1ZOGA

Crystal structure of protein kinase ck2 in complex with tbb-derivatives
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
325
structure length
325
Chain Sequence
SKARVYADVNVLRPKEYWDYEALTVQWGEQDDYEVVRKVGRGKYSEVFEGINVNNNEKCIIKILKPVKKKKIKREIKILQNLCGGPNIVKLLDIVRDQHSKTPSLIFEYVNNTDFKVLYPTLTDYDIRYYIYELLKALDYCHSQGIMHRDVKPHNVMIDHELRKLRLIDWGLAEFYHPGKEYNVRVASRYFKGPELLVDLQDYDYSLDMWSLGCMFAGMIFRKEPFFYGHDNHDQLVKIAKVLGTDGLNVYLNKYRIELDPQLEALVGRHSRKPWLKFMNADNQHLVSPEAIDFLDKLLRYDHQERLTALEAMTHPYFQQVRAAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Inspecting the structure-activity relationship of protein kinase CK2 inhibitors derived from tetrabromo-benzimidazole.
pubmed doi rcsb
source organism Zea mays
molecule tags Transferase
molecule keywords PROTEIN KINASE CK2, alpha SUBUNIT
total genus 107
structure length 325
sequence length 325
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2005-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1zogA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1zogA02
4QQTA 3GNIB 5ANOA 4YURA 1FOTA 2HZNA 4O1OA 3PIYA 5GJFA 1YXSA 4FG7A 3UYTA 3BV3A 4QMQA 4X3FC 4TRLA 2XBAA 4NW6A 2BAQA 4KIPA 4F7NA 4AT4A 2QNJA 3ORMA 5I5ZA 2Y9QA 3BYSA 1YDTE 4W8DA 3G15A 3KEXA 3QQGA 5CTPA 2X7OA 1PXLA 2HIWA 3MIAA 4JX3A 3FV8A 2UZNA 3E8EA 4OUCA 2VWVA 4ZOGA 5IQHA 4WO5A 5D41A 5AP4A 3QWKA 1H01A 2I0YA 4IEBA 4L3JA 2ZDTA 4OTIA 4FI1A 2R2PA 2Y6OA 3NMUF 4BCQA 3EKKA 2RF9A 4IAKA 2VTNA 2ITPA 4NIFA 3R02A 2BDWA 3KN5A 4F9WA 3AD5A 3NW5A 4Y73A 4NJ3A 4RPVA 5DBXA 3RTPA 4R78A 3TACA 4G9RA 5CZIA 2A19B 3EJ1A 4FK3A 5KMJA 5FP6A 1K3AA 2BRHA 2OZAA 4QMXA 4XOYA 3VBWA 1MQ4A 2H96A 1PXIA 3IQ7A 4FTOA 4EYMA 2HXLA 1UA2A 3DJ6A 1YWRA 2CJMA 4GL9A 4USEA 4IAYA 3BKBA 2VTRA 3DJ5A 2HZ4A 4JG6A 4I0RA 3FL5A 4UMRA 5LVMA 3W2QA 2GU8A 4QP9A 3RGFA 1XH9A 4D0WA 2QI8A 3UO4A 4EH3A 4RGJA 5CNNA 2IW9A 3O17A 5ETAA 2CSNA 5JH6A 2C4GA 2H34A 3E87A 3JUHA 4LG4A 3ZFXA 2EXEA 2BTRA 3PJCA 4M67A 3EZRA 4FTAA 4FTKA 2XK8A 1WBVA 2QO9A 3W2OA 4AQCA 4EKKA 1HOWA 5EYKA 4D0XA 2QCSA 4ZJVA 3L1SA 4JRNA 2JGZA 4NSTA 3WF7A 3U51A 3QZHA 2XCKA 3NUYA 1FQ1B 5AM6A 4ANMA 2VX3A 3FE3A 4ALUA 3AC3A 4IACA 5CF4A 5C8MA 3UOJA 5F95A 2YIRA 5CVFA 4U44A 3CCNA 3MBLA 2UW3A 4EZ5A 1PHKA 2QONA 2JEDA 5LCJA 3OROA 3A61A 1KUTA 3RP9A 1MQBA 4C7TA 2CCIA 3P4KA 4YLKA 1JSVA 3R8MA 5LQFA 5CANA 3QRJA 4FKIA 4O7WA 1S9JA 4K2RA 4F1TA 4FTUA 3NW6A 5HBJA 2OJGA 1CTPE 3DBEA 2VTQA 3H9RA 4MXYA 3F5PA 4H36A 4N6ZA 5EOLA 4NM3A 3ID6C 4Q2AA 2O65A 5AAEA 4BBFA 5CAQA 4RX8A 5K0XA 5M4UA 4FEXA 4S34A 2CNVA 4E5WA 1OPJA 1R3CA 2XNEA 4TWCA 4C36A 5J1VA 4GUEA 2C5YA 5CU4A 2J9MA 4NZWB 5GJDA 5HOAA 3VRZA 3I0OA 4HCUA 4XOZA 4CKRA 3IW8A 3R01A 4HPTE 3LPBA 3QYZA 1PXPA 1L3RE 3NUNA 3UE4A 2BROA 2OBJA 3F3TA 3PE2A 1U5QA 4C59A 5BUIA 4EJ7A 4RLLA 2OZOA 2XS0A 2XKEA 5FDPA 5CU6A 4BGGA 4QYYA 4JDIA 1Z5MA 4K77A 4FEQA 2R3RA 3BWFA 2PSQA 4JBPA 4RJ4A 3I0QA 3LJ1A 5E8SA 2IPXA 4PMMA 2UW9A 3E7OA 4TPTA 5AP7A 3QHRA 5ACKA 3VIDA 3VUHA 3KXMA 4D4SA 3R7YA 4E6AA 4I0SA 3DY7A 3MPAA 2C1AA 5HLPA 5HGIA 3ZDUA 3ZYAA 4PTEA 4AZSA 4CCBA 3HV7A 3H30A 3RZBA 5BYLA 3AC8A 4RWLA 5CVGA 4ZSLA 1A48A 1PRYA 2YN8A 4YHJA 3KRWA 3H3CA 1YXTA 1WZYA 3TXOA 4GH2A 3TNPC 4CFXA 3R83A 3NS9A 2CKQA 5FUTA 4YC3A 3FI3A 3PDTA 4IB0A 3NIZA 4QMSA 3P78A 3R28A 4ZS4A 3DQXA 4AA5A 3LQ8A 4O6LA 5M06A 5CU0A 3W18A 3BCEA 4DGMA 4IMYA 5BVNA 5I3RA 2F49A 4YGAA 3A99A 3P5KA 5CSPA 3W55A 2H8HA 2WTVA 3LXNA 2BDJA 1ZARA 4ZZOA 3NW7A 4N57A 3A4PA 4E93A 2FB8A 3E64A 4XBRA 3ODYX 5IH6A 1E1VA 1UNHA 2C3LA 2JC6A 3DV3A 5AP1A 5FG8A 1Q5KA 4FTIA 3GU5A 3FHRA 4BDBA 2Y4IC 3NEWA 5IA5A 3I81A 4XV9A 4Q9ZA 4BYJA 3WARA 4LGHA 5HTCA 3VW8A 3FZSA 3NNUA 1H0VA 3UP2A 4YP8A 3FLNC 3S95A 3ZDIA 5DEWA 3G2FA 4OBPA 4BCKA 4KIKB 4O2ZA 3FXWA 1NXKA 3FSKA 3UOKA 2RKUA 5AR3A 3C4CA 4CV9A 3DTWA 3PWDA 5EW3A 5EYMA 5K4JA 1P4OA 4GRBA 4GIHA 1TQIA 2J5EA 4U79A 4A06A 5B2MA 4UXLA 4G5JA 4S2ZA 4HVIA 4FKLA 3HRCA 4D2RA 3MFUA 5TE0A 3PLSA 4ZSEA 2QOQA 4PY1A 4FIFA 4PDPA 3SDJA 4FODA 2IVUA 2UW5A 4EC8A 3MSSA 4CMOA 2QODA 4XX9A 2OH4A 2B53A 5D1JA 4DT8A 2RIOA 3CSVA 4FNZA 4ITHA 3KB7A 3JPVA 4O7ZA 3SGCA 5A46A 3OP5A 4GFGA 3VUMA 3GU6A 3UVQA 5KZIA 4E6CA 1G3NA 3MJ2A 3GENA 3PY3A 1SVGA 3R8PA 3ZLXA 4LRJA 3C5UA 3DQWA 1J1BA 2PZYA 1YI3A 2B9IA 2WMSA 4B99A 3FXXA 1ZWSA 2ERKA 4ZTNA 4BTFA 3PSBA 4LOOA 4PNIA 3FZ1A 3WZUA 3DPKA 2ZYBA 3FL4A 3QBNA 5M57A 2EB2A 3EMGA 5CSHA 4RC4A 1WBNA 3NVMB 3GU4A 4QNAA 4FV1A 3EH9A 1IASA 3AOXA 3FZTA 4M84A 2JDVA 4AG8A 3SQQA 3F66A 1YI6A 2JKOA 3DAEA 2OJ9A 4QTAA 2PWLA 4PWNA 3CXWA 4NIFB 3RNYA 4M68A 3ITZA 5KMKA 3C5IA 1M52A 1Q3DA 3N4TA 4IVDA 5GZ9A 3OW3A 2OICA 4MWHA 3R22A 1Q8YA 3TL8A 4OW8A 3IDCA 3R9HA 4MBLA 4J52A 5LVOA 3LMHA 1FINA 3RHXA 4U9AA 3FAAA 4A9TA 4E4MA 5CWZA 3ZS5A 4YR8A 5CALA 3ZRLA 2WQNA 5HG8A 4QQCA 1WVYA 4J53A 3Q4ZA 4NH1A 4FSTA 3RAKA 3D9VA 3EQFA 2R3NA 2VO7A 2E9PA 3CY3A 2C0OA 4RWJA 4X0MA 2ITTA 3HAMA 3D0EA 4IZ5A 4E6QA 2XZSA 5EDPA 5TR6A 5EQPA 3ZEWA 3C0IA 4G3GA 1CDKA 3U9CA 3GXLA 1ERKA 4JNWA 4QMLA 4ZTSA 5IQGA 2JD5A 2VWUA 3P23A 3MH1A 2VTHA 4WBBB 5AV3A 3BU6A 4AACA 3A7IA 2PULA 3CQUA 3DS6A 1JAMA 4H3QA 2YM7A 1IEPA 1OL7A 1SZMA 3E8NA 2R3OA 4IC7A 5IQCA 4B0GA 4TYHB 4M13A 3MESA 3KMUA 4OTQA 3EQPA 4YZMA 