1ZOGA

Crystal structure of protein kinase ck2 in complex with tbb-derivatives
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
325
structure length
325
Chain Sequence
SKARVYADVNVLRPKEYWDYEALTVQWGEQDDYEVVRKVGRGKYSEVFEGINVNNNEKCIIKILKPVKKKKIKREIKILQNLCGGPNIVKLLDIVRDQHSKTPSLIFEYVNNTDFKVLYPTLTDYDIRYYIYELLKALDYCHSQGIMHRDVKPHNVMIDHELRKLRLIDWGLAEFYHPGKEYNVRVASRYFKGPELLVDLQDYDYSLDMWSLGCMFAGMIFRKEPFFYGHDNHDQLVKIAKVLGTDGLNVYLNKYRIELDPQLEALVGRHSRKPWLKFMNADNQHLVSPEAIDFLDKLLRYDHQERLTALEAMTHPYFQQVRAAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN KINASE CK2, alpha SUBUNIT
publication title Inspecting the structure-activity relationship of protein kinase CK2 inhibitors derived from tetrabromo-benzimidazole.
pubmed doi rcsb
source organism Zea mays
molecule tags Transferase
total genus 107
structure length 325
sequence length 325
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2005-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1zogA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1zogA02
4MNFA 1G8AA 4WT6A 4FT7A 4L01A 2EXMA 4ANBA 5FM3A 4IADA 4RG0A 2ZV7A 5EQEA 5DHJA 4AF3A 3PPZA 3MIYA 3ALNA 3FLYA 2W4OA 4V04A 3HA6A 4I92A 4PPAA 2PZIA 4PV0A 2XK4A 4WO5A 4Y95A 5HVYA 5J7BA 3ZSHA 3PXZA 3JVRA 3FJQE 1Y91A 1OBDA 4C4HA 4XCUA 3RCJA 2CNQA 4IAAA 4ZP5A 5E4HA 3UOKA 4U44A 4FKRA 4DFXE 2RSVA 1ZRZA 1IAHA 3G9NA 3RZBA 1M2QA 3DZOA 4BB4A 2VWWA 5JQ8A 3PVBA 2WU6A 4P2KA 5J7HA 4DFZE 2PE0A 2H6DA 3GU5A 3R7UA 3ZHPC 3VUMA 4F6SA 3FMLA 4BHZA 2BRMA 2YM8A 4ASEA 2Y6OA 5E8SA 2EUFB 2BR1A 5GJGA 3DBQA 3QBNA 3PZHA 5JMSA 4IX3A 3BU5A 4ITIA 2CGXA 3TKUA 4BGHA 4EK6A 5FTGA 2IVTA 1MQ4A 1OL5A 2RG6A 2CJMA 3K2LA 3DKCA 3ZXTA 3ROYA 3WI6A 5AV3A 1WVXA 4W4WA 1S9IA 2W4JA 3RK5A 2I7QA 4B7TA 2C6OA 4E4MA 1YOMA 1ATPE 4RC4A 4YJRA 5HBEA 4IM2A 1V0PA 5L8KA 5H2UA 1QMZA 5C4LA 2WMQA 5EHLA 5A3XA 5A46A 1FOTA 3HGKA 5KBQA 3A4PA 5C03A 3CKWA 1TKIA 4BBFA 5D41A 3ZRMA 2WFYA 3LFAA 3V5PA 3NNUA 5F20A 4YNEA 3KRWA 2J0MB 4UWBA 1K9AA 4O82A 3EKNA 5FXQA 3DK6A 1ZXEA 2HOGA 3FZPA 4FKOA 4V05A 1OIRA 3HMPA 4O0XA 3PJ8A 3A7FA 4GJ2A 4D2SA 3E8NA 4D2RA 2F2CB 2H96A 3W10A 4Z16A 4LRKA 2GNHA 3RAWA 1RDQE 3CSVA 4BCGA 4MBLA 5CF6A 3SVVA 3LFNA 4FKSA 2BZKB 3FZSA 2GNLA 1WBOA 2QO7A 4ZK5A 2J2IB 2C6LA 4QTCA 4UEUA 4AN2A 2P2IA 1ZZ2A 5L2WA 1SZMA 1DI9A 2XBAA 3G6GA 4H1MA 5G1XA 4F7NA 3COIA 5CXHA 3UIUA 3RPVA 3KA0A 4AZVA 4DGGA 5KMNA 4RJ3A 3HX4A 5K0XA 2J6MA 2UW9A 3QRUA 4I21A 2OF2A 2YCFA 4PP9A 3HZTA 4I6FA 3GXLA 3KB7A 3ZS5A 2I0HA 4RZWA 4FZAB 5LMKA 3LW0A 2X9FA 2WIHA 4UZHA 1YDSE 2VTQA 2YHVA 1ZYJA 2A27A 3F5PA 3P1AA 4D2PA 5GZ9A 4JVGA 4RX7A 4W8EA 1URCA 4KS7A 4AZEA 3ZMMA 4DTKA 4ACCA 5BVDA 2IJMA 1YHWA 2JFLA 3VUGA 4YSJA 3GU6A 5ACKA 3C7QA 4EOJA 5JFXA 2O65A 2XIXA 4JRVA 1WBVA 5CQWA 5BMSA 3SG9A 3MY5A 4ZJJA 3VS6A 1U4DA 4G3EA 4QTDA 4C8BA 4UXLA 4U8ZA 1H0WA 4EK4A 3I7BA 5I9YA 3OG7A 4MXOA 3HLLA 5CU3A 1PXNA 4I3ZA 3Q96A 4U97A 3FL4A 3DQXA 3QKLA 1J1CA 3B2TA 4OBOA 4P4CA 1PYEA 2IZTA 3R71A 4JJRA 3SLSA 5KO1A 4BYIA 4ERWA 2Z7RA 2JGZA 4U43A 4BYJA 3U9CA 2CKQA 4BIEA 4XP0A 4BHNA 2RIOA 4OW8A 4JR7A 1UV5A 4ARKA 2VTMA 3QHRA 5AP0A 4I1ZA 1H1SA 4C3FA 5HZNA 4W9XA 3PVGA 4FEUA 2R3JA 4A9TA 3SKCA 5E1SA 3F2AA 5HCZA 5GNKA 3IG7A 2I0YA 3G90X 3FLNC 5JRQA 5HLNA 1XH6A 1OVEA 1M2RA 3OW4A 4I5PA 4KIQA 3NIZA 4LV8A 3VUIA 3PYYA 2R3RA 3TWJA 4LRMA 4EKKA 3QKKA 5JFSA 4G5JA 2G2FA 3QCYA 4NWMA 5AWMA 3ZFXA 3AC3A 3A7IA 4B8LA 5EK7A 3F82A 3U4UA 5HO7A 5J5TA 5JZJA 3NUAA 3R7GA 4XG7A 3PIYA 4WOVA 4HYHA 4X6QC 3PA4A 4MD9E 1H27A 1M17A 1WCCA 2ITWA 2NP8A 3OF0A 5H9BA 1H28A 1NW1A 3AD6A 3DBDA 1WAKA 2XMYA 4HGTA 4NCTC 1R78A 4WG3A 3W55A 3DXNA 1QPEA 1YXUA 1AD5A 4EH6A 3E7OA 4PDPA 2UVZA 2BRNA 3CJGA 3GI3A 5D7AA 5IZFA 1JKKA 4KSQA 1VJYA 4JDJA 4B6LA 2XH5A 4KIKA 2Y8OA 4AA0A 4CT1A 3TACA 4C34A 2CCIA 3PG1A 1MRUA 2O64A 2YM5A 5KHWA 2YITA 2WMTA 5JT2A 3A4OX 4E4XA 5JEBA 1U5QA 3KREA 4LL0A 4WSQA 3L9NA 5EDQA 2OU7A 2XP2A 2R64A 2REIA 4DFUA 4J96A 4N70A 5IQIA 1ZLTA 3NYNA 3A62A 3OW3A 4JDIA 4D28A 1IG1A 1A48A 3R1QA 1OKWA 3TTIA 4EUTA 3VHKA 1REKA 2R2PA 3CE3A 3BLRA 1UVRA 4HGSA 3BWFA 3OT3A 3GC8A 1JKTA 4UWCA 3EQIA 4Y5HA 1J7UA 4M68A 4QMXA 3NAYA 4BR3A 1H00A 2OZAB 3CY3A 3GP0A 2WZJA 2C6IA 4FMQA 3QTSA 5BMMA 5IA1A 3QZGA 4BDDA 3CGFA 3FPQA 4C38A 1LEWA 3E92A 4XV1A 5D12A 2JIUA 4AN3A 1M52A 3R63A 3R8LA 5C8NA 4FTUA 1E1XA 2PY3A 4RMZA 4LGHA 2XKCA 2NPQA 2UW4A 2GU8A 5AP3A 3V5TA 4ZLZA 2QR7A 3D4QA 1JSUA 1MQBA 3UMXA 3DTWA 3R1YA 4NIFB 5FWKK 4E73A 