1ZOGA

Crystal structure of protein kinase ck2 in complex with tbb-derivatives
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
325
structure length
325
Chain Sequence
SKARVYADVNVLRPKEYWDYEALTVQWGEQDDYEVVRKVGRGKYSEVFEGINVNNNEKCIIKILKPVKKKKIKREIKILQNLCGGPNIVKLLDIVRDQHSKTPSLIFEYVNNTDFKVLYPTLTDYDIRYYIYELLKALDYCHSQGIMHRDVKPHNVMIDHELRKLRLIDWGLAEFYHPGKEYNVRVASRYFKGPELLVDLQDYDYSLDMWSLGCMFAGMIFRKEPFFYGHDNHDQLVKIAKVLGTDGLNVYLNKYRIELDPQLEALVGRHSRKPWLKFMNADNQHLVSPEAIDFLDKLLRYDHQERLTALEAMTHPYFQQVRAAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Inspecting the structure-activity relationship of protein kinase CK2 inhibitors derived from tetrabromo-benzimidazole.
pubmed doi rcsb
source organism Zea mays
molecule tags Transferase
molecule keywords PROTEIN KINASE CK2, alpha SUBUNIT
total genus 107
structure length 325
sequence length 325
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2005-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1zogA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1zogA02
4FTOA 4PTCA 3ZBXA 3M2WA 5JRQA 3FXWA 1ZOGA 5IQAA 4YURA 1RDQE 4FV0A 3OCTA 4O7SA 3F61A 5CWZA 4L9IA 4X3FC 4IB0A 4G17A 3TDWA 1GIJA 4BIDA 4Q9ZA 4IAZA 3H9FA 1JVPP 4FKJA 4U45A 1H07A 5CU0A 3ORIA 5ETAA 4EC8A 1T45A 5EI8A 2XMYA 4YO6A 3QWJA 4P2KA 4FV1A 4RX7A 4C3PA 3LFFA 3Q53A 3HV7A 5GINE 4D2VA 2WGJA 4PPAA 2XM8A 4MXXA 4KKEA 2W06A 4HZSA 4DFLA 4BKZA 3NUAA 3BV2A 1U5RA 2YERA 2VTJA 2EB3A 3GC9A 3F7ZA 3LKMA 4OTWA 2QOQA 3H9RA 4F65A 3QC4A 3VUIA 2WMVA 2ITZA 2R5TA 1XH4A 3HL7A 5AR3A 2C5VA 3AGLA 4L45A 3CCNA 4MHAA 4J8NA 4AU8A 3UQGA 2V7OA 2IZUA 2HELA 4FT3A 5AV3A 5F20A 5J5TA 3O7LB 5J1VA 2ERZE 4DH3A 1WAKA 3WARA 4E4MA 4MXYA 3HLLA 4E26A 2ESMA 2PVLA 4YNOA 4CRSA 1ZLTA 3ACJA 3DAEA 2VO7A 3NGAA 4HGEA 5H3QA 2Z02A 5M44A 3JVRA 3RVGA 4FKUA 2RKUA 3QF9A 4ANSA 4TL0A 5HCYA 1FVVA 5CI6A 3ORMA 4KUJA 3V5LA 4MKCA 3IDCA 4LV5A 2R64A 4XOZA 3BELA 3TV6A 3MA3A 4QD6A 5ICPA 2JDTA 1NXKA 5FM2A 5AAFA 3U9CA 5K4JA 1OI9A 2UV2A 5CAOA 4BCIA 1PXPA 4FV5A 3A99A 5FEQA 3DGKA 3KEXA 4FIIA 4ZTQA 2XM9A 3BHVA 2UZOA 4RX8A 1W8CA 4RIXA 3WF8A 3A8WA 3EZRA 3OUKA 3CQUA 4NCTA 3EQCA 3GFWA 1DAWA 3JYAA 3LZBA 4XH6A 5C01A 4J99A 4FV9A 4EK5A 2BILB 4FKQA 3DV3A 3ERKA 3VF9A 5BVDA 5A14A 2OZOA 4OTGA 5DRBA 2JAMA 4DGNA 5LVOA 4GKIA 5IEVA 1Q4LA 2PMNX 4WHZA 3GCUA 1Y6BA 5JEBA 2PMIA 4NK9A 4BCQA 4ZZNA 4AX8A 2ZB1A 1YHSA 3GT8A 4ZSJA 3ORLA 4IAYA 5HCXA 4ZIMA 3C50A 2DQ7X 3W1FA 3ZSGA 3UPZA 5I9VA 3AG9A 3SRVA 4J53A 5HQ0A 2PSQA 3RK9A 1ZYLA 2R9SA 4NT4A 5AP3A 4BDEA 5IEXA 4MAOA 3DK3A 1K2PA 4S32A 5JMSA 4BTKA 1M2PA 4Y5QA 3UIUA 4M0ZA 2GS6A 3RM6A 4Y5HA 3BQRA 3QALE 4BL1A 4W9WA 5AP1A 4FNZA 4XP3A 4C7TA 4I5HA 4ZY4A 5FD2A 4YLKA 5HTBA 4R3PA 3AQVA 3E8DA 4IHPA 4LYNA 5CLPA 5LQFA 3EQRA 4IVAA 4C34A 2PZYA 3EHAA 3FQHA 5FBOA 3ZH8A 4FKWA 1Q61A 1TQPA 4G3GA 3RAHA 2WMRA 5HU9A 2HYYA 3LFBA 4FSRA 4UB7A 5CASA 1G8AA 3MIYA 3DB8A 3OHTA 3QUDA 3C0GA 5DR2A 3ZC5A 4A4OA 1XO2B 2BRHA 5I9XA 5LVLA 4FODA 5BVKA 2G2IA 3V01A 3RMFA 3HMPA 5GZ8A 4F70A 3UP7A 2XH5A 3CGOA 5BVEA 2IVSA 5L3AA 4G31A 4AA4A 2QOKA 2BRBA 1Q8TA 2JFMA 3R7IA 4Y73A 3DPKA 3E8EA 4QOXA 3KXZA 4U43A 4OT6A 2VTMA 5EYCA 5FWKK 3TACA 4YZNA 3TM0A 3VAPA 4QP7A 4ZLYA 4OTQA 3NYVA 3FZTA 3GU7A 3OFMA 1M17A 3QRUA 3O2MA 5D9HA 1WBWA 1J1BA 4A4LA 3GCSA 2HAKA 3QKLA 4QP4A 5AR2A 3ZEPA 4EOLA 3U6JA 4F7NA 2XJ1A 3SA0A 3OEFX 2PMLX 2PWLA 3AMYA 2VNYA 4HYUA 4QMQA 5F94A 1JKKA 3TWJA 3ZONA 1OBGA 4E93A 5AR4A 2Z7LA 3W2PA 5TO8A 3VBWA 2J5FA 5DOSA 4I92A 2XJ0A 4XLVA 4WRGA 3LFSA 1PXOA 1H1WA 4WSQA 5HBJA 3TZMA 4KKHA 1KE5A 3IDPA 4EQUA 1CKPA 2J0JA 4O7TA 4I6BA 1YW2A 4YHJA 5HG8A 5EQYA 5C26A 3FY0A 4R77A 2DYLA 3C13A 3R02A 4L67A 4NIFA 5I9UA 2C3JA 1JSTA 4WSYA 2WMQA 5HVJA 3NDMA 4ZTRA 1K9AA 3NUSA 3R8UA 3WZDA 5LJJA 4BN1A 2UVXA 2YWPA 3E63A 3OCGA 4EI4A 3OG7A 2OO8X 4LRJA 4R3RA 3ULIA 4F0IA 4FE2A 3LCSA 3ZRMA 5HBEA 2WTVA 3IW6A 4TWPA 5EQPA 3C5UA 1W98A 2WKMA 5CF5A 3DNDA 2YN8A 3D5UA 3VUGA 4JNWA 3SHEA 3ORNA 3PRFA 4OTRA 3NW5A 5CENA 3W2CA 1YRPA 4KKGA 4LMUA 3FDNA 4JIKA 3MVHA 3TIYA 2RSVA 3OCSA 3KL8A 1AGWA 1WBSA 3OOMA 4P7EA 5AIRA 1ZWSA 2E9PA 3WE4A 4EWQA 4W4VA 2VAGA 4DCEA 3MB7A 3GXLA 4OR5A 5FGKA 3VJOA 3GVUA 2PVKA 1IAHA 4RSSA 3MH1A 4FKVA 4FKOA 5E7RA 3FKOA 5JH6A 5E9EA 3VUKA 3Q6UA 4M69B 2EUFB 4BTFA 3OY3A 3TNWA 4CKRA 4A9TA 3RWQA 1AQ1A 5HI2A 4BDIA 1YXVA 3RKBA 2FSOX 5L2SA 3GU4A 4M3QA 3DBFA 4I94A 4CTCA 4ZJIA 5AV1A 4RPVA 4ANBA 2ZYBA 2KULA 4M7IA 1JPAA 2QR7A 3VHEA 5CT0A 3BBTB 5JKGA 2C0OA 1SMHA 2CKPA 2HY0A 5I9WA 2B54A 2Y6MA 5BVWA 3IG7A 4A9UA 3GBZA 5KE0A 3U51A 4D1XA 4P5QA 2YJRA 3PXFA 2GTMA 4M66A 4V0GB 5ANDA 4DG0E 3DXNA 5E8UA 5ETFA 4BCJA 4QMUA 3HUCA 1QCFA 3BI6A 5J79A 3Q4TA 3HP5A 4YR8A 4BI0A 4CT1A 3T9TA 4RRVA 4UWYA 1TQMA 4JDKA 3R63A 3V8TA 4EH7A 5BNJA 4HYIA 3I79A 4QMLA 2W4JA 4ZTMA 2YCSA 3IGOA 4IX5A 4HW7A 3MVMA 3HX4A 3FSKA 4ZSLA 4R1VA 3S1HA 3MSSA 4AXAA 2C0TA 4BI2A 3O0GA 2HK5A 2OF2A 3H30A 3PJ1A 4XJ0A 4WT6A 2C0IA 3WZEA 5T3QA 4BCNA 4F6WA 5BUEA 5HE1A 4C4FA 2OH0E 3COIA 3I0OA 5KHXA 4KS7A 4JBOA 3UBDA 5IQEA 2I0EA 3IGGA 5GJFA 1U59A 2WMSA 3KGAA 2XP2A 5J8IA 4I4EA 3KFAA 5HNIX 4KBKA 3P1AA 2BRNA 3C0IA 3KULB 4QYYA 3THBA 3PDTA 5EDQA 3FC1X 3PY3A 4BDJA 2O65A 3B8QA 3DJ5A 4L00A 