5JRQA 3KXGA 2ETKA 4O81A 2OJIA 1Q4LA 5HU9A 5KBQA 3BYOA 2QOCA 4OGRA 4K0YA 5BMMA 4A9RA 4D2WA 4PP7A 2C6OA 3G0FA 2BPMA 3OVVA 4CNHA 4BDHA 3U4UA 4J71A 4ANOA 3C4FA 4CQGA 4ERKA 4O7RA 5HE2A 4HGTA 3FUPA 3W32A 4L7SA 4X6RA 2UZWE 4L00A 5AR7A 5IPJA 1Y57A 2UW7A 3ORTA 4IC8A 4O38A 3PPZA 1H25A 3MS9A 5KKRB 5E8WA 1ND4A 4NL0A 3AMBA 4YPDA 4C4JA 3OWKA 4FVPA 1FVVA 3NDMA 5FM3A 3RCJA 1XH6A 4IBMA 2WNTA 4DCAA 5A54A 4Z9LA 3LQ5A 4QMNA 4MQ1A 4MVFA 3KREA 5LXMA 1KE6A 2F4JA 2G2FA 2GDOA 5HO8A 2JIVA 4DT9A 4FNWA 1PMUA 3DDPA 2O8YA 4QP2A 3Q52A 4G34A 3M1SA 2XK9A 4GW8A 4RZVA 3HLLA 5ACBC 3R7UA 3KU2A 2HZIA 4TW9A 1SYKA 4W8EA 4LUDA 3PSDA 4IM2A 5ANKA 4EZ7A 4EOKA 2XM8A 3E92A 3QFVA 1ZXEA 4KIKA 4QP7A 3TJCA 4F1MA 5GNKA 1H24A 4MYGA 5IA0A 2VGOA 1M14A 1SNUA 4EK3A 3SOAA 1R0PA 1NY3A 4EH7A 4JQEA 2KTYA 1FGKA 3ANRA 3RPSA 4NYEA 5HNGA 3D7TB 2C30A 5AUXA 3QD4A 4IAAA 5C4LA 5JMSA 4CKIA 3HMIA 4GFOA 4KIOA 4U40A 4OAUC 3E62A 2XCHA 2CCHA 3C4WA 4CTCA 1TQMA 4O7YA 5BVWA 3BU5A 3OBGA 4FG8A 3BV2A 3LXLA 3R7OA 4AGUA 5C26A 4JDJA 3GC9A 1PMNA 3ZONA 3FPMA 1BL6A 3HA6A 4I22A 5M55A 3SXFA 2WTDA 3UPXA 2RGPA 4L45A 3LVPA 3TZ9A 5LMKA 3VULA 4UV0A 5DVRA 1O6KA 4XV1A 3PZEA 4IZYA 2ITYA 2XNPA 4QPMA 3QUEA 4QYFA 4AX8A 4YJQA 4E20A 2PHKA 1IAHA 3NCGA 5I0BA 5DLSA 2WMWA 4EHVA 3ZC5A 4C2WA 4L53A 3A7HA 4DC2A 4DEBA 2PE1A 2QO2A 5CYIA 4LGDA 3GC8A 5DNRA 3VWAA 3N4VA 2YITA 4ZXTA 4RRVA 4IX3A 2XKFA 4YZBA 2PVRA 3K5VA 1IG1A 1I09A 3L9LA 4I5CA 4BDGA 4GG7A 3F2RA 2BCJA 2R0IA 1ZMWA 2X1NA 3MWUA 4JQ8A 2ZB0A 4ZTMA 3UIXA 4F6WA 3SXSA 2QOOA 3NUUA 3FMNA 4H1MA 4W4WA 4CKJA 2PVLA 1ZYSA 4JG7A 2CKOA 3FC2A 5IU2A 3S1HA 4FTLA 3ZUVA 4MXAA 5BNJA 2PVNA 3BPRA 5A4LA 3ZO3A 4AE9A 2Z8CA 4J8MA 4RX7A 2HZ0A 1OIRA 4YZNA 4LV5A 4JIAA 1H1SA 3AC4A 4BFMA 4EI4A 5CXZA 3NYOA 2PPQA 5E8TA 3HRFA 5EI6A 1YQJA 1XQZA 5AM7A 2J6MA 2BR1A 3MVMA 4L42A 4DCEA 3EKNA 4GJ3A 1YKRA 5E90A 4MNEB 2XK6A 4F1OA 4O7TA 1BMKA 3EZVA 3GC7A 4O1PA 2GQSA 4CYJA 2WQBA 1VZOA 5AR2A 5KMMA 4I94A 3OTVA 3ORNA 1H00A 4WBOA 3ZUTA 5A4CA 4XG7A 4L3LA 2WO6A 5HE1A 3IW7A 4J98A 4W4VA 4WKQA 4TL0A 3NVKI 3VF8A 4FT3A 5EDRA 5EG3A 4DBXA 3JY0A 4XG4A 3OHTA 3GEQA 5CAVA 3PJ8A 4PPBA 3EQGA 4P90A 1OBGA 2YDKA 5FTGA 4QQJA 4APPA 4BR3A 3PXFA 4G3DA 4RX9A 1URCA 2XP2A 3CGOA 1GIJA 4YTHA 4G31A 4R6VA 4YSMA 3V04A 4L7FA 3O7LB 4I92A 2V5QA 3IDPA 4XJ0A 1JWHA 4CLIA 4G3CA 4AP7A 1PXKA 1W0XC 3HUBA 4IB1A 4ZZNA 1W98A 3FKLA 4WT6A 3VS0A 3RMFA 1OUKA 5IQIA 4RIWB 3VF9A 5M56A 4OTGA 4O6EA 5ETFA 2LGCA 3ZH8A 5JZNA 1NVRA 4FUYA 1B6CB 2FSMX 4X21A 5IISA 3KK8A 5T68A 2YLEA 2OLCA 2W4JA 4S31A 2QO7A 4U0IA 4C4HA 4JOAA 3L8SA 3LAUA 2YJRA 4PMTA 3TN8A 4BKZA 3EN6A 5CLPA 2X8EA 4CG9A 4GIIA 3EQCA 3MTLA 2GHLA 4YTIA 4ALWA 4I0TA 4F9BA 3QUDA 4RIXB 1Q3WA 3DJ7A 4RIXA 3WE8A 4BC6A 4J96A 1M2QA 2PMOX 2RL5A 1X8BA 3BHUA 3IOKA 4FKGA 3OY1A 3F2AA 2F9GA 3I79A 4FT9A 2W1HA 1VEBA 3FKOA 4XYFA 2Y6MA 4FKWA 3R1YA 2ITUA 4FZ7A 3KQ7A 4X2NA 3QXPA 4EOSA 5AV4A 5CS6A 5HICA 4RLKA 2GS6A 4XEYA 1B38A 5EFQA 5EHYA 2YZAA 5C8NA 3ROCA 4YU2A 5F4NA 3GFWA 1OPLA 2XYNA 4H3BA 4GK3A 4AT3A 4DAWA 2YAKA 5CASA 3Q4CA 5HCXA 4FV8A 4BHZA 4M69B 1IA8A 1Q8TA 5CI7A 3AT3A 3A7JA 4ERWA 4F99A 4Y46A 3F9NA 4U97A 1W7HA 3KVXA 4BDFA 5L2SA 2WMUA 3KGAA 4ZLYA 3HV5A 5C03A 2BKZA 4BICA 1YOMA 2BIYA 2XBJA 5CSXA 5FGKA 4IAZA 4J97A 4L52A 4X2JA 2EXMA 2UW0A 4D28A 1F5QA 5IQEA 3OOMA 5LARA 3C7QA 4HZRA 3V6RA 4GKHA 4NM5A 4YC8A 2JIUA 4NW5A 5AX3A 4DH8A 3SX9A 1ZOEA 4AA0A 5ANGA 4ZAUA 4II5A 3BE9A 4XH6A 4ZSGA 4FGRA 1IA9A 2CGXA 3IW6A 4YZ9A 3TTJA 3ZZEA 3DCVA 2QR7A 5IQDA 3MB6A 3MN3A 3GB2A 2J2IB 3QA0A 4FZ6A 2P3GX 4Q9SA 4HW7A 3QCSA 3DDQA 5L6WL 3QXOA 3EIDA 2A2AA 4I93A 4ZLZA 3SOCA 3WOWA 2YJSA 3PZHA 2XKDA 2O64A 1WBOA 4W9WA 5AUUA 5J87A 3NNWA 3S0OA 5JFVA 1TQPA 4DTKA 3A2CA 4TYJA 2ZM1A 4FV2A 4G9CA 3JYAA 2OF4A 2FH9A 3AGLA 1E9HA 1UVRA 3WF6A 1Y91A 3OXIA 4EQUA 4XCUA 2BRNA 3IECA 3B2TA 5ETIA 3FDNA 4FYOA 2FSTX 4BDJA 2ITNA 2YM5A 4P7EA 4O0WA 1GZNA 5LVNA 2WPAA 3UQGA 3MFTA 5LVPA 3GCSA 4A9YA 2X9EA 3LCDA 3CQEA 3R8ZA 3UG1A 2CN5A 2A1AB 2FYSA 4M0YA 5FBOA 2GNGA 3QC9A 2XJ2A 2ZV7A 3RWQA 3OT3A 4M3QA 4BDCA 4FTQA 3HAVA 5M09A 4CGAA 1SMHA 1BYGA 2GFSA 4DE4A 4LMUA 4DITA 3HRBA 4YSJA 4O7SA 3LQ3A 4FT0A 1YW2A 4PPAA 5BVOA 4DGOA 5IMEA 4LGGA 3TV4A 3EYGA 3BYVA 2W4OA 3FY0A 3UO6A 2W99B 2VWZA 5HD7A 3QTUA 3DXQA 3LXPA 3OFMA 5K3YA 3DKOA 2W96B 3CTHA 5FBNC 4F65A 5EKNA 2ZOQA 3IW4A 4IJPA 3QF9A 3RVGA 4MBIA 3TCPA 5DGZA 5ANEA 5H9BA 2ITXA 4WSYA 3QD0A 4RIYA 4USFA 2XYUA 3OW4A 1V1KA 2YDIA 3KMWA 2X2KA 3R1NA 2E2BA 2FVDA 5HEZA 3FI4A 1A06A 3QKKA 4RFZA 4QMOA 3MH0A 5EM7A 2CKEA 4I4EA 4Y5QA 2NP8A 2YM8A 4IADA 4EWHA 4IW0A 2PUUA 1M7NA 4DN5A 4QMTA 2DS1A 5CT7A 4DFNA 2FSLX 2YDJA 5HD4A 2YABA 4NFMA 5JSMA 2GFCA 5C1QB 2VO3A 4ALVA 2R3IA 4LOPA 2R4BA 1VYWA 4FEUA 3G33A 3K3JA 4EH6A 3QTSA 4DFYA 2G01A 4MH7A 3PG3A 4L46A 4AZWA 4D2TA 1OL5A 4ACHA 2XK3A 3HDNA 3EFLA 4JI9A 4PMSA 1IAJA 3QCXA 3Q9XA 2WMVA 1JNKA 3V5PA 3V8SA 5AP3A 5M07A 4FL2A 5M4CA 4RG0A 5D11A 4Z7GA 2JFMA 4E4LA 4A07A 3BU3A 2QLQA 3BGZA 4DFXE 3JVRA 2I1MA 4G6NA 3SW4A 2IVSA 2OZAB 4JBVA 4EUTA 1H07A 2YIQA 1JVPP 3MH3A 5E1SA 2VTJA 4V0GA 4DGNA 4FGBA 3LFEA 5CEOA 2E9OA 4JDKA 3WZDA 3R04A 1F0QA 2BAJA 4PUZA 3F6XA 5HNIX 1H26A 3KF7A 3M2WA 3HGKA 3KXNA 3F69A 4XMOA 2PY3A 3IPHA 3ZO2A 4FIJA 