4U41A 1WBTA 3SV0A 2WEIA 2GS7A 4M84A 4X2KA 3ZC5A 5IEVA 4O0WA 4H1JA 4HNIA 2C68A 3II5A 4X2NA 4K2RA 4PP7A 5AUXA 4KBCA 5CU0A 1YWVA 3VNTA 2GHLA 2OJFE 3COHA 3D83A 3FLSA 4YLKA 3DLZA 4F7LA 1ND4A 4EQUA 4CEGA 3MVMA 4RFZA 1XBBA 4IQ6A 2WTIA 4RC2A 2ITZA 2QG7A 2PVYA 5AX3A 2GNIA 4W4VA 2HXLA 4Q5EA 4FTAA 4ZSLA 3GCVA 3PVUA 2RFDA 4IDVA 2W1CA 4TNBA 3RAHA 3QYZA 4FSMA 4XMOA 3PJ3A 4DBXA 4AZWA 5IG1A 4ORKA 3EQPA 3TZMA 4U79A 2LAVA 4QMNA 2OW3A 1W7HA 4FTCA 2Z7QA 3GGFA 2YCSA 4LRJA 1FINA 1OECA 2QC6A 3ORZA 2GTNA 4FV9A 3GT8A 2CN5A 3OXZA 4M66A 1FMKA 4NJDA 4AGCA 2R5TA 2RF9A 3OUNB 5HNIX 3NMUF 3ALOA 4J7BA 4AS0A 3C51A 2W1FA 2Q0BA 2J0JA 3BELA 3MN3A 5IU2A 4QMVA 2A1AB 5TR6A 3PP0A 5I9ZA 3E8CA 3QA8A 1GZOA 4G3GA 4E6DA 1CDKA 4BDCA 4C57A 2VNWA 3ZUTA 1ZOGA 4ID7A 5BYLA 1OBGA 3FEGA 4FTKA 3MESA 3KU2A 4XV2A 4RJ5A 3GEQA 3FLWA 4OR5A 2B9FA 1ZMUA 3R28A 3DNEA 5AR8A 5HCYA 4BTMA 3OHTA 2QHNA 2SRCA 2YAKA 3QD4A 4O7VA 2PMNX 3B8RA 4JIAA 4L67A 5JRSA 3JR1A 2JKKA 5EM8A 2ONLA 4TY1A 5I9XA 5HX6A 4F6UA 4II5A 3KMUA 5LOHA 4FKGA 4ANNA 3TNHA 4G6LA 3RHKA 3AD4A 3KRRA 5K5XA 1ZMWA 2CCHA 1JSVA 2GSFA 2HWPA 1IASA 3O50A 2OI4X 4FA2A 3DFCB 3LLTA 4FNXA 3G2FA 2C4GA 4R3RA 4KA3A 2OJIA 5CALA 4BGGA 4X3FB 3OBJA 4G2FA 4TYJA 2VRXA 4HCVA 3GQLA 3R2BA 4QO9A 5FM2A 2PVNA 5AAGA 2C6DA 1PMVA 4RIXA 4IC8A 4QTAA 3QHWA 4AW0A 4D9UA 2UW7A 4BTKA 2WMBA 3O7LB 2YERA 4GFOA 1W98A 2BTSA 4O0UA 2BAKA 2YIRA 2OO8X 1YI3A 2G2HA 3ZH8A 3I5NA 2VTNA 4MH7A 5B2LA 4DE4A 5DG5A 4CMUA 5K0KA 2GNFA 4RIOA 5FQDC 4Z3VA 4EWQA 2WQBA 2PHKA 4O0YA 3OWPA 3E88A 4HVIA 2VV9A 4V0GA 2VX1A 4R7BA 2UW3A 3PXQA 2CHLA 2OFUA 3I5ZA 4GU6A 3UYSA 4IIRA 3MV5A 5HQ0A 3PTGA 5DGZA 1UA2A 2BKZA 4YPDA 4FTIA 1KUTA 4ITHA 4KWPA 4FVRA 4GG7A 2E9PA 4OT5A 4C37A 2ZMDA 3AQVA 3ELJA 5BVEA 3C5IA 2BTRA 2X1NA 4C58A 4PPCA 1Q3DA 4W8DA 5CU2A 3WZJA 4EONA 5HTCA 4FG8A 5BPYA 4R1YA 3C0HA 3LFFA 5JQ5A 2O3PA 4IAKA 3LMGA 2ERKA 4FT9A 2CN8A 3R9NA 3ORLA 3RMFA 3REPA 3E5AA 3HV4A 3H0YA 4YUQA 5BVFA 5CSPA 5AM6A 3UIBA 3ZCLA 4ZTQA 5HLWA 3UQFA 3OMVA 2J0LA 4IHPA 5HE3A 3VS5A 4DT9A 3G51A 3MB7A 1KE9A 3IOKA 4HPTE 3G0FA 4FBXA 4AE9A 2WMWA 3MJ2A 2XNBA 5HVJA 5E8XA 1SYKA 4CQGA 2C3KA 3FBVA 5LVLA 4BZDA 3DB8A 2O63A 3P08A 4X2FA 4CG9A 2W99B 3TNQB 3VUTA 4YZ9A 4FZ7A 4BCMA 4OTRA 3I4BA 2F7EE 1WMKA 2PZPA 5FGKA 3QA0A 2EWAA 5EW8A 4YTCA 3F7ZA 2R7BA 2YM7A 3UMWA 3K54A 4XHKB 1NVRA 1PXKA 1Z9XA 3ZEPA 2DWBA 1DAWA 3RTPA 2R7IA 3PWDA 2RKUA 2QNJA 3RINA 3M1SA 3EMGA 4L8MA 4EJ7A 1YXXA 4X21A 4PMTA 2E9OA 3D7TA 1Q8ZA 1UKIA 2BFYA 1E9HA 3TCPA 2C6KA 3IW4A 4Q2AA 5EM7A 2UZBA 4AGUA 3OXIA 1XKKA 4BVUA 4EORA 3BRBA 4I5HA 2WO6A 3OCGA 4DEHA 3BHYA 3FC2A 3D2KA 1H01A 3V6RA 5DA3A 3LXNA 5CSXA 2IZSA 4AFJA 1BL6A 3GC0A 2OICA 2XNGA 3TT0A 5KX8A 4E93A 1H0VA 2PE2A 1WZYA 2JDOA 3FAAA 1BUHA 2FSTX 4F9AA 4BCOA 1U5RA 4APCA 2WNTA 3PPJA 4M15A 1CMKE 5CENA 3FI8A 3HV5A 4PRJA 5GHVA 5LCJA 5K5NA 3QTWA 3OY3A 4TPTA 4XRLA 3LQ8A 4AW5A 1Q8WA 4CLJA 2BFXA 2XNOA 3ORKA 2XIKA 4ZLYA 1PHKA 2GHGA 2WOUA 1BKXA 3QTZA 3Q52A 5AUTA 4ZSAA 4YJQA 3AGMA 4UALA 3BZ3A 5CNOA 5L6PA 3R21A 1GAGA 1FVTA 5E8VA 3C4XA 3PJCA 4IVDA 3FKLA 2JKQA 3QRIA 5KMLA 4OAUC 3AG9A 4K33A 4TWOA 5JGDA 4O0SA 4C35A 5IA3A 5AIRA 4EOPA 3RBWA 3QX4A 3KF7A 4XG8A 4I6BA 4C36A 3EL7A 4O7YA 4GYGA 1GZNA 1JPAA 2R3HA 5HG8A 2VD5A 3NLBA 3RPRA 3DBFA 2PVJA 4L9IA 5I3RA 3F3TA 4R7IA 4FKQA 3ORTA 5DVRA 2HIWA 5BVWA 5KMKA 2QD9A 3CLYA 3GCPA 2HY81 4O2ZA 4UY9A 3HA8A 3LXLA 3MWUA 3QGWA 3A7HA 3V8SA 4HVGA 3QLGA 4R5YA 2VAGA 4L3LA 3EFKA 4NEUA 4DEDA 4F0FA 3EYHA 2WTDA 5DT0A 2BRHA 1KSWA 2QI8A 3R9HA 4QD6A 4H39A 4JLCA 4JAJA 3KXXA 1WBNA 4P5ZA 3PRFA 4BY9E 2RFEA 1GNGA 5FUTA 4ZSJA 4D4SA 1R39A 4DN5A 4EQCA 3QD0A 5AR7A 3O2MA 5F4NA 4O22A 3QD3A 5TOZA 3ZO4A 4OTIA 4CFFA 2B4SB 2OXXA 3DB6A 2IW6A 3ZO3A 3SOCA 2XRUA 4JBVA 1PXJA 5H8BA 3OY1A 4QMUA 5K4IA 5E9EA 4X7QA 5I9UA 4E1ZA 3SX9A 3Q6UA 4IAIA 4OBQA 5A4CA 3FC1X 3I1AA 4IVBA 3UZPA 5M4UA 4XBRA 4BWXA 5AA9A 5IQHA 5M51A 2PUPA 2PZYA 3QFVA 5CU6A 3WE8A 4M97A 5HBJA 5EFQA 2JC6A 1T46A 3DPKA 5AP5A 4A06A 2BDJA 5FLFA 4MNEA 1Q99A 4O0RA 4FZ6A 3QUPA 4A9SA 4M67A 4QTEA 2A19B 4NYEA 5HNGA 3BQRA 4ZOGA 4DEGA 3EN4A 4MBJA 4Y46A 5JSMA 2XKFA 2QO9A 3D5WA 3NIEA 4FYOA 3ZO1A 4LI5A 3KL8A 5AV2A 3LCDA 5LWNA 3NYVA 1O6LA 4HOKA 4RC3A 3ZTXA 5IH6A 4QMSA 4RLLA 4FNZA 3MGYA 2YDKA 3L8PA 4LM5A 5ACBC 4CSVA 3UOJA 2HYYA 2W4KA 1WFCA 3RWPA 3EN7A 3FMNA 3ZSGA 5AP7A 5A6NA 5A4QA 3PRIA 4GT5A 1YI4A 4MF1A 5T3QA 3H9FA 4QYHA 2YABA 3HMMA 3PXRA 2AC5A 4K0YA 3VS1A 4D9TA 2OIBA 4FZDB 1A06A 3FV8A 