1ZOGA

Crystal structure of protein kinase ck2 in complex with tbb-derivatives
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
325
structure length
325
Chain Sequence
SKARVYADVNVLRPKEYWDYEALTVQWGEQDDYEVVRKVGRGKYSEVFEGINVNNNEKCIIKILKPVKKKKIKREIKILQNLCGGPNIVKLLDIVRDQHSKTPSLIFEYVNNTDFKVLYPTLTDYDIRYYIYELLKALDYCHSQGIMHRDVKPHNVMIDHELRKLRLIDWGLAEFYHPGKEYNVRVASRYFKGPELLVDLQDYDYSLDMWSLGCMFAGMIFRKEPFFYGHDNHDQLVKIAKVLGTDGLNVYLNKYRIELDPQLEALVGRHSRKPWLKFMNADNQHLVSPEAIDFLDKLLRYDHQERLTALEAMTHPYFQQVRAAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN KINASE CK2, alpha SUBUNIT
publication title Inspecting the structure-activity relationship of protein kinase CK2 inhibitors derived from tetrabromo-benzimidazole.
pubmed doi rcsb
source organism Zea mays
molecule tags Transferase
total genus 107
structure length 325
sequence length 325
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2005-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1zogA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1zogA02
5EDPA 2JKOA 3DTWA 4O6EA 5TKDA 4XMOA 2QI8A 3DDPA 3THBA 3VULA 1I44A 3QQLA 5GZAA 2O8YA 2ZM4A 4IH8A 4TZRA 1Q8UA 4UXLA 4DAWA 4GT5A 3TL8A 2BRGA 2HELA 4O7RA 5E8ZA 2BILB 2J5FA 2EU9A 2UW5A 3P79A 3QFVA 5M51A 3AMBA 1FMKA 4U97A 4O7LA 4R3CA 5K9IA 2KULA 2VX1A 1YWRA 1OL5A 4FV6A 4L8MA 1NA7A 4JQEA 1HCKA 4I6BA 1PXKA 3KVXA 4RVMA 4ALVA 4UMUA 2X8EA 5AAGA 3HP5A 4FIFA 3UZRA 4FZ6A 5JSMA 1CMKE 3P4KA 3GT8A 3KRWA 4YTFA 5L4QA 5DHJA 5AJQA 1ERKA 2WIHA 3SXFA 5F95A 1S9JA 5E8TA 4NCTC 2QVSE 3Q53A 4JOAA 4MXCA 4FV8A 2O3PA 3D7ZA 1ZOGA 3LXLA 4XV3A 4XP0A 4XV2A 4DFZE 1CM8A 1GJOA 2A19B 4UBAA 1Q62A 4RZVA 4DFBA 1JSTA 4IFGA 2OF4A 4TWOA 1J1BA 4GU9A 5DEWA 5DT3A 3RM7A 3TNWA 5M09A 4FTOA 2OICA 3ULIA 2UZUE 3AMYA 1MRUA 2UW4A 2UZWE 4O21A 3QKMA 4RJ6A 4UWCA 1ZYDA 5D11A 2RIOA 2Z7QA 3F3ZA 5KUPA 4NW6A 5EFQA 5KHWA 3LFBA 3TDVA 2CPKE 4FKLA 5JZJA 2F57A 3BWFA 3U87A 1PRYA 1AQ1A 1Y6AA 3EZRA 2YA9A 3FZ1A 2O0UA 5AP3A 2RFNA 4EK6A 3WARA 5CT7A 5LMAA 1JSVA 5LVOA 3FL5A 1Q8TA 3ATTA 1UU8A 2JAVA 3D5WA 3SX9A 3SHEA 3PJ3A 2CKQA 3OF0A 1P14A 3CPCA 3QD2B 4OBQA 5GIPE 4FSRA 4JG6A 1P4FA 1YI6A 2YCSA 3CSVA 2Y4PA 1REKA 2ONLC 2F9GA 3SRVB 5DI1A 4KKEA 4JAIA 3RVGA 3TNIA 4TYHB 1LPUA 2OIQA 4CFNA 3VS4A 5EM7A 4AN9A 3NUAA 4J1RA 4BZDA 3S00A 2YIWA 4FKGA 3G2FA 4G3CA 4YBJA 5BVWA 4QMOA 1H1RA 3LJ1A 3EFJA 4CTBA 2ITQA 2BAQA 2WXVA 3OW4A 4FTRA 3W55A 4CZUA 4RFYA 4LGHA 4PDSA 4RC2A 4D0XA 5CF6A 2B9FA 4HNFA 4I21A 4RQVA 4GRBA 2QR8A 3OTVA 4BRXA 4KINA 4BTKA 5LMBA 5HG8A 4S30A 5FP5A 3ENHA 3JXWA 3I7BA 4TYGA 3SOAA 5IG1A 3PWDA 4F6SA 5EOBA 2WMRA 4WIHA 2HZNA 3E8CA 3F5GA 4IHPA 4QMSA 2Z7SA 3QTUA 2R7BA 4Q5HA 4FKUA 2P4IA 4FTJA 4DEHA 3NUUA 5IA5A 3C4CA 5E8UA 4GYIA 3ZSIA 5DH3A 4QMUA 3RHKA 3C1XA 4YPDA 1IA9A 1QPDA 3D0EA 3KVWA 2R3GA 3E3BX 3NUNA 5T6KA 4DLJA 1PXIA 4AWIA 5AADA 2J0IA 2NP8A 4FKVA 4QP8A 4YHJA 2ETRA 5CF8A 3CD8A 1MUOA 1Q8YA 3COIA 2OF2A 4TWPA 5AV2A 4O7WA 4EH3A 4O0SA 3IDBA 2OJJA 4DC2A 2BRMA 2ZJWA 4ZSAA 5CLPA 3RK5A 4FSUA 4QMYA 4TT7A 3KULB 4I0RA 3E8EA 2YCFA 4NSTA 3QRJA 3HLLA 2C69A 3C50A 4AW0A 4JJRA 4MNEA 3VBWA 3VN9A 4PDYA 2QG7A 1ZYSA 3AD5A 1FPUA 1JKSA 5EM6A 4QPSA 3FMJA 2HW7A 2GSFA 4S2ZA 4S31A 4FE2A 2WTJA 1B39A 3KXMA 4OTIA 3R9DA 5JN2A 2W1GA 3CS9A 3E88A 4M13A 1G8AA 2BDJA 3AC1A 2LAVA 3ENMA 5DIAA 3QX2A 3ZO3A 2J7TA 3BE2A 4KBKA 3UPZA 5AEPA 2R3LA 5I9ZA 2W1EA 2XA4A 3OVVA 3MFRA 4JR7A 3PIXA 1IASA 1YHWA 3BELA 1JPAA 4C3RA 4NEUA 4LMUA 4Y5QA 5LWMA 4FR4A 2CGUA 3EKKA 4NH1A 2WAJA 3PFQA 4F9WA 5IKWA 5J95A 2YABA 2W5HA 4I1ZA 4JX3A 4FKWA 4FV9A 4V0GA 4IEBA 3UVQA 3LQ3A 4FT0A 5EHLA 3OOGA 3FLZA 2BKZA 3EL8A 5CAQA 2E2BA 3MJ2A 2BPMA 4BIDA 4D58A 4CMOA 4YJPA 4USDA 3ZUVA 2CHLA 4LRMA 2Y6MA 2HZ0A 4B0GA 1WMKA 3BU6A 4CYJA 3O8PA 3FMDA 4LL0A 3ZM4A 2CLXA 4W8EA 5CSVA 4BCHA 2G15A 3PVGA 4QQTA 3ZTXA 4BCMA 3QD4A 2QG5A 4AZSA 4FGRA 4BR3A 4K11A 1O6YA 5L2QA 3W1FA 4BDEA 4FKTA 5K0KA 2PVLA 4JX7A 5FXSA 3W32A 5L8KA 3QF9A 1VR2A 3C4EA 3KXZA 3PZHA 4MK0A 1STCE 4I4EA 4ERWA 4DCAA 1ZRZA 1OIYA 3A7HA 3I60A 2VO3A 3W8QA 5BNJA 2YIQA 3AMAA 3P86A 4O84A 4RLLA 2W1HA 3FHIA 4ITIA 3DK3A 4ZSEA 3FMMA 2B9JA 4GK4A 4U45A 2ERZE 1PMNA 4KRDA 4JG8A 3O23A 3QUDA 2OU7A 3TEIA 4L67A 2I7QA 5KKRB 3DB6A 4HYHA 1WBSA 3ZBFA 1JBPE 1G5SA 3EQPA 4QP6A 3FSKA 1OB3A 2PZPA 1JVPP 5J5TA 5A4QA 3MA3A 3VS0A 1QCFA 4BYJA 4CFUA 2YLEA 3W2SA 4D2RA 5BQ0A 2Y8OA 2ITUA 3FWQA 3GB2A 4F9BA 4Q9SA 5ETCA 3HRBA 3OXIA 4X6QC 4CRSA 4IVCA 1WBTA 4DTAA 2PVJA 2CNUA 3TDWA 2OG8A 3KMWA 4MF0A 3A4OX 4E73A 4HVSA 4E6DA 4FEVA 3DBCA 5H8GA 3R7EA 4O1OA 4YJQA 5IQDA 2PK9A 5DYJA 4YLJA 5DE2A 2BTRA 3HRFA 2B1PA 3FMLA 4PTEA 5HVYA 5JFSA 5ETFA 4Z7HA 4C8BA 4DEGA 3I79A 2IN6A 4IIRA 1XH5A 5KCVA 3P7CA 3E92A 4R7BA 4Y72A 3RNYA 3OUKA 3W10A 4LOQA 1UU9A 4I5MA 2XIRA 1QPJA 2XBAA 5FLFA 4C62A 3VHEA 3JPVA 3UJGA 1TQIA 3PG1A 1T45A 3R30A 5A54A 5FGKA 2PYWA 3PG3A 3MTFA 2QHMA 5E90A 3C7QA 4FTKA 2VWBA 4HGEA 5EYDA 4ANSA 4DGGA 4EZ3A 4FC0A 1Y91A 4OAVB 4IANA 3PSBA 2G01A 2RKUA 4ONAA 1LUFA 4BDKA 4W4WA 4O7NA 4USEA 4O83A 3W8LA 3LFQA 4LGDA 2VNYA 3DB8A 4FT3A 5C4KA 3W2PA 3CTJA 4XG3A 4ACHA 4EOOA 1YQJA 5DWRA 4A4XA 4FVPA 4O22A 4BFMA 4IVBA 4U80A 5L2IA 2WMXA 4ID7A 4RJ5A 4W9WA 4YP8A 4ACMA 5B2MA 