3TZ8A 4D4VA 4F4PA 4AS0A 4LOQA 4I5PA 4K9YA 2A0CX 4O0VA 2B55A 2XVDA 3ZO4A 2Y0AA 3BGPA 3RAHA 4M69A 3ERKA 2B9HA 4U3ZA 1KE7A 3UG2A 5CZHA 3NWWA 3IDBA 3GUBA 1OM1A 2G9XA 3BWJA 3FMKA 5LOHA 2DWBA 3CE3A 3GOPA 4S33A 2R3HA 2JDTA 3B8QA 1CKJA 3A62A 4XNEA 3S2PA 1H27A 4LI5A 2QHNA 4YMJA 4RT7A 3IKAA 3R7VA 3KXHA 4ENXA 3DBCA 3EHAA 3TV7A 3OCSA 4GSBA 4RMZA 5M44A 1U54B 4FSNA 4LRKA 4AT5A 4J8NA 2BUJA 3WF8A 2HK5A 1XBBA 5H2UA 5JGBA 2JAMA 3R1SA 4U6RA 2G2HA 2PVMA 4R1YA 1SM2A 4M7IA 3FLSA 4EK8A 4USDA 4H05A 2PZ5A 3FMLA 5HX6A 4AW5A 3LMGA 3V8TA 3II5A 1Q41A 1UU3A 5HQ0A 5L2WA 3AT4A 3BLQA 5CAPA 2W1IA 3P7CA 2W5AA 3QA8A 4GG5A 3I7CA 3TNWA 3F5GA 3S4QA 5JQ5A 2DYLA 4GMYA 1QMZA 2VU3A 1PKDA 2I40A 3RWPA 4DG2E 2X4FA 3SW7A 4LRMA 3W2CA 5H8BA 3QD3A 4P4CA 1VR2A 4IJ9A 1KV1A 3CIKA 3A7FA 3SHEA 4FOBA 2UZVA 4QMUA 4UYNA 3VJOA 3WF9A 4ACMA 1QPEA 2PL0A 3KXXA 4Y83A 4ZTLA 3RCDA 3DAKA 5J5TA 3Q5IA 4C3RA 1JKKA 2HW6A 4CZYB 3PPJA 5J7BA 3O8PA 3HMNA 3PXQA 4L6QA 4RVTA 2PZIA 5EI8A 4AFEA 3ALNA 3BHYA 2VTLA 3DB6A 1UWHA 4FKPA 4PNKA 4ACGA 4ANQA 3HUCA 3IK3A 2PZRA 1PMEA 2VWYA 4MXOA 4U42A 1U54A 3IGOA 2W1EA 5TT7A 1H8FA 4GT3A 4EOMA 3D7ZA 5LVLA 5CAOA 5I9XA 4Y8DA 2CPKE 4PL5A 3UQCA 5KKRC 5DI1A 5FXRA 4DTAA 1T45A 4UMQA 4YHFA 2C5VA 2RSVA 4FICA 4CQEA 4HVHA 2J7TA 4YJNA 5FD2A 1WFCA 5HX8A 2Z7LA 2GPHA 4FE2A 3ET7A 1WVWA 4AOIA 3NUPA 3LLTA 3UNJA 5AR8A 1Q61A 2BALA 4KA3A 5GIPE 5K9IA 2R3QA 4PP9A 2XF0A 2B4SB 4NUSA 2UZEA 4Q5EA 2HCKA 2OFUA 3PVGA 5E91A 3ULIA 4DINA 4FR4A 4EKLA 4F63A 3U54A 4HCTA 1U46A 4C35A 4C4EA 2PMLX 2XIYA 5AJQA 4D9TA 4B8MA 3QCYA 4PDOA 2V7OA 3HZTA 2B1PA 4KAOA 3E3PA 4TTHB 4ZMEA 4ANNA 2IZSA 2VTTA 3FYKX 1OMWA 3P1AA 2IVTA 4KINA 1GY3A 4WUAA 4EC9A 5HHWA 3VHEA 5EW8A 4FKJA 2UZLA 4IDTA 4FTRA 5JRSA 4DLJA 4JX7A 4BN1A 4IM0A 2JKQA 3ZTXA 3NGAA 4MD7E 2QOFA 1KV2A 4DFUA 2VTSA 2ETMA 4BCOA 4DEDA 1OUYA 1R39A 3MB7A 1REJA 2W1FA 4BBEA 4G3EA 4IZ7A 4IFCA 3OWPA 2X2MA 3DA6A 4FG9A 2XNMA 4MWIA 3BBWA 4EHGA 5JFWA 2GS7A 3RAIA 1OKYA 4K8AA 4D1XA 4DH7A 1YHWA 4QMZA 3ZRKA 3HDMA 3FMEA 1Q8UA 2C5OA 4QQ5A 1OIYA 4HYSA 5IG1A 3UMWA 5E8VA 1ZAOA 5LJJA 1YWVA 3FLYA 4DGGA 1JSUA 1YI4A 4D5HA 4F70A 3MJ1A 4X6QC 4BRXA 3QX4A 3QU0A 3OF0A 4F08A 4JAJA 5DPVA 1Y8YA 4NTTA 1RDQE 2NO3A 4IANA 3ZSIA 4CMTA 3SD0A 1QL6A 2C6EA 3LFSA 4IB3A 5IDPA 3M42A 3MDYA 3WILA 2JFLA 1CKIA 3MY0A 3UJGA 5L2IA 1MRUA 3U9NA 4DBNA 4YJUA 3C4EA 1U59A 2OI4X 2BKKA 5HO7A 3I1AA 3EL8A 4XG6A 4U45A 4FKTA 5J9ZA 2CDZA 2WD1A 3S00A 5IQAA 3OEFX 4K6ZA 3EOCA 3DFCB 2C6MA 4I41A 3Q4UA 5A3XA 4O83A 1OPKA 4YJOA 4DG0E 3RPVA 4AE6A 2C0TA 4EBVA 1STCE 3ORKA 3U55A 2XRUA 3A8XA 3AC5A 3D5WA 3R9RA 5AV2A 2UZUE 4GUBA 2UZOA 3DLZA 3UVRA 2ZJWA 4QMYA 4XLVA 3ORLA 3OS3A 3ANQA 3Q2MA 4WNOA 4WG4A 5FEDA 2UV2A 3F3VA 4RQKA 3ZM9A 3TDWA 2RG6A 4UMPA 3FLWA 5DG5A 4BWKA 1W83A 2BIKB 4HPUE 4ZZMA 2ONLC 3V5WA 5JN2A 3OOGA 5HG9A 5AV1A 4F9CA 2F2CB 2WTKB 3Q9WA 3DKCA 5BYYA 1IRKA 3FKNA 4MTAA 1QPJA 1PYXA 2UZDA 4E4XA 2FGIA 1XHAA 3FEGA 3CQWA 3G9NA 4L44A 3COIA 2C68A 4PTGA 2PUPA 3Q96A 3RM7A 2EWAA 3UZTA 4AWIA 4BCPA 3LXKA 1Y6BA 3H9FA 3QALE 5KX8A 2QOIA 5ETCA 1A9UA 3QTIA 5IH4A 2YCQA 4F6UA 4UN0C 4FBXA 4QPSA 3ZM4A 1MP8A 4QP3A 4UMUA 3QHWA 5LMBA 4O27B 3VC4A 4N70A 5CNOA 5DRBA 4BCMA 4EOLA 4EQMA 4C61A 5DT0A 4C34A 2ZVAA 2YWVA 5D7AA 2JBPA 4FSQA 4OR5A 4G2FA 2YM6A 2ZV9A 3COMA 3L9MA 4HYHA 4NTSA 4PTCA 4AN9A 3QGYA 1H1PA 4NKSA 5HORA 3GC0A 2C5XA 4JVGA 2IJMA 4DEGA 3C1XA 3CY2A 3IGGA 4ZY6A 4O22A 4TWPA 4ONAA 4AN2A 4DFLA 5CEKA 1ZYCA 4FIEA 3OTUA 2VWIA 5IQFA 5HCYA 3D5UA 5CEIA 2Y4IB 4AUAA 4C38A 4R1VA 3AD6A 3TKIA 1ZZLA 3VAPA 2HY0A 4IAIA 1VYZA 2BZHB 4GKIA 2J0KA 3ODZX 3NCZA 4MNFA 3W10A 5IUGA 1XH7A 3PVBA 2HWOA 5L8JA 3K3IA 1HCKA 4IVBA 3NSZA 5HIDA 3I4BA 4CT2A 2XMYA 5J79A 3G90X 4WNMA 3C4ZA 4L68A 4RA5A 2ZM3A 2XH5A 2B9JA 5JFXA 1H28A 5CF6A 1PYEA 2GHGA 3DBFA 2QU6A 4IX5A 3TIYA 5DIAA 4C3FA 4BIEA 3GU7A 3KMMA 3RAWA 4F64A 4KBKA 3GCPA 1YXVA 1JKTA 3R73A 3CLYA 4ZJJA 1BI7A 3QLGA 1JSTA 2C6IA 3W1FA 3W2SA 3C9WA 1APME 4FV4A 2X7FA 3PVUA 3QTZA 2XIKA 4M15A 2XNBA 5DA3A 3UIUA 3ACJA 4GYGA 5C4KA 3ZZWA 2CGUA 3LKMA 2ZB1A 3WYYA 3F2NA 3E8CA 2QURA 3IS5A 3MH2A 3FZOA 2ACXA 4GS6A 3VS6A 3SAYA 3FZPA 3GP0A 3O7LD 3QCQA 3VS1A 4CLJA 2P0CA 3R71A 4KKGA 2W06A 4JG8A 3VUGA 3RI1A 3ZBXA 2WFYA 3H9OA 3FSFA 3G9LX 4FK6A 5LCKA 2R3LA 5C27A 4F7SA 5ANJA 3EWHA 3QKLA 4MBJA 2XA4A 3CGFA 4BTKA 4YTCA 2ZMCA 2PMIA 4NKAA 3VBXA 2WTKC 4FKSA 2XEZA 4O0SA 5TF9A 3UOLA 3C0GA 4CFMA 5JEBA 5H8GA 2C1BA 2ONLA 4NU1A 4CZUA 4TKSA 4EH2A 3DB8A 3KA0A 4HCVA 2V0DA 4WSQA 4JJRA 1WVXA 2GTMA 3NRMA 4NWMA 4TYIA 3IONA 1PKGA 4O7VA 3CTQA 4DLIA 3Q60A 2WTWA 5D12A 4HVSA 1CMKE 3O50A 3DK7A 4DA5A 5I9YA 4QP6A 4QP1A 3V6SA 2BILB 2WB8A 2UZBA 3Q53A 4ASDA 3PIXA 4KABA 4PV0A 3VRYA 5HLWA 2CGWA 2PVJA 3ZSGA 4ZY4A 4R77A 2QLUA 1OIQA 3WIKA 4ENYA 2ITVA 1YDRE 1R0EA 4D9UA 4NM0A 4XG3A 4R3PA 3BE2A 2X4ZA 3DBQA 4QYGA 3VS4A 2NRYA 2OIQA 3L8VA 4BWPA 2OG8A 2BMCA 4XV3A 3RK9A 3RK7A 5A4TA 2PVFA 3TJDA 2RFEA 3CP9A 3KF4A 5EKOA 4R8QA 4XLIA 2R0UA 1YVJA 4AA4A 4A9SA 2V22A 4FV6A 3I60A 1YOJA 3QD2B 3FY2A 4L3PA 1Q8ZA 2BFXA 1V0OA 2UW6A 3HV4A 4GFMA 3LJ0A 4EOQA 4WRGA 3VBVA 3MFSA 4AF3A 5KMNA 3MIYA 4YBKA 5DR6A 4D55A 1SVEA 5IF1A 3F7ZA 4QPAA 4O0XA 4RIYB 3OMVA 2ZM4A 2BDFA 2HWPA 4I3ZA 1GZ8A 5DYJA 