1OPLA 4C62A 4EZ3A 4F64A 5K0XA 4PMMA 4KBCA 3SKCA 5AUTA 4GG5A 2Z7RA 4QQCA 3F3VA 5KBRA 4PL3A 3R8PA 3ZRLA 5JQ8A 2BVAA 4ALUA 1F0QA 2WIHA 2OSCA 4GFOA 4J97A 4LGDA 4O0UA 2NRYA 2UW6A 2J7TA 3VS0A 1DI9A 2HZIA 3DT1A 1OKZA 1OL5A 4L44A 1YXXA 3HA6A 3FLSA 2ACXA 1NVQA 3UQFA 1QMZA 4CFMA 4ENYA 4IM2A 2HWOA 5IKWA 3KCKA 4O0SA 5DEWA 5KBQA 2I0HA 4IX4A 3EQGA 2PE0A 4TWNA 5AX3A 5HNBA 3TKHA 4BWPA 3A7JA 4RC4A 4FZAB 3R1NA 2ZV9A 2ONLA 4JDHA 2ITNA 5AADA 4JQ7A 2C5XA 2XNGA 3R7GA 4FTRA 4L42A 3V3VA 2A2AA 1FGIA 4LL5A 3R8ZA 1HOWA 2OJIA 2VGOA 3G9NA 4YZDA 1Q62A 1WBNA 4BKYA 3MH3A 1PXLA 2A0CX 4NEUA 5T6KA 3TNIA 5L2QA 4CFXA 4ITJA 3SQQA 4IDVA 5L6PA 3ID6C 4MF1A 5LWMA 3QRKA 3QHWA 4L3PA 2PVJA 4RVLA 5J5SA 1PYEA 4WUAA 2ITTA 3CY3A 2R3KA 4GK4A 4BBMA 3VS3A 5K5XA 4O7VA 3FE3A 5GJGA 3R7OA 3S2PA 1UA2A 3TL8A 4FSNA 3EFKA 3C1XA 4G9CA 2J0KA 4MEDA 4S34A 2HWPA 4NW5A 2W4KA 3BE9A 2CPKE 3Q32A 3LW0A 4O84A 2V7AA 2O8YA 4UZHA 3B2TA 4EOPA 2JAVA 3H10A 4JLCA 1NW1A 2IJMA 2X39A 4RJ3A 4FEUA 2UZDA 4OAUC 4GS6A 4H3PA 3K3IA 3HV6A 2WTKB 2RGPA 3BGPA 4BICA 1F5QA 4L43A 5BYZA 4AN9A 3JUHA 4N6YA 4FZFB 3UIMA 2Y7JA 3I6UA 3P23A 4PF4A 3VS4A 4AN3A 4CLJA 4RA4A 4S2ZA 5AX9A 4AACA 1OUKA 2QLUA 3LM0A 3P5KA 4TRLA 3FXZA 4FI1A 4PMTA 5D41A 5IQIA 4DGLC 4L3JA 1YI3A 5AA8A 2B9HA 5J87A 4KINA 1ZY5A 4I5PA 4MF0A 5JRSA 4EK8A 4NFNA 2XRUA 4H1JA 2WEIA 1RW8A 4TN6A 4CSVA 3ZU7A 5EOLA 2X8EA 4ZLZA 4FA2A 5CVGA 1GNGA 4O0WA 4YO4A 2CSNA 3D7ZA 3QZHA 1W83A 3EFWA 4YJOA 4EH5A 5HIEA 4KRCA 3GQIA 2WEVA 3HV5A 2PZPA 1BYGA 4ALWA 2R3NA 5DIAA 4A9RA 1GOLA 1R1WA 3F3ZA 5IH5A 5J7HA 2XK9A 2YAKA 3HYHA 2B53A 4YZMA 5KMMA 3D14A 5EQEA 3KKVA 5HLNA 2VRXA 5CZIA 4O7RA 2O2UA 4UALA 3D94A 4GIHA 3ZHPC 3GU5A 5AV0A 3D7TA 4KBAA 3IPHA 2RIOA 3ROCA 4R5SA 4I6FA 3S0OA 3R7VA 2HW7A 3PVBA 5AP0A 3DFCB 2B52A 4ORKA 5CEKA 4B4LA 3GQLA 4TNDA 4DT8A 4K1BA 4ZSGA 5H2UA 2EVAA 3OCBA 3FL4A 3ORXA 2OJ9A 3OWPA 4U5JA 3DA6A 3UOKA 3BGZA 3QLGA 5EYDA 1R39A 1TKIA 3LXKA 1NT2A 3ZS5A 4KRDA 3MPAA 3PVWA 4KIKA 4RIWA 4TW9A 1J7UA 4FSQA 5AUZA 1GZOA 4HYHA 5DFPA 3A4PA 4R7IA 1M2QA 4RLKA 5DA3A 4QQJA 2WELA 4L01A 4E6AA 3O50A 3CR0A 4FF8A 2F2UA 1XKKA 2HOGA 2G2HA 3DDPA 3E87A 4X3FA 5CZHA 3UYTA 4ZLOA 1RE8A 1EH4A 3ZO3A 4ZMFA 2R3LA 2VD5A 1S9JA 4W4XA 5CX9A 4EBWA 3OF0A 3ZUUA 3ZMMA 5HG5A 4YJSA 3IW5A 4QT1A 2JIVA 3EN9A 4FL3A 3QD0A 4BCKA 4DFNA 4WNPA 4EUTA 4RC2A 4USDA 5J1WA 4N57A 3KC3A 4DITA 2W5BA 2OU7A 3EQHA 4YHFA 3TNQB 2VX1A 3WBLA 4IFCA 2B55A 2R0IA 2X2MA 4PP9A 5CEOA 1Y91A 4QO9A 2JKMA 4CRLA 4PL4A 4MBLA 1Y8YA 4E5AX 2GQSA 1W7HA 2Q83A 1PKGA 1REKA 3E8NA 3V8SA 5E4HA 3MY0A 4XEYA 5HESA 4EK3A 2VX3A 5M09A 3GFEA 4MNEB 3RNIA 1JSVA 3OD6X 4C4JA 3KRJA 4LRKA 5B2MA 2WMTA 3QKKA 3BV3A 2G01A 1ZXEA 1KSWA 2J4ZA 4KS8A 3DQXA 5LWNA 4E3CA 4RT7A 4J95A 1PHKA 3OS3A 4CTBA 5CXZA 4HGSA 4J8MA 4D9UA 3MB6A 5IA2A 4II5A 5HHWA 3UMXA 4EOQA 1SNUA 3V04A 1UWHA 4JAJA 4M69A 4OBPA 4I3ZA 2QI8A 4CLIA 2VWUA 5CEIA 4I93A 3RAWA 4ANOA 2XIXA 3S3IA 5L4QA 3KXGA 2J0LA 5CU2A 4RFYA 4YPSA 3PA4A 3QUEA 5KO1A 4H05A 3IKAA 3SD0A 1YQJA 3K2LA 3JXWA 4DTBA 3RPYA 4HPTE 3QUPA 4HPUE 4E5BA 4ZSAA 5I4NA 4XP0A 4ANLA 4EWHA 3ZO1A 4B8MA 2ZV2A 1WMKA 2IO6A 2VWWA 2ZAZA 4QP8A 4UYAA 4BB4A 1XHAA 2PZ5A 4AA5A 4Y72A 2IPXA 3RPVA 4FT0A 3RHKA 4EUUA 4O86A 2WMUA 3W10A 4Y8DA 1J7LA 4APPA 1Y57A 3D5XA 3F69A 4GT4A 2XK4A 1MRUA 2H96A 4GRBA 4QYEA 4BCGA 4NIFB 1U5QA 1DM2A 4FK3A 4DG2E 5LXMA 1H26A 2GSFA 5M55A 2G15A 5IEYA 3F3UA 2WTJA 5KX8A 4DFZE 4KA3A 2XB7A 3FMJA 3PA5A 4XYFA 3KXMA 1P4FA 3G9LX 3MJ1A 3OW4A 4WUNA 4UMQA 3E92A 3Q4CA 1YOJA 2UZUE 3TUDA 4IWPA 3PXKA 4MD8E 4CV9A 4EKKA 4O83A 2QQ7A 3DS6A 2VWVA 4IC7A 4R3CA 3DJ6A 3RCJA 3I7BA 5A6NA 4QNAA 5CYIA 4MTAA 5LVPA 3KU2A 2X0GA 3PIYA 2JDRA 4NU1A 3CC6A 4XG8A 5AV2A 4RJ7A 3W55A 3QAME 5BUIA 2CKOA 4Z7HA 3F2AA 3QZGA 4PY1A 4ACMA 3LQ3A 5CSPA 3ATTA 2VX0A 3EIDA 3GCQA 4G2FA 1Y8GA 5HVYA 2GNGA 4HGLA 2VO6A 5L8LA 4RVMA 2ZB0A 4RWJA 5CSHA 2CKQA 1LR4A 5L2WA 3CQEA 5ANGA 3EH9A 4EHZA 1XJDA 2UZWE 4RZWA 4RC3A 3FLWA 3I60A 4MBIA 2YDKA 4G5PA 5IA0A 3W2SA 2FSLX 2OZAB 1PXKA 5LMBA 1NY3A 3DDQA 2OFUA 5CAQA 5K0KA 4LM5A 3LFEA 2ITXA 4KABA 4PWNA 3W2OA 3C5IA 2I7QA 4TYHA 4L7FA 4DH5A 1CTPE 5HTCA 2BR1A 2C4GA 4XHKB 4ZZOA 4CKIA 2YZAA 2WMBA 4DCAA 2H34A 3CKXA 5CEPA 3BU3A 5ANJA 2VTNA 1SVGA 2VN9A 3O51A 3L8SA 1LUFA 3OXIA 2NRUA 5CY3A 3IS5A 4G3CA 4XCUA 4XV9A 3H3CA 4C4IA 3QBNA 3QQGA 3EB0A 2ZMCA 3PIZA 4FTCA 2YIWA 1CKIA 1PXJA 2E9VA 3LFDA 2Y4IC 4IIRA 3W2RA 4F09A 4TWOA 3TDVA 3TJDA 2DS1A 2R2PA 4QMWA 4DLJA 3T3VA 4C3RA 1ZY4A 4LL0A 4S30A 4V0GA 4C33A 2ZDTA 2J90A 4YJTA 1OVEA 2W1FA 2X4FA 1FMKA 4RG0A 4X6RA 3FMKA 4LGGA 5DGZA 4FEWA 4QMYA 2WMXA 1DS5A 3BYOA 1YOMA 2YEXA 4I0SA 4EL9A 2PE2A 4E4LA 4CG9A 4G6OA 2ZM1A 3TXOA 3ZM9A 1APME 1GAGA 1RJBA 4QTDA 4IB5A 4AGCA 1PXNA 4HZRA 3D4QA 4FTJA 2C6IA 3NSZA 1BI8A 2BRGA 2R3PA 3OXZA 4OTIA 4DH7A 2WOUA 2C6DA 3A2CA 3LJ1A 4H58A 3MBLA 3GENA 1UV5A 4OW8A 3EQDA 3IONA 4TT7A 5EHYA 4YLJA 3AC8A 5M51A 1VR2A 3VQUA 3UO5A 3PE2A 3TT0A 1I09A 5FDXA 5HG7A 5ANOA 2QC6A 2XNBA 4JBPA 4XV2A 4XV3A 5HBHA 3ZSHA 3ENHA 1ZYSA 3EWHA 3G0EA 4C59A 4ZJVA 3F2RA 4NUSA 2P0CA 3DTCA 2OZAA 1E1VA 3BLQA 4GEOA 5DT0A 4DH8A 2UW8A 4FVQA 2E9UA 2Y8OA 4QTEA 5BUJA 4DFBA 5K5NA 3EKNA 3IW7A 4DT9A 5M08A 3GOPA 4O82A 2PZRA 2WU7A 3ZDUA 4FICA 4NWMA 