3UIMA 3PXQA 3EQHA 4TXCA 4WBBB 4F0IA 4B7TA 1UNLA 1UWJA 3RPSA 4UEUA 3W18A 2ZB0A 3VUDA 2EB2A 4ZTMA 4D28A 3ZH8A 4GG7A 2C3JA 3RBWA 2ZMDA 4I3ZA 2XNBA 5EW8A 3V8WA 3HMOA 2B0QA 5ITAA 2GNGA 3OHTA 2FVDA 3MH1A 4X3FB 3O17A 3FLWA 2XJ2A 4BGGA 5AA9A 4E4XA 4G34A 2WIPA 2R3IA 4WNOA 4I93A 4RIWA 2R4BA 4W4YA 2OXXA 3UO5A 4TWNA 4WSQA 1O9UA 1H0WA 1QPCA 4FSMA 5CZIA 1Q8WA 5M06A 3MY1A 3N4VA 4IX5A 2GNLA 2YJRA 4U41A 5IDNA 1SVGA 3DPKA 3KL8A 4QPAA 2O2UA 5DGZA 3DNEA 2VNWA 3FC2A 4OR5A 3LZBA 3VW6A 2RFDA 2C1BA 5AUXA 5LCKA 4DG0E 4CQEA 5IPJA 2JBOA 4GFOA 2C6OA 3V6RA 4APCA 2X7GA 4DFUA 4NUSA 5CF4A 4CNHA 3GCPA 2XVDA 4ZJJA 3OCGA 4MBLA 3PPZA 3IW5A 4V05A 5JFWA 3TUDA 3DXPA 5TR6A 4HOKA 4FF8A 4V01A 3SLSA 3RCDA 3ZO2A 4AW1A 4F9YA 1U4DA 3DKOA 2GQGA 3EJ1A 5JK3A 4OAUC 2BZKB 5GNKA 4AS0A 4E5WA 1XH8A 1R3CA 1UWHA 4AG8A 2C5OA 2GNFA 4RMZA 2HOGA 1IAHA 2I6LA 3H10A 4CRLA 1XH7A 4TYJA 1OVEA 4FT9A 2B9HA 3GQLA 4YJRA 1ZWSA 2YJSA 3HUBA 3KCKA 5GJFA 4B6LA 4U79A 5FM3A 3L1SA 3NUXA 2JDVA 3FLNC 3NR9A 3ORMA 4LFIA 3NLBA 4C2WA 4FK6A 5EHOA 2XCKA 3WBLA 2YCRA 5IEXA 1Y8GA 3ZUUA 2YERA 5CWZA 4KUJA 3MYGA 1NY3A 1IEPA 4G3EA 2WD1A 4IJ9A 4K77A 5IQCA 4YNOA 3PLSA 2I40A 4IADA 5HICA 3TV7A 3ZXTA 5I0BA 3Q52A 3QD3A 3R00A 3KF4A 4K33A 3ZFMA 5I9WA 2WTKB 2OKRA 2WGJA 2R0UA 3KK9A 3F88A 4LUDA 4RLKA 3AD4A 1G8SA 3BHTA 5DR9A 1CKJA 2BROA 1U5QA 4BKJA 4DH3A 3QCSA 2QOKA 2WEIA 4LI5A 4J7BA 4PWNA 3ZMMA 4BGQA 4WBOA 2GTMA 1QMZA 1XBCA 3K5VA 5AP0A 4RJ7A 5F20A 3U9NA 3IG7A 4ARKA 4OTGA 4A9SA 4FA2A 4YZNA 2BAKA 1GZKA 5BUIA 3R9HA 4K0YA 1P2AA 4ZZNA 3U6HA 4QMNA 5M4FA 4D9UA 2JBPA 3GC9A 2CGWA 3JVSA 3WZDA 3CKWA 4IX3A 1PXLA 4AZTA 4BCGA 5ANKA 2C6DA 4PTGA 3EQBA 1TQMA 3IO7A 2OJGA 4GUBA 4G16A 4AXAA 4BHNA 4C35A 4HVHA 3QUEA 4PL4A 2CGXA 4AUAA 5E8VA 1OUYA 2AC5A 3UOJA 3ZYAA 3E7OA 4DBNA 3QRIA 2BUJA 2C6MA 2VU3A 4ZLZA 2OZAB 2H8HA 4ENYA 4EC9A 4FV0A 1GOLA 1NT2A 3AG9A 1UU3A 2F2UA 3VAPA 4BKZA 2WHBA 2GTNA 3RKBA 2OXYA 4WD5A 4YZBA 4D2PA 4D4YA 3UNKA 5C4LA 4H3QA 1ZLTA 4FL3A 5FM2A 3W2CA 3CEKA 4K18A 5J8IA 3GU7A 1DI8A 2Y7JA 3OWKA 3MJ1A 4WG5A 5AR3A 2XEZA 5H8BA 3ZFXA 2UV2A 4KAOA 4OBPA 2H6DA 3FL4A 3SW4A 4DH1A 3RM6A 3I6WA 4D55A 5KMJA 3FMHA 5HIEA 4HCTA 3QQJA 1BYGA 4AT5A 1Y6BA 5C9CA 4MD7E 3RALA 2B55A 1J91A 2IVSA 3MVMA 3EN7A 5K4JA 5KX8A 2YZLA 4JQ7A 5HESA 1PMUA 5HU3A 1Q24A 5E9EA 3LFAA 2W5AA 1KV2A 3ID6C 2W1DA 3LW0A 3DAEA 3WE8A 4BDJA 2VTIA 4BCKA 3CE3A 5HNGA 4KS8A 3PXYA 2DYLA 3ORTA 3R22A 5IQBA 3QZIA 3NMUF 2O64A 4G6NA 3F66A 2BDFA 2R3OA 1V0OA 5DT0A 3BHYA 4XP3A 3VWAA 4C58A 1SNUA 3F6XA 2REIA 5E8YA 4C34A 2F7XE 4WA9A 3UOLA 5AUZA 1W8CA 1XO2B 2FSOX 1LEZA 2JIIA 3BBWA 3G0FA 2HWPA 3NSZA 3P23A 3BCEA 3UO4A 4FTCA 2V5QA 4HGTA 5FXRA 1GAGA 4ZZMA 2PHKA 1H27A 1YRPA 3K3JA 2PMOX 3DBFA 3NYNA 3QRTA 2BHHA 4GS6A 3IOPA 4RFZA 5HZNA 1SZMA 3ZRLA 4RC4A 2BFXA 4QP7A 5CU6A 3MESA 5D7AA 4M0ZA 1UKIA 2V0DA 3E8DA 4N4SA 4P5ZA 3U4UA 3VRYA 4BI2A 2FYSA 4WG3A 1Q41A 1K3AA 1GIJA 2WTDA 4IAKA 3ZRMA 3FQEA 4E1ZA 4BBMA 4GK2A 1H28A 3KQ7A 2OJFE 5HBJA 2PVKA 5CAPA 1H07A 3KEXA 3WZEA 1UU7A 3FXZA 3VQHA 4E4MA 3GOPA 4MF1A 3H3CA 5IEVA 4L42A 4QTBA 5G6VA 3UTOA 3OBJA 4IWOA 4U9AA 5CQWA 4EKKA 4GKIA 5LQFA 1IA8A 4IACA 4MWHA 3PA4A 4QNAA 2DQ7X 3DAJA 1F5QA 4FEXA 2PWLA 1DI9A 4QTCA 2RL5A 3IECA 5JFXA 3EN5A 3ZZWA 5AM7A 4F1MA 3OEZA 1UV5A 2PZIA 3II5A 4O7ZA 2ITZA 4M69A 3DK6A 2X2MA 3Q4TA 3BYVA 3GC7A 5L8JA 3CQUA 4AA5A 4CT2A 3FKOA 4EJ7A 2YDKA 5C8KA 2VWVA 4YTHA 3W33A 4O0UA 3E7VA 4AGWA 4ENXA 3KRRA 3AT4A 5J1WA 2QD9A 4LM5A 1Q4LA 3OT8A 1OUKA 1WBWA 5HHWA 3ULZA 5CZHA 4BCNA 5HD7A 5HO8A 5JKGA 5KE0A 2GNJA 4DGLC 3CJGA 2H96A 3UP2A 4F70A 1NVSA 2B54A 2UZNA 2X1NA 3BYUA 1W7HA 3VO3A 3FMEA 5FBOA 4Z3VA 1ZYLA 4JDHA 5FTOA 4IVDA 1KE7A 4CG8A 1ZYJA 3OWJA 4TN6A 3A7GA 4FK3A 4D2VA 4KBAA 2YLFA 4R6VA 5IQFA 4D4SA 3DJ7A 3QL8A 1BMKA 4H1JA 3F5PA 2J0LA 2VWZA 2FSMX 2HK5A 3PPKA 3SGCA 3OWPA 2QOQA 4CG9A 3BYOA 2WMUA 3JY0A 4AFEA 5HCYA 1AD5A 2IZSA 4JRVA 4QYFA 4TNDA 3RMFA 4UMTA 3PRFA 3VF8A 1V0PA 2CCIA 3VVHA 3MIAA 3F3VA 3NVKI 5D1JA 3A61A 2XIYA 4XCUA 4J8MA 4FNYA 2R3HA 4FTQA 4RIYA 4XH6A 5FEEA 4IB0A 3LJ0A 4RIOA 4BWPA 1PXNA 5HVJA 3V51A 1GY3A 3KREA 3UQGA 3DJ5A 5HG5A 4DFXE 4ASZA 3CLYA 4FZFB 3LXKA 3QRKA 4WKQA 2EXCX 3AGLA 3I0QA 4O7VA 4O0WA 4PX6A 3RAKA 2HZIA 4QP3A 4AP7A 1A48A 5EM5A 5FRIA 3ZO4A 4YSMA 4ZS4A 4BTMA 3UODA 3DV3A 4UYAA 2PUUA 4B9DA 3FBVA 1P5EA 3L8SA 1R0EA 4FSTA 3G6GA 4F7SA 5HD4A 3BV3A 4IZAA 4EQMA 3FZRA 3CQEA 3BRBA 4HVGA 3ORXA 3LM5A 5HO7A 5CSWA 5KMNA 4D2TA 3BBTB 3O8TA 4O27B 2YM4A 2YM7A 3RGFA 4C4HA 1CTPE 3DZOA 3O96A 2VTTA 3EYHA 4R7HA 3JS2A 4BKYA 5J9LA 2PZRA 1XH6A 1V1KA 4BICA 2XS0A 3A8WA 3F5UA 2OK1A 2UZBA 3QKKA 4J95A 5HORA 1H4LA 5JRSA 4HVDA 4PMTA 1LP4A 3ORLA 4WUNA 1FINA 4DT9A 1QPEA 3DTCA 2PTKA 3R8ZA 4XG2A 3DT1A 4UX9A 3QTIA 3UIUA 4C37A 1ZY5A 3A62A 3UG2A 5CAVA 5TO8A 3RPOA 4RT7A 3UG1A 4A9YA 5IF1A 3LCOA 1KE8A 4KS7A 3UP7A 4PDOA 3P08A 3TNQB 3NUPA 1PY5A 3UVRA 2W1IA 2XRUA 4FG7A 4G3FA 5AP7A 4NCTA 4PQNA 1OZ1A 2YEXA 4AE9A 4EYJA 5B7VA 1OMWA 4GUEA 5IA2A 3A8XA 3HAVA 5EOLA 3MH2A 3DKFA 4BCPA 2UZOA 2XK8A 2XEYA 4O91A 2PUIA 3HYHA 3NCZA 4FSZA 4D1ZA 3NNWA 5FBNC 4XV1A 2BZHB 3I1AA 2GNIA 3R63A 4FIJA 1M2QA 1GZ8A 1ZMUA 3CBLA 2JDOA 4RC3A 4BC6A 2XK3A 4XG8A 2OSCA 2NRYA 3DFCB 4AX8A 4IFCA 1OITA 