4JBQA 3UPZA 5CI6A 2QU5A 4U7ZA 4EWQA 3DXNA 3GBZA 4HVDA 1J7IA 2Z60A 3MVLA 3MV5A 1K2PA 4FEWA 4RFYA 2Q0BA 4YLJA 3QQHA 3ZBFA 5JT2A 3PA3A 4YNEA 3LFFA 1UU9A 3LCTA 5FLFA 1YOLA 2R3MA 3ZO1A 1JPAA 4IWQA 1LEZA 3KVWA 4IIRA 3HEGA 5CSVA 3MA6A 2P2IA 1DI9A 4LMNA 3ZCLA 3WZJA 4M0ZA 3P0MA 5DT3A 3FQSA 2BAKA 1QPDA 3LFNA 4O91A 3NZ0A 2UVYA 3ZLSA 4AOJA 4YZCA 4XRJA 4F7LA 5KBRA 1RW8A 4L8MA 4U5JA 3KK9A 4CFNA 1H1WA 4AZTA 5J8IA 3TDVA 3RALA 3TI1A 3BBTB 4EBWA 4EH4A 1UWJA 2WMAA 3TT0A 5T6KA 4WNPA 4FTNA 4O84A 2ITQA 2OJFE 2YA9A 5EM6A 5DWRA 1JLUE 4HGSA 2GNHA 2UVXA 4GU6A 4HNFA 4KS8A 4X3FA 3UZPA 4C37A 4CV8A 4CVAA 2V7AA 3V8WA 4FKOA 3JY9A 2LAVA 2P2HA 4E26A 2ZV2A 1OVEA 5CEQA 4YBJA 4UY9A 5DHJA 3N4UA 4AU8A 2WQMA 4XP0A 2O2UA 5FM2A 5DT4A 4BI1A 1Y8GA 2J0JA 3PXKA 2QOKA 2A27A 3HL7A 2R7IA 4BZNA 3T3VA 3QX2A 4ZEGA 5L8LA 4TYEA 3ETAA 2B7AA 5AEPA 2YACA 4FOCA 3K5UA 2PTKA 2V62A 4JAIA 4IHPA 4W9XA 4K18A 2XKCA 1OB3A 2WELA 3ORXA 1XH8A 4MEDA 3CTJA 1V0PA 3D14A 2VWWA 4WRSA 5FEEA 4BDDA 4E5BA 4KSQA 3E8DA 3ROYA 5IH5A 2JDRA 4L67A 3ZLWA 5AIRA 4BDKA 4C02A 4UX9A 4MXZA 3QTXA 4HVGA 4ACDA 4JLCA 5M51A 2PZPA 2XIZA 4CT1A 3KY2A 2W1DA 4BF2A 2FSOX 4EK4A 2XJ1A 4UALA 4FL1A 1WBSA 5GIOE 4OLIA 1P2AA 2OIDA 3SC1A 3KULB 3JVSA 4FKRA 3CD8A 2OXXA 1ZYLA 3ZMMA 1YXXA 5E8XA 3NAYA 1O9UA 5A6OA 4O82A 3FWQA 1FGIA 2F7EE 4BDIA 5AP0A 4F7JA 5IEYA 3PXZA 1OKZA 4DHFA 4ARKA 3TIZA 4EORA 4PF4A 4BZOA 4B4LA 4EK5A 2OGVA 5C9CA 2UW8A 4I5HA 4U8ZA 4FIGA 1GOLA 3TZMA 3OXTA 3UP7A 2XEYA 4JR7A 3EQRA 3D2IA 2JIIA 2YIXA 3O2MA 4O21A 5BUEA 4G3FA 3BELA 4JS8A 3SLSA 3UIMA 2G15A 4AXAA 5K5XA 3D15A 5CQUA 3UC4A 2R3GA 3BYUA 4BCHA 2Y4PA 5HZNA 4RJ5A 4XP2A 5GJGA 5IA4A 3Q2JA 3UIBA 3O71A 4UWBA 3F5XA 3IOPA 3PXYA 4QTBA 3H10A 3EL7A 3BQCA 2C6KA 2VX0A 2UZTA 3A60A 5I3OA 3PRFA 3E5AA 4FTCA 4JT3A 3I6WA 3KN6A 3TKUA 5E9EA 1YHSA 5I9VA 2XIRA 3GCQA 3UC3A 3HX4A 3BQRA 3RPOA 2GHMA 3ZXZA 2J0MB 4MKCA 4KUJA 3ZXTA 4DEIA 4YJSA 1O6LA 2PE2A 4BGHA 5I9WA 1QPCA 2J90A 3D5XA 5EW9A 2BRGA 3NPCA 3F82A 4GT4A 3BHVA 2HXQA 4LFIA 3TNIA 4FA2A 4K1BA 2W9ZB 3TM0A 3VUDA 3R8LA 4E1ZA 4QP8A 2HELA 4KIQA 2I6LA 1ATPE 2CNUA 4D4RA 5E1EA 3A8WA 3EQBA 4EYJA 3OXZA 1LEWA 1U4DA 4FVRA 3RK5A 1Z9XA 2Q0NA 5FTOA 2QHMA 3JXWA 2OFVA 2XB7A 3QRIA 5AUVA 4RJ3A 2YM3A 3C50A 4JR3A 4RIOA 3I6UA 4G6LA 1OL1A 1BI8A 3H0YA 5IA1A 4RX5A 4X7QA 5E92A 5AADA 5M4FA 3LW0A 4XBUA 5KHWA 5B7VA 4D2PA 3D7TA 3G5DA 2YHVA 4Y72A 4CFWA 3DKFA 2VWBA 4AW1A 4ZTRA 1ZYDA 4GT5A 2GCDA 2WGJA 4TNBA 5K5NA 1XBCA 3W8QA 2ITWA 2WEIA 3M11A 4IVAA 5JKGA 1KE9A 5E4HA 4FIIA 4FTMA 4LM5A 3FC1X 1UNLA 3P86A 2Z02A 3OY3A 4OTFA 3Q6WA 2GMXA 3E93A 1JKLA 3PJ3A 1UKHA 2YAAA 4BZDA 1UU7A 3ZLYA 3NR9A 2UW4A 2XNNA 3HNGA 3QC4A 3MA3A 2NNWB 3LHJA 1URWA 1KE8A 2CHLA 2FA2A 3FZRA 2BZJA 1OL2A 2PK9A 1V0BA 2GTNA 4NK9A 1JOWB 4UEUA 4I6FA 2YCRA 4QOXA 3DBDA 3DKGA 2PUNA 1DAWA 2JDOA 3VW6A 4FKUA 2XUUA 4FV3A 5I9UA 3TEIA 2QOBA 5LMKC 3P9JA 1ZOGA 1OKWA 3WBLA 5BX0A 2W0JA 3C0HA 4YNOA 5EM5A 5HI2A 5BVKA 3VBYA 2J4ZA 5KCVA 4C0TA 3B2WA 3QZFA 4YUQA 3MY5A 4Z55A 2OH0E 3TNQB 5C8KA 4CG8A 4BIBA 5F1ZA 3FI8A 2OU7A 5GINE 4C4IA 4EH9A 3RM6A 3ZHPC 1OZ1A 2I0EA 4IX4A 2ZV8A 3DGKA 3EN7A 3CJFA 4PL4A 1F3MC 4UB7A 4V0GB 4Y5HA 3W33A 3SG9A 4IWDA 5GZ8A 5F20A 3WZKA 3I5NA 3R1QA 4RC2A 4B8LA 5BVDA 3HP2A 2R3FA 2XIXA 4JIKA 3O96A 3TWJA 3HMMA 4JBOA 2RFSA 3QL8A 1KOAA 4UYAA 3PP0A 4EOOA 2EUFB 3D2KA 1LUFA 3OCTA 4MF0A 4R3RA 4PDYA 2P33A 4W4XA 3OWLA 4AGDA 4QMVA 4TY1A 1KWPA 2NRUA 2XM9A 3VO3A 3LFCA 5H3QA 3OCBA 5EYDA 3Q6UA 4IDVA 4AN3A 1H1RA 2ITZA 4FF8A 3OWJA 2X7GA 4OBOA 5CY3A 5HTBA 2XRWA 1ZRZA 1OL6A 4M97A 3FLZA 1WBTA 3BYMA 3RPRA 4UWYA 4I1ZA 3AT2A 3N51A 5G6VA 4TYGA 3WIGA 4O86A 4ZY5A 5CU2A 4X2KA 4D5KA 1FVRA 2B0QA 3GCUA 3LFAA 1BUHA 4KBCA 2SRCA 4ZIMA 2X6DA 4AGCA 1CKPA 3MFRA 2JITA 3CEKA 3O0GA 1ZY4A 3E88A 3HP5A 1VJYA 3PG1A 2HW7A 1DS5A 2WEVA 5AMNA 5EHLA 4F0FA 4RVMA 3VQUA 3G51A 3LM0A 4I6HA 3COKA 3WF5A 4TZRA 4CSVA 2BRMA 4ZTQA 3KRXA 4I6QA 2PMNX 3LZBA 3RHKA 3PE1A 3THBA 4C2VA 3JR1A 4P5ZA 2HOGA 5B2KA 2OXYA 4DFBA 1ZOHA 5FXQA 2XK7A 4U81A 3ZSHA 3DAJA 1ZZ2A 2W9FB 4PDSA 3KKVA 4CTBA 2R3PA 2BHHA 2VO6A 3ZFYA 1PXNA 2BFYA 3P79A 4DEHA 1ZMUA 4JXFA 2VTIA 1PF8A 4C57A 4E3CA 2RFNA 3LFQA 4M14A 2OJJA 3TUBA 1B39A 4AGWA 1W8CA 5ICPA 1H08A 2WMBA 4J1RA 3G6GA 4S32A 5E8UA 3VS3A 5A14A 3BI6A 3R0TA 3QGWA 4YJRA 5CSWA 5M4IA 3NUXA 3OT8A 4HYUA 4EJNA 5HVYA 3EFJA 2NPQA 5EYCA 4C33A 2FO0A 5B0XA 2OIBA 3QQLA 2QOHA 2R64A 5CT0A 2YERA 4IAFA 2C47A 3T9TA 4DG3E 4FV0A 1XR1A 4I6BA 2V55A 4WNKA 3FMDA 4GCJA 1Q99A 2VTOA 3TUCA 4K33A 3RBWA 3WE4A 1UKIA 4BI0A 2QKRA 4FNYA 3FI2A 4N0SA 5AA9A 5F9EA 1H1QA 3ATTA 4EQCA 5M08A 3BRBA 3U87A 2OWBA 3BHTA 3QWJA 3TNHA 3SA0A 4DTBA 3L8XA 1UV5A 2B9FA 1LPUA 4CRLA 1JBPE 3CKXA 3ELJA 3PPKA 4ID7A 5LMAA 2VRXA 4B7TA 4FX3A 3PY0A 3QQKA 3R8UA 1YRPA 3I5ZA 5BVFA 3R2BA 4MD9E 4ANSA 5L6PA 3LMIA 4BVUA 4I21A 4CCUA 2EB3A 2RG5A 5CAUA 4U3YA 3UQFA 4WIHA 2C69A 4XG9A 4APCA 5KUPA 3VS5A 2BZKB 2Z7QA 5I9ZA 4E8AA 5IQBA 1ZYJA 1Q97A 5HESA 3N9XA 5A4QA 3R00A 4MXCA 5EK7A 3V5QA 4QMPA 3GCVA 4AAAA 1TVOA 3MY1A 4G1WA 3WZEA 3A4OX 4DH1A 4QT1A 3GQLA 1LP4A 2CLQA 3Q4TA 4I24A 2IW8A 4Z3VA 3QRUA 1M2RA 3TKHA 2J50A 3VUIA 4MF1A 4XRLA 4PX6A 5LWNA 3F61A 3ENHA 3QLFA 5TOZA 4BY9E 3CR0A 2WQOA 4DFZE 4UBAA 