA 5ACKA 4EK3A 5H3QA 5FP5A 1RQQA 1URWA 2V62A 4IZAA 5ANOA 5EQEA 4PX6A 4U44A 4B8LA 3QRKA 4U8ZA 5FEEA 3AGLA 2IW8A 3LKMA 2XIYA 3TV6A 3RPOA 3U6IA 3CTJA 4JNWA 2CLXA 4QMZA 5DRBA 3V04A 2G01A 4RIOA 1GIJA 5DR9A 3MB7A 5DFPA 3ZU7A 3KULB 1WCCA 3OS3A 5CI7A 5I4NA 5JKGA 3MH3A 2JEDA 2XEYA 5F95A 2C47A 2XKEA 5EM5A 4U0IA 3TG1A 4E6CA 2V7AA 3P78A 2QOCA 4DGGA 4O7LA 1F0QA 4YHTA 3DPKA 4H1MA 5FP6A 2QI8A 4BIBA 3NFFB 1JBPE 4EOOA 5AAFA 3ZDUA 1YRPA 4EOSA 3BHUA 3QTQA 3HV5A 4FK3A 4JX7A 2WMTA 5AUVA 2B0QA 4KUJA 2P4IA 1XMMA 2CDZA 3FLZA 3VBTA 5LCJA 3ZBFA 3QD3A 4KRCA 5M57A 5GJFA 4F9AA 4X2KA 2V0DA 3OT8A 1P2AA 3DXPA 2PVKA 4M8TA 4EK5A 1FMOE 5ANGA 3LOKA 5HIDA 1OL2A 1VJYA 3SX9A 3UZRA 4DAWA 3A7GA 3IGOA 5IPJA 4I23A 4FIJA 4BDAA 3V5PA 4IMYA 4DEBA 4FNZA 3JXWA 4HNFA 5E8ZA 2HWPA 3HDNA 2RKUA 2ZYBA 4LGGA 3WOWA 4C2WA 1ST4A 4HPTE 5IQEA 3SW4A 4FV4A 3TWJA 3TDWA 4GG7A 4G6NA 4LYNA 3VHEA 2E9VA 3S4QA 4FMQA 3MESA 5CXHA 4R1YA 2E9NA 3GGFA 3LCKA 4AXAA 2QO2A 3A61A 3DAJA 5C8KA 3BU3A 5ANKA 1G3NA 3LCDA 4HVSA 2WNTA 5AAGA 5M4UA 3EN6A 3GCVA 3I0QA 5HTBA 4KIKA 3VF8A 3BEAA 2AYPA 3FY0A 3L1SA 4K6ZA 3ATTA 1A9UA 3IKAA 3VUTA 2Z7SA 3KC3A 2GNJA 4TXCA 4BGGA 2Z7LA 4FK6A 3BWJA 4RIXA 1PRYA 4F64A 4IX5A 4FF8A 3DB8A 3F5UA 4J7BA 5KZ0A 1JKLA 1YDSE 2I0VA 2PHKA 3FQEA 4MXZA 5JQ8A 3F88A 2YFXA 4EYMA 3F3UA 2Z7QA 1KE9A 4O7VA 2WMXA 1WFCA 4O6EA 1H1QA 4ZTQA 4EZ3A 3AC5A 4X21A 4LUEA 3R01A 5K5NA 4ZMEA 3UQFA 3ZONA 3FAAA 5AP3A 1AGWA 4RFZA 3QGWA 4DG2E 4M69A 3QCQA 2ITTA 2BFYA 2XIKA 5C01A 1KE7A 5IQCA 3AQVA 4MWIA 2REIA 5IQAA 1O6KA 4I0TA 4EH2A 4FUYA 2FUMA 4V0GB 5ANJA 1Q3WA 2X8DA 4FSUA 3GQIA 4G9RA 4XYFA 4PMPA 4PPAA 2YJSA 3SRVB 1WVXA 2X2KA 1W98A 2DUVA 3CGOA 4X0MA 