3KXNA 3VW6A 2CLQA 4WRSA 4AAAA 4BFMA 2QO2A 4DN5A 5KMOA 3VBXA 3D83A 3IQ7A 2PUIA 2A4LA 2EXMA 3R8LA 3SC1A 4C37A 3P7AA 3Q52A 4QMSA 1DI8A 2JDVA 3QYZA 3NWWA 3NUNA 4BCHA 5FXRA 2YM5A 2JIIA 2IWIA 3PTGA 2DWBA 4GL9A 1U54B 3R9HA 5AIKA 3HRFA 3L9MA 4FV3A 4Y85A 3G6HA 3V5QA 3ZEWA 2IW6A 4ACDA 5EHLA 4FL2A 4BC6A 4QPAA 5FG8A 4C58A 3UGCA 2ZV7A 4ZTNA 2YDJA 4PDOA 3MH0A 1YXTA 3FHRA 3NVKI 4IFGA 4H36A 3HMNA 2REIA 5H9BA 3FXXA 4N70A 3CPCA 4A7CA 4EJNA 3UNKA 2XNPA 2XEYA 1M7QA 1UNHA 5KKRB 1BLXA 2WQBA 3NYXA 1OUYA 5DT4A 2SRCA 4EOKA 1GIIA 3GNIB 3TZ7A 2YZLA 3MFRA 4GK3A 1YKRA 4M67A 2XIZA 1JBPE 2PULA 2RFEA 4U8ZA 5KMIA 2Z7QA 2FVDA 2QCSA 4DEEA 1FGKA 4CEGA 2QHMA 2YCFA 4GU9A 4NZWB 4D0WA 1P4OA 5CAPA 2W1GA 4EC9A 3D5WA 2YABA 5HG9A 5HKMA 4TYHB 4O7NA 2VWIA 4KIOA 1O6YA 1R3CA 2G1TA 1VEBA 1ZRZA 2XNEA 2ZM3A 3FV8A 3R71A 4EH4A 2BKKA 2A19B 1YWRA 3C4WA 3DOGA 4TPTA 5AR8A 4XOYA 5A54A 2NPQA 2B4SB 2BKZA 2JBPA 3FC2A 3ZLXA 3ZLYA 1JSUA 3MTFA 4DEHA 4YLLA 5BQ0A 1H0WA 3PPZA 5L6OA 2FB8A 3ITZA 5CAVA 3GOKA 1PYXA 2BTRA 3EFLA 4U3YA 2R4BA 3VBYA 4FKLA 2VO0A 2VTQA 3R22A 3VF8A 4GYIA 3WF5A 3TKUA 3DAKA 4IX6A 4U80A 3QKMA 1H8FA 2O63A 3H0ZA 1JNKA 2RG6A 2ITYA 3FZSA 3F82A 3IECA 4IXPA 4UEUA 5D1JA 4QMTA 4F9AA 3Q5ZA 3LPBA 4FL1A 4W8DA 1A48A 5C4KA 4QPMA 2W9FB 1GZ8A 5LARA 4CFVA 4M13A 3QX2A 2PPQA 3NNXA 3QRJA 5HVKA 5TT7A 1OIUA 1PMUA 2WHBA 2ITOA 3PY0A 1WBOA 1R0PA 4OTFA 2XJ2A 3PXQA 4FKIA 3RINA 5TE0A 4FIJA 4DBNA 2VWXA 1T46A 3FLNC 3KMWA 3BYSA 3LMGA 4FYOA 4LRMA 2JEDA 4FSZA 4P90A 5FTQA 5GZAA 4PMSA 4R7HA 4YJVA 2R3JA 3C4ZA 3OT3A 4JG8A 4RA5A 3ZBFA 5AM6A 4AUAA 3DK7A 5FQDC 1SVEA 2R3FA 3QTRA 5AMNA 5HX6A 1PJKA 3JS2A 3OMVA 5HLWA 2FGIA 4NW6A 4ASEA 2B9JA 3AT3A 4HCUA 4LOPA 3G33A 1H1PA 5E8XA 5EM8A 1YWVA 3WI6A 3MESA 3NW7A 2IVVA 2UW5A 4FOCA 4CFWA 5IDPA 3KCFA 3PPKA 4JDJA 2BHHA 3NEWA 5ANIA 1KUTA 5IZFA 2CN8A 2BIYA 4WA9A 1BI7A 4G6LA 4JS8A 4OTDA 2XBAA 5AUXA 4BHNA 2XKCA 2UW0A 3AC3A 4PDPA 4F9BA 2QO9A 5CVHA 3EMGA 4GFMA 4KNBA 4G5JA 4X21A 5CU3A 3Q2MA 2Z7SA 5AEPA 3FAAA 3ORZA 5KZ0A 4FTIA 3ZC6A 3W32A 3BX5A 2BMCA 4BCFA 4ANNA 4ANMA 4EOJA 1P2AA 2PMOX 1H1RA 3LMIA 2YM3A 3NUPA 3O8UA 3PSBA 2JDOA 3IW8A 3FZOA 2OW3A 2BZKB 5F4NA 3ZFMA 2VTOA 4CT2A 4NFMA 4CQGA 3R2BA 3RHXA 1FOTA 2YM8A 4BBEA 3L9LA 4CZYB 2C6MA 5KMKA 4WNMA 5DHJA 1KE8A 4NYEA 4JQEA 2F2CB 3FI3A 4QNYA 3ZO2A 4Z7GA 3HUBA 1UKIA 1H00A 4RJ8A 5GZ9A 3S4QA 2UVYA 3KRXA 3ORPA 2WAJA 4HVGA 4MWIA 4IW0A 2PTKA 5KMLA 4FTKA 4FR4A 4WNOA 5JFXA 3ZO4A 2OFVA 3Q4UA 3Q9XA 3U6HA 5AFVA 2A1AB 4U41A 4AT3A 2HXLA 3P78A 4EZ7A 1PMEA 5DEYA 2X7FA 4XG7A 4O2PA 4CFUA 3MPTA 3R8VA 4F1TA 2ZOQA 3SG8A 3LOKA 4EKLA 3QCQA 3AC2A 5JN2A 2V22A 5FEEA 2W1ZA 3CXWA 2YLFA 3C4EA 2BTSA 2W05A 3GU8A 3ZDIA 2CNUA 5KNJA 3ULZA 3A7FA 4U3ZA 2G2FA 3NPCA 3UO6A 3K3JA 4R7BA 5AP2A 5BYLA 3PZHA 3IOPA 4IZAA 5JT2A 1JWHA 3KREA 5B7VA 5BPYA 2BFYA 1ZOHA 4CZUA 4ALVA 4JG6A 4C4HA 2ETKA 2YCRA 5HIDA 1RQQA 5FEDA 3PJ8A 2P33A 4BWXA 4B7TA 4MXCA 5HD4A 5DMZA 4IJ9A 4X3FB 4C61A 4XG4A 2PYWA 2WIPA 1PMNA 3U55A 3LXPA 5I3RA 3MYGA 3W8QA 3DAJA 3HGKA 4L46A 4O96A 1YHWA 4UXQA 1Z5MA 4YZ9A 2CDZA 5AP5A 2HZ0A 3HAMA 3AGMA 2B7AA 4KSQA 4FIFA 4MWHA 4QQ5A 2KTYA 4UZDA 4C2VA 3UPXA 2VTAA 3NNVA 3N4UA 4IBMA 5CT7A 4GYGA 3KVXA 5C4LA 3NNUA 2QOHA 3O7LD 4IVCA 3I1AA 3QGYA 3DK6A 5EHOA 1WVWA 2E9NA 2W99B 3HRBA 1M2RA 3MY5A 3OXTA 1J3HA 3AOXA 3VUTA 1Q99A 4ZAUA 3JY9A 4JX3A 3FWQA 4GUEA 3CIKA 4F63A 4FZ6A 4I22A 4E4XA 2CHLA 3ANQA 4AP7A 5EW3A 5I9YA 4CGAA 4E4NA 2CKEA 4J96A 4DHFA 5CXHA 3LHJA 3AC5A 1SZMA 4FSUA 2YIRA 4LFIA 3H9OA 1MRYA 4LOOA 1BMKA 2W5HA 5JK3A 1HCKA 2UW3A 2F7ZE 3NUXA 2AC3A 4FZ7A 3U8WA 2W96B 3RPSA 4FSWA 3R21A 4J52A 3COKA 4BF2A 4J7BA 4FKSA 3O8PA 3TEIA 4D28A 2PE1A 4FGBA 4GCJA 4CMTA 2QKWB 5C8NA 3T3UA 4JR7A 2C6KA 3GCVA 2OGVA 3CTHA 4I0TA 3R8MA 4HYSA 5DT3A 5L8KA 4GT5A 4PUZA 1V0PA 4RX5A 3OBGA 4G16A 5JFVA 5DBXA 4YGAA 3CE3A 4R78A 2QU6A 4O7WA 4UMPA 3P4KA 4ZK5A 2UZLA 2ZJWA 3W16A 2YLEA 1R78A 2FUMA 1XH6A 3E88A 4I23A 4NKAA 4AG8A 2R3MA 3GCPA 3RP9A 2BZJA 5BVOA 1KE7A 5IQFA 3QC9A 5EK7A 5HCZA 4YP8A 5IQCA 4DC2A 4RFZA 1VJYA 2OIBA 3MJ2A 2I6LA 4BDHA 4GKHA 4M84A 5GJDA 3KVWA 4X3JA 4F7SA 1J91A 3EJ1A 2VTPA 5HD7A 3U87A 3FPMA 2RFNA 3A7GA 3DLSA 4XRLA 2PUPA 3SOAA 1VYWA 3O71A 4O0RA 5IUGA 5EYMA 2GHLA 1OBDA 2PVFA 2UZTA 3BEAA 4XP2A 3A8XA 1JAMA 4IB1A 4V05A 4W9XA 3P9JA 3SXSA 3BU5A 3L8XA 3OOGA 3A61A 1NVSA 2WTIA 2Y0AA 4FSYA 4GSBA 3R1YA 2QG5A 3COMA 4BTJA 3RPOA 3MA6A 3FZ1A 1LEWA 2R3HA 4KAOA 2OICA 4FT7A 2XIYA 4MQ2A 4CVAA 3POOA 4PRJA 4JDIA 4TYEA 5D12A 3AD4A 2X6EA 1YI6A 3NX8A 4B6LA 3R7UA 3BEGA 5DR9A 1ZYCA 4NH1A 5HE0A 3R9RA 4BDFA 1H27A 3UIBA 2X2KA 4DFYA 5HO7A 2GDOA 2JKKA 1IASA 4LGHA 5AUVA 4AQCA 3PA3A 3PZEA 3Q9YA 3VQHA 4NKSA 4BRXA 2BCJA 2YJSA 4PPBA 4U42A 4K9YA 5D11A 3S95A 4TNBA 3ROYA 3KQ7A 2V0DA 3W8LA 1ZMWA 4DEGA 4EK6A 2CGUA 1W0XC 5C27A 5IA1A 3OUNB 4AZFA 2QO7A 2J51A 4FNWA 4U9AA 3ZUVA 4D4SA 4KIQA 4IZ7A 2GTNA 4RLLA 4TXCA 1IG1A 5HICA 4K11A 4KD1A 4F9YA 1FMOE 3DKGA 3GB2A 4EEVA 5DRDA 5KMJA 3ZXTA 1H01A 2X2LA 3I5NA 1OB3A 3DKCA 4DBXA 3VN9A 2WO6A 2A27A 4Z9LA 2XZSA 4WO5A 5AV4A 4RIYB 2EWAA 4DEIA 3CSVA 3F3WA 3TNPC 4KIKB 3EN7A 3REPA 3WIGA 3EOCA 3VS2A 4D4YA 4EH8A 3TCPA 4UBAA 3LMHA 3PYYA 4CZTA 4AZVA 3NUYA 4MD9E 2QKRA 3FZRA 1IAJA 2PU8A 