4C58A 5J5SA 2VX1A 5H8EA 1W84A 2HYYA 5KNJA 3CBLA 4TXCA 2HENA 4XG2A 4FSUA 4PMPA 2YCFA 3NUSA 4G17A 1GAGA 4ITIA 1H0WA 3QRTA 4KD1A 2WU6A 2Y8OA 3UNKA 2VN9A 4BCNA 5J1WA 4O0YA 3W2RA 4LQMA 5TKDA 4BKJA 1FPUA 5DRDA 4FSYA 5AUWA 5BQ0A 4V04A 2QQ7A 2F7XE 1OITA 2WMTA 5EI2A 4D58A 5AR5A 4A4XA 5FQDC 2WIHA 3D4QA 4LUEA 4OAVB 2WKMA 2YIYA 4M66A 2VAGA 4PQNA 4GJ2A 3U6JA 2VV9A 5EM8A 5IZFA 4IB5A 4XUFA 4HGLA 2O63A 3QQFA 3KCFA 4KB8A 2AC5A 3QKMA 3RPYA 5L4QA 2HAKA 2EVAA 4TN6A 4BHNA 1L8TA 4ORKA 2WHBA 4KBAA 3NAXA 2F7ZE 4FSRA 1KOBA 1ZMVA 2WIPA 1BLXA 3KRRA 5CU3A 4YPSA 3QQUA 5F94A 4E5AX 3AMAA 2WZJA 3PYYA 3SRVA 1M17A 2O3PA 5TO8A 1ZY5A 2VTAA 3NYNA 2REIA 3FBVA 4FMQA 5DH3A 1M7QA 3T3UA 5HU3A 4O7LA 3TZ7A 1Q62A 5LWMA 4NT4A 5T3QA 4C4FA 4EOJA 4L01A 3UNZA 4ZLOA 1UNGA 4CD0A 2VGPA 3Q32A 4KSPA 4KWPA 3QYWA 3D5VA 5DOSA 3NX8A 5IDNA 4IE9A 2CNQA 4QRCA 2HY81 4HYIA 3UYSA 1W82A 3PTGA 4KKEA 3ULZA 3F3UA 4WUNA 4EUUA 2AYPA 3ORPA 4RSSA 4YJVA 1AGWA 5FEQA 4J99A 4TT7A 3EQIA 4RWKA 1K9AA 4LYNA 4I20A 2ESMA 4FL3A 4Y95A 4BDEA 4QYEA 2YIWA 5CQWA 1J3HA 3LCKA 4MX9A 5L2QA 1ZLTA 3GT8A 1HCLA 3FYJX 3UBDA 3K54A 3HV3A 4R7BA 2WMXA 1OGUA 4FT7A 5I4NA 2ETRA 1BL7A 3LM5A 5AP5A 5E8YA 4H1JA 3KL8A 2CMWA 4YJTA 4MNEA 2WU7A 3OBJA 5KMIA 4QP4A 1CSNA 4BBMA 2QG7A 5JFSA 4MD8E 4FV7A 1S9IA 3NLBA 3V51A 2C3JA 4EH5A 4X3FB 2CKPA 4WOVA 4WG5A 4GU9A 3R21A 4M12A 3D83A 2ERZE 2GQGA 3PXRA 4D2SA 3QRKA 4FV9A 2J0IA 3BHHA 4BB4A 4RJ8A 3Q3BA 5IEVA 2C3KA 5HBEA 2DUVA 3KCKA 5DN3A 3OD6X 3BGQA 4NCTC 3KFAA 5FWKK 2XJ0A 3V5LA 5L2TA 4EONA 3LFDA 3IO7A 4PRJA 4YO6A 3QUPA 4OBQA 3V01A 1MRYA 1GNGA 4RWIA 5HTIA 1XJDA 3Q9ZA 4Q5HA 5K4IA 5KMOA 4UXQA 4CZTA 4BTMA 4HJOA 4BL1A 1PXMA 4DEAA 5HIEA 4IWPA 4R7HA 3P7AA 3AD4A 1FVTA 5IA3A 2PVKA 1UU8A 2WMQA 3Q04A 5EH0A 3SV0A 4MQ2A 3COHA 4XHKB 5BPYA 4AZVA 2PVHA 4OTRA 4H39A 3R9DA 3F5UA 4RVKA 5CEMA 5DMZA 1J7LA 3EFWA 3AQVA 4HZSA 5HNBA 3OUNB 1XO2B 2G1TA 2R3JA 2IWIA 3F7WA 3SVVA 2VNWA 3R2YA 3V5JA 2IN6A 3GVUA 3DOGA 4Z16A 3F88A 2Z7SA 3SKCA 4FUXA 3PA5A 4RJ7A 1OBDA 4ANLA 3NNVA 4OT5A 2W1CA 4QTEA 4FNXA 3W2PA 4I23A 5JGAA 4OTPA 5FP5A 1I44A 2ZAZA 3C51A 3UGCA 4U80A 4H58A 5KMLA 4QNYA 2ZMDA 3BEGA 2YM4A 3LCOA 3OC1A 3HMPA 3R7GA 5CX9A 4IZAA 1P14A 2KULA 2W17A 3DT1A 5IKWA 3VS2A 2J51A 1YDSE 4R7IA 2PUIA 3PJ1A 4FZAB 4RIWA 3K2LA 1FMKA 3O51A 3R30A 1PMVA 3RNIA 2X2LA 2YWPA 1GZKA 3BX5A 3OUKA 4GVJA 4RVLA 3SXRA 3VHKA 4F0GA 3EFKA 2C0IA 2W05A 3IW5A 4IFGA 4C4GA 1KSWA 1XKKA 1PJKA 3EYHA 5KE0A 1T46A 4AZEA 2W1GA 3OEZA 2GS2A 4BYIA 1GIIA 1Z57A 3ACKA 4IQ6A 2YCSA 2C5NA 3P7BA 5JQ8A 3CPCA 1DAYA 3VNTA 1O6YA 3WYXA 5A4EA 4O7NA 4A9UA 2JDSA 3E63A 3HVCA 4S30A 2IW6A 1E1XA 2WQEA 3LE6A 3CJGA 3QTQA 1Y6AA 4D2VA 1MRVA 2W1ZA 5ANIA 3UOHA 5ANDA 4XS2A 2O0UA 1AD5A 4FZFB 2BTSA 2OK1A 1WBWA 3CS9A 3PFQA 2OW3A 5AWMA 3UTOA 4CEGA 2IZTA 2R7BA 4RJ6A 5M53A 2X8IA 3KRLA 4UWCA 2IVVA 5FXSA 5B2LA 4ZSAA 5J9YA 4CFUA 4ASXA 2QD9A 4HOKA 4MHAA 2X8DA 5D10A 2X39A 1TKIA 1GIHA 3TUDA 1J1CA 1FMOE 3SRVB 4BWXA 4A7CA 2UUEA 2XNOA 5D7VA 5AP6A 4XV2A 3W8LA 1YHVA 4OT6A 2OF2A 4CFVA 3LLAA 4O2PA 5CEPA 1PW2A 2QG5A 2FUMA 2C6LA 5D9HA 5IUHA 5EQEA 1Q8WA 4U41A 4GK2A 3JS2A 4RZWA 4YZDA 2YEXA 2X0GA 4F9YA 3LJ2A 3DXPA 4L43A 2QC6A 3H4JA 4O0RA 5DEYA 1R78A 3OCGA 5BUJA 3ORZA 4RA4A 4KKHA 4LL5A 3NYVA 4FTTA 4WG3A 3O8UA 1NVSA 3O23A 1J91A 1OKVA 3KULA 4NJDA 3PRIA 4FSMA 4R3CA 4U43A 5CENA 4TWNA 3C13A 3D94A 4FKVA 5GHVA 4A4LA 4C3PA 1XBAA 5AAFA 3QZIA 3PIZA 3ZEPA 3MYGA 3VQHA 4EOIA 2Q83A 4FIHA 3MTFA 4FC0A 3CKWA 3C4XA 4QYHA 2YISA 4QMMA 4I4FA 4C8BA 3GOKA 5HCZA 4FV5A 4LV8A 3ZRMA 2YFXA 3R6XA 2BZIB 1JKSA 2QVSE 2AUHA 4IWOA 5JGDA 4RC3A 1DM2A 3MVJA 4MXXA 1XWSA 3HMOA 3PA4A 3VN9A 3LCSA 3QTRA 2VD5A 3HECA 5DR2A 2XK4A 3DZOA 4MK0A 4ZS0A 3UDBA 1NA7A 4RBLA 4UZHA 1WAKA 3IG7A 5DFPA 2P55A 5AUTA 2A4LA 2I0HA 4E4NA 2C6TA 3H0ZA 3POOA 3FLQA 2I7QA 4DEEA 1EH4A 3FQHA 3BLHA 5HG5A 1PY5A 5AUZA 5AFVA 2R5TA 2AC3A 5IA2A 4BCJA 3PVWA 5AX9A 4RFMA 3UZRA 4HGEA 2B52A 4X2GA 4EHZA 4AOTA 4B9DA 2E9NA 4F0IA 3R8VA 3TG1A 3CD3A 3VJNA 4JQ7A 5EHOA 5BYZA 3DNEA 1NW1A 3P08A 3KXZA 3REPA 5IEXA 4A4OA 3NIEA 3FQEA 4N6YA 3VS7A 4ZJIA 3AC1A 1P5EA 4YO4A 2J0LA 2VUWA 4I5MA 2OSCA 3PJ2A 4E73A 4IXPA 1PXOA 2CN8A 2YLFA 4R5YA 3U8WA 2JKKA 4ASEA 3G0EA 1M2PA 4PPCA 4NCTA 4QTDA 3MGYA 5C01A 3V5TA 3I7BA 4EOPA 4WD5A 4YC6A 4AW0A 4O96A 3O8TA 3VVHA 3UMXA 4J95A 3R9NA 3ORIA 3RKBA 4X2FA 3EB0A 2BRBA 2C3IB 3HYHA 5FRIA 3BZ3A 3EQDA 1XH4A 2GNLA 4EHEA 5J7HA 2P4IA 3S3IA 2QKWB 3VUTA 3DK3A 2Y7JA 5FDXA 5HE0A 1IR3A 5CF5A 4J7BA 3KC3A 2BVAA 3TV6A 2VZ6A 3PUPA 3PSCA 4DGLC 3AC2A 3QQJA 3U6HA 2PYWA 3ENMA 2VNYA 3GU8A 3CC6A 2ZDUA 4IM3A 3VBTA 2W5BA 5HG7A 2I0VA 5BVEA 2WTCA 4G6OA 4KRDA 4BI2A 3QZGA 4WA9A 5HBHA 2GNJA 4H3PA 3MI9A 3F3WA 3G6HA 3DK6A 5E8ZA 2X6EA 5KO1A 1CM8A 2ITOA 4UMTA 2E9VA 4EZ3A 3UO5A 4TWOA 3FMJA 1RE8A 5AV0A 5J95A 3FMMA 3R63A 3L8PA 5AA8A 2GNFA 4EH8A 3RJCA 5J9LA 4AW2A 4FYNA 4YHTA 2G2IA 1YWNA 2X9FA 4FKQA 1Q24A 1KE5A 3AG9A 3R9OA 4O0UA 3R7IA 3ZFMA 1H4LA 3ZUUA 3MVHA 2C6DA 3GI3A 3QAME 4P5QA 4D1SA 2WTJA 3T8OA 5HVJA 4ZK5A 3DTCA 4D4YA 4EL9A 4YJPA 3R7EA 3FJQE 4ZMFA 2R9SA 4DYMA 1NT2A 3A7GA 2VTMA 3ZC6A 4GK4A 4BIDA 4V01A 5JK3A 1PXJA 4CFFA 3T9IA 4TYHA 4IX6A 5G1XA 3CPBA 3W16A 2GNIA 2RFDA 5GZAA 1BX6A 3VUKA 1FBNA 5EDQA 