4KSPA 5AR7A 4FG9A 1R0PA 3VVHA 4OLIA 4FR4A 5JFXA 3QRIA 3VS1A 4E6AA 3TEIA 4F9BA 2ITYA 4MF1A 2YAKA 3THBA 2CGXA 4AXFA 4XG2A 3BHVA 3NW7A 3UE4A 4DFNA 4IAAA 1JNKA 4NW6A 2QOQA 2B53A 4GFOA 3DJ6A 2R7BA 3MVLA 3D94A 1Q8TA 3FMKA 4JRVA 1DI9A 4JIKA 4E5BA 4NEUA 3AMBA 3ORZA 3KRWA 3II5A 2EXCX 5GIOE 3KCKA 3W0PA 4FV6A 2GS6A 2FVDA 2XIXA 3PE2A 4FIHA 3P5JC 4JOAA 4YZDA 3LM0A 4YC8A 5D9HA 3UO6A 3VN9A 3ZZWA 4DF3A 5TF9A 3ZRKA 2W1EA 2YISA 2UZUE 3FKNA 3OWKA 4MBIA 1W2FA 4HZRA 3FMDA 1APME 5IU2A 2CJMA 3RVGA 1HOWA 2VTHA 3KXMA 3LQ5A 4GK2A 1YI6A 4HGSA 4J95A 4IB0A 4XV2A 4FOCA 5LVPA 3HMNA 1G5SA 3EQHA 4LMUA 3BGQA 5H8GA 3M42A 3QUDA 2O63A 4FODA 4KS7A 3EQRA 4EHZA 3KIOC 4KRDA 4QYFA 1I44A 2V7OA 3VBVA 4MD8E 4YJTA 2OZAB 5AR5A 3BL9A 5FM3A 1HCKA 4GIIA 2WIHA 3NUSA 3M11A 5HVJA 5CSPA 4FVRA 5GHVA 3GNIB 3R21A 3CE3A 4KD1A 3P7BA 5FXRA 4QDEA 2BDFA 3QKMA 5HX6A 3ODZX 5EG3A 3P23A 3RM6A 2C6TA 2GQRA 3FZOA 3AC2A 4P4CA 4RZWA 4CXAA 3QX4A 4B8MA 4DLJA 3C13A 2YDKA 3QQJA 3PVUA 2VTSA 5JK3A 1AD5A 2RIOA 2ZV2A 2B9FA 1UKIA 2PZRA 2UUEA 4CT1A 5LWMA 4IAYA 1SMHA 3DJ7A 4DHFA 3LMIA 4MKCA 4EK8A 1U54A 2QOKA 4R3CA 1BI8A 4A9SA 4O0YA 4JX3A 5AR8A 1Q62A 3WI6A 5C4LA 4EH5A 1ZYSA 5HIBA 5EOBA 3QC9A 3OBJA 2F7EE 2JBPA 4J1RA 1E1XA 3GC7A 1FINA 2VX3A 3BELA 3E8EA 3RK5A 5CF8A 1FPUA 2QQ7A 3D5VA 4JRNA 4MEDA 4AG8A 3MFUA 4JR7A 4D2RA 2PVFA 3R2YA 4I5CA 5HO6A 5KE0A 3RAIA 5CEPA 1G8JA 4RIXB 4DG0E 2YA9A 1H1SA 3QCSA 3PYYA 2UVZA 2PMNX 2P3GX 2RG5A 4QNYA 2HZ0A 2J4ZA 2YACA 5CAQA 1P14A 2ITXA 4CLIA 1UNLA 2C0TA 3IS5A 5FWKK 4ZSJA 1GIIA 4A9UA 4IVCA 2VNYA 3H9RA 1OL6A 5DOSA 4EBWA 4F1MA 1YWNA 2YIQA 3C4CA 3UVPA 4FSTA 2ITWA 3TACA 4G5PA 4ITIA 2XJ0A 4N6ZA 3NW5A 3R28A 4JBQA 4OBQA 