2A0CX 1E1VA 2HWOA 1TVOA 4BCOA 2X9FA 5CENA 5TF9A 2PL0A 4FIGA 2UVXA 5ANEA 5HG9A 2WB8A 5DRBA 2UZVA 4J99A 3QQFA 5CI7A 2GQRA 3FV8A 4XX9A 1BLXA 3QRUA 4QTEA 5DNRA 4ZMEA 3E3PA 3LFFA 2XNOA 5K4IA 1XQZA 4EOKA 4O7SA 3GU5A 2R5TA 2QODA 1BX6A 3LFSA 2QR7A 3R01A 4J97A 4MBJA 2WKMA 4U0IA 1ZOEA 4YZDA 3S2PA 3TKUA 3IGGA 1URCA 4YNEA 2IW6A 4QYYA 4B8LA 2W9FB 1I09A 4O1PA 2ONLA 3P5KA 3LM0A 1VZOA 4EHGA 4ZIMA 4DE4A 1MP8A 2Y4IB 4HGSA 4HW7A 3PY1A 1PHKA 4FUYA 3Q9WA 3ZONA 4C4IA 3FSFA 3R1SA 2IW8A 5D7VA 5G1XA 3RI1A 5BX0A 5EQYA 4G2FA 1Z57A 4Z16A 5EDRA 3OP5A 2W4OA 3IKAA 4KD1A 2VV9A 4UZHA 2UW9A 3Q04A 1KOBA 1JKLA 4LOPA 3MFSA 3R6XA 2CKOA 4DTBA 3UIXA 1VJYA 2VWWA 1VYWA 2BFYA 3O50A 3FMNA 4RJ4A 4X6RA 4CSVA 5E91A 3CGOA 4DF3A 4JBVA 3MY5A 2W4JA 2V7AA 5LCJA 3DGKA 4IM3A 4RRVA 4TWCA 4WG4A 4C57A 4C4GA 2CSNA 4FZ7A 3QQKA 4H1MA 2W1FA 3QC9A 4XBUA 3QTQA 3OWLA 3U51A 3QBNA 1KE9A 3KU2A 2CKEA 3MVLA 4KA3A 5EH0A 4BI1A 2WPAA 3EFWA 4CKRA 2P2HA 3C5IA 5GINE 4ZS0A 2HXLA 3LQ5A 4UN0C 4NL0A 2Q0BA 2SRCA 3QCXA 5M57A 1PMEA 4NM0A 3GFEA 3F7ZA 4MTAA 3QWKA 1BUHA 5DA3A 4QTAA 3SV0A 4M14A 3IK3A 4K2RA 2XK7A 3F82A 4FUXA 3TWJA 3VW8A 4EORA 3VRZA 3TT0A 5AX9A 3OXTA 3DS6A 3KKVA 1YXTA 3UZPA 4ASEA 1GZNA 3B8RA 4OW8A 5CSXA 3NGAA 2XJ0A 4QMWA 2JKQA 4F9CA 2J4ZA 2OZOA 3D4QA 4IBMA 3C0GA 5IQEA 4A7CA 3UC4A 4GYGA 4GKHA 4A9RA 3VIDA 3DXNA 1AGWA 2QOLA 3MH3A 2PULA 3R28A 5HLNA 5AV0A 3TM0A 2PVHA 3NIEA 4EYMA 3EL7A 4FV4A 2R3MA 2V55A 3BV2A 2C5NA 3H30A 3S0OA 4FL1A 1WBOA 2X9EA 3HX4A 3VUGA 3KA0A 4IM2A 5DT4A 4R78A 4ZSJA 1Y57A 5I5ZA 3ZLSA 1JOWB 2W4KA 4IX4A 3T8OA 4QQCA 5BUJA 3AT3A 4D5HA 4L44A 3MA6A 5D41A 5AR7A 1WVXA 3MV5A 3QC4A 3SQQA 2I0EA 4QMPA 3FLSA 1DAYA 5EKOA 3WF5A 1DM2A 4JIKA 4BGHA 4XG4A 3BHVA 4AOJA 2I0VA 3BKBA 4DGMA 1OIUA 5ICPA 1L8TA 4O7TA 3HEGA 5ANGA 2W9ZB 3EQGA 4RWKA 4R1VA 1KWPA 4I5PA 4CV9A 4AQCA 4HVIA 2I0YA 1H8FA 2CCHA 3PSDA 4K8AA 4NKAA 4RQKA 5CXHA 5EW3A 5HOAA 4O86A 3CPBA 4IWPA 4KWPA 5EYKA 5KO1A 3FKNA 3FZTA 1Y8YA 3IGOA 3BI6A 1U59A 3DKGA 4IX6A 3U54A 4JDJA 3BLQA 3BPRA 4IMYA 4BCIA 1Q3WA 3OROA 2JFMA 4EQCA 1ZOHA 2JD5A 3ANRA 4GEOA 3Q60A 2OJIA 3D83A 3TKIA 5K5XA 4USFA 3M1SA 4YZCA 3U9CA 3DY7A 4F7LA 2OWBA 5AUYA 5ANDA 2PMLX 5IUHA 3UVPA 4F9AA 4WRGA 3DNDA 4YGAA 4EOIA 2PE2A 3SDJA 4IW0A 3UYSA 4KIKA 2ZV7A 3ZO1A 5FTGA 4R7IA 2F49A 2WELA 4ZJIA 3PTGA 5ETIA 2G2HA 3FY0A 4II5A 2IVTA 5J7HA 4ITJA 5JRQA 4XJ0A 4R3RA 1URWA 3V5JA 4BDAA 4R1YA 3NRMA 4PMPA 3UBDA 4O0RA 3GU8A 4I24A 2VO6A 5HE3A 3UQCA 3QCQA 4IJPA 2BR1A 3JR1A 1M7NA 4ZLOA 3O71A 2C6TA 2G2FA 4BI0A 2AC3A 3D7TA 4CVAA 4YTIA 3PY3A 5L3AA 3K5UA 3PA3A 1J7IA 4A9UA 2G2IA 2XM9A 3H0ZA 2F7EE 2PSQA 3F2AA 3QA8A 2X0GA 3QXOA 4MQ1A 5AIRA 4MXXA 5AWMA 3VUIA 2VX3A 1H1PA 4P2KA 1RJBA 3VNTA 3OTUA 4O0XA 2P55A 2Z2WA 5LMKC 2HXQA 1J3HA 2DS1A 4PP9A 3AC5A 1Z5MA 4UZDA 3PP0A 3ROCA 4YU2A 5A9UA 1JKTA 3T9IA 4FV2A 1SVEA 2V62A 1NXKA 3LAUA 4OTPA 2V22A 2VTAA 3C4WA 2FO0A 3PWYA 1NVQA 2VTPA 4JT3A 2O5KA 4G17A 4D9TA 1OBGA 4APPA 3EKNA 4OTWA 4I6HA 1GIHA 2OI4X 3GXLA 4X3FC 3E62A 3RZBA 2UVZA 4R77A 3RZFA 1EH4A 2BIYA 2VD5A 4QD6A 3RCJA 2HY0A 4FG9A 3OCBA 5IA3A 2X81A 4MX9A 4EQUA 5I9VA 4YR8A 2EXEA 3G9NA 3G33A 3FKLA 4MNEB 4CKJA 4JBOA 1FVVA 3H0YA 4NM7A 5I4NA 3N51A 1U46A 3ODZX 2Z8CA 4C59A 4XHKB 4F63A 5EHYA 4FZAB 2VTLA 4AOIA 2ZV8A 4C61A 5K3YA 3BX5A 3VS3A 5GZ8A 5CSHA 4IC7A 4EBVA 4EOJA 3EOCA 3UNJA 3WF8A 4H05A 2YFXA 3AOXA 4WUAA 3C4XA 3OY1A 4N70A 3KXXA 4U44A 4GK3A 4CFXA 3ELJA 4DTKA 4OTRA 3IW8A 4QMXA 2AUHA 5HEZA 3HKOA 4H3BA 4E7WA 2GMXA 4WNPA 3R8PA 3VBYA 5A6OA 2C47A 5D12A 4GSBA 3LMHA 4MXOA 5CU3A 4MH7A 3UYTA 3GQIA 4V0GB 5IQHA 3QTSA 4AT4A 4EBWA 1UA2A 3KCFA 4DITA 1U54A 3HZTA 3HMPA 4EL9A 2ZVAA 3ZBXA 3TKHA 3KY2A 4NK9A 4ZTLA 3W2RA 2GHLA 1YXXA 3BLRA 3FI3A 3Q5IA 4L3JA 4NTSA 5DR2A 2E9VA 3SC1A 2JIUA 4X2JA 3EMGA 4ASXA 2W99B 3G5DA 2Q83A 4L00A 4ZY6A 2BZIB 2VTOA 3AQVA 4PRJA 4LYNA 2VTQA 4O6LA 3ZC6A 2I0HA 2CNQA 3BYSA 4CKIA 4DBXA 1YDRE 3VC4A 2WTKC 3LFNA 4GVJA 1M2RA 4E5BA 4G6OA 5HI2A 2YITA 2XP2A 3ZLYA 4DN5A 1OI9A 2CJMA 1O6KA 3R2BA 3ROYA 3PE2A 4JNWA 4F7NA 4YUQA 4PPBA 3QTWA 3V5LA 5L6WL 5BMSA 4NIFA 5CAOA 4FNXA 3L9LA 3R7YA 1FVRA 4QMMA 2XKEA 4X0MA 2ITYA 1XHAA 2CN5A 4YLKA 5AIKA 3RPRA 3ZUTA 4K6ZA 4RVKA 4I94A 3R7VA 2YM8A 2WTIA 4OT5A 4FYOA 4W4XA 3RAWA 4CTCA 2FUMA 4FKPA 3MW1A 4LRJA 3FDNA 2FB8A 2YWVA 3QLFA 5CEOA 3F9NA 2Y6OA 3IPHA 3P7AA 5HNBA 5AUUA 4XOYA 4CCUA 4FSWA 5JH6A 2CKPA 3OY3A 3RK7A 4CZYB 3KN6A 1PXJA 4CD0A 2PVNA 4X2GA 5CASA 4FMQA 2J90A 4FNWA 4GV1A 1XBBA 2YISA 3MS9A 5AP5A 4F65A 1SVHA 2UW0A 4K9YA 3TZ7A 4D2SA 3C4ZA 5AM6A 3FXWA 2HENA 2PZYA 5A4CA 1YDSE 4EC8A 5KNJA 2QOHA 2VTRA 4OBOA 3BZ3A 5KMIA 5EW9A 3LOKA 2ZV9A 3R9RA 2X39A 1M2PA 3DOGA 1OL6A 3D94A 4M97A 5AR4A 3KMMA 3LVPA 2J2IB 5JGDA 3IDCA 2XH5A 4FL2A 5IA0A 4ZJVA 5K0XA 3A99A 3LCSA 4E26A 4EH2A 3F3WA 3A7IA 4FOCA 3V5TA 3WE4A 3E64A 2QC6A 3AD6A 4F0GA 5KBRA 3C4FA 1OPJA 4D4VA 4E8AA 2IG7A 4PL3A 3R0TA 3DU8A 1O6LA 4KBCA 5JGAA 2R3FA 4IB3A 1WFCA 5C26A 1M52A 2JKKA 4NM5A 4FTUA 4M8TA 3NIZA 1H1SA 4O81A 5BVOA 4HPTE 3HV7A 3AT2A 4ANQA 3PDTA 3I0OA 5EI8A 1R0PA 1G3NA 2R9SA 3RTPA 4WSYA 3WIGA 4CXAA 4A06A 3V8SA 3G9LX 5A4LA 1BI8A 4CT1A 3QKLA 2ITPA 4G3GA 4FKSA 5E8XA 4EZ7A 4FICA 4BDGA 1F3MC 3EQFA 5FEDA 4M68A 4YJTA 2VWIA 1JLUE 4CZTA 