3EKKA 2QNJA 3QQKA 4AOJA 4BYJA 2J9MA 2O64A 4FUYA 3FMLA 3BHTA 4JT3A 2FSTX 5A4EA 3OVVA 4O7LA 2J0MB 4GV1A 4FV2A 4MD7E 3WF6A 4N4SA 4YC3A 1B39A 3V8WA 4CNHA 3CQWA 2E9OA 4IANA 4M97A 3OT8A 4ITIA 2XNNA 1URCA 4EOMA 3DY7A 2XVDA 5EI2A 3UTOA 2PY3A 3KK8A 2P3GX 1XBCA 3C4XA 4M15A 4TY1A 5E91A 5AWMA 3UIXA 4DAWA 5LMKA 3UG1A 4QMXA 3OROA 2WPAA 4NCTC 5CNNA 4AZSA 2OBJA 2V62A 1Y6AA 3OW3A 2CJMA 4O91A 3RK7A 4MYGA 3ALOA 5C8KA 4CFNA 4X2GA 3LQ5A 3NCZA 4QMOA 5L6WL 4YPDA 2WOTA 3DKFA 4YJRA 1KOAA 4O2ZA 4OLIA 1PRYA 2XKEA 4IAAA 3FKNA 5FP6A 3VJNA 4C3FA 4DFXE 5FLFA 4L52A 5FBNC 3VC4A 3ENMA 4PV0A 4Z16A 3VBTA 2GNLA 3ORKA 4OTHA 4AE6A 3LJ2A 4EYMA 5EM6A 5AM7A 1OIRA 2GHMA 2JDSA 2JITA 4USFA 1PY5A 5IQGA 1JLUE 1Q5KA 3EL7A 4UY9A 4YC8A 2X8IA 4FV6A 5JGAA 5E8SA 3G2FA 3R7EA 2ZMDA 3ODYX 4IE9A 4A06A 4IAFA 4ONAA 3MIAA 2HY81 1XR1A 3MFSA 3QCXA 4TYJA 3CTJA 4YBJA 3LCOA 4ASZA 3VBQA 4BGHA 4NL0A 5GIOE 5IG1A 5HX8A 5IA3A 3QTUA 2C3KA 3UE4A 3ZRKA 4DLIA 4F9WA 4O0TA 2VWBA 5F95A 3FI2A 3RI1A 3SV0A 2C30A 5LMKC 4QYFA 3CEKA 3OWKA 5B0XA 3Q04A 2QD9A 4FIEA 3NRMA 5DYJA 4FKRA 4HVSA 1FVRA 5IMEA 2YITA 4C4EA 4K33A 3LM5A 1UNLA 3R30A 4BCOA 4Q5EA 1UU3A 2BALA 4BY9E 1O6LA 1W82A 2C6EA 3RK5A 5EG3A 3K54A 4RGJA 5IQDA 5M4IA 1O6KA 3TIZA 1OKWA 3TNHA 1YWNA 2YCQA 3D0EA 5BYYA 3UVRA 3F66A 2AC5A 3DNEA 4CMUA 5I5ZA 2X9FA 1S9IA 3EQBA 4JBVA 3KULA 4QMZA 5ETCA 5TOZA 3CGFA 5A9UA 4FX3A 3ZM4A 3DBEA 4NM3A 4ZJJA 4XV1A 5DR6A 3VNTA 1OIQA 4G9RA 3P86A 3L1SA 2YACA 1UVRA 3SG9A 1FVTA 3BQCA 3GU6A 3E62A 4EH3A 2QHNA 4GIIA 4AOTA 3R9OA 5AA9A 3DZOA 1JKLA 2XKFA 2ZV8A 3IW4A 4MK0A 4OBOA 5FP5A 4ENXA 2WQNA 4GT3A 5BVNA 2VWZA 3LFCA 3PG1A 4TYGA 1ZYJA 5CALA 4MX9A 4CKJA 1GIHA 4EHEA 4AF3A 4BWKA 3O23A 4O81A 3M1SA 3K5UA 2BIKB 3F5UA 2UZVA 4YZCA 3UQCA 2FSMX 4FV4A 5GNKA 3ZTXA 2R7IA 3FQEA 1CSNA 3RGFA 4GH2A 4C02A 3TUCA 2VTSA 3SLSA 4Q9SA 2ETMA 1WFCA 2YIXA 3SOCA 2J50A 4EH9A 4EOSA 3U54A 2Z60A 1OL6A 2C6OA 3PE1A 2BAQA 1YXUA 5KKRC 4BZDA 4X0MA 3AMAA 5G1XA 2CGWA 4ACGA 1ZAOA 4IH8A 1ZZ2A 3JVSA 3NNWA 3ZOSA 5IA4A 3TUBA 3Q5IA 3CBLA 3P0MA 4IEBA 3N4VA 1Q8WA 3NZ0A 5I9ZA 2CLXA 3K5VA 2BDFA 4ZY6A 4S33A 4FV8A 4JAIA 4V01A 3WE8A 2YAAA 4NTSA 4BZOA 5FRIA 4W4YA 2W1EA 2JKOA 3UVQA 3R6XA 4YNEA 2OXYA 3AT2A 1UU9A 1J1CA 4DYMA 5EKNA 1FINA 1HCLA 2P55A 2UZBA 3I7CA 3N4TA 4O21A 3DZQA 3MPMA 4E7WA 3MN3A 5E8WA 4F99A 2JBOA 3DLZA 4I4FA 2BDJA 3HKOA 4WG4A 1ATPE 4DEBA 5JFSA 3PRIA 5LOHA 4FBXA 4UWBA 2ITVA 3Q4ZA 4RJ4A 4C8BA 3FYJX 2GFSA 5IUHA 3UOHA 4FOBA 4AE9A 2VGPA 4D4VA 5EDPA 3R9NA 3RPRA 4D1ZA 2C68A 5CVFA 2W0JA 4HJOA 4WKQA 2GNIA 3MVJA 4AZTA 4O27B 4RJ6A 4WG3A 3KN6A 5ANKA 4AW5A 1WBTA 2XYUA 2JD5A 3PFQA 2XCHA 4DTAA 4GU6A 4GK2A 4OT5A 3C4CA 2IZSA 1ND4A 4A9SA 3KF4A 1NVRA 2WTCA 4MBJA 1A9UA 1SNXA 2GFCA 3D9VA 2BUJA 2QOIA 3IK3A 4PL5A 1F3MC 1H25A 4L6QA 1AD5A 4ZS4A 2FO0A 2C3LA 4JG7A 4YJQA 4ZTSA 3TKIA 3PVGA 3RALA 1U4DA 4BYIA 3SVVA 2WXVA 1WVXA 3CJGA 4QTCA 4RWKA 4D2PA 4RIYA 5IH6A 1FQ1B 3O96A 4M12A 5B2KA 4C57A 5E1EA 4EORA 3W18A 2H6DA 3QZIA 3NCGA 1BKXA 5HEZA 3UZTA 5FXQA 4FYNA 4G1WA 3R2YA 4CYIA 3WF7A 5HTIA 4Y46A 1Q8YA 2XCKA 1OPKA 4ZMEA 5E8VA 2AUHA 1J7IA 3P7CA 4K8AA 2FH9A 5BMSA 2F49A 2UUEA 1OL1A 4DGMA 3LCTA 4MXOA 3LCKA 4L8MA 5KUPA 3QTWA 5L8JA 3QTZA 2Y6OA 2WQMA 3POZA 2PL0A 2Z2WA 4BDAA 3I5ZA 1YHVA 4BDKA 2EXCX 3MS9A 4CD0A 2VV9A 2Y4IB 4UV0A 4WIHA 4U6RA 2XF0A 4MH7A 5HNGA 3R7YA 4BI1A 1O9UA 3PWYA 1TVOA 5M56A 4S31A 5T68A 1M7NA 1GY3A 2IVTA 2HZ4A 4WOVA 1ZARA 4CMOA 1JKTA 4N0SA 2FYSA 2OIQA 3R1QA 5E92A 1STCE 3DBDA 3UOLA 4EHVA 5H8EA 4IWQA 3TN8A 2QVSE 2HXQA 2R0UA 3BE2A 3LQ8A 3QQHA 4FIHA 4G6NA 4IZYA 5HGIA 3QA0A 3DCVA 5AUWA 1OL2A 5KCVA 5HLPA 2EB2A 2WB8A 1OECA 2W9ZB 1CDKA 1GZKA 2QOLA 2XK3A 2R7BA 4RQVA 5ACBC 2QOFA 2R3OA 3RM7A 2YHVA 4C38A 1VZOA 4RVTA 5IH4A 3VUHA 3C4FA 4FKGA 3QZFA 3KN5A 3KY2A 1CKJA 4AT4A 4PMPA 4DE4A 1NA7A 4B0GA 5IQHA 5FTGA 4RJ5A 3MH2A 4B8LA 2QU5A 4EZ5A 3A7IA 5IA5A 3LIJA 3QTSA 3RBWA 1OPJA 1H08A 4DEDA 3IOKA 3KB7A 3UZPA 5HE3A 4EBVA 5E8ZA 3QX4A 5AP4A 1H0VA 4JX7A 3SW4A 4YSMA 4OTPA 1H4LA 3PJ2A 2JFLA 4WNKA 3H0YA 5HE2A 3NYNA 3L8VA 4IM3A 1H1SA 4AN2A 4D5HA 2UW7A 3MDYA 3F3TA 4GUBA 3BHYA 4H3QA 1Q24A 4H3BA 1YDRE 4I5MA 3B8RA 2JGZA 4X6QC 5TKDA 3PVUA 3NIZA 5DH3A 3JR1A 1LP4A 1ZMVA 1X8BA 5CEQA 5EYKA 4FVPA 2BROA 4X2FA 3UYSA 3FHIA 3ORTA 2XYNA 4JOAA 4LUEA 1LEZA 1WVYA 3WZKA 4U44A 3FMHA 4I21A 4FTAA 1CMKE 5K4IA 4O1OA 5A4TA 5EKOA 3E5AA 3FMMA 4RIOA 4OGRA 5CQUA 2VUWA 4IJPA 3TV7A 3KXHA 3KXXA 3A60A 3QGWA 5IF1A 2W17A 3KRWA 4OUCA 5A4CA 5DN3A 4XRJA 5BX0A 3Q96A 5J7BA 4O7YA 4QRCA 1QPDA 2IW9A 2R3GA 2IN6A 2IVUA 3FLYA 2VU3A 3LFQA 5JZNA 4BIBA 3DU8A 2VTRA 3VS7A 4IX3A 4E1ZA 2F7XE 5CF4A 5E8TA 2R3IA 3HECA 2GQGA 5CU6A 5CF8A 3QL8A 4L53A 2F9GA 4KWPA 4ASXA 5IU2A 4YBKA 1H24A 4L7SA 5M53A 2RFSA 4XG3A 2WU6A 3HMIA 3UVPA 4QQTA 2C47A 3ZXZA 2WZJA 1Q8UA 1LPUA 4PTEA 5CSWA 5A3XA 2W5AA 2CN5A 4CQEA 3Q9WA 4IM0A 2BRMA 4K18A 2BDWA 5DE2A 5AR5A 2UW9A 3PUPA 5AP7A 3BWFA 2QOBA 4HCVA 3TTIA 4AZWA 4NJ3A 2BAKA 2FA2A 3QLFA 3EYGA 1JKSA 4HGTA 1IA8A 2GCDA 4FG8A 4HNFA 3I0QA 5AP6A 5FXSA 4F1MA 3U4WA 3QWKA 3QQLA 5IUIA 4BZNA 2IZTA 3QU0A 4HOKA 4GVJA 1YVJA 1XH7A 3LVPA 5HIBA 2YIQA 3PJCA 2F4JA 4AT5A 4E8AA 4JRNA 2NNWB 3C9WA 3DJ7A 3LJ0A 3R0TA 1YOLA 2ITQA 3E7VA 5BVFA 1QPJA 