4DHJA 2FB8A 1IA9A 2YIRA 3OCTA 1NA7A 4M69B 4O86A 2GTMA 3DK3A 4XRJA 3QD2B 3VW6A 4WUNA 2C0IA 2WTWA 5AP2A 3KA0A 3MB6A 2CKQA 3BV2A 3QQHA 5M4CA 2PVNA 4FSQA 1PYXA 3BYVA 3PRIA 3QC4A 1W0XC 3CY2A 2XYNA 5BVKA 2BKKA 3PXZA 3TMOA 2C6IA 2OG8A 3G33A 1UU3A 4X2JA 4FBXA 3R8LA 2YZLA 3TIYA 4FTLA 1DS5A 4ANLA 4BDJA 2W5BA 3ZO4A 2JAMA 3UNZA 3DA6A 3N9XA 3F6XA 2CMWA 2DS1A 3KEXA 1H28A 4DCAA 4MD9E 1QPEA 3KKVA 3G15A 2PL0A 4ORKA 4U3ZA 2ZB1A 3VS3A 1OPKA 2G9XA 2OZOA 2GMXA 3I5NA 3LM5A 2VWBA 3GOPA 4TW9A 5AP1A 4BWXA 3PY1A 3BQCA 4CRLA 4LUDA 4EK4A 4ASXA 5AUUA 3VRZA 5HU3A 3ANRA 2F57A 4LRMA 1ZYDA 4RC3A 1WBPA 3SVVA 4CV9A 3R7UA 5DLSA 1U5RA 4BCKA 5G1XA 5CEIA 5CEQA 5K4JA 5HORA 2EVAA 4MAOA 4ZTHA 1ZMWA 2VGOA 2VAGA 3HRFA 2OSCA 3LCTA 1YHWA 3SG8A 4I5PA 4IAIA 5F4NA 4FRFA 3ZO3A 1OL1A 2H6DA 4H3PA 3R9DA 3OC1A 3KY2A 5F20A 4K18A 3OG7A 3BLRA 4PDPA 4R5SA 3O8UA 5HG9A 3UNJA 4ITJA 3OWJA 3D14A 5IF1A 2IJMA 4WD5A 2UW6A 3ZC5A 4ENYA 1ZOHA 3ZCLA 4DHIB 3Q4ZA 4L3JA 4O91A 2YN8A 3BYMA 5LVLA 2R0IA 2ZV7A 3DT1A 4PL4A 4F4PA 3I0OA 4KBKA 5EM8A 4DGMA 4HVDA 4I93A 3CJFA 3QUEA 1JSUA 5CU2A 4EOQA 3HL7A 3COIA 1BLXA 2JDSA 4YTCA 3R2BA 3LIJA 3MDYA 4L00A 1W2DA 3FE3A 1KOBA 1L3RE 5HO8A 4BDDA 5FBNC 4KS8A 4F09A 2UW0A 5JMSA 2XANA 3R8ZA 3TCPA 1W8CA 2WTIA 1VYWA 5I3OA 3R9OA 4E5WA 2RL5A 5I9WA 2W5AA 4MQ2A 4YJUA 5L8JA 4U5JA 3R6XA 3R71A 3F3ZA 5FEQA 4TTHB 1HCLA 3KMMA 4EONA 2WMQA 2X0GA 3F5PA 2C6LA 4JS8A 3LFBA 4S30A 3DK7A 1SNXA 2GHGA 3H4JA 3TNPC 3QZGA 2VO3A 4QQTA 1U54B 3FUPA 2CNVA 1JKKA 1SVHA 3HV4A 3DLZA 3KVXA 5IG1A 2CKPA 2Z02A 4RZVA 4X2NA 4UN0C 1J3HA 2GNIA 3R73A 3GOKA 4NW5A 5IA5A 3PSDA 3IG7A 4QTCA 2W5HA 3RM7A 3AKLA 3QWJA 5E8VA 3H9OA 3PXKA 3LMHA 3KL8A 3GVUA