4NU1A 2BZHB 2R3LA 5KMMA 1FMOE 4J98A 4OBPA 1V0BA 2YIQA 4P5QA 3R8UA 5EQYA 1H24A 1B38A 2YM3A 4I0SA 4X2GA 3KMMA 4XG3A 3V6SA 3UVQA 5D11A 4M8TA 5C9CA 5DR2A 3IGOA 1R1WA 4RWLA 5DFPA 2B9HA 4FR4A 3C0IA 3P79A 4QP4A 5JKGA 5J1VA 4MD7E 3HNGA 2ITNA 3UZRA 3FXXA 4KKHA 5KUPA 4DFLA 3BEAA 4DT8A 1WVWA 4TXCA 4ZZOA 4EH9A 5KHXA 2Z02A 3LQ3A 4J97A 4MXXA 5IQGA 2CGVA 5ANJA 3QQKA 3TDWA 4KRCA 2VZ6A 2BHHA 1GOLA 4LFIA 4XYFA 4U0IA 2F57A 4JBQA 4AE6A 5AM7A 4YTIA 3R7OA 4TTHB 1PYXA 1UU7A 2BPMA 3OEZA 3PSCA 4BDGA 3RWQA 3BYUA 2VO6A 4TL0A 3G0EA 4QMTA 3D14A 3Q4TA 4ACGA 2H34A 5AR3A 4ZMFA 3O8UA 3EB0A 3V01A 5IMXA 2ZB1A 4IAFA 1CSNA 2CKEA 3R8VA 5M55A 3GNIB 4O81A 5HU9A 4X2JA 3UDBA 4E5WA 4FSQA 4BI1A 4ASXA 3A99A 3JVSA 2WEVA 3A61A 3AC1A 4BDKA 4UBAA 5EDPA 5FEQA 4PMSA 2J7TA 2C5XA 3LFCA 4HYIA 3UIXA 5A4EA 3DDQA 4EOSA 5TKDA 4F99A 5A9UA 2PZRA 4KNBA 1DAYA 3H0ZA 4OTPA 4KIOA 4BN1A 3LJ2A 2J5EA 2YDJA 2ZM4A 3R83A 4XOYA 3RNYA 2YCQA 2YM4A 2BZJA 5EDRA 3V3VA 2PYWA 4U6RA 4FGBA 4RIYA 4FX3A 1F0QA 2Y4IC 4BZNA 3EH9A 3DKOA 4GL9A 3PA3A 4PNIA 4BCJA 4USEA 2DYLA 5A54A 4D5KA 3UNKA 4FV3A 1XH4A 2PUUA 4Z7GA 4CFWA 3P23A 2JEDA 4WNPA 3SHEA 4U40A 5DR6A 3W2OA 3LVPA 4HVDA 4QQ5A 2GS2A 3LFQA 4JOAA 2X8EA 3F3WA 2X2MA 3Q9XA 4G6NA 4L68A 4F70A 1NVQA 2GQRA 3RVGA 2XJ0A 2GQSA 2QODA 2R3QA 1OPLA 1REJA 5CT0A 3FHRA 3WBLA 4DH3A 5HG9A 3TNPC 3ZBXA 3D94A 3IECA 5I9WA 4NM7A 1W82A 3GBZA 4WRSA 3ZRLA 3V04A 2VTJA 2V55A 4M0ZA 4FIIA 4EC9A 5CEOA 1YXSA 4KBAA 5EW3A 3V5LA 5L3AA 3R73A 2YAAA 4R6VA 2OFVA 4EYMA 4AFEA 3KULB 3MFSA 4QOXA 4F9CA 3TIYA 5J1WA 4U7ZA 2Y7JA 4N4SA 2HWOA 1F3MC 4H36A 4FTMA 5E8YA 2UV2A 3A7JA 4JNWA 1W83A 4C2VA 4DEAA 2XUUA 3O17A 4HGEA 3BBWA 3W2PA 5FEEA 3HMOA 3PSDA 4ZTNA 3WIKA 5LWMA 3ORXA 4RFMA 2PVLA 2F9GA 4YLJA 4I93A 4EOMA 4UZDA 4G34A 5E7RA 3WZKA 3FMKA 5LVOA 5HG5A 3TV6A 1ZWSA 4FV1A 3ZONA 5ETIA 4PTGA 2KTYA 3M2WA 3RM7A 3N4TA 3MVHA 1B39A 1CM8A 4JQ8A 3LAUA 3GCQA 3JY0A 1QPCA 5CS6A 3DAEA 2QOHA 4FG9A 5E8ZA 5E8WA 3MB6A 3UPZA 1OGUA 3MIAA 3QXPA 3GU8A 4BRXA 4RIWA 1I09A 4UX9A 3WIGA 1YXVA 5FBNC 3BLHA 5DT3A 3EJ1A 1VR2A 4D2WA 5BYYA 4XOZA 4BCNA 3VRZA 2FVDA 3DOGA 3ERKA 4KIPA 4WUAA 3QD2B 3FI4A 2UVYA 4TYHB 2JKMA 5ETAA 2Q0NA 2R0UA 4BI2A 1P4OA 4CMTA 1LR4A 4CT2A 1UNLA 1GZ8A 3VBYA 3WYYA 3F69A 5BUJA 3IS5A 1Q97A 4M69A 5IQAA 5HIBA 3OBGA 3HV3A 4ANSA 4K77A 2XJ1A 5GZ8A 2YCRA 4L46A 4OGRA 5CU4A 5HORA 4AWIA 2PULA 5KKRB 2C3IB 4FV8A 4PNKA 2WAJA 4H05A 3ETAA 1OL2A 4WBBB 3VF9A 4AA5A 3RPYA 4KKGA 4WG5A 3RKBA 4FSNA 1YRPA 2OZOA 5EW9A 3SXSA 4F0IA 4B9DA 3U6IA 5CEKA 2JAVA 4ACHA 3QQFA 4YJUA 2HENA 1UWJA 3EFLA 3CPCA 3B2WA 3AD5A 4I5CA 5HU3A 4C62A 4QMLA 1STCE 2XK9A 5EM5A 4U9AA 3ZO2A 1IR3A 4EK3A 3LJ1A 3F2NA 3U6JA 3HP5A 3QUEA 4RLKA 4BKZA 1H26A 4YZDA 5DRBA 3W2CA 3VUKA 2GQGA 4MXZA 3D5XA 2UW0A 3UIMA 2XB7A 4GT3A 4JX7A 4L45A 3EQHA 4WUNA 2X8IA 2CNUA 5M09A 1SNXA 4A4XA 4G31A 1L8TA 3EKKA 3BU3A 4J8NA 3I6WA 4CCUA 4HZSA 3DY7A 4HNFA 4L52A 5KMJA 4ZS4A 3T8OA 4IZAA 2YIWA 4LMUA 3NCGA 3VF8A 2OLCA 3NUSA 3DBEA 3H30A 4RA5A 3AT2A 4AXAA 1H25A 1H08A 3SRVA 4RVLA 3LCOA 1Q5KA 5HOAA 5J5SA 4GVJA 4H3PA 5JGAA 2GFCA 2XF0A 2RG5A 3HYHA 4FV2A 4BIDA 2F4JA 5M07A 4O7ZA 4DLJA 3BKBA 4RT7A 3MBLA 5E8TA 4E26A 3B8QA 4TYIA 4E4LA 5LQFA 1TQPA 2J51A 2FSOX 1CKJA 5DPVA 5CAOA 2ZV9A 1X8BA 3NUUA 3O8TA 3SOAA 2XEYA 2Z8CA 1J7IA 1O6KA 2YFXA 3DKGA 2BROA 4QT1A 3T9IA 4G9CA 5AV1A 4DEIA 3EQCA 3PFQA 4D4YA 5IF1A 3HRCA 2YN8A 1OITA 1KE7A 4JRNA 3SW7A 4PY1A 2W5HA 2ITPA 4HGLA 1OKYA 4DGLC 2X2LA 3TM0A 4NZWB 4U45A 3CC6A 4KB8A 1NA7A 4LUEA 1URWA 2ONLC 2WMSA 3FDNA 4GT4A 1L3RE 4XLIA 1H1PA 1IAJA 4CKIA 2Y9QA 1BX6A 3QQLA 1UU9A 2YLFA 3COMA 3VRYA 4R77A 3DNDA 4EH8A 2PL0A 1UU8A 4GK3A 4RVKA 5B7VA 1WVYA 1YDRE 2PVHA 3HECA 4JAIA 2YJSA 2C6MA 5M57A 3FMDA 3KXNA 3O96A 5EOBA 3ZZWA 5KMIA 2ETRA 2EB3A 4RGJA 4NJ3A 1AQ1A 4RWKA 4BDBA 1V0OA 1OI9A 3GUBA 3L8XA 5EHOA 3UTOA 2WIPA 2V22A 3AMAA 3ULIA 3E63A 3HV7A 4TW9A 5AA8A 2CLQA 2R4BA 3ZFYA 2BAJA 2UVXA 4TKSA 1RJBA 3Q6WA 4NK9A 4QP1A 4TZRA 3DGKA 2R3NA 3VVHA 3TI1A 3SXFA 4Q9ZA 4MKCA 3HVCA 4FL2A 4QYGA 5C1QB 4KRDA 3LJ0A 2WTKC 1YDTE 3VJOA 4USDA 4DH7A 1S9JA 3PP1A 5T6KA 1OKZA 4RBLA 4ZEGA 5I3OA 5J95A 3ZC6A 2WQMA 4CRLA 2YDIA 1XR1A 1OL6A 1MP8A 1QL6A 3R8MA 5CF8A 3DXQA 1BI8A 2WQNA 3SD0A 4TYGA 1VYZA 2BVAA 5ETFA 4QPAA 2W5AA 4UV0A 4NTSA 4NKAA 3P5KA 2BHEA 3OOGA 4GVAA 3MVLA 4MAOA 5LARA 3TN8A 4ERKA 5AEPA 4FVQA 4F9BA 5IQBA 1ZMVA 3R1NA 4BFMA 3Q9YA 4O83A 4B0GA 4ZMEA 5M06A 4OTWA 4FE2A 3MSSA 3KN5A 1YQJA 5FTOA 1ZOEA 1YOJA 2X4ZA 