4EOOA 3WILA 3EQFA 2PUNA 2GNHA 1P5EA 3FMDA 3TJCA 4HVHA 3NS9A 4RIWB 2JLDA 3GI3A 4ZSEA 3WOWA 1XH9A 3BPRA 2P2HA 4BDDA 4CYJA 3PWDA 4LI5A 2GQRA 4IAKA 3G5DA 2B9IA 4R8QA 4D2RA 3A62A 2JIUA 4XG6A 3DBCA 4Q5HA 3R83A 4AWIA 1ZZLA 5TF9A 4UXLA 2X6DA 4ZOGA 4AFEA 1WZYA 2HENA 3VBVA 1PMVA 3IDBA 3WF9A 3R04A 3EN6A 2QG7A 3QD3A 1L8TA 3KMMA 3NVMB 4YTFA 3GP0A 2LGCA 2WMAA 4PNIA 5L2IA 3VULA 5AUYA 4LG4A 3PSDA 4JQ8A 4Q2AA 3O8TA 3HV3A 3DXQA 5EI6A 4AGDA 5CI7A 3VO3A 2UW4A 3QXPA 4AA0A 4D2SA 2W1HA 4RVKA 3CJFA 2H9VA 4ERWA 4ERKA 5M06A 3HVCA 4XG2A 4DF3A 4DTKA 3VWAA 5DNRA 4QYHA 1V0BA 5HU3A 4QTBA 3GUBA 4R1YA 4FTLA 3E93A 3UNJA 4EJ7A 2GS7A 5HZNA 2X7OA 5JGDA 2GNFA 5AR7A 3TZ9A 5TR6A 3LXNA 5CNOA 2Q0NA 5M4UA 4MNFA 4UWCA 4QPSA 4PP7A 1V0OA 1WBVA 3DTWA 4UN0C 4Y95A 3MW1A 2W7XA 4QMVA 5IISA 4KIPA 4MXZA 3N9XA 2X7GA 5JFWA 2QLQA 2HCKA 2YM7A 3RJCA 2ZVAA 1PF8A 3ET7A 4FZDB 2YA9A 4JIAA 4O6LA 2I40A 5JQ5A 2I1MA 1JQHA 3BYUA 1L3RE 2QURA 2XK6A 4E6QA 4RQKA 2W1CA 4I1ZA 4NSTA 1KV2A 3P79A 5A4LA 5C8MA 4UYNA 4M8TA 2OJGA 2VZ6A 2X1NA 3GGFA 3KMUA 4ASDA 3NIEA 3UJGA 4JRVA 4O0YA 3OTUA 4AZEA 2QOOA 5CANA 3FMEA 4X2JA 3ZFXA 4CCUA 2J6MA 2OK1A 2ERKA 2VO3A 2CCHA 2XKDA 1OKVA 4F7LA 3BKBA 4BBFA 4O38A 3EL8A 1M52A 3U9NA 4BGGA 2B0QA 4C4GA 4LMNA 3MI9A 5EH0A 4IVDA 3UNZA 2OJJA 4UMTA 5EM5A 4D2TA 3A4OX 4I0RA 3ZLSA 4E20A 5FUTA 4YUQA 1E9HA 3FMNA 4BTMA 4GJ3A 4QP2A 3EQPA 1ZYDA 4E5WA 1ZMUA 3BWJA 1GJOA 1KOBA 3OWJA 1Z9XA 4FV7A 4U40A 3EZVA 4YTCA 1U46A 2ITPA 3EQIA 1BL6A 3HP2A 4U81A 2WQOA 4G34A 5BMMA 2CCIA 3L9NA 3QHRA 4YZBA 5ACKA 4O22A 4FNYA 1OL7A 4IACA 2OXXA 4FTMA 3QRIA 5DLSA 5DVRA 1XWSA 2WMWA 3HRCA 1QPEA 4IQ6A 1Q97A 3VS5A 3BCEA 2O3PA 3L8PA 4F6UA 5KHWA 2BZHB 3V51A 2EXEA 4V04A 4IZ5A 3PG3A 4GVAA 4YJUA 4IVBA 4TZRA 4U7ZA 2LAVA 4MXAA 3RAKA 4IADA 1W84A 4AFJA 3VUMA 2Z8CA 3RTPA 5CAUA 3HMMA 4L68A 2XK7A 4BCMA 4CCBA 4MNEA 3V6RA 4APCA 4D0XA 3FEGA 3RCDA 3NLBA 3U6IA 4K6ZA 2YM6A 4ACHA 2R3QA 3WYYA 1OKYA 5D7VA 3FL5A 1DAYA 5C9CA 4DINA 2W1IA 5HORA 3ZYAA 3D5VA 2ITWA 3AC4A 3NR9A 1OGUA 1XQZA 1MRVA 4PTGA 3RWPA 4A4XA 2IG7A 3KA0A 2GS2A 1YDTE 3BIZA 4FG7A 4IB3A 5E90A 3A7HA 1MQBA 4AGWA 2RF9A 4DGOA 4FEXA 2ETRA 2QONA 3LXLA 4JI9A 5A4QA 5JGBA 3C7QA 4I24A 5LCJA 3SW7A 2C5YA 4I20A 3BHHA 3R28A 4DH1A 1SYKA 4FG9A 3BGQA 4F9CA 3HZTA 5A46A 2C1BA 4EH6A 3DXPA 4JVGA 1R0EA 3CS9A 2XK8A 3BBWA 3NYOA 4I5CA 3OEZA 3S00A 4Z55A 3RNYA 4LUDA 2OI4X 1YDSE 4XLIA 4WD5A 2C69A 3TZ8A 3UO4A 3QYWA 4I41A 4ANQA 3BLRA 3AD6A 3ODZX 3PLSA 2GPHA 4QTAA 3F9NA 3QCYA 5GHVA 4BCPA 4PDYA 1PXIA 2X9EA 3HA8A 1IA9A 4FK6A 3PPJA 3VS1A 5KZIA 3R01A 1GZNA 4HCTA 4C2WA 5K9IA 3E7OA 1FBNA 3NMUF 4W8EA 5FDPA 3FI8A 3CD8A 4BHZA 4AW1A 5EDRA 3ACKA 2RL5A 2EU9A 5IQBA 4CV8A 4ZP5A 1UWJA 4D5KA 3FYKX 4F0GA 4EYJA 3L9PA 2WD1A 3KRLA 5KMNA 2XNMA 3W33A 3P7BA 4J98A 2WQEA 4E6CA 3NAXA 4UMRA 5ITAA 2AYPA 3DB6A 5D7AA 1UKHA 3E3PA 4TYIA 3VW8A 3DQWA 4H1MA 5C03A 4E6DA 3LE6A 2IW8A 3DBQA 5HO8A 4UX9A 4NM0A 4KB8A 2QOCA 2C1AA 4IWDA 3PLAE 3MFUA 4Y83A 3OTVA 4NJDA 4QP1A 2VTTA 3OY1A 5CQWA 3M11A 4FT9A 4P5ZA 5E8YA 2XRWA 4ZTHA 2XS0A 4XS2A 3MV5A 1JOWB 3LCDA 3O17A 3LLTA 4EH2A 2C6LA 4XMOA 4Z3VA 2C3IB 3CLYA 3T8OA 2YISA 3H4JA 2PUUA 4FIGA 1XH5A 5CF6A 3QD2B 3RAIA 2X4ZA 4RX9A 4F08A 3KF7A 3VRZA 2Q0BA 2G9XA 1M14A 2F7EE 3F5GA 1WBPA 1OM1A 3FLQA 3QTXA 4HNIA 4IAIA 3CPBA 3UC3A 2HIWA 2OKRA 4FTUA 4H39A 3KK9A 4DEAA 1SVHA 3QTIA 1B6CB 4WBOA 3II5A 5M4CA 2CMWA 4ITHA 4O7ZA 3SXRA 3CD3A 3PP0A 2PVHA 4BDGA 5H8GA 2PVNA 4BDCA 3MGYA 3CTQA 2OF4A 3R1SA 5IDNA 3Q9ZA 1BL7A 1VYZA 3Q3BA 4ZS0A 3G51A 3D2IA 3ETAA 2PHKA 4L3LA 5E1SA 4FEQA 3AT4A 2P4IA 3BYVA 3EYHA 3Q60A 4O0XA 2GMXA 5F9EA 2YM4A 4X7QA 3UZRA 4ZZMA 3FPQA 2B1PA 4JL9A 4EONA 5IPJA 2BPMA 4XG9A 3RZFA 5AAGA 3UOJA 1H1QA 3C51A 3MWUA 5FM3A 1E1XA 3VUDA 2YFXA 4EOIA 3U4UA 1YXSA 1ERKA 2OIDA 2PZIA 3V5JA 3ELJA 3FJQE 4CG8A 4EQMA 4C0TA 2J2IB 2JC6A 4O1PA 3PXZA 3ZZEA 5F1ZA 3EFJA 3VS6A 4F1OA 2VTHA 5FTOA 4XBRA 2BAJA 3VIDA 3ATSA 3Q2JA 2CNQA 2WTKC 2BHEA 1P14A 2WTWA 1V1KA 1OZ1A 2JKQA 3FUPA 3NW6A 4G3DA 4X2KA 3PXYA 5D10A 3KRRA 1Q41A 4NM7A 5HOAA 2J5EA 3WZJA 3FZPA 2W4OA 4K2RA 4D4RA 4RWIA 4HVDA 4G3EA 3F5PA 4RWLA 3FI4A 4K0YA 3V5TA 4RIXB 3VVHA 5J9LA 5I3OA 1XH8A 3F88A 3G6GA 4D9TA 2QR8A 2UVZA 3FKLA 2C5OA 2XBJA 4FMQA 3ZLWA 4UMUA 1OIYA 4FEVA 2BZIB 3LFNA 3I4BA 4YC6A 4C35A 4J71A 3HDNA 3AD5A 3TG1A 2CGXA 3V6SA 3QRTA 2GNJA 3OZ6A 4OBQA 4QP6A 3WIKA 4XBUA 4BKJA 2ZM4A 4ARKA 2ITUA 4MQ1A 1UU8A 3G0FA 3P08A 3G15A 3MY1A 3G90X 3EN4A 3NAYA 3F2NA 4GW8A 4J1RA 3NUUA 4TWCA 3SRVB 1TQIA 3UC4A 2X8DA 4F4PA 3RZBA 4ZY5A 3FLZA 5IMXA 4O6EA 4PPCA 4BIEA 5GIPE 4E73A 3UMWA 4AW2A 3VHKA 1ZOEA 3SGCA 2OXDA 2GHGA 2PVRA 2OJFE 1PKDA 2PVMA 3OC1A 5CS6A 2O5KA 4FNXA 3WYXA 2V5QA 5J9ZA 1G5SA 4MCVA 4BGQA 4HVIA 4QP3A 3PIXA 3TI1A 2BFXA 4FKTA 4PQNA 1URWA 3DFAA 5EW8A 1IRKA 3WZUA 3HAVA 3FY2A 3QXOA 4R6VA 1KE6A 1BX6A 4IMYA 5L2TA 1FPUA 4YTIA 2WNTA 2OH4A 3HMOA 3Q6WA 3MVLA 2P2IA 3N51A 3UODA 3JY0A 4YTHA 5DI1A 4K77A 2YWVA 4CFFA 2X81A 4JR3A 2WFYA 4LOQA 1U54A 4NTTA 1I44A 3V5PA 3QA8A 3BLHA 4ZEGA 3ZUTA 1IR3A 4TKSA 4M0YA 4GMYA 4O0VA 2C6TA 3LLAA 2VTIA 2XIRA 3GC8A 2W1DA 2NP8A 3PSCA 3TTJA 4IWOA 4YSJA 5I0BA 5EOBA 2H8HA 2Y4PA 2ONLC 4B9DA 4M14A 4YJNA 4G3FA 1Q3WA 1A06A 4RMZA 2RG5A 3SXFA 2UZEA 4D55A 