5FP6A 3U6IA 5CS6A 4PNIA 4NYEA 3FQSA 3QYWA 3SA0A 4I5HA 2PZ5A 3F69A 4XUFA 2EVAA 3BEGA 3O8UA 1W84A 2OFVA 4HPUE 3LCKA 4ZEGA 2B52A 5E92A 3KB7A 5T3QA 5AFVA 4U42A 3FXXA 1YXUA 1HCLA 4FBXA 4AF3A 5HIBA 2OFUA 5M53A 2F4JA 4YMJA 3QAME 4G31A 5IQAA 3KC3A 3NUYA 4CFVA 1A06A 3W2QA 3HUCA 1YI4A 5JZNA 4RX8A 3GNIB 4XRLA 5B2KA 4FI1A 5E1EA 2JC6A 3R8MA 3EQCA 4NT4A 4G9RA 4QMTA 3DFAA 1FGIA 1YHSA 3L8XA 2R3QA 5A6NA 3H4JA 3ZC5A 2R3KA 2VN9A 4TKSA 3WIKA 2PMNX 3AC2A 5F1ZA 4ZTRA 4B99A 2BZJA 3QCYA 3V04A 1OIRA 1Q8ZA 3CC6A 1ZAOA 4UXQA 5CALA 1VYZA 2B9IA 2FSLX 4AGDA 1UVRA 3I5NA 3PSCA 2QHNA 4AW2A 1PJKA 2XK6A 4DCEA 3A2CA 3UZTA 3UC3A 4R5YA 4JI9A 3NS9A 3CP9A 3BLHA 2QKRA 5CEPA 4N57A 4IZ5A 4N0SA 3VBQA 4OTHA 2OIBA 3EFKA 1J7LA 2OH4A 3VUMA 3Q32A 2C4GA 3TUCA 2O65A 2C0TA 1JAMA 2BRNA 5I9XA 3FI4A 2PVMA 4ANBA 3LCDA 5HGIA 1TKIA 3R7GA 3QA0A 3TTIA 2ACXA 4CEGA 5HVKA 4RX7A 4TNBA 5IUGA 3PXKA 1XWSA 2VWXA 2HYYA 4G6LA 4GT4A 4WO5A 5I3RA 3HDMA 5AR2A 4FGBA 3ZSGA 4FV5A 5AMNA 3P1AA 2CGVA 3FZSA 2P33A 4D0WA 4ZTQA 5J5SA 3PUPA 4GCJA 5FQDC 3KFAA 2FH9A 4QNYA 3HV6A 2VGPA 3HA8A 4RIXA 4X3JA 5F9EA 3EQIA 1YWNA 2HCKA 2IVUA 5CQUA 4C38A 4EH6A 1HOWA 1OKWA 2J50A 2Y9QA 5DVRA 2IPXA 2NO3A 2FSTX 1XR1A 4IAZA 4ZXTA 2XYUA 5EI2A 3K2LA 3RAIA 4O82A 2J6MA 2YIRA 3NX8A 4YJUA 3I7CA 2QCSA 4J98A 5CNNA 3UGCA 3KXGA 5AV4A 4NKSA 2ETKA 2ZMCA 3HV5A 3UMWA 4C4JA 4PPCA 4AGUA 4NM3A 1FBNA 2BALA 1GIIA 3Q4ZA 4J96A 5LOHA 4NJ3A 1SMHA 4ANLA 4NJDA 4X2NA 5CT0A 4QYHA 4E6CA 4MBIA 5BVFA 2XK9A 2ESMA 2IZUA 3JY9A 3FPMA 5CANA 4HJOA 3EZVA 2B7AA 2WMQA 4QP9A 3RPYA 5HNIX 2XF0A 4Q2AA 3QGWA 2HY81 4TRLA 3AC4A 4F1OA 5IDPA 1WVWA 3IDPA 4YJSA 3QHWA 2VTHA 4MCVA 2WMWA 2GFSA 3R04A 4ERKA 3NAYA 3T3UA 3N9XA 2JDSA 4M3QA 4OTFA 3HP2A 3QZGA 1KE5A 2C5XA 2GHGA 2GS2A 3HDNA 4RWIA 3WF9A 4AT3A 2YM5A 2QURA 2GQSA 3F3TA 4A4OA 4FEUA 3ACJA 5C8NA 4U5JA 4RVLA 4IQ6A 4AE6A 4HCUA 2E9NA 4BBEA 4F0FA 4EH4A 3MVHA 5AX3A 4RJ8A 4YBKA 1WBVA 3GFWA 4EJNA 4AU8A 1XJDA 3A7FA 3CXWA 2RGPA 4F1TA 5DBXA 4JRNA 2X2KA 5DOSA 1M17A 1YOJA 1ZXEA 4EK8A 3EFLA 3JUHA 3MPAA 1M14A 2X4FA 2W5BA 5AUVA 4PV0A 4QOXA 5LARA 3FLYA 2XM8A 4DLIA 1R1WA 1MRVA 3QZFA 3EHAA 2ZM1A 3E63A 4QQJA 1XBAA 4CYIA 1L3RE 3TN8A 1FMOE 4AZWA 2O63A 5C01A 3POZA 1BL7A 5FEQA 4FKOA 4JVGA 4RX9A 5JGBA 3DLSA 4KIOA 1PKDA 2UW6A 5CEKA 4BDIA 4EONA 3PPJA 1DS5A 1JQHA 3Q6WA 2CN8A 4WT6A 2UZEA 3PZEA 1E9HA 4HYUA 2BCJA 3F61A 4AA4A 4ZTSA 4B8MA 5IH4A 3A60A 4IB5A 1W82A 3EN9A 1RW8A 3KK8A 4E5AX 3PLAE 4W8DA 3B2WA 3OBGA 4FV3A 4MXYA 4FKJA 5KMKA 3VUHA 5LVNA 2FA2A 4I23A 4RPVA 3OG7A 4MYGA 3VS5A 3ZRKA 2LGCA 5A14A 1SNXA 2WFYA 4L45A 3V01A 1IAJA 5ETAA 4ZY5A 4EK4A 2UZTA 1K2PA 4WRSA 2VUWA 4DGOA 3R8VA 5FDXA 5GZ9A 2QKWB 3Q9ZA 1MQ4A 3OXZA 3D14A 4UMQA 5F94A 4QMZA 2W05A 3ZLXA 4ZMFA 2J0KA 2Z7LA 5HG7A 3NPCA 3MY0A 4GFGA 3TJDA 3DK7A 4MXAA 4DFYA 4FTAA 3T9TA 4KSPA 4ZOGA 4QMQA 1QL6A 4RVTA 3QQHA 2UW7A 3E87A 3CTQA 4YJVA 3NEWA 3GGFA 2QOOA 5EYCA 1H25A 1CDKA 5DG5A 1YOLA 3QTZA 3PIYA 3TNPC 3DJ6A 3ZCLA 2R64A 4TTHB 2Z02A 2Q0NA 3R9OA 3R71A 4C33A 2YM3A 1RDQE 4EOPA 2WQNA 3SRVA 3CY2A 2ITXA 2WMBA 4TYHA 4YPSA 4N6YA 2VTSA 5I3OA 3TXOA 1RE8A 2GS6A 4MD8E 3HA6A 4XS2A 2IZRA 3PVUA 2Y4IC 4FG8A 4OT6A 2WQEA 1PXOA 3L9NA 4NU1A 3V5QA 2XNEA 4EOMA 5TT7A 4QRCA 2QLQA 2JKMA 1YXVA 4GMYA 3VJNA 3MDYA 5A4EA 4KB8A 2VX0A 3BQCA 2E9OA 4DFLA 3PYYA 2WU6A 3FY2A 1UKHA 1WZYA 2OGVA 2XRWA 4J53A 3ALNA 4YZMA 4GW8A 5FWKK 2UW3A 4C3FA 4F6WA 4DHFA 4XYFA 3NZ0A 2WZJA 4G1WA 4D1SA 2W7XA 4LOOA 3RP9A 3RPVA 1PYXA 2W06A 2W17A 2XKFA 1K9AA 5EI6A 5HCZA 4BIEA 4M69B 3UDBA 4D2WA 5L6PA 4M15A 2RF9A 3Q5ZA 1Q61A 3R8UA 5DEYA 4YTCA 2VWYA 5KBQA 3LHJA 3RNIA 2OLCA 2JDTA 4I22A 3R9NA 2EB3A 5CYIA 5AR8A 4EH9A 5L6OA 4IM0A 4U3YA 3KMUA 4NW5A 3TG1A 1ND4A 3T3VA 3D9VA 4MNFA 2VRXA 3M42A 3GUBA 3MH0A 5FDPA 3GVUA 1H1WA 3GU4A 5HTCA 5LVPA 4PDPA 4PMSA 4O0TA 4TYIA 4F99A 2WMSA 1PXMA 2C6LA 4D5KA 4FVQA 1MRYA 4O2ZA 4YSJA 2PU8A 2GU8A 3EQDA 3LMGA 4XG6A 3GC8A 4MKCA 2WU7A 4EI4A 3IS5A 3UQFA 5CX9A 5DLSA 5C8MA 3HMIA 3U55A 3VS1A 3NUSA 4JDKA 1PXPA 2BTSA 2CMWA 2PUPA 3QGYA 3BGPA 4BHZA 3QHRA 3C0IA 3DA6A 4GFMA 5BPYA 1JSUA 5J9YA 3TV4A 4G9CA 3MN3A 4ACDA 3HAMA 3NNUA 2FGIA 2R3JA 5C27A 1ZZLA 2OXDA 4ACCA 3DKCA 4OTQA 5E1SA 2R3PA 3KULA 4HZSA 2JITA 4FTTA 3VUKA 5IMXA 3A7JA 3Q3BA 5HQ0A 5T68A 2XIZA 3SD0A 5KZ0A 3ZM9A 4NZWB 5CXZA 4FVRA 3V5WA 4EKLA 3F2RA 3LKMA 4IZYA 1OBDA 3WILA 4EEVA 4RIYB 3VBXA 1OKZA 5IZFA 3R1NA 4LMNA 2GNHA 3O7LB 4KNBA 3MSSA 5AR5A 4RJ3A 4AN2A 2C1AA 3R02A 5GHVA 2IJMA 4KSQA 5JEBA 3AC3A 4BB4A 3O0GA 4FIEA 2YDIA 4RBLA 4L46A 5FUTA 3C51A 3QD0A 3C0HA 4UB7A 2JLDA 5FG8A 2VO7A 3LMIA 2QOBA 4GT3A 4DH8A 3ZHPC 1J1CA 4Y8DA 1H08A 2AYPA 3PJ8A 5IUIA 4OUCA 4EK3A 3EYGA 4DA5A 1PW2A 4XEYA 2WMTA 5HO6A 5L2SA 3W2OA 4FEQA 3CTHA 5LVMA 2BDWA 2R3RA 2A1AB 2J0JA 1W0XC 4X7QA 3G15A 2ITVA 4J8NA 4L3PA 2X8DA 4AFJA 3RINA 3ORKA 4I6FA 3FJQE 1W83A 1ZMVA 3BGQA 3Q6UA 1XH9A 4F6UA 2ZB1A 4BZOA 2GHMA 4M66A 3PVWA 5CY3A 2C3KA 4BZNA 2IW9A 3KN5A 2QU6A 2BRBA 3VUTA 5L8LA 4G5JA 3QTXA 3VBTA 3VS2A 2EWAA 4E3CA 5CEMA 5M44A 3H9FA 1XKKA 4TY1A 3OEFX 3P0MA 2ZAZA 4GU6A 3CCNA 1JKKA 2C0OA 4U3ZA 3IW6A 2GPHA 4OLIA 3Q2JA 2C3LA 4DH7A 4F08A 4IE9A 4AN3A 4RGJA 5IH6A 4DEBA 4A4LA 3V6SA 1FGKA 4C02A 2HIWA 2X4ZA 4IDTA 2ITOA 4U7ZA 