3OZ6A 3GGFA 5KHXA 3ALOA 5L8KA 2DQ7X 4GEOA 5A6NA 3DNDA 1SVHA 3EQHA 4FTJA 3AXWA 4RQVA 3Q9YA 5HE3A 2BHEA 4ZTHA 3B8RA 4FSWA 4JDHA 3U4WA 1J7UA 4CRSA 4NEUA 2JBOA 3ZU7A 1GZOA 2XNGA 3POZA 2Z7RA 4N4SA 1OIUA 4FSZA 3UVPA 2GQRA 3FHIA 2J5FA 5AR4A 1XH5A 1AQ1A 1LR4A 3PWYA 2UVZA 3E7VA 4LL0A 2VO0A 3DFAA 2IZRA 2CLXA 3GFEA 4BGQA 2EXCX 4F9AA 2PE0A 5HLNA 5FTQA 5E7RA 4AFJA 1G8AA 4QMWA 4BTJA 3FPQA 1REKA 5CF8A 2PU8A 2WAJA 4KRCA 3RZFA 4FEVA 3UODA 3BLRA 5K0KA 4QD6A 3HV6A 4TNDA 1G8SA 3PY1A 4MAOA 2E9UA 3RINA 3DU8A 2JAVA 3AMYA 3WI6A 4EEVA 3EN9A 3MPTA 4BCIA 4F6SA 3OG7A 4K11A 4W4YA 2QOLA 4GV1A 4G5PA 1DI8A 4Z7HA 1QCFA 3LIJA 4DH3A 4ANBA 5AUYA 1U5RA 3NNXA 4XG8A 3NUAA 3HA8A 5CXHA 1OI9A 2WMRA 4HNIA 2YZLA 2H9VA 2IO6A 5IMXA 2OXDA 3MPMA 1JQHA 1SNXA 3DZQA 5HO6A 4E6DA 5L6OA 2JKMA 2GSFA 2F57A 2WXVA 3GQIA 3VBQA 5EQYA 4ITJA 3QTWA 2VWXA 3EN4A 3HKOA 2F2UA 3E3BX 4OTWA 4IH8A 5CVHA 5ITAA 4NFNA 1OECA 4G16A 3SG8A 4L9IA 1RQQA 1WCCA 4JRVA 4V05A 4Y85A 4R5SA 2OKRA 4F09A 2PVYA 4PL3A 5DR9A 4ASZA 4YLLA 2Z2WA 4CMUA 5IUIA 4XP3A 2WTIA 5HIBA 4UZDA 4MCVA 3TTIA 3ZOSA 4BCFA 5AP2A 3MW1A 4WHZA 3V3VA 2R3KA 5JZJA 2CGVA 2QR8A 4QO9A 1NVQA 3ATSA 4KNBA 1BKXA 4FZDB 2W4KA 1YXUA 2OO8X 4QTCA 4NM7A 4JL9A 5HKMA 4BDAA 2WOUA 5HVKA 3F3ZA 4YTFA 3BIZA 4D1ZA 2EU9A 4OTDA 2IZUA 4BCGA 2X81A 4ZSJA 1WMKA 3AGMA 3Q5ZA 2H6DA 4FVQA 5KZ0A 3LFBA 1WBPA 2W5HA 1RJBA 3LOKA 1P4FA 2JLDA 3BEAA 4EK6A 5L3AA 4GVAA 4GYIA 4B6LA 4FT5A 4DF3A 4BKYA 4E7WA 3NYXA 5DE2A 5EOBA 4CYIA 5AAGA 3FMHA 4ZP5A 3PP1A 4M8TA 2W7XA 4KS7A 2IG7A 5A9UA 2WOTA 3DLSA 4OTHA 5BMSA 5AIKA 4P2KA 3KRJA 3FXZA 1GJOA 4ACCA 4DH5A 4IVCA 4X3JA 4AZFA 1G5SA 3L9NA 2O5KA 3L9PA 2B54A 1R1WA 4O0TA 4C62A 3U6IA 4CXAA 3PLAE 3EN5A 2VTPA 1MUOA
chains in the Genus database with same CATH superfamily
4QQTA 3GNIB 5ANOA 4YURA 1FOTA 2HZNA 4O1OA 3PIYA 5GJFA 1YXSA 4FG7A 3UYTA 3BV3A 4QMQA 4X3FC 4TRLA 2XBAA 4NW6A 2BAQA 4KIPA 4F7NA 4AT4A 2QNJA 3ORMA 5I5ZA 2Y9QA 3BYSA 1YDTE 4W8DA 3G15A 3KEXA 3QQGA 5CTPA 2X7OA 1PXLA 2HIWA 2X0QA 3MIAA 3FV8A 4JX3A 2UZNA 3E8EA 4OUCA 2VWVA 4ZOGA 5IQHA 4WO5A 5D41A 5AP4A 3QWKA 1H01A 2I0YA 4IEBA 4L3JA 2ZDTA 4OTIA 4FI1A 2R2PA 2Y6OA 3NMUF 4BCQA 3EKKA 2RF9A 4IAKA 2VTNA 2ITPA 4NIFA 3R02A 2BDWA 3KN5A 4F9WA 3AD5A 3NW5A 4Y73A 4NJ3A 4RPVA 5DBXA 3RTPA 4R78A 3TACA 4G9RA 5CZIA 2A19B 3EJ1A 4FK3A 5KMJA 5FP6A 1K3AA 2BRHA 2OZAA 4QMXA 4XOYA 3VBWA 1MQ4A 2H96A 1PXIA 3IQ7A 4FTOA 4EYMA 2HXLA 1UA2A 3DJ6A 1YWRA 2CJMA 4GL9A 4USEA 4IAYA 3BKBA 2VTRA 3DJ5A 2HZ4A 4JG6A 4I0RA 3FL5A 4UMRA 5LVMA 3W2QA 2GU8A 4QP9A 3RGFA 1XH9A 4D0WA 2QI8A 3UO4A 4EH3A 4RGJA 5CNNA 2IW9A 3O17A 5ETAA 2CSNA 5JH6A 2C4GA 2H34A 3E87A 3JUHA 4LG4A 3ZFXA 2EXEA 2BTRA 3PJCA 4M67A 3EZRA 4FTAA 4FTKA 2XK8A 1WBVA 2QO9A 3W2OA 4AQCA 4EKKA 4QDVA 1HOWA 1W2DA 5EYKA 4D0XA 2QCSA 4ZJVA 3L1SA 4JRNA 2JGZA 4NSTA 3WF7A 3U51A 3QZHA 2XCKA 3NUYA 1FQ1B 5AM6A 4ANMA 2VX3A 3FE3A 4ALUA 3AC3A 4IACA 5CF4A 5C8MA 3UOJA 5F95A 2YIRA 5CVFA 4U44A 3CCNA 3MBLA 2UW3A 4EZ5A 1PHKA 2QONA 2JEDA 5LCJA 3OROA 3A61A 1KUTA 2XARA 3RP9A 1MQBA 4C7TA 2CCIA 3P4KA 4YLKA 1JSVA 3R8MA 5LQFA 5CANA 3QRJA 4FKIA 4O7WA 1S9JA 4K2RA 4F1TA 4FTUA 3NW6A 5HBJA 2OJGA 1CTPE 3DBEA 2VTQA 3H9RA 4MXYA 3F5PA 4H36A 4N6ZA 5EOLA 4NM3A 3ID6C 4Q2AA 2O65A 5AAEA 4BBFA 5CAQA 4RX8A 5K0XA 5M4UA 4FEXA 4S34A 4AQKA 2CNVA 4E5WA 1OPJA 1R3CA 2XNEA 4TWCA 4C36A 5J1VA 4GUEA 2C5YA 5CU4A 2J9MA 4NZWB 5GJDA 5HOAA 3VRZA 3I0OA 4HCUA 4XOZA 4CKRA 3IW8A 3UDTA 3R01A 4HPTE 3LPBA 3QYZA 1PXPA 1L3RE 3NUNA 3UE4A 2BROA 2OBJA 3F3TA 3PE2A 1U5QA 4C59A 5BUIA 4EJ7A 4RLLA 2OZOA 2XS0A 2XKEA 5FDPA 5CU6A 4BGGA 4QYYA 4JDIA 1Z5MA 4K77A 4FEQA 2R3RA 3BWFA 2PSQA 4JBPA 4RJ4A 3I0QA 3LJ1A 5E8SA 2IPXA 4PMMA 2UW9A 3E7OA 4TPTA 5AP7A 3QHRA 5ACKA 3VIDA 3VUHA 3KXMA 4D4SA 3R7YA 4E6AA 4I0SA 3DY7A 3MPAA 2C1AA 5HLPA 5HGIA 3ZDUA 3ZYAA 4PTEA 4AZSA 4CCBA 3HV7A 3H30A 3RZBA 5BYLA 3AC8A 4RWLA 5CVGA 4ZSLA 1A48A 1PRYA 2YN8A 4YHJA 3KRWA 3H3CA 1YXTA 1WZYA 3TXOA 4GH2A 3TNPC 4CFXA 3R83A 3NS9A 2CKQA 5FUTA 4YC3A 3FI3A 3PDTA 4IB0A 3NIZA 4QMSA 3P78A 3R28A 4ZS4A 3DQXA 4AA5A 3LQ8A 4O6LA 5M06A 5CU0A 3W18A 3BCEA 4DGMA 4IMYA 1VLRA 5BVNA 5I3RA 2F49A 4YGAA 3A99A 3P5KA 5CSPA 3W55A 2H8HA 2WTVA 3LXNA 2BDJA 1ZARA 4ZZOA 3NW7A 4N57A 3A4PA 4E93A 2FB8A 3E64A 4XBRA 3ODYX 5IH6A 1E1VA 1UNHA 2C3LA 2JC6A 3DV3A 5AP1A 5FG8A 1Q5KA 4FTIA 3GU5A 3FHRA 4BDBA 2Y4IC 3NEWA 5IA5A 3I81A 4XV9A 4Q9ZA 4BYJA 2XAMA 3WARA 4LGHA 5HTCA 3VW8A 3FZSA 3NNUA 1H0VA 3UP2A 4O4CA 3FLNC 4YP8A 3S95A 3ZDIA 5DEWA 3G2FA 4OBPA 4BCKA 4KIKB 4O2ZA 3FXWA 1NXKA 3FSKA 3UOKA 2RKUA 5AR3A 3AKLA 3C4CA 4CV9A 3DTWA 3PWDA 5EW3A 5EYMA 5K4JA 1P4OA 4GRBA 4GIHA 1TQIA 2J5EA 4U79A 4A06A 5B2MA 4UXLA 4G5JA 4S2ZA 4HVIA 4FKLA 3HRCA 4D2RA 3MFUA 5TE0A 3PLSA 4ZSEA 2QOQA 4PY1A 4FIFA 4PDPA 3SDJA 4FODA 2IVUA 2UW5A 4EC8A 3MSSA 4CMOA 2QODA 4XX9A 2OH4A 2B53A 5D1JA 4DT8A 2RIOA 3CSVA 4FNZA 4ITHA 3KB7A 3JPVA 4O7ZA 3SGCA 5A46A 3OP5A 4GFGA 3VUMA 3GU6A 3UVQA 5KZIA 4AXCA 4E6CA 1G3NA 3MJ2A 3GENA 3PY3A 1SVGA 3R8PA 3ZLXA 4LRJA 3C5UA 3DQWA 1J1BA 2PZYA 1YI3A 2B9IA 2WMSA 4B99A 3FXXA 1ZWSA 2ERKA 4ZTNA 4BTFA 3PSBA 4LOOA 4PNIA 3FZ1A 3WZUA 4AAYA 3DPKA 2ZYBA 3FL4A 3QBNA 5M57A 2EB2A 3EMGA 5CSHA 4RC4A 1WBNA 3NVMB 3GU4A 4QNAA 4FV1A 3EH9A 