2F57A 2XEZA 3SX9A 4GFGA 3I81A 2O0UA 1QL6A 3QD4A 5A6OA 3HEGA 3AMBA 4W4WA 4IC8A 2IZRA 1G8SA 1IEPA 3BHUA 3EN5A 4AS0A 4BR3A 2Y9QA 1REJA 3QFVA 4PDSA 1Z57A 4YU2A 1PXMA 1XBAA 2HW6A 3DKOA 3F6XA 2V55A 4XNEA 4F7JA 5LVMA 2XUUA 4LQMA 3OWLA 4DG3E 2DUVA 3B2WA 4D2WA 3FSFA 3MFTA 3SAYA 4WBBB 5LVNA 4QMNA 5AAEA 4N6ZA 3FBVA 4RZVA 4U79A 1PW2A 4U97A 2R3RA 2XNOA 5J95A 3C0HA 3COHA 4PNKA 3ZSIA 5H8BA 1B38A 4FTTA 4RBLA 4EQCA 4DGGA 5DWRA 3JPVA 2XA4A 3QTQA 4I6HA 3UDBA 5LCKA 3PXRA 3QCSA 4MVFA 5CEMA 5M57A 2YIYA 4YHTA 1H28A 4USEA 4KSPA 5M4FA 3HNGA 3BYMA 1QPCA 2WTDA 3OP5A 3PY1A 4PX6A 4C36A 4FTQA 4TTHB 4EHGA 4FC0A 4FUXA 1MP8A 4ACCA 2OWBA 3QQJA 4D58A 4ZXTA 3QQFA 4QP9A 4XUFA 3R73A 5J9YA 2B9FA 4FGRA 5AJQA 1KWPA 3VRYA 4CXAA 5AUUA 4JXFA 3ANRA 5B2LA 5G6VA 3PJ3A 2VNWA 3M42A 4FT5A 5EM7A 1XBBA 4FSMA 4WG5A 3LFAA 3D15A 3CKWA 3F7WA 3BRBA 4JBQA 5CSXA 3D2KA 5DG5A 4FTNA 4M68A 3AXWA 2HZNA 1CM8A 5ETIA 5C1QB 4DA5A 3AC1A 3GEQA 3W2QA 2CGVA 3E3BX 4IDTA 3GC0A 3ZCLA 3IO7A 2ZDUA 4B99A 3TV4A 3D7TB 1KV1A 3BU6A 4F0FA 3I6WA 4FVRA 3GC7A 4YMJA 1WCCA 3ALNA 3F5XA 4X2NA 4BVUA 2VWYA 1YI4A 3MTLA 1MQ4A 1BUHA 4JJRA 4A9YA 4QMPA 4XX9A 1OMWA 1OITA 4GJ2A 5K3YA 3V5WA 1Q3DA 2PVYA 2RFDA 3CY2A 3R00A 4LV8A 4QYGA 1KE9A 2I0VA 5HO6A 3UG2A 2I0YA 2UZNA 2OLCA 5JZJA 2GU8A 1G3NA 3HV4A 2XIKA 4U0IA 3E8CA 5CSVA 3BZ3A 4D1SA 4P4CA 3SDJA 3R9DA 3QQUA 2E2BA 2YDIA 2CNVA 2PK9A 4GG7A 4DFUA 2C5NA 5EW9A 5LMAA 4YJPA 4ID7A 1SM2A 1Q8ZA 5M07A 4I6QA 5EFQA 2J0IA 3HDMA 2OG8A 4R5YA 4ZTLA 4AOIA 4A07A 1UNGA 3T9IA 2NO3A 5JSMA 4OAVB 3PP1A 1K3AA 3UP2A 4F6SA 4NM5A 3CP9A 4AGUA 1UU7A 5DPVA 4EK4A 4FSTA 4BDBA 3OBJA 4QMMA 5CTPA 2VTLA 1MUOA 3E64A 5CU4A 3ZFYA 3ZZWA 3FQSA 2QODA 4RFMA 4FKPA 5ANEA 4AW0A 3LAUA
chains in the Genus database with same CATH superfamily
4FTOA 4PTCA 3ZBXA 3M2WA 5JRQA 3FXWA 1ZOGA 5IQAA 4YURA 1RDQE 4FV0A 3OCTA 1ST0A 3F61A 4O7SA 5CWZA 4L9IA 4X3FC 4IB0A 4G17A 3TDWA 1GIJA 4BIDA 4Q9ZA 4IAZA 3H9FA 1JVPP 4FKJA 4U45A 1H07A 5CU0A 3ORIA 5ETAA 4EC8A 1T45A 5EI8A 1TFFA 2XMYA 4YO6A 3QWJA 4P2KA 4FV1A 4RX7A 4C3PA 3LFFA 3Q53A 3HV7A 5GINE 4D2VA 2WGJA 4PPAA 2XM8A 4MXXA 4KKEA 2W06A 4HZSA 4DFLA 4BKZA 3NUAA 3BV2A 1U5RA 2YERA 2VTJA 2EB3A 3GC9A 3F7ZA 3LKMA 4OTWA 2QOQA 3H9RA 4F65A 3QC4A 3VUIA 2WMVA 2ITZA 2R5TA 1XH4A 3HL7A 5AR3A 2C5VA 3AGLA 4L45A 3CCNA 4MHAA 4J8NA 4AU8A 3UQGA 2V7OA 2IZUA 2HELA 4FT3A 5AV3A 5F20A 5J5TA 3O7LB 5J1VA 2ERZE 4DH3A 1WAKA 3WARA 4E4MA 4MXYA 3HLLA 3AKLA 4E26A 2ESMA 2PVLA 4YNOA 4CRSA 1ZLTA 3ACJA 3DAEA 2VO7A 3NGAA 4HGEA 5H3QA 2Z02A 5M44A 3JVRA 3RVGA 4FKUA 2RKUA 3QF9A 4ANSA 4TL0A 5HCYA 1FVVA 5CI6A 3ORMA 3ML1A 4KUJA 3V5LA 4MKCA 3IDCA 4LV5A 2R64A 4XOZA 3BELA 3TV6A 3MA3A 4QD6A 5ICPA 2JDTA 1NXKA 5FM2A 5AAFA 3U9CA 5K4JA 1OI9A 2UV2A 5CAOA 4BCIA 1PXPA 4FV5A 3A99A 5FEQA 3DGKA 3KEXA 4FIIA 4ZTQA 2XM9A 3BHVA 2UZOA 4RX8A 1W8CA 4RIXA 3WF8A 3A8WA 3EZRA 3OUKA 3CQUA 4NCTA 3EQCA 3GFWA 1DAWA 3JYAA 3LZBA 4XH6A 5C01A 4J99A 4FV9A 4EK5A 2BILB 4FKQA 3DV3A 3ERKA 3VF9A 5BVDA 5A14A 2OZOA 4OTGA 5DRBA 2JAMA 4DGNA 5LVOA 4GKIA 5IEVA 1Q4LA 2PMNX 4WHZA 3GCUA 1Y6BA 5JEBA 2PMIA 4NK9A 4BCQA 4ZZNA 4AX8A 2ZB1A 1YHSA 3GT8A 4ZSJA 3ORLA 4IAYA 5HCXA 4ZIMA 3C50A 2DQ7X 3W1FA 3ZSGA 3UPZA 5I9VA 3AG9A 3SRVA 4J53A 5HQ0A 2PSQA 3RK9A 1ZYLA 2R9SA 4NT4A 5AP3A 4BDEA 5IEXA 4MAOA 3DK3A 1K2PA 4S32A 5JMSA 4BTKA 1M2PA 4Y5QA 3UIUA 4M0ZA 2GS6A 3RM6A 4Y5HA 3BQRA 3QALE 4BL1A 4W9WA 5AP1A 4FNZA 4XP3A 4C7TA 4I5HA 4ZY4A 5FD2A 4YLKA 5HTBA 4R3PA 3AQVA 3E8DA 4IHPA 4LYNA 5CLPA 5LQFA 3EQRA 4IVAA 4C34A 2PZYA 3EHAA 3FQHA 5FBOA 3ZH8A 4FKWA 1Q61A 1TQPA 4G3GA 3RAHA 2WMRA 5HU9A 2HYYA 3LFBA 4FSRA 4UB7A 5CASA 1G8AA 3MIYA 3DB8A 3OHTA 3QUDA 3C0GA 5DR2A 3ZC5A 4A4OA 1XO2B 2BRHA 5I9XA 5LVLA 4FODA 5BVKA 2G2IA 3V01A 3RMFA 3HMPA 5GZ8A 4F70A 3UP7A 2XH5A 3CGOA 5BVEA 2IVSA 5L3AA 4G31A 4AA4A 2QOKA 2BRBA 1Q8TA 2JFMA 3R7IA 4Y73A 3DPKA 3E8EA 4QOXA 3KXZA 4U43A 4OT6A 2VTMA 5EYCA 5FWKK 3TACA 4YZNA 3TM0A 3VAPA 4QP7A 4ZLYA 4OTQA 3NYVA 3FZTA 3GU7A 3OFMA 1M17A 3QRUA 3O2MA 5D9HA 1WBWA 1J1BA 4A4LA 3GCSA 2HAKA 3QKLA 4QP4A 5AR2A 3ZEPA 4EOLA 3U6JA 4F7NA 2XJ1A 3SA0A 3TMOA 3OEFX 2PMLX 2PWLA 3AMYA 2VNYA 4HYUA 4QMQA 5F94A 1JKKA 3TWJA 3ZONA 1OBGA 4E93A 5AR4A 2Z7LA 3W2PA 5TO8A 3VBWA 2J5FA 5DOSA 4I92A 2XJ0A 4XLVA 4WRGA 3LFSA 1PXOA 1H1WA 4WSQA 5HBJA 3TZMA 4KKHA 1KE5A 3IDPA 4EQUA 1CKPA 2J0JA 4O7TA 4I6BA 1YW2A 4YHJA 5HG8A 5EQYA 5C26A 3FY0A 4R77A 2DYLA 3C13A 3R02A 4L67A 4NIFA 5I9UA 2C3JA 1JSTA 4WSYA 2WMQA 5HVJA 3NDMA 3P5JC 4DHIB 4ZTRA 1K9AA 3NUSA 3R8UA 3WZDA 5LJJA 4BN1A 2UVXA 2YWPA 3E63A 3OCGA 4EI4A 3OG7A 2OO8X 4LRJA 4R3RA 3ULIA 4F0IA 4FE2A 3LCSA 3ZRMA 5HBEA 2WTVA 3IW6A 4TWPA 5EQPA 3C5UA 1W98A 2WKMA 5CF5A 3DNDA 2YN8A 3D5UA 3VUGA 4JNWA 3SHEA 3ORNA 3PRFA 4OTRA 3NW5A 5CENA 3W2CA 1YRPA 4KKGA 4LMUA 3FDNA 4JIKA 3MVHA 3TIYA 2RSVA 3OCSA 3KL8A 1AGWA 1WBSA 3OOMA 4P7EA 5AIRA 1ZWSA 2E9PA 3WE4A 4EWQA 4W4VA 2VAGA 4DCEA 3MB7A 3BL9A 3GXLA 4OR5A 5FGKA 3VJOA 4BJJA 3GVUA 2PVKA 1IAHA 4RSSA 3MH1A 4FKVA 4FKOA 5E7RA 3FKOA 5JH6A 5E9EA 3VUKA 3Q6UA 4M69B 2EUFB 4BTFA 3OY3A 3TNWA 4CKRA 4A9TA 3RWQA 1AQ1A 5HI2A 4BDIA 1YXVA 3RKBA 2FSOX 5L2SA 3GU4A 4M3QA 3DBFA 4I94A 4CTCA 4ZJIA 5AV1A 4RPVA 4ANBA 2ZYBA 2KULA 4M7IA 1JPAA 2QR7A 3VHEA 