3LPBA 3ZS5A 2X7OA 4IDVA 2YZAA 2YIYA 3NNXA 4I92A 4JS8A 4LV5A 3Q9XA 4MVFA 4A9TA 5BUEA 4IAFA 3UMXA 3BU3A 4HCVA 5IQGA 4FX3A 4DGNA 1APME 2QOFA 3MB6A 5HX8A 3TTJA 3C5UA 1NW1A 2QO9A 4EWQA 1YDTE 3ZU7A 4KKGA 1LR4A 4J52A 2ITWA 5KKRC 1IRKA 5DR6A 5GJGA 3NDMA 3M2WA 4FYNA 2R3NA 3V8TA 3KXNA 3CQWA 4WNMA 3G0EA 4IAIA 4CLJA 3D15A 4YC6A 1XH4A 3Q96A 2VTNA 4AA0A 2C30A 1IR3A 2WTVA 4FT5A 4YO6A 3PA5A 3OCSA 3Q4CA 2PPQA 1WAKA 2OO8X 1YW2A 5AP4A 3NYXA 4L7FA 2XNMA 4PF4A 4WNKA 4XLIA 3RAHA 4Q9ZA 4UV0A 3L8VA 3IONA 3OZ6A 3U4WA 1YVJA 3TZMA 4RA4A 2WQOA 2IVVA 5GIOE 5CU0A 2X6DA 3SVVA 1IG1A 1U5RA 3B8QA 3DBDA 3GCSA 4FTIA 3CJFA 3OMVA 4XNEA 2YACA 4HNIA 3TIYA 4G3DA 4PUZA 2HAKA 1W98A 1PKGA 4WOVA 4EH7A 2BVAA 3KXHA 4R8QA 5LVLA 4BTFA 1OL1A 4FV7A 4O38A 3WYYA 2YAKA 4L6QA 5M4CA 4TPTA 2YWPA 3F5XA 3QYZA 4DYMA 2WO6A 3D5XA 3LFDA 4EUTA 4Y73A 3S95A 1J7UA 1BKXA 5J79A 2C6KA 2Z60A 5JT2A 1F0QA 1OIQA 3I4BA 4DEIA 1H0VA 1YOMA 2YN8A 3G51A 4NTTA 1S9IA 3KGAA 4PMMA 4UALA 3RJCA 4AZEA 4FKRA 3NVMB 1GNGA 2XMYA 3PXFA 5LMKA 1KSWA 4MEDA 5BVDA 3BIZA 1OL7A 3U6JA 5ACBC 1REJA 4FNZA 4C4FA 5B0XA 2R7IA 4AACA 3LFCA 4IC8A 4EH5A 3QU0A 4EHEA 4PNKA 3TV6A 4QO9A 3E5AA 3K54A 2OH0E 3FYKX 3MFTA 4ZLYA 4C0TA 4P4CA 4R5SA 5HIDA 4IXPA 4M0YA 4X2KA 3FI8A 3EQRA 1FQ1B 3GI3A 3MVJA 3CD3A 4FTLA 4X3FA 5CU4A 3NWWA 5H3QA 5CVFA 4ZAUA 3DZQA 1WBNA 3JYAA 3R1QA 4JAJA 5BVKA 4DINA 4CV8A 5A46A 3MFUA 5CI6A 3PJCA 2NRUA 2C3IB 2RFSA 2WOTA 5CTPA 2X7FA 4N6ZA 4DEDA 4E4NA 4JBPA 2BIKB 3Q2MA 4BDCA 3D2KA 3F3UA 1DAWA 3FZPA 3K3IA 4JLCA 4O96A 3SXRA 3VQUA 3N4TA 3R1YA 4O0VA 4AZVA 2IWIA 1OGUA 4EK5A 5JFVA 4CGAA 3CGFA 4UWBA 3FZOA 3FHRA 1P4OA 3BEAA 3IW4A 4D4RA 5LXMA 4QYGA 4YJNA 4GJ2A 3HGKA 1YWVA 3ODYX 5F4NA 3JVRA 3NCGA 3WI6A 3GBZA 2NNWB 2A2AA 4ANMA 3MBLA 3BHUA 3RWQA 3EB0A 3KRLA 4FV1A 4HZRA 4L68A 5DRDA 2CNVA 4KABA 4FSQA 3NW6A 4FTMA 4DH5A 3ALOA 3PJ1A 4M12A 4Y5HA 3REPA 1YHVA 3OW3A 3RWPA 3KRXA 3QTRA 4FOBA 3BE9A 2WQMA 4QP2A 1H24A 5EK7A 1H01A 5HBEA 5AAEA 3MI9A 3BWJA 4L3LA 2XBJA 4LGGA 5ANOA 5AP6A 5HCXA 2QNJA 1SYKA 5I9YA 4EH8A 4F4PA 5HX6A 1YKRA 2JEDA 3FI2A 4I0TA 2WMVA 3DCVA 3IW7A 4TYEA 4U8ZA 1YI3A 5HBHA 3IQ7A 1WCCA 5A3XA 3PJ2A 4UMRA 1T46A 4FSYA 4RFMA 2XKCA 4CLIA 4MXZA 4QQ5A 3R21A 3SW7A 3OS3A 3TACA 2C0IA 4ZP5A 2C5YA 3R7UA 3ZXZA 4MHAA 3WZKA 4KIKB 4PL5A 3N4UA 2JGZA 2A27A 4BTJA 3SOCA 3TZ9A 3NW7A 4JR3A 3LJ2A 4H36A 5AAFA 4BWKA 4U81A 2EXMA 4C4EA 5J87A 4E20A 4ZZOA 1TQPA 2XJ1A 5AP1A 1OKYA 4BBFA 5HE2A 2G9XA 2YIXA 4QP1A 5IEYA 3ZLWA 3QZHA 5AP2A 3O2MA 4O7YA 1X8BA 4QT1A 5KMLA 2H9VA 3D7TB 4BCQA 3WZUA 2PMIA 1CKIA 5L2TA 3ZOSA 4ZY4A 4CMTA 4Q5EA 4WHZA 2HZ4A 2PVRA 4OGRA 2XZSA 4XG7A 3WF7A 4BN1A 4JQ8A 4FTNA 2QO2A 3UIBA 2A4LA 4IWQA 1M7QA 1JWHA 3UPXA 4BDDA 3ZEPA 3ERKA 4DG2E 4E4LA 4E6QA 3VF9A 1H1QA 3B2TA 3GC0A 3LXPA 3P78A 3QUPA 4RSSA 3FLQA 5KMMA 5LWNA 3TIZA 5E4HA 3H9OA 4HYSA 3EWHA 3MWUA 3FAAA 3AC8A 2OZAA 3PY0A 1OPLA 4PTCA 2EUFB 4LRKA 1ZARA 3OFMA 2GFCA 3COHA 3OUNB 4KKHA 4YC8A 4ZTNA 4BDHA 2X8IA 3TUBA 2PVFA 4XG9A 3GP0A 5HTIA 3RHXA 2KTYA 3S4QA 4ANNA 3ANQA 5LJJA 2WQBA 3PVBA 2GCDA 5M08A 3V3VA 2VTMA 5BYZA 4B4LA 4V04A 4ORKA 3DAKA 4FODA 2W1CA 1Q3DA 4GVAA 3RK9A 5CEIA 4Z55A 2VAGA 2W0JA 2UVYA 2VGOA 3HRCA 2BHEA 2YDJA 3L9MA 4L7SA 4RG0A 3CIKA 5ANJA 3G6HA 2V7OA 2C6IA 3UOKA 3NAXA 3Q9YA 4IB1A 4LG4A 3FQHA 2R2PA 4U6RA 5C1QB 4M7IA 5TOZA 3LXNA 3P9JA 5EDQA 5FD2A 2W96B 5IA4A 4HGLA 3PE1A 4NFMA 2XCHA 5H9BA 3DXQA 2ZDTA 1YXSA 3ACKA 4O2PA 1A9UA 1BI7A 3BQRA 2GS7A 4LV8A 4QYEA 3R7OA 4I20A 4DFNA 3I6UA 3MPMA 5JMSA 3DQWA 3O7LD 4FKIA 3EN4A 4BCFA 2R0IA 3UNZA 4D1XA 2OIDA 4I0SA 4GG5A 2QQ7A 1MQBA 4CCBA 4QTDA 4RWLA 5I9UA 2WOUA 4EOSA 2J0MB 2ETMA 2QU5A 3SKCA 3GCQA 3HECA 3LE6A 3VHKA 3LLAA 1U54B 3TI1A 5M55A 3CR0A 3SG8A 3COKA 2RG6A 4XOZA 3MTLA 4DG3E 4W4VA 4NWMA 3R8LA 3KF7A 3E8NA 4EWHA 4JXFA 5KMOA 3FUPA 5E8WA 3UOHA 4U40A 4E6AA 3GCVA 4FIIA 3M11A 3OT3A 4YO4A 2QONA 5IMEA 2J5EA 1E1XA 5AV1A 3HMNA 3HNGA 4IVAA 2UW8A 3ETAA 3C9WA 3EN6A 3ET7A 3I5ZA 4YHFA 4O0YA 4PY1A 4CQGA 3FPQA 4H39A 3ZFYA 3D2IA 2VWUA 2BRHA 3CKXA 3CY3A 4G5PA 4PPAA 3QQUA 4I41A 5D9HA 5EYMA 3SAYA 3NYOA 5CAUA 2XYNA 4NIFB 4RIWB 1ZZ2A 4BY9E 3ZDUA 5JQ8A 5IISA 4JL9A 2ZM3A 3BYMA 4DT8A 5FXQA 4EHZA 2JDRA 4FKQA 3H9RA 4FEWA 2ZDUA 2E9PA 5AV3A 3UE4A 3GCUA 2QO7A 4K1BA 4BYIA 5DPVA 4A07A 5J7BA 3MPTA 4C7TA 4YLLA 2XNNA 4MWIA 3LQ8A 3MB7A 4ZSLA 1OPKA 1Q5KA 3WOWA 5HKMA 4BL1A 1H00A 4LQMA 5TE0A 4C2VA 4QMLA 2BKKA 5K5NA 4DEEA 2YAAA 3ITZA 5AUTA 4DEAA 1PMVA 5M4UA 1KUTA 5EG3A 4EOQA 3HV4A 2I1MA 3PIZA 3QALE 4Y46A 4R3PA 3FE3A 5IQIA 2OBJA 4AGCA 3QQGA 1FOTA 2J9MA 4BDBA 3GEQA 3ZSHA 4BDFA 5L2WA 3BU5A 5FTQA 3HV3A 3L8PA 4QMVA 4M84A 5BYYA 3VBVA 3FMKA 1OL2A 4ASDA 3R7IA 2JFLA 5BMMA 3COMA 4S34A 4Y95A 5J9ZA 5J1VA 5DFPA 2ERKA 2QOIA 4KIPA 3POOA 4F09A 5M4IA 4L43A 4MD9E 3TZ8A 2OJ9A 2XUUA 5CVGA 4XRJA 2PY3A 5IA1A 3TCPA 5EKNA 4XV9A 4S32A 4I5CA 4KRCA 2JIVA 1NVRA 2XIXA 3DLZA 1KOAA 2WMAA 4IZ7A 3ZEWA 3PP1A 2UZDA 2DUVA 3MGYA 3IOKA 3OCTA 3TNHA 3ZDIA 2XIKA 3BGZA 3LFEA 1Q99A 3Q4UA 2XB7A 2J51A 2OW3A 4AZFA 3EIDA 3HL7A 3QLGA 4Y85A 3U8WA 4KIQA 2Z7RA 3D5VA 2WEVA 4RWJA 4M67A 3SG9A 4MQ2A 3NNVA 4UYNA 3BHHA 3D5UA 2PE1A 4CMUA 4FT7A 1KE6A 4I6QA 4EUUA 4I4FA 4Z7GA 3VS6A 4L9IA 3F2NA 2IO6A 3ORZA 4IWDA 3NYVA 