3BIZA 3F5GA 2EXCX 3UODA 2XK6A 5CVGA 1Q62A 4JX3A 3TZ8A 3V5WA 1U54B 5KKRC 3NW6A 4O7SA 2B53A 3LFBA 4Y83A 4MTAA 4QPSA 3ODYX 2WTWA 3BWJA 4CFXA 4BCHA 1OB3A 3BX5A 3JUHA 3D0EA 5TF9A 2KULA 4LUDA 1RW8A 4ZAUA 4FTRA 3CTJA 2FB8A 5ANDA 4ANMA 3MH0A 2OIQA 3Q2MA 2QU5A 4QMWA 5BQ0A 4MHAA 2EVAA 2GTMA 3ENMA 4MQ1A 5GZAA 2CLXA 4K1BA 5AV4A 3D5VA 3IQ7A 3PLSA 2Z7SA 1OMWA 5CSHA 2WMRA 5TT7A 3NAXA 4YJNA 3ORIA 2QOIA 1TVOA 1G3NA 3OEFX 4C0TA 3NGAA 4DITA 3AC4A 5K9IA 5LJJA 3DLSA 4JT3A 3CQWA 2W0JA 4RQVA 3ZLXA 3AOXA 4PTCA 4AOJA 4EWHA 2BDWA 3M42A 3TZ7A 3TV4A 4QP2A 5LXMA 3Q60A 2PZ5A 4NFNA 3KK9A 4YMJA 4S33A 4TWNA 2UW5A 2PVRA 4NCTA 5KMOA 2OGVA 2HZ0A 5CVFA 4EOOA 3RAIA 3IGGA 4CYIA 4F9WA 3WARA 4FTTA 4FZFB 3ACKA 3BV2A 3NYOA 4MX9A 4PL3A 1JWHA 2J9MA 1KE5A 2W17A 2XJ2A 4FT5A 4Z7HA 4ACMA 4DH8A 5ITAA 1XWSA 3TNWA 2PE1A 3FXWA 2CGUA 2VU3A 4N6YA 4YHFA 3UNJA 5DMZA 2X6EA 1Q3WA 3PE1A 5AP6A 4YHTA 1HCKA 3FMJA 1TQMA 4R3CA 2QU6A 3TKIA 4HJOA 4QMMA 3IK3A 4H3BA 4YJVA 3EFWA 3T3VA 3V5JA 5F1ZA 3IOPA 3F5UA 3D7ZA 3R2YA 3QWKA 3R6XA 4E5AX 4E6CA 3AT4A 3S2PA 5BUEA 1KV1A 3IO7A 3FMEA 5G6VA 2XM8A 3FMMA 4CCBA 3LKMA 4KS8A 2W1IA 3FY2A 1SMHA 5AADA 5J9YA 3GENA 4IB0A 2NNWB 2A2AA 3QGYA 4YJTA 4BCIA 4FIEA 4EKLA 2NO3A 5IA4A 4DGNA 2VO3A 4GRBA 4C4JA 4MBIA 5CI7A 4MCVA 1NY3A 1WBSA 2AUHA 3S1HA 1Q8TA 5LMBA 3QCSA 4FV6A 4Q9SA 4F08A 5IA2A 4DF3A 4IB5A 4IE9A 1Q24A 5KNJA 2B1PA 1BMKA 4I23A 3QALE 3UVRA 2PUNA 4PUZA 2QOKA 5EI8A 2PVFA 4FKWA 3E93A 3OROA 4UMPA 5DH3A 3ZLWA 1JSTA 4YU2A 1YHSA 2ZV8A 3FZTA 2QOFA 3FUPA 3MS9A 5DBXA 3QL8A 2GMXA 4YZMA 4BC6A 2ZM3A 4JQEA 5CVHA 4ZIMA 2UW8A 4GEOA 4GMYA 4QNYA 5FEDA 3FZOA 3O23A 2P3GX 5HVKA 2GFSA 2BRGA 3COKA 3R22A 4FKVA 3JPVA 5D10A 3DXPA 4U5JA 2WQEA 3KVWA 1MRVA 3R02A 4B99A 3Q5IA 2C47A 2WOTA 3CGOA 3HUBA 4EK8A 3TXOA 4FTQA 4C33A 5BX0A 3LFSA 3QZHA 5CEPA 3KN6A 4GU9A 4L53A 2CMWA 3NPCA 2XEZA 4L44A 4BDJA 5AUUA 3TG1A 2X7OA 2ZDTA 5HIDA 3QQUA 1XH7A 1Y6AA 2B7AA 4HZRA 4ZTRA 1PXOA 3FZRA 5CYIA 3RZFA 4CZUA 4D4RA 2I0VA 4IWDA 3RJCA 5CF4A 4FKUA 2HW7A 4AT4A 3CEKA 5CNNA 3DV3A 2IZUA 3QQJA 4JBOA 2VWVA 4GFGA 1J91A 2X6DA 4DLIA 3EQRA 2QOOA 5LMAA 4LV5A 3R00A 4O0TA 2JLDA 4LMNA 4I41A 4H3QA 1LPUA 2VWIA 2YLEA 2ETMA 2VTRA 3CQUA 4FOBA 4IFGA 1ZY4A 2VN9A 4CMOA 4D0WA 3BHTA 5C8MA 2PMOX 3JS2A 4R1VA 5TE0A 4BDEA 2BUJA 1YVJA 4MEDA 4QMZA 3K3JA 1SM2A 3NRMA 4EH2A 1PRYA 2VO0A 3UPXA 3CCNA 3R7YA 1NXKA 5EM6A 2IVUA 1ZYSA 4C4FA 4GUEA 2E9UA 3GC9A 3BGPA 5GIPE 3F2RA 2OXDA 3FLQA 3NDMA 4JQ7A 2DQ7X 3MYGA 5AAFA 1FVVA 2O2UA 2BALA 2E2BA 3L9LA 2XZSA 4O0VA 4UN0C 4FNYA 3BI6A 1J3HA 3UO6A 2R3OA 3BGZA 5CASA 5JK3A 2OKRA 2UZOA 3W1FA 4M7IA 1XO2B 5M53A 5FDXA 1LP4A 4HVHA 3BE2A 1WBPA 2P0CA 3UG2A 1U59A 3DZQA 1PMUA 4I22A 4RPVA 3GOKA 3RP9A 2PSQA 2QOCA 1GIJA 4J95A 3V8TA 5D1JA 4FODA 4O6EA 1IA9A 3PLAE 5FP6A 1XBAA 3ANRA 4GS6A 1VYWA 2XYUA 2X0GA 3U9NA 4OTGA 3BYSA 4CXAA 3ZEWA 3QZFA 3FYKX 4ALWA 4G3DA 4O6LA 5IKWA 3WZEA 1Y6BA 3QU0A 2XCKA 3FKOA 3SC1A 3PVWA 4AX8A 3W2SA 1LEZA 4ZJIA 3F3ZA 3OS3A 1H1WA 2X7FA 3Q3BA 2GPHA 5DI1A 2XYNA 4OTQA 3IKAA 3UC4A 2ZV2A 2VTTA 2OZAA 4QP8A 2I40A 1Q8YA 3IONA 4ZXTA 5BYZA 4BGQA 2IWIA 4N57A 1NVSA 2XK3A 1LUFA 4AN9A 1F5QA 4J52A 4EHGA 4M14A 4WNKA 4O7TA 3HAMA 3GCSA 4C3RA 1FGKA 2P2HA 4YJPA 4MYGA 5KE0A 3GCUA 3FY0A 4RJ8A 3MPTA 1H1QA 5CZHA 3TV7A 5AFVA 3SG8A 3AC5A 4EH7A 5CAVA 3VS3A 1R0PA 3BV3A 4XNEA 4NIFA 5ANGA 3KXGA 3OT8A 1ZOHA 3I0QA 3IPHA 2V62A 4FI1A 4I20A 2JIIA 4F7JA 4IZ5A 5H8EA 3PDTA 4X6RA 2O5KA 2OK1A 3CQEA 4M0YA 2C1AA 2Y4IB 3KVXA 2W1DA 3PPKA 4QMOA 5E90A 4D1XA 2XIYA 4F64A 3OP5A 4WBOA 2HZNA 2X4FA 2OG8A 4IM3A 4RJ4A 4ZSGA 4TWCA 3DU8A 5KCVA 1GJOA 5FBOA 4MWHA 4FKIA 2FYSA 2HAKA 1YWRA 5ICPA 4F7SA 5ANEA 2BAQA 3M11A 4IWQA 3QRTA 4APPA 5CSVA 4FEXA 3EZVA 2HW6A 1P5EA 3W2RA 5AUYA 3R8ZA 5K3YA 2OWBA 4PWNA 5ANIA 5GIOE 5AIKA 3QUDA 4P90A 5M08A 4ZS0A 1PXPA 2ZB0A 2Z60A 1BLXA 5BVOA 4NW6A 4EEVA 1XQZA 1UNHA 3IDCA 3O7LD 3GFEA 5DRDA 4N0SA 4IM0A 4AW1A 3RGFA 5HE1A 2NRYA 3MDYA 4FVPA 4IZYA 3UGCA 3K5UA 3KKVA 4FICA 4RWIA 4XJ0A 3O71A 3UG1A 4KUJA 3DJ6A 3HRFA 4F9YA 5AR4A 4F09A 4NW5A 4RJ6A 5EYMA 4CKRA 2NRUA 2V7OA 2VO7A 3IW6A 3K5VA 5CY3A 3ULZA 1JKLA 4GCJA 2HZ4A 3F66A 2GNJA 2VUWA 4MF0A 5HG7A 3VJNA 4W4XA 4I4FA 5JH6A 3BHUA 5IH5A 4IX6A 5AUZA 3O51A 1JQHA 3R7IA 2GHMA 3A8XA 4KIKB 3UJGA 3N4UA 3FI2A 2PPQA 3S4QA 4GKIA 4FNWA 1GIIA 2ITQA 3R30A 4LYNA 4F65A 3UYTA 4J71A 1FBNA 2GS6A 3MW1A 5E92A 5GJFA 4A4OA 3MH2A 4O1PA 3OFMA 4UMUA 4OAVB 4PL5A 4EC8A 3KY2A 4D5HA 3C9WA 5DWRA 3QLFA 1OKVA 