5CT0A 3BBTB 5JKGA 2C0OA 1SMHA 2CKPA 2HY0A 5I9WA 2B54A 2Y6MA 5BVWA 3IG7A 4A9UA 3GBZA 5KE0A 3U51A 4D1XA 4P5QA 2YJRA 3PXFA 2GTMA 4M66A 4V0GB 5ANDA 4DG0E 3DXNA 5E8UA 5ETFA 4BCJA 4QMUA 3HUCA 1QCFA 3BI6A 5J79A 3Q4TA 3HP5A 4YR8A 4BI0A 4CT1A 3T9TA 4RRVA 4UWYA 1TQMA 4JDKA 3R63A 3V8TA 4EH7A 5BNJA 4HYIA 3I79A 4QMLA 2W4JA 4ZTMA 2YCSA 3IGOA 4IX5A 4HW7A 3MVMA 3HX4A 3FSKA 4ZSLA 4R1VA 3S1HA 3MSSA 4AXAA 2C0TA 4BI2A 3O0GA 2HK5A 2OF2A 3H30A 3PJ1A 4XJ0A 4WT6A 2C0IA 3WZEA 5T3QA 4BCNA 4F6WA 5BUEA 5HE1A 4C4FA 2OH0E 3COIA 3I0OA 5KHXA 4KS7A 4JBOA 3UBDA 5IQEA 2I0EA 3IGGA 5GJFA 1U59A 2WMSA 3KGAA 2XP2A 5J8IA 4I4EA 3KFAA 5HNIX 4KBKA 3P1AA 2XAOA 2BRNA 3C0IA 3KULB 4QYYA 3THBA 3W0PA 3PDTA 5EDQA 3FC1X 3PY3A 4BDJA 2O65A 3B8QA 3DJ5A 4L00A 1OPLA 4C62A 4EZ3A 4F64A 5K0XA 4PMMA 4KBCA 3SKCA 5AUTA 4GG5A 2Z7RA 4QQCA 3F3VA 5KBRA 4PL3A 3R8PA 3ZRLA 5JQ8A 2BVAA 4ALUA 1F0QA 2WIHA 2OSCA 4GFOA 4J97A 4LGDA 4O0UA 2NRYA 2UW6A 2J7TA 3VS0A 1DI9A 2HZIA 3DT1A 1OKZA 1OL5A 4L44A 1YXXA 3HA6A 3FLSA 2ACXA 1NVQA 3UQFA 1QMZA 4CFMA 4ENYA 4IM2A 2HWOA 5IKWA 3KCKA 4O0SA 5DEWA 5KBQA 2I0HA 4IX4A 3EQGA 2PE0A 4FJVA 4TWNA 5AX3A 5HNBA 3TKHA 4BWPA 3A7JA 4RC4A 4FZAB 3R1NA 2ZV9A 2ONLA 4JDHA 2ITNA 5AADA 4JQ7A 2C5XA 2XNGA 3R7GA 4FTRA 4L42A 3V3VA 2A2AA 1FGIA 4LL5A 3R8ZA 1HOWA 2OJIA 2VGOA 3G9NA 4YZDA 1Q62A 1WBNA 4BKYA 3MH3A 1PXLA 2A0CX 4NEUA 5T6KA 3TNIA 5L2QA 4CFXA 4ITJA 3SQQA 4IDVA 5L6PA 3ID6C 4MF1A 5LWMA 3QRKA 3QHWA 4L3PA 2PVJA 4RVLA 5J5SA 1PYEA 4WUAA 2ITTA 3CY3A 2R3KA 4GK4A 4BBMA 3VS3A 5K5XA 4O7VA 3FE3A 5GJGA 3R7OA 3S2PA 1UA2A 3TL8A 4FSNA 3EFKA 3C1XA 4G9CA 2J0KA 3KIOC 4MEDA 4S34A 2HWPA 4NW5A 2W4KA 3BE9A 2CPKE 3Q32A 3LW0A 4O84A 2V7AA 2O8YA 4UZHA 3B2TA 4EOPA 2JAVA 3H10A 4JLCA 1NW1A 2IJMA 2X39A 4RJ3A 4FEUA 2UZDA 4OAUC 4GS6A 4H3PA 3K3IA 3HV6A 2WTKB 2RGPA 3BGPA 4BICA 1F5QA 4L43A 5BYZA 4AN9A 3JUHA 4N6YA 4FZFB 3UIMA 2Y7JA 3I6UA 3P23A 4PF4A 3VS4A 4AN3A 4CLJA 4RA4A 4S2ZA 5AX9A 4AACA 1OUKA 2QLUA 3LM0A 3P5KA 4TRLA 3FXZA 4FI1A 4PMTA 5D41A 5IQIA 4DGLC 4L3JA 1YI3A 5AA8A 2B9HA 5J87A 4KINA 1ZY5A 4I5PA 4MF0A 5JRSA 4EK8A 4NFNA 2XRUA 4H1JA 2WEIA 5BV3A 1RW8A 4TN6A 4CSVA 3ZU7A 5EOLA 2X8EA 4ZLZA 4FA2A 5CVGA 1GNGA 4O0WA 4YO4A 2CSNA 3D7ZA 3QZHA 1W83A 3EFWA 4YJOA 4EH5A 5HIEA 4KRCA 3GQIA 2WEVA 3HV5A 2PZPA 1BYGA 4ALWA 2R3NA 5DIAA 4A9RA 1GOLA 1R1WA 3F3ZA 5IH5A 5J7HA 2XK9A 2YAKA 3HYHA 2B53A 4YZMA 5KMMA 3D14A 5EQEA 3KKVA 5HLNA 2VRXA 5CZIA 4O7RA 2O2UA 4UALA 3D94A 4GIHA 3ZHPC 3GU5A 5AV0A 3D7TA 4KBAA 3IPHA 2RIOA 3ROCA 4R5SA 4I6FA 3S0OA 3R7VA 2HW7A 3PVBA 5AP0A 3DFCB 2B52A 4ORKA 5CEKA 4B4LA 3GQLA 4TNDA 4DT8A 1TZDA 4K1BA 4ZSGA 5H2UA 3W0OA 2EVAA 3OCBA 3FL4A 3ORXA 2OJ9A 3OWPA 4U5JA 3DA6A 3UOKA 3BGZA 3QLGA 5EYDA 1R39A 1TKIA 3LXKA 1NT2A 3ZS5A 4KRDA 3MPAA 3PVWA 4KIKA 4RIWA 4TW9A 1J7UA 4FSQA 5AUZA 1GZOA 4HYHA 5DFPA 4LDTA 3A4PA 4R7IA 1M2QA 4RLKA 5DA3A 4QQJA 2WELA 4L01A 4E6AA 3O50A 3CR0A 4FF8A 2A98A 1XKKA 2F2UA 2HOGA 3E87A 2G2HA 3DDPA 4X3FA 5CZHA 3UYTA 4ZLOA 1RE8A 1EH4A 3ZO3A 4ZMFA 2R3LA 2VD5A 1S9JA 4W4XA 5CX9A 4EBWA 3OF0A 3ZUUA 3ZMMA 5HG5A 4YJSA 3IW5A 4QT1A 2JIVA 3EN9A 4FL3A 3QD0A 4BCKA 4DFNA 4WNPA 4EUTA 4RC2A 4USDA 5J1WA 4N57A 3KC3A 4DITA 2W5BA 2OU7A 3EQHA 4YHFA 3TNQB 2VX1A 3WBLA 4IFCA 2B55A 2R0IA 2X2MA 4PP9A 5CEOA 1Y91A 4QO9A 2JKMA 4CRLA 4PL4A 4MBLA 1Y8YA 4E5AX 2GQSA 1W7HA 2Q83A 1PKGA 1REKA 3E8NA 3V8SA 5E4HA 3MY0A 4XEYA 5HESA 4EK3A 2VX3A 5M09A 3GFEA 4MNEB 3RNIA 1JSVA 3OD6X 4C4JA 3KRJA 4LRKA 5B2MA 2WMTA 3QKKA 3BV3A 2G01A 1ZXEA 1KSWA 2J4ZA 4KS8A 3DQXA 5LWNA 4E3CA 4RT7A 4J95A 1PHKA 3OS3A 4CTBA 5CXZA 4HGSA 4J8MA 4D9UA 3MB6A 5IA2A 4II5A 5HHWA 3UMXA 4EOQA 1SNUA 3V04A 1UWHA 4JAJA 4M69A 4OBPA 4I3ZA 2QI8A 4CLIA 2VWUA 1XMMA 5CEIA 4I93A 3RAWA 4ANOA 2XIXA 3S3IA 5L4QA 3KXGA 2X0PA 2J0LA 5CU2A 4RFYA 4YPSA 3PA4A 3QUEA 5KO1A 4H05A 3IKAA 3SD0A 1YQJA 3K2LA 3JXWA 4DTBA 3RPYA 4HPTE 3QUPA 4HPUE 4E5BA 4ZSAA 5I4NA 4XP0A 4ANLA 4EWHA 3ZO1A 4B8MA 2ZV2A 1WMKA 2IO6A 2VWWA 2ZAZA 4QP8A 4UYAA 4BB4A 1XHAA 2PZ5A 4AA5A 4Y72A 2IPXA 4DDIA 3RPVA 4FT0A 3RHKA 4EUUA 4O86A 2WMUA 3W10A 4Y8DA 1J7LA 4APPA 1Y57A 3D5XA 3F69A 4GT4A 2XK4A 1MRUA 2H96A 4GRBA 4QYEA 4BCGA 4NIFB 1U5QA 1DM2A 4FK3A 4DG2E 5LXMA 1H26A 2GSFA 5M55A 2G15A 5IEYA 3F3UA 2WTJA 5KX8A 4DFZE 4KA3A 2XB7A 3FMJA 3PA5A 4XYFA 3KXMA 1P4FA 3G9LX 3MJ1A 3OW4A 4WUNA 4UMQA 3E92A 3Q4CA 1YOJA 2UZUE 3TUDA 4IWPA 3PXKA 4MD8E 4CV9A 4EKKA 4O83A 2QQ7A 3DS6A 2VWVA 4IC7A 4R3CA 3DJ6A 3RCJA 3I7BA 5A6NA 4QNAA 5CYIA 4MTAA 5LVPA 3KU2A 2X0GA 3PIYA 2JDRA 4NU1A 3CC6A 4XG8A 5AV2A 4RJ7A 3W55A 3QAME 5BUIA 2CKOA 4Z7HA 3F2AA 3QZGA 4PY1A 4ACMA 3LQ3A 5CSPA 3ATTA 2VX0A 3EIDA 3GCQA 4G2FA 1Y8GA 5HVYA 2GNGA 4HGLA 2VO6A 5L8LA 4RVMA 2ZB0A 4RWJA 5CSHA 2CKQA 4QDVA 1LR4A 5L2WA 3CQEA 5ANGA 2XARA 3EH9A 4EHZA 1XJDA 2UZWE 4RZWA 4RC3A 3FLWA 2X0OA 3I60A 4MBIA 2YDKA 4G5PA 5IA0A 3W2SA 2FSLX 2OZAB 1PXKA 5LMBA 1NY3A 3DDQA 2OFUA 5CAQA 5K0KA 4LM5A 3LFEA 2ITXA 4KABA 4PWNA 3W2OA 3C5IA 2I7QA 4TYHA 4L7FA 4DH5A 1CTPE 5HTCA 2BR1A 2C4GA 4XHKB 4ZZOA 4CKIA 2YZAA 2WMBA 4DCAA 2H34A 3CKXA 5CEPA 1W2DA 3BU3A 5ANJA 2VTNA 1SVGA 2VN9A 3O51A 3L8SA 1LUFA 3OXIA 2NRUA 5CY3A 3IS5A 4G3CA 4XCUA 4XV9A 3H3CA 4C4IA 3QBNA 3QQGA 3EB0A 2ZMCA 3PIZA 4FTCA 2YIWA 4AXCA 