2ZOQA 4ZSGA 4FZDB 2PE0A 4X21A 2YM6A 4TW9A 4BIBA 3HMMA 4P7EA 1B38A 3HVCA 5KZIA 4Z9LA 2X6EA 2ZV2A 3ORNA 1R78A 2VTJA 4BWXA 4HYIA 3R73A 4C36A 3DBQA 4GIIA 3ORIA 1V0BA 1ATPE 5ACKA 2F7ZE 2Y0AA 4QP4A 2B53A 4F64A 4ANOA 3AGMA 5BVNA 3VJOA 3EH9A 4RZWA 4XLVA 4ALWA 4LUEA 5AA8A 3AXWA 1OM1A 3LCTA 3S3IA 2BMCA 2PVYA 3QWJA 4YURA 3E93A 4ITHA 3LIJA 2RFEA 4ZTHA 3TJCA 2YHVA 5IU2A 5KHXA 3ATSA 4JBQA 3OOMA 3PXZA 4L53A 2XK4A 5HE1A 1PYEA 1ZMWA 5GJDA 1OKVA 3F7WA 3PXRA 4CFWA 5DN3A 5ANIA 4ALUA 3WYXA 2RG5A 1UNGA 3OD6X 3FEGA 4GJ3A 2CLQA 4EOLA 4YZ9A 3NW5A 4U43A 4GIHA 2C6EA 3G90X 3LLTA 4NFNA 1SM2A 3ORPA 5E7RA 5HTBA 5M56A 5BVEA 4L52A 5AUWA 4JIAA 1WVYA 2G1TA 2P0CA 4CFMA 4YJOA 1B6CB 4PP7A 3VS7A 5H8EA 5B2LA 5CNOA 5BYLA 2ITTA 1WBPA 5A4TA 3FC1X 2E9UA 3FYJX 4XP2A 3WF6A 5CVHA 3GENA 2YCQA 1FVTA 4UY9A 4AAAA 4BVUA 3A4PA 4C3PA 4H3PA 2P3GX 4W9XA 5D10A 2H34A 5HLWA 4XBRA 2XKDA 4IAAA 4Y83A 2C68A 5IH5A 1CKPA 1H26A 1RQQA 2RSVA 4GL9A 1ZY4A 4ZK5A 4AW5A 4RIXB 4BF2A 5JQ5A 5EQEA 4F7JA 5EM8A 2XNPA 3DQXA 5M07A 3P7BA 4MAOA 1VEBA 3SXSA 3DBEA 3V5PA 4JG7A 3W16A 4QPMA 1CSNA 3KRJA 4P5QA 2PUNA 4L01A 1JNKA 3GOKA 2UUEA 1UNHA 1R39A 5DMZA 4JDIA 2WTWA 1BL6A 1OECA 2X2LA 4J71A 5CSPA 1GZOA 3R2YA 4UMPA 2XNGA 3PRIA 3GU6A 3OC1A 1KV1A 1LEWA 3S1HA 4ACGA 3L9PA 2UZLA 4YHTA 2GDOA 1PF8A 5H2UA 5HE0A 2WTCA 3R83A 3MIYA 3I81A 2NPQA 4S33A 3UO6A 4P90A 3C13A 5CU2A 2ITNA 2JAMA 4GH2A 4CFFA 2IZTA 4H58A 2C5VA 5E8SA 5C03A 4FSNA 4YC3A 4E93A 2B4SB 2VZ6A 4RX5A 4FIHA 3ZZEA 5CEQA 3QXPA 3DDQA 2ZYBA 5HLPA 4TL0A 2P2IA 4RA5A 4AOTA 1Z9XA 2DWBA 4IAYA 1ZYCA 2WNTA 4BCJA 5CF5A 4X2FA 5HU9A 3WZJA 2BAJA 5EQPA 2HW6A 4LL5A 3QX4A 2QLUA 2CDZA 4OTDA 1Q97A 4UWYA 4EHVA 2F2CB 2VO0A 2W1ZA 3O51A 2QOCA 4EZ5A
chains in the Genus database with same CATH superfamily
5EDPA 2JKOA 3DTWA 4O6EA 5TKDA 4XMOA 2QI8A 3DDPA 3THBA 3VULA 1I44A 3QQLA 5GZAA 2O8YA 2ZM4A 4IH8A 4TZRA 1Q8UA 4UXLA 4DAWA 4GT5A 3TL8A 2BRGA 2HELA 4O7RA 5E8ZA 2BILB 2J5FA 2EU9A 2UW5A 3P79A 3QFVA 5M51A 3AMBA 1FMKA 4U97A 4O7LA 4R3CA 5K9IA 2KULA 2VX1A 1YWRA 1OL5A 4FV6A 4L8MA 1NA7A 4JQEA 1HCKA 4I6BA 1PXKA 3KVXA 4RVMA 4ALVA 4UMUA 2X8EA 5AAGA 3HP5A 4FIFA 3UZRA 4FZ6A 5JSMA 1CMKE 3P4KA 3GT8A 3KRWA 4YTFA 5L4QA 5DHJA 5AJQA 1ERKA 2WIHA 3SXFA 5F95A 1S9JA 5E8TA 4NCTC 2QVSE 3Q53A 4JOAA 4MXCA 4FV8A 2O3PA 3D7ZA 1ZOGA 3LXLA 4XV3A 4XP0A 4XV2A 4DFZE 1CM8A 1GJOA 2A19B 4UBAA 1Q62A 4RZVA 4DFBA 1JSTA 4IFGA 2OF4A 4TWOA 1J1BA 4GU9A 5DEWA 5DT3A 3RM7A 3TNWA 5M09A 4FTOA 2OICA 3ULIA 2UZUE 3AMYA 1MRUA 2UW4A 2UZWE 4O21A 3QKMA 4RJ6A 4UWCA 1ZYDA 5D11A 2RIOA 2Z7QA 3F3ZA 5KUPA 4NW6A 5EFQA 5KHWA 3LFBA 3TDVA 2CPKE 4FKLA 5JZJA 2F57A 3BWFA 3U87A 1PRYA 1AQ1A 1Y6AA 3EZRA 2YA9A 3FZ1A 2O0UA 5AP3A 2RFNA 4EK6A 3WARA 5CT7A 5LMAA 1JSVA 5LVOA 3FL5A 1Q8TA 3ATTA 1UU8A 2JAVA 3D5WA 3SX9A 3SHEA 3PJ3A 2CKQA 3OF0A 1P14A 3CPCA 3QD2B 4OBQA 5GIPE 4FSRA 4JG6A 4AAYA 1P4FA 1YI6A 2YCSA 3CSVA 2Y4PA 1REKA 2ONLC 2F9GA 3SRVB 5DI1A 4KKEA 4JAIA 3RVGA 3TNIA 4TYHB 1LPUA 2OIQA 4CFNA 3VS4A 5EM7A 4AN9A 3NUAA 4J1RA 4BZDA 3S00A 4AQKA 2YIWA 4FKGA 3G2FA 4G3CA 4YBJA 5BVWA 4QMOA 1H1RA 3LJ1A 3EFJA 4CTBA 2ITQA 2BAQA 2WXVA 3OW4A 4FTRA 3W55A 4CZUA 4RFYA 4LGHA 4PDSA 4RC2A 4D0XA 5CF6A 2B9FA 4HNFA 4I21A 4RQVA 4GRBA 2QR8A 3OTVA 4BRXA 4KINA 4BTKA 5LMBA 5HG8A 4S30A 5FP5A 3ENHA 3JXWA 3I7BA 4TYGA 3SOAA 5IG1A 3PWDA 4F6SA 5EOBA 2WMRA 4WIHA 2HZNA 3E8CA 3F5GA 4IHPA 4QMSA 2Z7SA 3QTUA 2R7BA 4Q5HA 4FKUA 2P4IA 4FTJA 4DEHA 3NUUA 5IA5A 3C4CA 5E8UA 4GYIA 3ZSIA 5DH3A 4QMUA 3RHKA 3C1XA 4YPDA 1IA9A 1QPDA 3D0EA 3KVWA 2R3GA 3E3BX 3NUNA 5T6KA 4DLJA 1PXIA 4AWIA 5AADA 2J0IA 2NP8A 4FKVA 4QP8A 4YHJA 2ETRA 5CF8A 3CD8A 1MUOA 1Q8YA 3COIA 2OF2A 4TWPA 5AV2A 4O7WA 4EH3A 4O0SA 4MUQA 3IDBA 2OJJA 4DC2A 2BRMA 2ZJWA 4ZSAA 5CLPA 3RK5A 4FSUA 4QMYA 4TT7A 3KULB 4I0RA 3E8EA 2YCFA 4NSTA 3QRJA 3HLLA 2C69A 3C50A 4AW0A 4JJRA 4MNEA 3VBWA 3VN9A 4PDYA 2QG7A 1ZYSA 3AD5A 1FPUA 1JKSA 5EM6A 4QPSA 3FMJA 2HW7A 2GSFA 3NFFB 4S2ZA 4S31A 4FE2A 2WTJA 1B39A 3KXMA 4OTIA 3R9DA 5JN2A 3W0PA 2W1GA 3CS9A 3E88A 4M13A 1G8AA 2BDJA 3AC1A 2LAVA 3ENMA 5DIAA 3QX2A 3ZO3A 2J7TA 3BE2A 4KBKA 3UPZA 5AEPA 2R3LA 5I9ZA 2W1EA 2XA4A 3OVVA 3MFRA 4JR7A 2XANA 3PIXA 1IASA 1YHWA 3BELA 1JPAA 4C3RA 4NEUA 4LMUA 4Y5QA 5LWMA 4FR4A 2CGUA 3EKKA 4NH1A 2WAJA 3PFQA 4F9WA 5IKWA 5J95A 2YABA 2W5HA 4I1ZA 4JX3A 4FKWA 4FV9A 4V0GA 4IEBA 3UVQA 3LQ3A 4FT0A 5EHLA 3OOGA 3FLZA 2BKZA 3EL8A 5CAQA 2E2BA 2A98A 3MJ2A 2BPMA 4BIDA 4D58A 4CMOA 4YJPA 4USDA 3ZUVA 2CHLA 4LRMA 2Y6MA 2HZ0A 4B0GA 1WMKA 3BU6A 4CYJA 3O8PA 3FMDA 4LL0A 3ZM4A 2CLXA 4W8EA 5CSVA 4BCHA 2G15A 3PVGA 4QQTA 3ZTXA 4BCMA 3QD4A 2QG5A 4AZSA 4FGRA 4BR3A 4K11A 1O6YA 5L2QA 3W1FA 4BDEA 4FKTA 5K0KA 2PVLA 4JX7A 5FXSA 3W32A 5L8KA 3QF9A 1VR2A 3C4EA 3KXZA 3PZHA 4MK0A 1STCE 4I4EA 4ERWA 4DCAA 1ZRZA 1OIYA 3A7HA 3I60A 2VO3A 3W8QA 5BNJA 2YIQA 3AMAA 3P86A 4O84A 4RLLA 2W1HA 3FHIA 4ITIA 3DK3A 4ZSEA 3FMMA 2B9JA 4GK4A 4U45A 2ERZE 1PMNA 4KRDA 4JG8A 3O23A 3QUDA 2OU7A 3TEIA 4L67A 2I7QA 5KKRB 3DB6A 4HYHA 1WBSA 1W2DA 3ZBFA 1JBPE 1G5SA 3EQPA 4QP6A 3FSKA 1OB3A 2PZPA 1JVPP 5J5TA 5A4QA 3MA3A 3VS0A 1QCFA 4BYJA 4CFUA 2YLEA 3UDTA 3W2SA 4D2RA 5BQ0A 2Y8OA 2ITUA 3FWQA 3GB2A 4F9BA 4Q9SA 5ETCA 3HRBA 3OXIA 4X6QC 4CRSA 4IVCA 