2FH9A 2XIZA 3KCFA 3KC3A 5EOLA 4QPMA 5HESA 4I5MA 2XM9A 3QC4A 5IUGA 4X3FA 5IA0A 1YHVA 5C26A 5C4KA 2ESMA 4QQTA 4YSMA 4BKJA 4FV7A 3LZBA 2C5VA 3DJ7A 3QCQA 1M14A 2WMUA 2G2IA 2ITTA 3VBXA 4AOTA 4PDYA 2XS0A 5J87A 3BE9A 5BVNA 4TN6A 3KXZA 1Z5MA 2C3JA 5CT7A 5ANKA 3R7VA 3VW6A 4DAWA 1Q61A 4UMQA 5A4TA 4ZZNA 1XH8A 5DEWA 1ZYLA 2W06A 3ITZA 4IH8A 2JDSA 3R7EA 2OIDA 3I6UA 2IW8A 3GFWA 4KINA 3W16A 2C69A 2XRWA 1OIQA 2JDTA 5EG3A 3DA6A 5AP1A 4IZ7A 4IX4A 3UQCA 5CI6A 5L8JA 4C2WA 4AQCA 4EOIA 2YIYA 4ZY6A 3HDMA 3QZIA 2JFMA 2PMIA 3R04A 4FKTA 3LMHA 5I9VA 4WIHA 3RK9A 5LMKC 4AACA 5HTIA 5HO8A 4LQMA 3ZDUA 4EZ3A 4XG4A 3BLQA 3BYVA 3CTQA 4HYUA 4QNAA 4WA9A 3UBDA 3UOHA 4S2ZA 3W32A 4EOLA 3QTXA 2OH4A 4O7WA 4O2PA 4YNOA 4V01A 4QQJA 4DEBA 2ITOA 2IZRA 4I0TA 2IVSA 3ZXZA 1V1KA 3DBCA 1P2AA 4CTCA 4DFNA 2YZLA 3H9RA 4YTHA 5L2IA 2UZUE 3HMNA 4XX9A 4FSRA 5FRIA 2C30A 2DS1A 4FSZA 4TYEA 1NT2A 3QTUA 3QRKA 4FKJA 4DGOA 4GJ3A 1B6CB 1CKIA 4EYJA 2Y4PA 3VUHA 4BF2A 2IG7A 4QP6A 5AX9A 4OT6A 4C61A 4CZTA 3I81A 5E8UA 4Z9LA 3OD6X 2QG5A 1KV2A 1O6YA 3CXWA 3U55A 4LOQA 4H58A 2QR8A 5IA5A 5HLPA 4PMPA 4U81A 4LGGA 2A4LA 3C13A 1WBWA 3C4CA 2QOLA 5FG8A 5C27A 4E3CA 3TKHA 4U3YA 4XEYA 4BWPA 3VBWA 3Q53A 2YA9A 3NUXA 1OUYA 4WRGA 5L2TA 3TIZA 4MXAA 5AJQA 1YWNA 3LM5A 4FUYA 3CBLA 4XBUA 2QONA 4AA4A 5JFWA 3H3CA 5EQPA 1PKGA 4G1WA 2Y0AA 5HE2A 3BU6A 1RQQA 5CEMA 2WTCA 4QYFA 3R8PA 3ZM4A 3OCSA 1SVEA 3FQEA 1GZKA 5AV0A 2I6LA 4G6OA 4E7WA 4ZZMA 5A6OA 3I0OA 5IEYA 4GK2A 1M7NA 2YZAA 1M7QA 4D2VA 2JKOA 3G15A 2IW9A 3DTCA 3PIZA 4LOPA 4YGAA 3QQGA 4ANOA 4F0GA 3GOPA 4K18A 4XG6A 1H8FA 2ITYA 1APME 2W1GA 3F9NA 3WZDA 4IJPA 2VTLA 3A2CA 1OUKA 3Q4UA 1KWPA 1PXMA 3HV6A 3W18A 5CQUA 4AG8A 3NCZA 3ATTA 4FKPA 4S30A 3CPBA 1PXIA 2C5OA 3DK7A 2J90A 3LIJA 5HD7A 4EH5A 4G3FA 5JGBA 3G5DA 1CTPE 1P4FA 5M4FA 4YTFA 3LM0A 1M2PA 3TJDA 4NM3A 4RIXB 3GU7A 3P7AA 3R0TA 3LXPA 3WOWA 2GDOA 4CQEA 1IEPA 3HUCA 4BCFA 4EHZA 3FL5A 4AGWA 5DYJA 2BKKA 2X7GA 3EOCA 5HNBA 3NUNA 3F5XA 4ONAA 4BTFA 2B54A 4AZTA 2WU7A 2VWXA 4RVMA 2FUMA 2GCDA 2YACA 4YPSA 5L4QA 4QYEA 3BYMA 4I4EA 3BQCA 2WKMA 2WTKB 3LHJA 4FV0A 1T45A 3DQWA 3ZFMA 4DC2A 2B0QA 3ZUUA 3PUPA 3QKMA 3ROCA 2HELA 3A7GA 4V0GB 2F7XE 2VWBA 4FKLA 4IVAA 4JI9A 4DH1A 2IPXA 1H1RA 3HEGA 3L1SA 2QO2A 3AT3A 4MK0A 2QLUA 4RQKA 3CIKA 2HY0A 3JYAA 4AT3A 2FO0A 4CLIA 3OTUA 3FXZA 3G33A 2G1TA 3MPMA 3QF9A 4PL4A 3U51A 4GV1A 2JIVA 2ZJWA 5EYDA 4A4LA 4CG8A 3T3UA 3V5QA 3VUDA 3PJ1A 1QPJA 1PY5A 4LG4A 2V0DA 3HKOA 3CS9A 5H3QA 4UYAA 1XBCA 5AP4A 3Q5ZA 4O84A 1GY3A 5B2KA 5HEZA 3UZTA 2R3KA 3D2IA 3QTIA 4RRVA 1Q41A 2G15A 5L2QA 3KF4A 4AZSA 2FGIA 3PXKA 3UQGA 3VN9A 1W0XC 2C0OA 2VNYA 5J9ZA 4IC7A 3TZ9A 5IMEA 2WELA 4BBMA 2VTIA 3LLAA 3EZRA 3GU4A 2Z2WA 4DCEA 1Y57A 4MWIA 1R0EA 2VTPA 1OL7A 3BBTB 3CD8A 2VWUA 2Z7LA 3FYJX 1A9UA 1Q8UA 3NW7A 2VGOA 3P0MA 4FYNA 2WTJA 1HCLA 4I0RA 4C02A 4L43A 4XP3A 4EH4A 3TUCA 4ENYA 5FDPA 3DT1A 2I0EA 2C6TA 3ANQA 3SDJA 3NVKI 2BILB 3FSKA 3PE2A 2ACXA 2OF4A 3E3BX 3ZZEA 4DINA 5JFVA 2YWVA 3W33A 1BYGA 5B0XA 1ZYCA 4C59A 3TL8A 2YM6A 3E7VA 3PZEA 4N6ZA 4QP3A 1JNKA 2J50A 3EQBA 1JKSA 3HP2A 4I94A 3HRBA 4JXFA 2IN6A 1YKRA 4FG7A 5FD2A 5J9LA 5AR5A 2VTSA 3BHVA 4XG2A 1TQIA 5JN2A 3SQQA 5DEYA 3WE4A 5CEQA 4F1TA 4BBEA 2J0IA 3PY1A 4BDHA 4YO4A 3ACJA 1ZAOA 2WMXA 2W1ZA 4FIHA 2PVMA 2WXVA 2C0TA 4RX5A 2HCKA 3D7TB 3GB2A 3OC1A 3NWWA 4IBMA 4QYYA 4HCTA 3VS2A 4AT5A 5IDPA 2ZM1A 5EH0A 1I44A 1R3CA 3FLZA 3PG3A 1PJKA 1J7LA 2F7ZE 3E62A 1G8SA 4JDKA 4OTHA 3VWAA 3MVJA 4F1OA 3TUBA 3EFJA 3QWJA 2XBJA 3OXTA 5L6WL 3L9MA 4CTBA 4WG4A 1JBPE 3AC2A 3F61A 1W8CA 1EH4A 3GC7A 3RHXA 1H4LA 5HTBA 5DR9A 4LOOA 3OVVA 4FEQA 4EL9A 1SVHA 4AZFA 2O8YA 3MY0A 3QQHA 4MXCA 5HI2A 4JS8A 3P7BA 1OIYA 2HZIA 5HICA 4IX5A 5C8KA 2G01A 3FE3A 5HO6A 4GSBA 1K3AA 2J5FA 3FZ1A 4X3JA 3SGCA 3SAYA 2QKWB 2R3FA 3OUKA 1OPKA 4K9YA 4MD8E 3BEGA 2C5NA 2BDFA 4R5SA 3N4VA 3C50A 4PF4A 4K6ZA 4DFBA 3FQSA 3EN6A 2X2KA 3E3PA 4FIGA 1IA8A 4QMPA 4I6QA 4D55A 2P33A 3HDNA 3MTFA 4FV5A 3OCTA 1XJDA 2W1EA 5DOSA 2WMVA 2FSLX 3EQFA 4RVTA 3EQDA 5EKNA 2J0KA 2YEXA 2OH0E 2WD1A 2Y6MA 3VS4A 2VTAA 4NH1A 4EOQA 4D4VA 3WILA 1MUOA 3LQ5A 2CSNA 4FK3A 4HCUA 4NSTA 3KGAA 1RE8A 3MI9A 3ET7A 4A9RA 3WF7A 1FPUA 1JLUE 4L42A 5AAEA 4L6QA 3NW5A 4ITJA 4DCAA 4ANQA 3ENHA 2GNGA 2FA2A 3ZSIA 2OBJA 3POOA 2F2UA 2JDVA 2R3MA 5L8LA 4IANA 2FSMX 4YC3A 4DG3E 2B52A 3P78A 4ASZA 2W5BA 3WF5A 3DCVA 2YJRA 5GINE 4RX9A 2C6EA 1KOBA 4L3JA 3TUDA 3QXOA 3QCXA 5EKOA 5CAUA 5DIAA 4D0XA 2BIYA 3IDBA 5J79A 3ZU7A 