1IASA 3AOXA 3FZTA 4M84A 3W0NA 2JDVA 4AG8A 3SQQA 3F66A 1YI6A 2JKOA 3DAEA 2OJ9A 4QTAA 2PWLA 4PWNA 3CXWA 3PUFC 4NIFB 3RNYA 4M68A 3ITZA 5KMKA 3C5IA 1M52A 1Q3DA 3N4TA 4IVDA 5GZ9A 3OW3A 2OICA 4MWHA 3R22A 1Q8YA 3TL8A 4OW8A 3IDCA 3R9HA 4MBLA 4J52A 5LVOA 3LMHA 1FINA 3RHXA 4U9AA 3FAAA 4A9TA 4E4MA 5CWZA 3ZS5A 4YR8A 5CALA 3ZRLA 2WQNA 5HG8A 4QQCA 1WVYA 4J53A 3Q4ZA 4NH1A 4FSTA 3RAKA 3D9VA 3EQFA 2R3NA 2VO7A 2E9PA 3CY3A 2C0OA 4RWJA 4X0MA 2ITTA 3HAMA 3D0EA 4IZ5A 4E6QA 2XZSA 5EDPA 5TR6A 5EQPA 3ZEWA 3C0IA 1XMMA 4G3GA 1CDKA 3U9CA 3GXLA 1ERKA 4JNWA 4QMLA 4ZTSA 5IQGA 2JD5A 2VWUA 3P23A 3MH1A 2VTHA 4WBBB 5AV3A 3BU6A 4AACA 3A7IA 2PULA 3CQUA 3DS6A 1JAMA 4H3QA 2YM7A 1IEPA 1OL7A 1SZMA 3E8NA 2R3OA 4IC7A 5IQCA 4B0GA 4TYHB 4M13A 3MESA 3KMUA 4OTQA 3EQPA 4YZMA 5JRQA 3KXGA 2ETKA 4O81A 2OJIA 1Q4LA 5HU9A 5KBQA 3BYOA 2QOCA 4OGRA 4K0YA 5BMMA 4A9RA 4D2WA 4PP7A 2C6OA 3G0FA 2BPMA 3OVVA 4CNHA 4BDHA 3U4UA 4J71A 4ANOA 3C4FA 4CQGA 4ERKA 4O7RA 5HE2A 4HGTA 3FUPA 3W32A 4L7SA 4X6RA 2UZWE 4L00A 5AR7A 5IPJA 1Y57A 2UW7A 3ORTA 4IC8A 4O38A 3PPZA 1H25A 3MS9A 5KKRB 5E8WA 1ND4A 4NL0A 2IF8A 3AMBA 4YPDA 4C4JA 3OWKA 4FVPA 1FVVA 3NDMA 5FM3A 3RCJA 1XH6A 4IBMA 2WNTA 4DCAA 5A54A 4Z9LA 3LQ5A 3W0OA 4QMNA 4MQ1A 4MVFA 3KREA 5LXMA 1KE6A 2F4JA 2G2FA 2GDOA 5HO8A 2JIVA 4DT9A 4FNWA 1PMUA 3DDPA 2O8YA 4QP2A 3Q52A 4G34A 3M1SA 2XK9A 4GW8A 4RZVA 3HLLA 5ACBC 3R7UA 3KU2A 2HZIA 4TW9A 1SYKA 4W8EA 4LUDA 3PSDA 4IM2A 5ANKA 4EZ7A 4EOKA 2XM8A 3E92A 3QFVA 1ZXEA 4KIKA 4QP7A 3TJCA 4F1MA 5GNKA 1H24A 4MYGA 5IA0A 2VGOA 1M14A 1SNUA 4EK3A 3SOAA 1R0PA 1NY3A 4EH7A 4JQEA 2KTYA 1FGKA 3ANRA 3RPSA 4NYEA 5HNGA 3D7TB 2C30A 5AUXA 3QD4A 4IAAA 5C4LA 5JMSA 4CKIA 3HMIA 4GFOA 4KIOA 4U40A 4OAUC 3E62A 2XCHA 2CCHA 3C4WA 4CTCA 1TQMA 4O7YA 5BVWA 3BU5A 3OBGA 4FG8A 3BV2A 3LXLA 3R7OA 4AGUA 5C26A 4JDJA 3GC9A 1PMNA 3ZONA 3FPMA 1BL6A 3HA6A 4I22A 5M55A 3SXFA 2WTDA 3UPXA 2RGPA 4L45A 3LVPA 3TZ9A 5LMKA 3VULA 4UV0A 5DVRA 1O6KA 4XV1A 3PZEA 4IZYA 2ITYA 2XNPA 4QPMA 3QUEA 4QYFA 4AX8A 4YJQA 4E20A 2PHKA 1IAHA 3NCGA 5I0BA 5DLSA 2WMWA 4EHVA 3ZC5A 3PFYA 4C2WA 4L53A 3A7HA 4DC2A 4DEBA 2PE1A 2QO2A 5CYIA 4LGDA 3GC8A 5DNRA 3VWAA 3N4VA 2YITA 4ZXTA 4RRVA 4IX3A 2XKFA 4YZBA 2PVRA 3K5VA 1IG1A 1I09A 3L9LA 4I5CA 4BDGA 4GG7A 3F2RA 2BCJA 2R0IA 1ZMWA 2X1NA 3MWUA 4JQ8A 2ZB0A 4ZTMA 3UIXA 4F6WA 3SXSA 2QOOA 3NUUA 3FMNA 4H1MA 4W4WA 4CKJA 2PVLA 1ZYSA 4JG7A 2CKOA 3FC2A 5IU2A 2ZFYA 3S1HA 4FTLA 3ZUVA 4MXAA 5BNJA 2PVNA 3BPRA 5A4LA 3ZO3A 4AE9A 2Z8CA 4J8MA 4RX7A 2HZ0A 1OIRA 4YZNA 4LV5A 4JIAA 1H1SA 3AC4A 4BFMA 4EI4A 5CXZA 3NYOA 2PPQA 5E8TA 3HRFA 5EI6A 1YQJA 1XQZA 5AM7A 2J6MA 2BR1A 3MVMA 4L42A 4DCEA 3EKNA 4GJ3A 1YKRA 5E90A 4MNEB 2XK6A 4F1OA 4O7TA 1BMKA 3EZVA 3GC7A 4O1PA 2GQSA 4CYJA 2WQBA 1VZOA 5AR2A 5KMMA 4I94A 3OTVA 3ORNA 1H00A 4WBOA 3ZUTA 5A4CA 4XG7A 4L3LA 2WO6A 5HE1A 3IW7A 4J98A 4W4VA 4WKQA 4TL0A 3NVKI 3VF8A 4FT3A 5EDRA 5EG3A 4DBXA 3JY0A 4XG4A 3OHTA 3GEQA 5CAVA 3PJ8A 4PPBA 3EQGA 4P90A 1OBGA 2YDKA 5FTGA 4QQJA 4APPA 4BR3A 3PXFA 4G3DA 4RX9A 1URCA 2XP2A 3CGOA 1GIJA 4YTHA 4G31A 4R6VA 4YSMA 3V04A 4L7FA 3O7LB 4I92A 2V5QA 3IDPA 4XJ0A 1JWHA 4CLIA 4G3CA 4AP7A 1PXKA 1W0XC 3HUBA 4IB1A 4ZZNA 1W98A 3FKLA 4WT6A 3ML1A 3W0QA 3VS0A 3RMFA 1OUKA 5IQIA 4RIWB 3VF9A 5M56A 4OTGA 4O6EA 5ETFA 2LGCA 3ZH8A 5JZNA 1NVRA 4FUYA 1B6CB 2FSMX 3TMOA 4X21A 5IISA 3KK8A 5T68A 2YLEA 2OLCA 2W4JA 4S31A 2QO7A 4U0IA 4C4HA 4JOAA 3L8SA 3LAUA 2YJRA 4PMTA 3TN8A 4BKZA 3EN6A 5CLPA 2XANA 2X8EA 4CG9A 4GIIA 3EQCA 3MTLA 2GHLA 4YTIA 4ALWA 4I0TA 4F9BA 3QUDA 4RIXB 1Q3WA 3DJ7A 4RIXA 3WE8A 4BC6A 4J96A 1M2QA 2PMOX 2RL5A 1X8BA 3BHUA 3IOKA 4FKGA 3OY1A 3F2AA 2F9GA 3I79A 4FT9A 2W1HA 2X0PA 1VEBA 3FKOA 4XYFA 2Y6MA 4FKWA 3R1YA 2ITUA 4FZ7A 3KQ7A 4X2NA 3QXPA 4EOSA 5AV4A 5CS6A 5HICA 4RLKA 2GS6A 4XEYA 1B38A 5EFQA 5EHYA 2YZAA 5C8NA 3ROCA 4YU2A 5F4NA 3GFWA 1OPLA 2XYNA 4H3BA 4GK3A 4AT3A 4DAWA 2YAKA 5CASA 3Q4CA 5HCXA 4FV8A 4O4EA 4BHZA 4M69B 1IA8A 1Q8TA 5CI7A 3AT3A 3A7JA 4ERWA 4F99A 4Y46A 3F9NA 4U97A 1W7HA 3KVXA 4BDFA 5L2SA 2WMUA 3KGAA 4ZLYA 3HV5A 5C03A 2BKZA 4BICA 1YOMA 2BIYA 2XBJA 5CSXA 5FGKA 4IAZA 4J97A 4L52A 4X2JA 2EXMA 2UW0A 4D28A 1F5QA 5IQEA 3OOMA 5LARA 3C7QA 4HZRA 3V6RA 4GKHA 4NM5A 4YC8A 2JIUA 4NW5A 5AX3A 1G8JA 4DH8A 3SX9A 1ZOEA 4AA0A 5ANGA 4ZAUA 4II5A 3BE9A 4XH6A 4ZSGA 4FGRA 1IA9A 2CGXA 3IW6A 4YZ9A 3TTJA 3ZZEA 3DCVA 2QR7A 5IQDA 3MB6A 3MN3A 3GB2A 2J2IB 3QA0A 4FZ6A 2P3GX 4Q9SA 4HW7A 3QCSA 3DDQA 5L6WL 3QXOA 3EIDA 2A2AA 4I93A 4ZLZA 3SOCA 3WOWA 2YJSA 3PZHA 2XKDA 2O64A 1WBOA 4W9WA 5AUUA 5J87A 3NNWA 3S0OA 5JFVA 1TQPA 4DTKA 3A2CA 4TYJA 2ZM1A 4FV2A 4G9CA 3JYAA 2OF4A 2FH9A 3AGLA 1E9HA 1UVRA 3WF6A 1Y91A 3OXIA 4EQUA 4XCUA 2BRNA 3IECA 3B2TA 5ETIA 3FDNA 4FYOA 2FSTX 4BDJA 2ITNA 2YM5A 4P7EA 4O0WA 1GZNA 5LVNA 2WPAA 3UQGA 3MFTA 5LVPA 3GCSA 4A9YA 2X9EA 3LCDA 3CQEA 3R8ZA 3UG1A 2CN5A 2A1AB 2FYSA 4M0YA 5FBOA 2GNGA 3QC9A 2XJ2A 2ZV7A 3RWQA 3OT3A 4M3QA 4BDCA 4FTQA 3HAVA 5M09A 4CGAA 1SMHA 1BYGA 2GFSA 4DE4A 4LMUA 4DITA 3HRBA 4YSJA 4O7SA 3LQ3A 4FT0A 1YW2A 4PPAA 5BVOA 4DGOA 5IMEA 4LGGA 3TV4A 3EYGA 3BYVA 2W4OA 3FY0A 3UO6A 2W99B 2VWZA 5HD7A 3QTUA 3DXQA 3LXPA 3OFMA 3VONA 5K3YA 3DKOA 2W96B 3CTHA 5FBNC 4F65A 5EKNA 2ZOQA 3IW4A 4IJPA 3QF9A 