1WBTA 4DTAA 2PVJA 2CNUA 3TDWA 2OG8A 3KMWA 4MF0A 3A4OX 4E73A 4HVSA 4E6DA 4FEVA 3DBCA 5H8GA 3R7EA 4O1OA 4YJQA 5IQDA 4AXCA 2PK9A 5DYJA 4YLJA 5DE2A 2BTRA 3HRFA 2B1PA 3FMLA 4PTEA 5HVYA 5JFSA 5ETFA 4Z7HA 4C8BA 4DEGA 3I79A 2IN6A 4IIRA 1XH5A 5KCVA 3P7CA 3E92A 4R7BA 4DDGA 4Y72A 3RNYA 3OUKA 3W10A 4LOQA 1UU9A 4I5MA 2XIRA 1QPJA 2XBAA 5FLFA 4C62A 3VHEA 3JPVA 3UJGA 1TQIA 3PG1A 1T45A 3R30A 5A54A 5FGKA 2PYWA 3PG3A 3MTFA 2QHMA 5E90A 3C7QA 4FTKA 2VWBA 4HGEA 5EYDA 4ANSA 4DGGA 4EZ3A 4FC0A 1Y91A 4OAVB 4IANA 3PSBA 2G01A 2RKUA 4ONAA 1LUFA 4BDKA 4W4WA 3BLAA 4USEA 4O7NA 3W8LA 3LFQA 4O83A 4LGDA 2VNYA 3DB8A 4FT3A 5C4KA 3W2PA 3CTJA 4XG3A 4ACHA 4EOOA 1YQJA 5DWRA 4A4XA 4FVPA 4O22A 4BFMA 4IVBA 4U80A 5L2IA 4JMQA 2WMXA 4ID7A 4RJ5A 4W9WA 4YP8A 4ACMA 5B2MA 3UIMA 4DHZA 3PXQA 3EQHA 4TXCA 4WBBB 4F0IA 4B7TA 1UNLA 1UWJA 3RPSA 4UEUA 3W18A 2ZB0A 3VUDA 2EB2A 4ZTMA 4D28A 3ZH8A 4GG7A 2C3JA 3RBWA 2ZMDA 4I3ZA 2XNBA 5EW8A 3V8WA 4I6LA 3HMOA 2B0QA 5ITAA 2GNGA 3OHTA 2FVDA 3MH1A 4X3FB 3O17A 3FLWA 2XJ2A 4BGGA 5AA9A 4E4XA 4G34A 2WIPA 2R3IA 4WNOA 4I93A 4RIWA 2R4BA 4W4YA 2OXXA 3UO5A 4TWNA 4WSQA 1O9UA 1H0WA 1QPCA 4FSMA 4DDIA 5CZIA 1Q8WA 5M06A 3MY1A 3N4VA 4IX5A 2GNLA 2YJRA 4U41A 5IDNA 1SVGA 3DPKA 3KL8A 4QPAA 2O2UA 5DGZA 3DNEA 2VNWA 3FC2A 4OR5A 3LZBA 3VW6A 2RFDA 2C1BA 5AUXA 5LCKA 4DG0E 4CQEA 5IPJA 2JBOA 4GFOA 2C6OA 3V6RA 4APCA 2X7GA 2XALA 4NUSA 5CF4A 4CNHA 3GCPA 2XVDA 4ZJJA 4DFUA 3OCGA 4MBLA 3PPZA 3IW5A 4V05A 5JFWA 3TUDA 3DXPA 5TR6A 4HOKA 4FF8A 4V01A 3SLSA 3RCDA 3ZO2A 4AW1A 4F9YA 1U4DA 3DKOA 2GQGA 3EJ1A 5JK3A 4OAUC 2BZKB 5GNKA 4AS0A 4E5WA 1XH8A 1R3CA 1UWHA 4AG8A 2C5OA 2GNFA 4RMZA 2HOGA 1IAHA 2I6LA 3H10A 4CRLA 1XH7A 4TYJA 1OVEA 4FT9A 2B9HA 3GQLA 4YJRA 1ZWSA 2YJSA 3HUBA 3KCKA 5GJFA 4B6LA 4U79A 5FM3A 3L1SA 3NUXA 2JDVA 3PFYA 3FLNC 3NR9A 3ORMA 4LFIA 3AKJA 3NLBA 4C2WA 4FK6A 5EHOA 2XCKA 2XARA 3WBLA 2YCRA 5IEXA 1Y8GA 3ZUUA 2YERA 5CWZA 4KUJA 3MYGA 1NY3A 1IEPA 4G3EA 2WD1A 4IJ9A 4K77A 5IQCA 4YNOA 3PLSA 2I40A 4IADA 5HICA 3TV7A 3ZXTA 5I0BA 3Q52A 3QD3A 3R00A 3KF4A 4K33A 3ZFMA 5I9WA 2WTKB 2OKRA 2WGJA 2R0UA 3KK9A 3F88A 4LUDA 4RLKA 3AD4A 1G8SA 3BHTA 5DR9A 1CKJA 2BROA 1U5QA 4BKJA 4DH3A 3QCSA 2QOKA 2WEIA 4LI5A 4J7BA 3VONA 4PWNA 3ZMMA 4BGQA 4WBOA 2GTMA 1QMZA 1XBCA 3K5VA 5AP0A 4RJ7A 5F20A 3U9NA 3IG7A 4ARKA 4OTGA 4A9SA 4FA2A 4YZNA 2BAKA 1GZKA 5BUIA 3R9HA 4K0YA 1P2AA 4ZZNA 3U6HA 4QMNA 5M4FA 4D9UA 2JBPA 3GC9A 2CGWA 3JVSA 3WZDA 3CKWA 4IX3A 3UDSA 1PXLA 4AZTA 4BCGA 5ANKA 2C6DA 4PTGA 3EQBA 1TQMA 3IO7A 2OJGA 4GUBA 4G16A 4AXAA 4BHNA 4C35A 4HVHA 3QUEA 4PL4A 2CGXA 4AUAA 5E8VA 1OUYA 2AC5A 3UOJA 3ZYAA 3E7OA 4DBNA 3QRIA 2BUJA 2C6MA 2VU3A 4ZLZA 2OZAB 2H8HA 4ENYA 4EC9A 4FV0A 1GOLA 1NT2A 3AG9A 1UU3A 2F2UA 3VAPA 4BKZA 2WHBA 2GTNA 3RKBA 2OXYA 4WD5A 4YZBA 4D2PA 4D4YA 3UNKA 5C4LA 4H3QA 1ZLTA 4FL3A 5FM2A 3W2CA 3CEKA 4K18A 5J8IA 3GU7A 1DI8A 2Y7JA 3OWKA 3MJ1A 4WG5A 5AR3A 2XEZA 5H8BA 3ZFXA 2UV2A 4KAOA 4OBPA 2H6DA 3FL4A 3SW4A 4DH1A 3RM6A 3I6WA 4D55A 5KMJA 3FMHA 5HIEA 4HCTA 3QQJA 1BYGA 4AT5A 1Y6BA 1W2FA 5C9CA 4MD7E 3RALA 2B55A 1J91A 2IVSA 3MVMA 3EN7A 5K4JA 5KX8A 2YZLA 4JQ7A 5HESA 1PMUA 5HU3A 1Q24A 5E9EA 3LFAA 2W5AA 1KV2A 3ID6C 2W1DA 3LW0A 3DAEA 3WE8A 4BDJA 2VTIA 4BCKA 3CE3A 5HNGA 4KS8A 3PXYA 2DYLA 3ORTA 3R22A 1OGYA 5IQBA 3QZIA 3NMUF 2O64A 4G6NA 3F66A 2BDFA 2R3OA 1V0OA 5DT0A 3BHYA 4XP3A 3VWAA 4C58A 1SNUA 3F6XA 2REIA 5E8YA 4C34A 2F7XE 4WA9A 3P5JC 3UOLA 5AUZA 1W8CA 1XO2B 2FSOX 1LEZA 2JIIA 3BBWA 3G0FA 2HWPA 3NSZA 3P23A 3BCEA 3UO4A 4FTCA 2V5QA 4HGTA 5FXRA 1GAGA 4ZZMA 2PHKA 1H27A 1YRPA 3K3JA 2PMOX 3DBFA 3NYNA 3QRTA 2BHHA 4GS6A 3IOPA 4RFZA 5HZNA 1SZMA 3ZRLA 4RC4A 2BFXA 4QP7A 5CU6A 3MESA 5D7AA 4M0ZA 1UKIA 2V0DA 3E8DA 4N4SA 4P5ZA 3U4UA 3VRYA 4BI2A 2FYSA 4WG3A 1Q41A 1K3AA 1GIJA 2WTDA 4IAKA 3ZRMA 3FQEA 4E1ZA 4BBMA 4GK2A 1H28A 3KQ7A 2OJFE 5HBJA 2PVKA 5CAPA 1H07A 3KEXA 3WZEA 1UU7A 3FXZA 3VQHA 4E4MA 3GOPA 4MF1A 3H3CA 5IEVA 4L42A 4QTBA 5G6VA 2X0QA 3OBJA 3UTOA 4IWOA 4U9AA 5CQWA 4EKKA 4GKIA 4DHJA 5LQFA 1IA8A 4IACA 4MWHA 3PA4A 4QNAA 2DQ7X 3DAJA 1F5QA 4FEXA 2PWLA 1DI9A 4QTCA 2RL5A 3IECA 5JFXA 3EN5A 3ZZWA 5AM7A 4F1MA 3OEZA 1UV5A 2PZIA 3II5A 4O7ZA 2ITZA 4M69A 3DK6A 2X2MA 3Q4TA 3BYVA 3GC7A 5L8JA 3CQUA 4AA5A 4CT2A 3FKOA 4EJ7A 2YDKA 5C8KA 2VWVA 4YTHA 3W33A 3ML1A 4O0UA 3E7VA 4AGWA 4ENXA 3KRRA 3AT4A 5J1WA 2QD9A 4LM5A 1Q4LA 3OT8A 1OUKA 1WBWA 5HHWA 3ULZA 5CZHA 4BCNA 5HD7A 1ST0A 5HO8A 5JKGA 5KE0A 2GNJA 4DGLC 3CJGA 2H96A 3UP2A 4F70A 1NVSA 2B54A 2UZNA 2X1NA 3BYUA 1W7HA 3VO3A 3FMEA 5FBOA 4Z3VA 1ZYLA 4JDHA 5FTOA 4IVDA 1KE7A 4CG8A 1ZYJA 3OWJA 4TN6A 3A7GA 4FK3A 4D2VA 4KBAA 2YLFA 4R6VA 5IQFA 4D4SA 3DJ7A 3QL8A 1BMKA 4H1JA 3F5PA 2J0LA 2VWZA 2FSMX 2HK5A 3PPKA 3SGCA 3OWPA 2QOQA 4CG9A 3BYOA 2WMUA 3JY0A 4AFEA 5HCYA 1AD5A 2IZSA 4JRVA 4QYFA 4TNDA 3RMFA 4UMTA 3PRFA 3VF8A 1V0PA 2CCIA 3VVHA 3MIAA 3F3VA 3NVKI 5D1JA 3A61A 2XIYA 4XCUA 4J8MA 4FNYA 2R3HA 4FTQA 4RIYA 4XH6A 5FEEA 4IB0A 3LJ0A 4RIOA 4BWPA 1PXNA 5HVJA 3V51A 1GY3A 3KREA 3UQGA 3DJ5A 5HG5A 4DFXE 4ASZA 3CLYA 4FZFB 3LXKA 3QRKA 4WKQA 2EXCX 3AGLA 3I0QA 4O7VA 4O0WA 4PX6A 3RAKA 2HZIA 4QP3A 4AP7A 1A48A 5EM5A 5FRIA 3ZO4A 4YSMA 4ZS4A 4BTMA 3UODA 3DV3A 4UYAA 2PUUA 4B9DA 3FBVA 1P5EA 3L8SA 1R0EA 