5IPJA 2Q83A 3Q4ZA 3PWYA 4Y5QA 3EN9A 3WF9A 5KBRA 2ITVA 3E8EA 2WPAA 3LFEA 4YZBA 3LE6A 4FOCA 4CFNA 5BVKA 4E4NA 5BNJA 3D9VA 4IWPA 2ZDUA 2XVDA 4CV8A 5CAQA 2JITA 3KCKA 3ZM9A 3ZBFA 4D1ZA 2WQOA 2R0IA 3EN5A 4IACA 3VBTA 3P7CA 4WNOA 4B4LA 2E9NA 5CXZA 4S31A 5I4NA 4BDAA 4G3CA 3I79A 3NNVA 2UW6A 3NX8A 3KK8A 4HPUE 2XNMA 4L7FA 2XK8A 2BRBA 3LPBA 2B9JA 3NYXA 4GIHA 1KE6A 3H4JA 3IW5A 2XKDA 4OTFA 4TNDA 4E5BA 4ZLOA 3S3IA 2UZVA 4FV4A 2PMLX 1ERKA 2UZLA 4IW0A 3VC4A 5AUWA 3ID6C 4B8MA 2ZAZA 4IB3A 3RPSA 3CD3A 2X81A 3PIXA 4DG2E 1FGIA 3UC3A 1MRYA 3PXFA 4ALVA 4BIBA 3MA3A 3MPAA 5F94A 3ORNA 4JL9A 3Q9ZA 5EYCA 1VZOA 2OXYA 5HE0A 2UUEA 4EI4A 4D58A 3DJ5A 3N9XA 1H07A 3Q4CA 4HYSA 4AOIA 2QOQA 3OWKA 4MNEB 5H8GA 3PXYA 4Y72A 4C7TA 3OTVA 4FT3A 5A4LA 2EB2A 3C4FA 4ZTLA 3UP7A 4ENXA 4DA5A 3RCDA 5B2MA 3W8QA 1ZYDA 2E9VA 1XH5A 3EIDA 2C5YA 3RM6A 4CFVA 4O7RA 1QPDA 2HXQA 3MJ1A 3G6HA 4YO6A 4NUSA 3T9TA 4EBVA 1OM1A 1OZ1A 5DN3A 1U46A 2IO6A 2W9ZB 3EQGA 3QTQA 4U42A 3SXRA 4FF8A 1YI6A 3KMWA 2VGPA 4A7CA 4WNMA 1ZARA 4U80A 3UP2A 5C01A 1ZY5A 3TDVA 3DAKA 3E8DA 4O27B 4W4YA 5CEIA 1K2PA 3EHAA 2C0IA 3GQIA 4HVSA 4QMQA 1JAMA 4AU8A 2HK5A 2I1MA 3KXHA 4FL1A 2AC3A 3CP9A 4PMMA 5LVPA 4BCKA 5AR2A 1Y8GA 5FXRA 3KULA 4PQNA 3NVMB 3KEXA 4GKHA 1PF8A 2XA4A 3U8WA 4PDSA 2XNNA 4PX6A 3ZLSA 3FI3A 4GG5A 3VBQA 3C1XA 3LCSA 5EYKA 5HBHA 4EJNA 5IQEA 4IB1A 2XKEA 4PTEA 3LMIA 5CZIA 4FGRA 4C4IA 5L6OA 4BCQA 4K8AA 3QYWA 4O7NA 3TJCA 5IUIA 4WD5A 4W9WA 4I6HA 3ZYAA 4GYIA 3UO5A 4QQCA 3R9RA 4MXYA 3C5UA 5KZ0A 2UZNA 3Q04A 4FTJA 2ZMCA 5HIEA 4F1MA 2VTHA 4IEBA 3V51A 3KQ7A 5HCXA 4XRJA 3WF8A 3CR0A 2CKOA 3LOKA 3RPOA 2QLQA 3C4EA 4IDTA 4L3PA 3MFUA 3FHIA 4WSYA 3F3UA 4S34A 5M44A 3H9OA 4XP2A 2PU8A 4RJ7A 4G9RA 5ANOA 3CY2A 4XUFA 4O21A 1PKDA 1ZZLA 4Q5HA 4E6AA 5IQDA 4YJOA 2B55A 3R1SA 5M4CA 4RFYA 4KAOA 2C3LA 1UNGA 4KSPA 4D1SA 5I5ZA 2V5QA 4TYHA 5F95A 3QX2A 5HHWA 5CX9A 4FSYA 3QRJA 4BTJA 3FPMA 4FT0A 3HAVA 2XK7A 1KOAA 1JVPP 4J99A 3ZLYA 4BDFA 3AXWA 2XNEA 4WKQA 5CF5A 4E20A 4M12A 4BWKA 3A8WA 3E87A 1P14A 4DGMA 4F4PA 2QCSA 2JBOA 4YURA 3U6HA 2UZDA 4OLIA 5K4JA 2JDRA 3F7WA 3D5UA 5IUHA 3NUPA 4NT4A 2P4IA 4WHZA 3G9LX 4JBPA 5LVNA 2O0UA 4LGDA 5CTPA 2CNVA 1PMEA 2BZIB 2QHMA 4AW2A 1PW2A 3UE4A 5EI2A 4ZTSA 4FSTA 4RIYB 4XS2A 4F6WA 2RFNA 3U87A 1DS5A 4GFMA 4DTBA 3P9JA 3OOMA 3THBA 3TNIA 4DFYA 2EU9A 2WB8A 3UO4A 4AUAA 3ZOSA 3O0GA 1IRKA 4FTNA 4FL3A 3IDPA 2W05A 1SNUA 4R78A 5T68A 3F6XA 4J53A 2JBPA 4FEVA 2B9IA 4JIKA 3E64A 3NR9A 3OZ6A 4J8MA 2YISA 4RA4A 1UWHA 3DK3A 5ETCA 3S00A 1Q4LA 4M13A 5I0BA 3TTJA 5A14A 4XV9A 2JAMA 4AAAA 4DTAA 3BCEA 3VHEA 4G17A 4BZOA 1BI7A 2ZYBA 2QKRA 3HMIA 3S0OA 3U4WA 3AMBA 4UYNA 3DS6A 4FTLA 2QQ7A 4E8AA 4ZTMA 5CAPA 4EK5A 4C4EA 3PJ2A 4S32A 2XNPA 5TO8A 2OJJA 1FQ1B 4ACDA 3EL8A 5L2SA 4D2TA 4YHJA 5E91A 4F63A 2P55A 4EUUA 3WZUA 2WMAA 4G16A 4UMTA 4NL0A 1BL7A 1XHAA 4FIFA 4EQMA 5LVMA 3JY9A 4GH2A 5IQCA 2VTOA 4PPBA 3L8VA 3QAME 1YOLA 4OTDA 1VEBA 3U54A 4ZY4A 1G5SA 1CKPA 2VWZA 2XCHA 4GIIA 4LL5A 5DLSA 4C3PA 3L8SA 3PA5A 2ETKA 4XH6A 5JZNA 4QTBA 2ZVAA 4Y8DA 4GW8A 4CRSA 4IWOA 2UZWE 2H9VA 3MH3A 4BKYA 4TRLA 3PY3A 5HKMA 3VQHA 2WTVA 4OUCA 4RZVA 4DYMA 2X9EA 5M4IA 5HX8A 4IFCA 2H8HA 3PSBA 4JR3A 5CSWA 4DHFA 3SA0A 1SVGA 1FVRA 3CKXA 5EHYA 3Q32A 1KE8A 3GVUA 1E1VA 4EZ7A 4NTTA 4X3FC 4RIWB 4QP7A 4FSUA 3KRXA 3PY0A 4ZY5A 4ASDA 3FWQA 4A9YA 3ZUVA 2CGWA 3NZ0A 3F3VA 3KRLA 4JG7A 1HOWA 4FSWA 3RK7A 4O7LA 3AMYA 4KKEA 4YC8A 4YZNA 3QTRA 4CZYB 4CYJA 4DH5A 2WHBA 1Y8YA 2WGJA 2OSCA 5GJDA 3ODZX 3AC8A 3MA6A 4AP7A 1YXTA 3I7CA 3KXMA 2R3GA 5AUVA 1PMNA 3BPRA 4GK4A 2CPKE 4O96A 4FTOA 3C0GA 4M69B 2W1HA 4PDOA 2RGPA 2PUIA 4XV3A 2OJGA 2OJ9A 4NM0A 5CLPA 4YC6A 4RX8A 2EXEA 2PVKA 4JDHA 4EOKA 4CKJA 3LXKA 3KFAA 2BIKB 5D9HA 4MVFA 4O38A 5AP2A 3BHHA 2LGCA 1UU3A 1QCFA 4IAYA 2XIRA 4G5PA 4KABA 3VW8A 5CANA 4R3PA 1DI8A 3MY1A 4DEEA 3Q2JA 4YLLA 4CGAA 2QOBA 3BYOA 3VAPA 5F9EA 3UVPA 4ANLA 2RL5A 4JG6A 3D15A 2JD5A 4XG9A 4YZCA 3KRJA 2X8DA 1W84A 2CDZA 2AYPA 2X39A 3MH1A 4P7EA 5FXSA 4BDIA 3UNZA 4CVAA 4FEWA 4BICA 4XLVA 3C4ZA 2R3PA 5D7VA 4DG0E 3NS9A 1U54A 5AMNA 3A60A 3DKFA 2VX3A 3V8WA 1OIUA 3NEWA 4NM5A 4KBKA 4BCPA 3S95A 4Z55A 1OL1A 2BMCA 4L7SA 5DNRA 2W9FB 4Y73A 2CKPA 5IQFA 1UKHA 4X0MA 2C1BA 2DUVA 2R3IA 3EYGA 4IXPA 4TWPA 3VIDA 4A07A 2PWLA 3QC9A 3VQUA 4EH3A 4HW7A 2F49A 1GIHA 3FKNA 4QP9A 4NFMA 4R8QA 4KD1A 2VX0A 4O91A 4YBKA 3SRVB 2UZEA 3MFTA 4QRCA 4NKSA 3OWJA 5HGIA 4E6QA 3ATSA 1YW2A 3EWHA 5IEXA 3VO3A 2J4ZA 3K3IA 3WF6A 4YJSA 3LCKA 