1CKIA 1PXJA 2E9VA 3LFDA 2Y4IC 4IIRA 3W2RA 4F09A 4TWOA 3TDVA 3TJDA 2DS1A 2R2PA 4QMWA 4DLJA 3T3VA 4C3RA 1ZY4A 4LL0A 4S30A 4V0GA 4C33A 2ZDTA 2J90A 4YJTA 1OVEA 2W1FA 2X4FA 1FMKA 4RG0A 4X6RA 3FMKA 4LGGA 5DGZA 4FEWA 4QMYA 2WMXA 1DS5A 3BYOA 1YOMA 2YEXA 3W0MA 4I0SA 4EL9A 2PE2A 4E4LA 4CG9A 3W0NA 4G6OA 2ZM1A 3TXOA 3ZM9A 1APME 4DDGA 1GAGA 1RJBA 4QTDA 4IB5A 4AGCA 1PXNA 4HZRA 3D4QA 4FTJA 2C6IA 3NSZA 1BI8A 2BRGA 2R3PA 3OXZA 4OTIA 4DH7A 2WOUA 1XMLA 2C6DA 3A2CA 3LJ1A 4H58A 3MBLA 3GENA 1UV5A 4OW8A 3EQDA 3IONA 4TT7A 5EHYA 4YLJA 3AC8A 5M51A 1VR2A 3VQUA 3UO5A 3PE2A 3TT0A 1I09A 5FDXA 5HG7A 5ANOA 2QC6A 2XNBA 4JBPA 4XV2A 4XV3A 5HBHA 3ZSHA 3ENHA 1ZYSA 3EWHA 3G0EA 4C59A 4ZJVA 3F2RA 4NUSA 2P0CA 3DTCA 2OZAA 1E1VA 3BLQA 4GEOA 5DT0A 3UDSA 4DH8A 2UW8A 4FVQA 2E9UA 2Y8OA 4QTEA 5BUJA 4DFBA 5K5NA 3EKNA 3IW7A 4DHZA 4DT9A 5M08A 3GOPA 4O82A 2PZRA 2WU7A 3ZDUA 4FICA 4NWMA 3KXNA 3VW6A 2CLQA 4WRSA 4AAAA 4BFMA 2QO2A 4DN5A 5KMOA 3VBXA 3D83A 3IQ7A 2PUIA 2A4LA 2EXMA 3R8LA 3SC1A 4C37A 3P7AA 3Q52A 4QMSA 1DI8A 2JDVA 3QYZA 3NWWA 3NUNA 4BCHA 5FXRA 2YM5A 2JIIA 2IWIA 3PTGA 2DWBA 4GL9A 4O4BB 1U54B 3R9HA 5AIKA 3HRFA 3L9MA 4FV3A 4Y85A 3G6HA 3V5QA 3ZEWA 2IW6A 4ACDA 5EHLA 4FL2A 4BC6A 4QPAA 5FG8A 4C58A 3UGCA 2ZV7A 4ZTNA 2YDJA 4PDOA 3MH0A 1YXTA 3FHRA 3NVKI 4IFGA 4H36A 3HMNA 2REIA 5H9BA 3FXXA 4N70A 3CPCA 4A7CA 4EJNA 3UNKA 2XNPA 2XEYA 1M7QA 1UNHA 5KKRB 1BLXA 2WQBA 3W0QA 3NYXA 1OUYA 5DT4A 2SRCA 4EOKA 1GIIA 3GNIB 3TZ7A 2YZLA 3MFRA 4GK3A 4AXEA 1YKRA 4M67A 2XIZA 1JBPE 2PULA 2RFEA 4U8ZA 5KMIA 2Z7QA 2FVDA 2QCSA 4DEEA 1FGKA 4CEGA 2QHMA 2YCFA 4GU9A 4NZWB 3UDTA 4D0WA 1P4OA 5CAPA 2W1GA 4EC9A 3D5WA 2YABA 5HG9A 5HKMA 2AEGA 4TYHB 4O7NA 2VWIA 4KIOA 1O6YA 1VLRA 1R3CA 2G1TA 1VEBA 1ZRZA 2XNEA 2ZM3A 3FV8A 3R71A 4EH4A 2BKKA 2A19B 1YWRA 3C4WA 3DOGA 4TPTA 5AR8A 4XOYA 5A54A 2NPQA 2B4SB 2BKZA 2JBPA 3FC2A 3ZLXA 3ZLYA 1JSUA 3MTFA 4DEHA 3PUFC 4YLLA 5BQ0A 1H0WA 3PPZA 5L6OA 2FB8A 3ITZA 5CAVA 3GOKA 1PYXA 2BTRA 3EFLA 4U3YA 2R4BA 3VBYA 4FKLA 2VO0A 2VTQA 3R22A 3VF8A 4GYIA 3WF5A 3TKUA 3DAKA 4IX6A 4U80A 3QKMA 4JMQA 1H8FA 2O63A 3H0ZA 1JNKA 2RG6A 2ITYA 3FZSA 3F82A 3IECA 4IXPA 4UEUA 5D1JA 4QMTA 4F9AA 3Q5ZA 3LPBA 4FL1A 4W8DA 1A48A 5C4KA 4QPMA 2W9FB 1GZ8A 5LARA 4CFVA 4M13A 3QX2A 2PPQA 3NNXA 3QRJA 5HVKA 5TT7A 1OIUA 1PMUA 2WHBA 2ITOA 3PY0A 1WBOA 1R0PA 4OTFA 2XJ2A 3PXQA 4FKIA 3RINA 5TE0A 4FIJA 4DBNA 2VWXA 1T46A 3FLNC 3KMWA 3BYSA 3LMGA 4FYOA 4LRMA 2JEDA 4FSZA 4P90A 5FTQA 5GZAA 4PMSA 4R7HA 4YJVA 2R3JA 3C4ZA 3OT3A 4JG8A 4RA5A 3ZBFA 5AM6A 4AUAA 3DK7A 5FQDC 1SVEA 1W2FA 2R3FA 3QTRA 5AMNA 1PJKA 5HX6A 3JS2A 3OMVA 5HLWA 2FGIA 4NW6A 4ASEA 2XAMA 2B9JA 3AT3A 4HCUA 4LOPA 3G33A 1H1PA 5E8XA 5EM8A 1YWVA 3WI6A 3MESA 3NW7A 2IVVA 2UW5A 4FOCA 4CFWA 5IDPA 3KCFA 3PPKA 4JDJA 2BHHA 3NEWA 5ANIA 1KUTA 5IZFA 2CN8A 2BIYA 4WA9A 1BI7A 4G6LA 4JS8A 4OTDA 2XBAA 5AUXA 4BHNA 2XKCA 2UW0A 3AC3A 4PDPA 4F9BA 2QO9A 5CVHA 3EMGA 4GFMA 4KNBA 4G5JA 4X21A 5CU3A 3Q2MA 2Z7SA 5AEPA 3FAAA 3ORZA 5KZ0A 4FTIA 3ZC6A 3W32A 3BX5A 2BMCA 4BCFA 4ANNA 4ANMA 4EOJA 1P2AA 2PMOX 1H1RA 3LMIA 2YM3A 3NUPA 3O8UA 3PSBA 2JDOA 3IW8A 3FZOA 2OW3A 2BZKB 5F4NA 3ZFMA 2VTOA 4CT2A 4NFMA 4CQGA 3R2BA 3RHXA 1FOTA 2YM8A 4BBEA 3L9LA 4CZYB 2C6MA 5KMKA 4WNMA 5DHJA 1KE8A 4NYEA 4JQEA 2F2CB 3FI3A 4QNYA 3ZO2A 4Z7GA 3HUBA 1UKIA 1H00A 4RJ8A 5GZ9A 3S4QA 2UVYA 3KRXA 3ORPA 2WAJA 4HVGA 4MWIA 4IW0A 2PTKA 5KMLA 4FTKA 4FR4A 4WNOA 5JFXA 3ZO4A 2OFVA 3Q4UA 3Q9XA 3U6HA 5AFVA 2A1AB 4U41A 4AT3A 2HXLA 3P78A 4EZ7A 1PMEA 5DEYA 2X7FA 4XG7A 4O2PA 4CFUA 3MPTA 3R8VA 4F1TA 2ZOQA 3SG8A 3LOKA 4EKLA 3QCQA 3AC2A 5JN2A 2V22A 5FEEA 2W1ZA 3CXWA 2YLFA 3C4EA 2BTSA 2W05A 3GU8A 3ZDIA 2CNUA 5KNJA 3ULZA 3A7FA 4U3ZA 2G2FA 3NPCA 3UO6A 3K3JA 4R7BA 5AP2A 5BYLA 3PZHA 3IOPA 4IZAA 5JT2A 1JWHA 3KREA 5B7VA 5BPYA 2BFYA 1ZOHA 4CZUA 4ALVA 4JG6A 4C4HA 2ETKA 2YCRA 5HIDA 1RQQA 5FEDA 3PJ8A 2P33A 4BWXA 3NFFB 4B7TA 4MXCA 5HD4A 5DMZA 4IJ9A 4X3FB 4C61A 4XG4A 2PYWA 2WIPA 1PMNA 3U55A 3LXPA 5I3RA 3MYGA 3W8QA 4F78A 3DAJA 3HGKA 4L46A 4O96A 1YHWA 4UXQA 1Z5MA 4YZ9A 2CDZA 5AP5A 2HZ0A 3HAMA 3AGMA 2B7AA 4KSQA 4FIFA 4MWHA 4QQ5A 2KTYA 4UZDA 4C2VA 3UPXA 2VTAA 3NNVA 3N4UA 4IBMA 5CT7A 4GYGA 3KVXA 5C4LA 3NNUA 2QOHA 3O7LD 4IVCA 3I1AA 3QGYA 3DK6A 5EHOA 1WVWA 2E9NA 2W99B 3HRBA 1M2RA 3MY5A 3OXTA 1J3HA 3AOXA 3VUTA 1Q99A 4ZAUA 3JY9A 4JX3A 3FWQA 4GUEA 3CIKA 4F63A 4FZ6A 4I22A 4E4XA 2CHLA 3ANQA 4AP7A 5EW3A 5I9YA 4CGAA 4E4NA 2CKEA 4J96A 4DHFA 2IF8A 5CXHA 3LHJA 3AC5A 1SZMA 4FSUA 2YIRA 4LFIA 3H9OA 1MRYA 4LOOA 1BMKA 2W5HA 5JK3A 1HCKA 2UW3A 2F7ZE 3NUXA 2AC3A 4FZ7A 3U8WA 2W96B 3RPSA 4FSWA 3R21A 4J52A 3COKA 4BF2A 4J7BA 4FKSA 3O8PA 3TEIA 4D28A 2PE1A 4FGBA 4GCJA 4CMTA 2QKWB 5C8NA 3T3UA 4JR7A 2C6KA 3GCVA 2OGVA 3CTHA 4I0TA 3R8MA 4HYSA 5DT3A 5L8KA 4GT5A 4PUZA 1V0PA 4RX5A 3OBGA 4G16A 5JFVA 5DBXA 4YGAA 3CE3A 4R78A 3AKKA 2QU6A 4O7WA 4UMPA 3P4KA 4ZK5A 2UZLA 2ZJWA 3W16A 2YLEA 1R78A 2FUMA 1XH6A 3E88A 4I23A 4NKAA 4AG8A 2R3MA 3GCPA 3RP9A 2BZJA 5BVOA 1KE7A 5IQFA 3QC9A 5EK7A 5HCZA 4YP8A 5IQCA 4DC2A 4RFZA 1VJYA 2OIBA 3MJ2A 2I6LA 4BDHA 4GKHA 4M84A 5GJDA 3KVWA 4X3JA 4F7SA 1J91A 3EJ1A 2VTPA 5HD7A 3U87A 3FPMA 2RFNA 3A7GA 3DLSA 4XRLA 2PUPA 3SOAA 1VYWA 3O71A 4O0RA 5IUGA 5EYMA 2GHLA