4FSTA 3G6GA 4F7SA 5HD4A 3BV3A 4IZAA 4EQMA 3FZRA 3CQEA 3BRBA 4HVGA 3ORXA 3LM5A 5HO7A 3BL9A 5CSWA 5KMNA 4D2TA 3BBTB 3O8TA 4O27B 2YM4A 2YM7A 3RGFA 4C4HA 1CTPE 3DZOA 3O96A 2VTTA 3EYHA 4R7HA 3JS2A 4BKYA 5J9LA 2PZRA 1XH6A 1V1KA 4BICA 2XS0A 3A8WA 3F5UA 2OK1A 2UZBA 3QKKA 4J95A 5HORA 1H4LA 5JRSA 4HVDA 4PMTA 1LP4A 3ORLA 4WUNA 1FINA 4DT9A 1QPEA 3DTCA 2PTKA 3R8ZA 4XG2A 3DT1A 4UX9A 3QTIA 3UIUA 4C37A 1ZY5A 3A62A 3UG2A 5CAVA 5TO8A 3RPOA 4RT7A 3UG1A 4A9YA 5IF1A 3LCOA 1KE8A 4KS7A 3UP7A 4PDOA 3P08A 3TNQB 3NUPA 1PY5A 3UVRA 2W1IA 2XRUA 4FG7A 4G3FA 5AP7A 4NCTA 4PQNA 1OZ1A 2YEXA 4AE9A 4EYJA 5B7VA 1OMWA 4GUEA 5IA2A 3A8XA 3HAVA 5EOLA 3MH2A 3DKFA 4BCPA 2UZOA 2XK8A 2XEYA 4O91A 2PUIA 1G8JA 3HYHA 3NCZA 4FSZA 4D1ZA 3NNWA 5FBNC 4XV1A 2BZHB 3I1AA 2GNIA 3R63A 4FIJA 1M2QA 1GZ8A 1ZMUA 3CBLA 2JDOA 4RC3A 4BC6A 2XK3A 4XG8A 2OSCA 2NRYA 3DFCB 4AX8A 4IFCA 1OITA 2A0CX 1E1VA 2HWOA 1TVOA 4BCOA 2X9FA 5CENA 5TF9A 2PL0A 4FIGA 2UVXA 5ANEA 5HG9A 2WB8A 5DRBA 2UZVA 4J99A 3QQFA 5CI7A 2GQRA 3FV8A 4XX9A 1BLXA 3QRUA 4QTEA 5DNRA 4ZMEA 3E3PA 3LFFA 2XNOA 5K4IA 1XQZA 4EOKA 4O7SA 3GU5A 2R5TA 2QODA 1BX6A 3LFSA 2QR7A 3R01A 4J97A 4MBJA 2WKMA 4U0IA 1ZOEA 4YZDA 3S2PA 3TKUA 3IGGA 1URCA 4YNEA 2IW6A 4QYYA 4B8LA 2W9FB 1I09A 4O1PA 2ONLA 3P5KA 3LM0A 1VZOA 4EHGA 4ZIMA 4DE4A 1MP8A 2Y4IB 4HGSA 4HW7A 3PY1A 1PHKA 4FUYA 3Q9WA 3ZONA 4C4IA 3FSFA 3R1SA 2IW8A 5D7VA 5G1XA 3RI1A 5BX0A 5EQYA 4G2FA 1Z57A 4Z16A 5EDRA 3OP5A 2W4OA 3IKAA 4KD1A 2VV9A 4UZHA 2UW9A 3Q04A 1KOBA 1JKLA 4LOPA 4BJJB 3MFSA 3R6XA 2CKOA 4LDTA 4DTBA 3UIXA 1VJYA 2VWWA 1VYWA 2BFYA 3O50A 3FMNA 4RJ4A 4X6RA 4CSVA 5E91A 3CGOA 4DF3A 4JBVA 3MY5A 2XAMA 2W4JA 2V7AA 5LCJA 3DGKA 4IM3A 4RRVA 4TWCA 4WG4A 4C57A 4C4GA 2CSNA 4FZ7A 3QQKA 4H1MA 2W1FA 3QC9A 4XBUA 3QTQA 3OWLA 3U51A 3QBNA 1KE9A 3KU2A 2CKEA 3MVLA 4KA3A 5EH0A 4BI1A 2WPAA 3EFWA 4CKRA 2P2HA 3C5IA 5GINE 4ZS0A 2HXLA 3LQ5A 4UN0C 4NL0A 2Q0BA 2SRCA 3QCXA 5M57A 1PMEA 4NM0A 3GFEA 3F7ZA 4MTAA 3QWKA 1BUHA 5DA3A 4QTAA 3SV0A 4M14A 3IK3A 4K2RA 2XK7A 3F82A 4FUXA 3TWJA 3VW8A 4EORA 3VRZA 3TT0A 5AX9A 3OXTA 3DS6A 3KKVA 1YXTA 3UZPA 4ASEA 1GZNA 3B8RA 4OW8A 5CSXA 3NGAA 2XJ0A 4QMWA 2JKQA 1W2CA 2J4ZA 2OZOA 4F9CA 3D4QA 4IBMA 3C0GA 5IQEA 4A7CA 3UC4A 4GYGA 4GKHA 4A9RA 3VIDA 3DXNA 1AGWA 2QOLA 3MH3A 2PULA 3R28A 5HLNA 5AV0A 3TM0A 2PVHA 3NIEA 4EYMA 3EL7A 4FV4A 2R3MA 2V55A 3W0SA 3BV2A 2C5NA 3H30A 3S0OA 4FL1A 1WBOA 2X9EA 3HX4A 3VUGA 3KA0A 4IM2A 5DT4A 4R78A 4ZSJA 1Y57A 5I5ZA 3ZLSA 1JOWB 2W4KA 4IX4A 3T8OA 4QQCA 5BUJA 3AT3A 4D5HA 4L44A 3MA6A 5D41A 5AR7A 1WVXA 3MV5A 3QC4A 3SQQA 2I0EA 4QMPA 3FLSA 1DAYA 5EKOA 3WF5A 1DM2A 4JIKA 2AEGA 4BGHA 4XG4A 3BHVA 4AOJA 2I0VA 3BKBA 4DGMA 1OIUA 5ICPA 1L8TA 4O7TA 3HEGA 5ANGA 2W9ZB 3EQGA 4RWKA 4R1VA 1KWPA 4I5PA 4CV9A 4AQCA 4HVIA 2I0YA 1H8FA 2CCHA 3PSDA 4K8AA 4NKAA 4RQKA 5CXHA 5EW3A 5HOAA 4O86A 3CPBA 4IWPA 4KWPA 5EYKA 5KO1A 3FKNA 3FZTA 1Y8YA 3IGOA 3BI6A 1U59A 3DKGA 4IX6A 3U54A 4JDJA 3BLQA 3BPRA 4IMYA 4BCIA 1Q3WA 3OROA 2JFMA 4EQCA 1ZOHA 2JD5A 3ANRA 4GEOA 3Q60A 2OJIA 3D83A 3TKIA 5K5XA 4USFA 3M1SA 4QDEA 4YZCA 3U9CA 3DY7A 4F7LA 2OWBA 5AUYA 5ANDA 2PMLX 5IUHA 3UVPA 4F9AA 4WRGA 3DNDA 4YGAA 4EOIA 2PE2A 3SDJA 4IW0A 3UYSA 1G8KA 4KIKA 2ZV7A 3ZO1A 5FTGA 4R7IA 2F49A 2WELA 4ZJIA 3PTGA 5ETIA 2G2HA 3FY0A 4II5A 2IVTA 5J7HA 4ITJA 5JRQA 4XJ0A 4R3RA 1URWA 3V5JA 4BDAA 4R1YA 3NRMA 4PMPA 3UBDA 4O0RA 3GU8A 4I24A 2VO6A 5HE3A 3UQCA 3QCQA 4IJPA 2BR1A 3JR1A 1M7NA 4ZLOA 3O71A 2C6TA 2G2FA 4BI0A 2AC3A 3D7TA 4O4FA 4CVAA 1ST4A 4YTIA 3PY3A 5L3AA 3K5UA 3PA3A 1J7IA 4A9UA 2G2IA 2XM9A 3H0ZA 2F7EE 2PSQA 3F2AA 3QA8A 2X0GA 3QXOA 4MQ1A 5AIRA 4MXXA 5AWMA 3VUIA 2VX3A 1H1PA 4P2KA 1RJBA 3VNTA 3OTUA 4O0XA 2P55A 2Z2WA 5LMKC 2HXQA 1J3HA 2DS1A 4PP9A 3AC5A 1Z5MA 4UZDA 3PP0A 3ROCA 4YU2A 5A9UA 1JKTA 3T9IA 4FV2A 1SVEA 2V62A 1NXKA 3LAUA 4OTPA 2V22A 2VTAA 3C4WA 2FO0A 3PWYA 1NVQA 2VTPA 4JT3A 2O5KA 4G17A 4D9TA 1OBGA 4APPA 3EKNA 4OTWA 4I6HA 1GIHA 2OI4X 3GXLA 4X3FC 3E62A 3RZBA 2UVZA 4O4BB 4R77A 3RZFA 1EH4A 2BIYA 2VD5A 4QD6A 3RCJA 2HY0A 4FG9A 3OCBA 5IA3A 2X81A 4MX9A 4EQUA 5I9VA 4YR8A 2EXEA 3G9NA 3G33A 3FKLA 4MNEB 4CKJA 4JBOA 1FVVA 3H0YA 4NM7A 5I4NA 3N51A 1U46A 3ODZX 2Z8CA 4C59A 4XHKB 4F63A 5EHYA 4FZAB 2VTLA 4AOIA 2ZV8A 4C61A 5K3YA 3BX5A 3VS3A 5GZ8A 5CSHA 4IC7A 4EBVA 4EOJA 3EOCA 3UNJA 3WF8A 4H05A 2YFXA 3AOXA 4WUAA 3C4XA 3OY1A 4N70A 3KXXA 4U44A 4GK3A 4CFXA 3ELJA 4DTKA 4OTRA 3IW8A 4QMXA 2AUHA 5HEZA 3HKOA 2NYAA 4H3BA 4E7WA 2GMXA 4WNPA 3R8PA 3VBYA 5A6OA 2C47A 3BL7A 5D12A 4GSBA 3LMHA 4MXOA 5CU3A 4MH7A 3UYTA 3GQIA 4V0GB 5IQHA 3QTSA 4AT4A 4EBWA 1UA2A 3KCFA 4DITA 1U54A 3HZTA 3HMPA 4EL9A 2ZVAA 3ZBXA 3TKHA 3KY2A 4NK9A 4ZTLA 3W2RA 2GHLA 1YXXA 3BLRA 3FI3A 3Q5IA 4L3JA 4NTSA 5DR2A 4F78A 2E9VA 3SC1A 2JIUA 4X2JA 3EMGA 4ASXA 2W99B 3G5DA 2Q83A 4L00A 4ZY6A 4FJVA 2BZIB 2VTOA 3AQVA 4PRJA 4LYNA 2VTQA 4O6LA 3ZC6A 2I0HA 2CNQA 4AXDA 3BYSA 4CKIA 4DBXA 1YDRE 3VC4A 2WTKC 3LFNA 4GVJA 1M2RA 4E5BA 4G6OA 5HI2A 2YITA 2XP2A 3ZLYA 4DN5A 1OI9A 2CJMA 1O6KA 3R2BA 3ROYA 3PE2A 4JNWA 4F7NA 4YUQA 4PPBA 3QTWA 3V5LA 5L6WL 5BMSA 4NIFA 5CAOA 4FNXA 3L9LA 3R7YA 1FVRA 4QMMA 2XKEA 4X0MA 2ITYA 1XHAA 2CN5A 4YLKA 5AIKA 3RPRA 3ZUTA 4K6ZA 4RVKA 4I94A 3R7VA 2YM8A 2WTIA 4OT5A