4GUBA 3ORMA 3LFDA 3UOLA 4IVCA 4L00A 4UB7A 3Q9WA 3CTHA 1XH9A 2PTKA 3O8PA 5DE2A 3OCBA 4ZTHA 5KZIA 4USFA 1DM2A 3P4KA 1PXLA 3H10A 3NNXA 3VS7A 4DBNA 5BUIA 2IVVA 5E1EA 2W96B 4UXQA 2BCJA 1JOWB 4EBWA 4IMYA 1O9UA 3IW8A 3R9DA 4FIJA 1AGWA 3LCTA 3RNIA 4UMRA 3OWLA 4BI0A 2ITXA 4R7HA 4FK6A 4I24A 3W2QA 4C4GA 3BGQA 4Y85A 3FMHA 3FQHA 3NUYA 4QMYA 4EHEA 5IH4A 4YP8A 5FP5A 4CV9A 3WYXA 3MFRA 3P86A 3HL7A 4K11A 2QVSE 3RI1A 3L9PA 3MTLA 3N51A 4JG8A 5CWZA 3ZDIA 4CNHA 2R9SA 3ORPA 3VS0A 3IW7A 5IDNA 4U3ZA 3VBVA 5DT4A 4BL1A 5EI6A 2V7AA 2YWPA 4J1RA 3NSZA 4CFMA 3C4WA 4RWJA 2W7XA 3R01A 2QURA 3TEIA 2VWYA 3ZRKA 3POZA 2PK9A 1Z57A 1OPJA 3F88A 2G9XA 2RFSA 3R9OA 4TT7A 2ZOQA 4CFUA 3W8LA 4IAZA 1J1BA 3DAJA 2YIXA 4RSSA 2ERZE 3SW4A 4ALUA 5HD4A 3AGLA 2A0CX 3I60A 4O1OA 4CD0A 4FUXA 5IISA 4YR8A 4EHVA 4ZSEA 4O86A 4UWYA 5J8IA 3RAKA 4AGDA 3DDPA 3VULA 3CJFA 2UZTA 4IJ9A 5FTQA 5LCKA 4A9UA 5M56A 4FC0A 4MQ2A 4ZJVA 3NNWA 3DFAA 3RALA 4EZ5A 2ITUA 4M3QA 4YBJA 3JXWA 3FSFA
chains in the Genus database with same CATH superfamily
1W2FA 4MNFA 1G8AA 4WT6A 4AXDA 4FT7A 4L01A 2EXMA 4ANBA 2XAMA 5FM3A 4IADA 4RG0A 2ZV7A 5EQEA 5DHJA 4AF3A 3PPZA 3MIYA 4BJJA 3ALNA 3FLYA 2W4OA 4V04A 3HA6A 4I92A 4PPAA 2PZIA 4PV0A 2XK4A 4WO5A 4Y95A 5HVYA 5J7BA 3ZSHA 3PXZA 3JVRA 3FJQE 1Y91A 1OBDA 4C4HA 4XCUA 3RCJA 2CNQA 4IAAA 4ZP5A 5E4HA 3UOKA 4U44A 4FKRA 4DFXE 2RSVA 1ZRZA 1IAHA 3G9NA 3RZBA 1M2QA 3DZOA 4BB4A 2VWWA 5JQ8A 3PVBA 2WU6A 4P2KA 5J7HA 4DFZE 2PE0A 2H6DA 3GU5A 3R7UA 3ZHPC 3VUMA 4F6SA 3FMLA 4BHZA 2BRMA 2YM8A 4ASEA 2Y6OA 5E8SA 2EUFB 2BR1A 5GJGA 3DBQA 3QBNA 3PZHA 5JMSA 4IX3A 3BU5A 4ITIA 2CGXA 3TKUA 4BGHA 4EK6A 5FTGA 2IVTA 1MQ4A 1OL5A 2RG6A 2CJMA 3K2LA 3DKCA 3ZXTA 3ROYA 3WI6A 5AV3A 1WVXA 4W4WA 1S9IA 2W4JA 3RK5A 2I7QA 4B7TA 2C6OA 4E4MA 1YOMA 1ATPE 4RC4A 4YJRA 5HBEA 4IM2A 1V0PA 5L8KA 5H2UA 1QMZA 5C4LA 2WMQA 5EHLA 5A3XA 5A46A 3TMOA 1FOTA 3HGKA 5KBQA 3A4PA 5C03A 3CKWA 1TKIA 4BBFA 5D41A 3ZRMA 2WFYA 3LFAA 3V5PA 2AEGA 3NNUA 5F20A 4YNEA 3KRWA 2J0MB 4UWBA 1K9AA 4O82A 3EKNA 5FXQA 3DK6A 1ZXEA 2HOGA 3FZPA 4FKOA 4V05A 1OIRA 3HMPA 4O0XA 3PJ8A 3A7FA 4GJ2A 4D2SA 3E8NA 4D2RA 2F2CB 2H96A 3W10A 4Z16A 4LRKA 2GNHA 3RAWA 1RDQE 3CSVA 4BCGA 4MBLA 5CF6A 3SVVA 3LFNA 4FKSA 2BZKB 3FZSA 2GNLA 1WBOA 2QO7A 4ZK5A 2J2IB 2C6LA 4QTCA 4UEUA 4AN2A 2P2IA 1ZZ2A 5L2WA 1SZMA 1DI9A 2XBAA 3G6GA 4H1MA 5G1XA 4F7NA 3COIA 5CXHA 3UIUA 4R5SA 3RPVA 3KA0A 4AZVA 4DGGA 5KMNA 4RJ3A 3HX4A 5K0XA 2J6MA 2UW9A 3QRUA 4I21A 2OF2A 2YCFA 4PP9A 3HZTA 4I6FA 3GXLA 3KB7A 3ZS5A 2I0HA 4RZWA 4FZAB 5LMKA 3LW0A 1ST0A 2X9FA 2WIHA 4UZHA 3UDZA 1YDSE 2VTQA 2YHVA 1ZYJA 2A27A 3F5PA 3P1AA 4D2PA 5GZ9A 4JVGA 4RX7A 4W8EA 1URCA 4KS7A 4AZEA 3ZMMA 4DTKA 4ACCA 5BVDA 2IJMA 1YHWA 2JFLA 3VUGA 4YSJA 3GU6A 5ACKA 3C7QA 4EOJA 5JFXA 2O65A 2XIXA 4JRVA 1WBVA 5CQWA 5BMSA 3SG9A 3MY5A 4ZJJA 3VS6A 1U4DA 4G3EA 4QTDA 4C8BA 4UXLA 4U8ZA 1H0WA 4EK4A 3I7BA 5I9YA 3OG7A 4MXOA 3HLLA 5CU3A 1PXNA 4I3ZA 3Q96A 4U97A 3FL4A 3DQXA 3QKLA 1J1CA 3B2TA 4OBOA 4P4CA 1PYEA 2IZTA 3R71A 4JJRA 3SLSA 5KO1A 4BYIA 4ERWA 2Z7RA 2JGZA 4U43A 4BYJA 3U9CA 2CKQA 4BIEA 4XP0A 4BHNA 2RIOA 4OW8A 4JR7A 1UV5A 4ARKA 2VTMA 3QHRA 5AP0A 4I1ZA 1H1SA 4C3FA 5HZNA 4W9XA 3PVGA 4FEUA 2R3JA 4A9TA 3SKCA 5E1SA 3F2AA 5HCZA 5GNKA 3IG7A 2I0YA 3G90X 3FLNC 5JRQA 5HLNA 1XH6A 1OVEA 1M2RA 3OW4A 4I5PA 4KIQA 3NIZA 4LV8A 3VUIA 3PYYA 2R3RA 3TWJA 4LRMA 4I6LA 4EKKA 3QKKA 5JFSA 4G5JA 2G2FA 3QCYA 4NWMA 5AWMA 3ZFXA 3AC3A 3A7IA 3BLAA 4B8LA 5EK7A 3F82A 3U4UA 5HO7A 5J5TA 5JZJA 3NUAA 3R7GA 4XG7A 3PIYA 4WOVA 4HYHA 4X6QC 3PA4A 4MD9E 1H27A 1M17A 1WCCA 2ITWA 2NP8A 3OF0A 5H9BA 1H28A 1NW1A 3AD6A 3DBDA 1WAKA 2XMYA 4HGTA 4NCTC 1R78A 4WG3A 3W55A 3DXNA 1QPEA 1YXUA 1AD5A 4EH6A 3E7OA 4PDPA 2UVZA 2BRNA 3CJGA 3GI3A 5D7AA 5IZFA 1JKKA 4KSQA 1VJYA 4JDJA 4B6LA 2XH5A 4KIKA 2Y8OA 4AA0A 4CT1A 3TACA 4C34A 2CCIA 3PG1A 1MRUA 2O64A 2YM5A 5KHWA 2YITA 2WMTA 5JT2A 3A4OX 4E4XA 5JEBA 1U5QA 3KREA 4LL0A 4WSQA 3L9NA 5EDQA 4LV7A 2OU7A 2XP2A 2R64A 2REIA 4FRFA 4DFUA 4J96A 4N70A 5IQIA 1ZLTA 3NYNA 3A62A 3OW3A 4JDIA 4D28A 1IG1A 1A48A 3R1QA 1OKWA 3TTIA 4EUTA 3VHKA 1REKA 2R2PA 3P5JC 3CE3A 3BLRA 1UVRA 4HGSA 3BWFA 3OT3A 3GC8A 1JKTA 4UWCA 3EQIA 4Y5HA 1J7UA 4M68A 4QMXA 3NAYA 4BR3A 1H00A 2OZAB 3CY3A 3GP0A 2WZJA 2C6IA 4FMQA 3QTSA 5BMMA 5IA1A 3QZGA 4BDDA 3CGFA 3FPQA 4C38A 1LEWA 3E92A 4XV1A 5D12A 2JIUA 4AN3A 1M52A 3R63A 3R8LA 5C8NA 4FTUA 1E1XA 2PY3A 4RMZA 4LGHA 2XKCA 2NPQA 2UW4A 2GU8A 5AP3A 3V5TA 4ZLZA 2QR7A 3D4QA 