3RVGA 4MBIA 3TCPA 5DGZA 5ANEA 5H9BA 2ITXA 4WSYA 3QD0A 4RIYA 4USFA 2XYUA 3OW4A 1V1KA 2YDIA 3KMWA 2X2KA 3R1NA 2E2BA 2FVDA 5HEZA 3FI4A 4LV7A 1A06A 3QKKA 4RFZA 4QMOA 3W0SA 3MH0A 5EM7A 2CKEA 4I4EA 4Y5QA 2NP8A 2YM8A 4IADA 4EWHA 4IW0A 2PUUA 1M7NA 4DN5A 4QMTA 2DS1A 5CT7A 4DFNA 2FSLX 2YDJA 5HD4A 2YABA 4NFMA 5JSMA 2GFCA 5C1QB 2VO3A 4ALVA 2R3IA 4LOPA 2R4BA 1VYWA 4FEUA 3G33A 3K3JA 4EH6A 3QTSA 4DFYA 2G01A 4MH7A 3PG3A 4L46A 4AZWA 4D2TA 1OL5A 4ACHA 2XK3A 3HDNA 3EFLA 4JI9A 4PMSA 1IAJA 3QCXA 3Q9XA 2WMVA 1JNKA 3V5PA 2IEWA 3V8SA 5AP3A 5M07A 4FL2A 5M4CA 4RG0A 4DDGA 5D11A 4Z7GA 2JFMA 4E4LA 4A07A 3BU3A 2QLQA 3BGZA 4DFXE 3JVRA 2I1MA 4G6NA 3SW4A 2IVSA 2OZAB 4JBVA 4EUTA 1H07A 2YIQA 1JVPP 3MH3A 5E1SA 2VTJA 4V0GA 4DGNA 4FGBA 3LFEA 1TZDA 5CEOA 2E9OA 4JDKA 3WZDA 3R04A 1F0QA 2BAJA 4PUZA 3F6XA 5HNIX 1H26A 3KF7A 3M2WA 3HGKA 3KXNA 3F69A 4XMOA 2PY3A 3IPHA 3ZO2A 4FIJA 3TZ8A 4D4VA 4F4PA 4AS0A 4LOQA 4I5PA 4K9YA 2A0CX 4O0VA 2B55A 4AXEA 2XVDA 3ZO4A 2Y0AA 3BGPA 3RAHA 4M69A 3ERKA 2B9HA 4U3ZA 1KE7A 3UG2A 5CZHA 3NWWA 4DHJA 3IDBA 3GUBA 1OM1A 2G9XA 3BWJA 3FMKA 5LOHA 2DWBA 3CE3A 3GOPA 4S33A 2R3HA 2JDTA 3B8QA 1CKJA 3A62A 4XNEA 3S2PA 1H27A 4LI5A 2QHNA 4YMJA 4RT7A 3IKAA 3R7VA 3TYKA 3KXHA 4ENXA 3DBCA 3EHAA 3TV7A 3OCSA 4GSBA 4RMZA 5M44A 4DHIB 1U54B 4FSNA 4LRKA 4AT5A 4F78A 4J8NA 2BUJA 3WF8A 2HK5A 1XBBA 5H2UA 5JGBA 2JAMA 3R1SA 4U6RA 2G2HA 2PVMA 4R1YA 1SM2A 4M7IA 3FLSA 4EK8A 4USDA 4H05A 2PZ5A 3FMLA 5HX6A 4AW5A 3LMGA 3V8TA 3II5A 1Q41A 1UU3A 5HQ0A 5L2WA 3AT4A 3BLQA 5CAPA 2W1IA 3P7CA 2W5AA 3QA8A 4GG5A 3I7CA 3TNWA 3F5GA 3S4QA 5JQ5A 2DYLA 4GMYA 1QMZA 2VU3A 1PKDA 2I40A 3RWPA 4DG2E 2X4FA 3SW7A 4LRMA 3W2CA 5H8BA 3QD3A 4P4CA 1VR2A 4IJ9A 1KV1A 3CIKA 3A7FA 3SHEA 4FOBA 2UZVA 4QMUA 4UYNA 3VJOA 3WF9A 4ACMA 1QPEA 2PL0A 3KXXA 4Y83A 4ZTLA 3RCDA 3DAKA 5J5TA 3Q5IA 4C3RA 1JKKA 2HW6A 1W2CA 4CZYB 3PPJA 5J7BA 3O8PA 3HMNA 3PXQA 4L6QA 4RVTA 2PZIA 5EI8A 4AFEA 3ALNA 3BHYA 2VTLA 3DB6A 1UWHA 4FKPA 4PNKA 4ACGA 4ANQA 3HUCA 3IK3A 2PZRA 1PMEA 2VWYA 4MXOA 4U42A 1U54A 3IGOA 2W1EA 5TT7A 1H8FA 4GT3A 4EOMA 3D7ZA 5LVLA 5CAOA 5I9XA 4Y8DA 2CPKE 4PL5A 3UQCA 5KKRC 5DI1A 5FXRA 4DTAA 1T45A 4UMQA 4YHFA 2C5VA 2RSVA 4FICA 4CQEA 4HVHA 2J7TA 4YJNA 5FD2A 1WFCA 5HX8A 2Z7LA 2GPHA 4FE2A 3ET7A 1WVWA 4AOIA 3NUPA 3LLTA 3UNJA 5AR8A 1Q61A 2BALA 4KA3A 5GIPE 5K9IA 2R3QA 4PP9A 2XF0A 2B4SB 4NUSA 2UZEA 4Q5EA 2HCKA 2OFUA 2A98A 3PVGA 5E91A 3ULIA 4DINA 4FR4A 4EKLA 4F63A 3U54A 4HCTA 1U46A 4C35A 4C4EA 2PMLX 2XIYA 5AJQA 4D9TA 4B8MA 3QCYA 4PDOA 2V7OA 3HZTA 2B1PA 4KAOA 3E3PA 4TTHB 4ZMEA 4ANNA 2IZSA 2VTTA 3FYKX 1OMWA 3P1AA 2IVTA 4KINA 1GY3A 4WUAA 4EC9A 5HHWA 3VHEA 5EW8A 4FKJA 2UZLA 4IDTA 3NFGB 4FTRA 5JRSA 4DLJA 4JX7A 4BN1A 4IM0A 2JKQA 3ZTXA 3NGAA 4MD7E 2QOFA 1KV2A 4DFUA 2VTSA 2ETMA 4BCOA 4DEDA 1OUYA 1R39A 3MB7A 1REJA 2W1FA 4BBEA 4G3EA 4IZ7A 4IFCA 3OWPA 2X2MA 3DA6A 4FG9A 2XNMA 4MWIA 3BBWA 4EHGA 5JFWA 2GS7A 3RAIA 1OKYA 4K8AA 4D1XA 4DH7A 1YHWA 4QMZA 3ZRKA 3HDMA 3FMEA 1Q8UA 2C5OA 4QQ5A 1OIYA 4HYSA 5IG1A 3UMWA 5E8VA 1ZAOA 5LJJA 1YWVA 3FLYA 4DGGA 1JSUA 1YI4A 4D5HA 4F70A 4AXDA 3MJ1A 4X6QC 3KIOC 4BRXA 3QX4A 3QU0A 3OF0A 4F08A 4JAJA 5DPVA 1Y8YA 4NTTA 1RDQE 2NO3A 4IANA 3ZSIA 4CMTA 3SD0A 1QL6A 2C6EA 3LFSA 4IB3A 5IDPA 3M42A 3MDYA 3WILA 2JFLA 1CKIA 3MY0A 3UJGA 5L2IA 3W0MA 1MRUA 3U9NA 4DBNA 4YJUA 3C4EA 1U59A 2OI4X 2BKKA 5HO7A 3I1AA 3EL8A 4XG6A 4U45A 4FKTA 5J9ZA 2CDZA 2WD1A 3S00A 2AEGA 5IQAA 3OEFX 4K6ZA 3EOCA 3DFCB 2C6MA 4I41A 3Q4UA 5A3XA 4O83A 1OPKA 4YJOA 4DG0E 3RPVA 4AE6A 2C0TA 4EBVA 1STCE 3ORKA 3U55A 2XRUA 3A8XA 3AC5A 3D5WA 3R9RA 5AV2A 2UZUE 4GUBA 2UZOA 3DLZA 3UVRA 2ZJWA 4QMYA 4XLVA 3ORLA 3OS3A 3ANQA 3Q2MA 4WNOA 4WG4A 1G8KA 5FEDA 2UV2A 3F3VA 4RQKA 3ZM9A 3TDWA 2RG6A 4UMPA 3FLWA 5DG5A 4BWKA 1W83A 2BIKB 4HPUE 4ZZMA 2ONLC 3V5WA 5JN2A 3OOGA 5HG9A 5AV1A 4F9CA 2F2CB 2WTKB 3Q9WA 3DKCA 5BYYA 1IRKA 3FKNA 4MTAA 1QPJA 4MUQA 1PYXA 2UZDA 4E4XA 2FGIA 1XHAA 3FEGA 3CQWA 3G9NA 4L44A 3COIA 2C68A 4PTGA 2PUPA 3Q96A 3P5JC 3RM7A 2EWAA 3UZTA 4AWIA 4BCPA 3LXKA 1Y6BA 3H9FA 3QALE 5KX8A 2QOIA 5ETCA 1A9UA 3QTIA 5IH4A 2YCQA 4F6UA 4UN0C 4FBXA 4QPSA 3ZM4A 1MP8A 4QP3A 4UMUA 3QHWA 5LMBA 4O27B 3VC4A 4N70A 5CNOA 5DRBA 4BCMA 4EOLA 4EQMA 1TFFA 4C61A 4FRFA 5DT0A 4C34A 2ZVAA 2YWVA 5D7AA 2JBPA 4FSQA 4OR5A 4G2FA 2YM6A 2ZV9A 3COMA 3L9MA 4HYHA 4NTSA 4PTCA 4AN9A 3QGYA 1H1PA 4NKSA 5HORA 3GC0A 2C5XA 4JVGA 2IJMA 4DEGA 3AKJA 3C1XA 3CY2A 3IGGA 4ZY6A 4O22A 4TWPA 4ONAA 4AN2A 4DFLA 5CEKA 1ZYCA 4FIEA 3OTUA 2VWIA 5IQFA 5HCYA 3D5UA 5CEIA 2Y4IB 4AUAA 4C38A 4R1VA 3AD6A 3TKIA 1ZZLA 3VAPA 2HY0A 4IAIA 1VYZA 2BZHB 4GKIA 2J0KA 3ODZX 3NCZA 4MNFA 3W10A 5IUGA 1XH7A 3PVBA 2HWOA 5BV3A 5L8JA 3K3IA 1HCKA 4IVBA 3NSZA 5HIDA 3I4BA 4CT2A 2XMYA 5J79A 3G90X 4WNMA 3C4ZA 4L68A 4RA5A 2ZM3A 2XH5A 2B9JA 5JFXA 1H28A 5CF6A 1PYEA 2GHGA 3DBFA 2QU6A 4IX5A 3TIYA 5DIAA 4C3FA 4BIEA 3GU7A 3KMMA 3RAWA 4F64A 4KBKA 3GCPA 1YXVA 1JKTA 3R73A 3CLYA 4ZJJA 1BI7A 3QLGA 1JSTA 2C6IA 3W1FA 3W2SA 3C9WA 1APME 4FV4A 2X7FA 3PVUA 3QTZA 2XIKA 4M15A 2XNBA 5DA3A 3UIUA 3ACJA 4GYGA 5C4KA 3ZZWA 2CGUA 3LKMA 2ZB1A 3WYYA 3F2NA 3E8CA 2QURA 3IS5A 3MH2A 3FZOA 2ACXA 4GS6A 3VS6A 3SAYA 3FZPA 3GP0A 3O7LD 3QCQA 3VS1A 4CLJA 2P0CA 3R71A 4KKGA 2W06A