1JSUA 1MQBA 3UMXA 3DTWA 3R1YA 4NIFB 3W0PA 5FWKK 4E73A 3VONA 4U41A 1WBTA 3SV0A 2WEIA 2GS7A 4M84A 4X2KA 3ZC5A 5IEVA 4O0WA 4H1JA 4HNIA 2C68A 3II5A 4X2NA 4K2RA 4PP7A 5AUXA 4DDGA 4KBCA 5CU0A 1YWVA 3VNTA 2GHLA 2OJFE 3COHA 3D83A 3FLSA 4YLKA 3DLZA 4F7LA 1ND4A 4EQUA 4CEGA 3MVMA 4RFZA 1XBBA 4IQ6A 2WTIA 4RC2A 2ITZA 2QG7A 2PVYA 5AX3A 2GNIA 4W4VA 2HXLA 4Q5EA 4FTAA 4ZSLA 3GCVA 3PVUA 2RFDA 4IDVA 2W1CA 4TNBA 3RAHA 3W0SA 3QYZA 4FSMA 4XMOA 3PJ3A 4DBXA 4AZWA 5IG1A 4ORKA 3EQPA 3TZMA 4U79A 2LAVA 4QMNA 2OW3A 1W7HA 4FTCA 2Z7QA 3GGFA 2YCSA 4LRJA 1FINA 1OECA 2QC6A 3ORZA 2GTNA 4FV9A 3GT8A 2CN5A 3OXZA 4M66A 1FMKA 4NJDA 4AGCA 2R5TA 2RF9A 3OUNB 5HNIX 3NMUF 3ALOA 4J7BA 4AS0A 3C51A 2W1FA 2Q0BA 2J0JA 3BELA 3MN3A 5IU2A 4QMVA 2A1AB 5TR6A 3PP0A 5I9ZA 3E8CA 3QA8A 1GZOA 4G3GA 4E6DA 1CDKA 4BDCA 4C57A 2VNWA 3ZUTA 1ZOGA 4ID7A 5BYLA 4MUQA 1OBGA 3FEGA 4FTKA 3MESA 3KU2A 4XV2A 4RJ5A 3GEQA 3FLWA 4OR5A 2B9FA 1ZMUA 3R28A 3DNEA 5AR8A 5HCYA 4BTMA 3OHTA 2QHNA 2SRCA 2YAKA 3QD4A 4O7VA 2PMNX 3B8RA 4JIAA 4L67A 5JRSA 3JR1A 2JKKA 5EM8A 2ONLA 4TY1A 5I9XA 5HX6A 4F6UA 4II5A 3KMUA 5LOHA 4FKGA 4ANNA 3TNHA 4G6LA 3RHKA 3AD4A 3KRRA 5K5XA 1ZMWA 2CCHA 1JSVA 2GSFA 2HWPA 1IASA 3O50A 2OI4X 4FA2A 3DFCB 3LLTA 4FNXA 3G2FA 2C4GA 4R3RA 4KA3A 2OJIA 5CALA 4BGGA 4X3FB 3OBJA 4G2FA 1W2CA 4TYJA 2VRXA 4HCVA 3GQLA 3R2BA 4QO9A 5FM2A 2PVNA 5AAGA 2C6DA 1PMVA 2A98A 4RIXA 4IC8A 4QTAA 3QHWA 4AW0A 4D9UA 2UW7A 4BTKA 2WMBA 3O7LB 2YERA 4GFOA 1W98A 2BTSA 4O0UA 2BAKA 2YIRA 2OO8X 1YI3A 2G2HA 3ZH8A 3I5NA 2VTNA 4MH7A 5B2LA 4DE4A 5DG5A 4CMUA 5K0KA 2GNFA 4RIOA 5FQDC 4Z3VA 4EWQA 2WQBA 2PHKA 4O0YA 3OWPA 3E88A 4HVIA 2VV9A 4V0GA 2VX1A 4R7BA 2UW3A 3PXQA 2CHLA 2OFUA 3I5ZA 4GU6A 3UYSA 4IIRA 3MV5A 5HQ0A 3PTGA 5DGZA 1UA2A 2BKZA 4YPDA 4FTIA 1KUTA 4ITHA 4KWPA 4FVRA 4GG7A 2E9PA 4OT5A 4C37A 2ZMDA 3AQVA 3ELJA 5BVEA 3C5IA 2BTRA 2X1NA 4C58A 4PPCA 1Q3DA 4W8DA 5CU2A 3WZJA 4EONA 5HTCA 4FG8A 5BPYA 4R1YA 3C0HA 3LFFA 5JQ5A 2O3PA 4IAKA 3LMGA 2ERKA 4FT9A 2CN8A 3R9NA 3ORLA 3RMFA 3REPA 3E5AA 3HV4A 3H0YA 2IF8A 4YUQA 5BVFA 5CSPA 5AM6A 3UIBA 3ZCLA 4ZTQA 5HLWA 3UQFA 3OMVA 2J0LA 4IHPA 5HE3A 3VS5A 4DT9A 3G51A 3MB7A 1KE9A 3IOKA 4HPTE 3G0FA 4FBXA 4AE9A 2WMWA 3MJ2A 2XNBA 5HVJA 5E8XA 1SYKA 4CQGA 2C3KA 3FBVA 5LVLA 4BZDA 3DB8A 2O63A 3P08A 3AKJA 4X2FA 4CG9A 2W99B 3TNQB 3VUTA 4YZ9A 4FZ7A 4BCMA 4OTRA 3I4BA 2F7EE 1WMKA 2PZPA 5FGKA 3QA0A 2EWAA 5EW8A 4YTCA 3F7ZA 2R7BA 2YM7A 3UMWA 3K54A 4XHKB 1NVRA 1PXKA 1Z9XA 3ZEPA 2DWBA 1DAWA 3RTPA 2R7IA 3PWDA 2RKUA 2QNJA 3RINA 3M1SA 3EMGA 4L8MA 4EJ7A 1YXXA 4X21A 4PMTA 2E9OA 3D7TA 1Q8ZA 1UKIA 2BFYA 1E9HA 3TCPA 2C6KA 3IW4A 4Q2AA 5EM7A 2UZBA 4AGUA 3OXIA 1XKKA 4BVUA 4EORA 3BRBA 4I5HA 2WO6A 3OCGA 4DEHA 3BHYA 3FC2A 3D2KA 1H01A 3V6RA 5DA3A 3LXNA 5CSXA 2IZSA 4AFJA 1BL6A 3GC0A 2OICA 2XNGA 3TT0A 5KX8A 4E93A 1H0VA 2PE2A 4DHIB 1WZYA 2JDOA 3FAAA 1BUHA 2FSTX 4F9AA 4BCOA 1U5RA 4APCA 2WNTA 3PPJA 4M15A 1CMKE 5CENA 3FI8A 3HV5A 4PRJA 5GHVA 5LCJA 5K5NA 3QTWA 3OY3A 4TPTA 4XRLA 3LQ8A 4AW5A 1Q8WA 4CLJA 2BFXA 2XNOA 3ORKA 2XIKA 4ZLYA 5BV3A 1PHKA 2GHGA 2WOUA 1BKXA 3QTZA 3Q52A 5AUTA 4ZSAA 4YJQA 3AGMA 4UALA 3BZ3A 5CNOA 5L6PA 3R21A 1GAGA 1FVTA 5E8VA 3C4XA 3PJCA 4IVDA 3FKLA 2JKQA 3QRIA 5KMLA 4OAUC 3AG9A 4K33A 4TWOA 5JGDA 4O0SA 4C35A 5IA3A 5AIRA 4EOPA 3RBWA 3QX4A 3KF7A 4XG8A 4I6BA 4C36A 3EL7A 4O7YA 4GYGA 1GZNA 1JPAA 2R3HA 5HG8A 2VD5A 3NLBA 3RPRA 3DBFA 2PVJA 4L9IA 5I3RA 3F3TA 4R7IA 4FKQA 3ORTA 5DVRA 2HIWA 5BVWA 5KMKA 2QD9A 3CLYA 3GCPA 2HY81 4O2ZA 4UY9A 3HA8A 3LXLA 3MWUA 3QGWA 3A7HA 3V8SA 4HVGA 3QLGA 4R5YA 2VAGA 3AKLA 4L3LA 3EFKA 4NEUA 4DEDA 4F0FA 3EYHA 2XALA 2WTDA 5DT0A 2BRHA 1KSWA 2QI8A 3R9HA 4QD6A 4H39A 4JLCA 4JAJA 3KXXA 1WBNA 4P5ZA 3PRFA 4BY9E 2RFEA 1GNGA 5FUTA 4ZSJA 4D4SA 1R39A 4DN5A 4EQCA 3QD0A 5AR7A 3O2MA 5F4NA 4O22A 3QD3A 5TOZA 3ZO4A 4OTIA 4CFFA 2B4SB 2OXXA 3DB6A 2IW6A 3ZO3A 3SOCA 2XRUA 4JBVA 1PXJA 5H8BA 3OY1A 4QMUA 5K4IA 5E9EA 4X7QA 5I9UA 4E1ZA 3SX9A 3Q6UA 4IAIA 4OBQA 5A4CA 3FC1X 3I1AA 4IVBA 3UZPA 5M4UA 4XBRA 4BWXA 5AA9A 5IQHA 5M51A 2PUPA 2PZYA 3QFVA 5CU6A 3WE8A 4M97A 5HBJA 5EFQA 2JC6A 1T46A 3DPKA 5AP5A 4A06A 2BDJA 5FLFA 4MNEA 1Q99A 4O0RA 4FZ6A 3QUPA 4A9SA 4M67A 4QTEA 2A19B 4NYEA 5HNGA 3BQRA 4ZOGA 4DEGA 3EN4A 4MBJA 4Y46A 5JSMA 2XKFA 2QO9A 3D5WA 3NIEA 2XANA 4FYOA 3ZO1A 4LI5A 3KL8A 5AV2A 3LCDA 5LWNA 3NYVA 1O6LA 4HOKA 4RC3A 3ZTXA 5IH6A 4QMSA 4RLLA 4FNZA 3MGYA 2YDKA 3L8PA 4LM5A 5ACBC 4CSVA 3UOJA 2HYYA 2W4KA 1WFCA 3RWPA 3EN7A 3FMNA 3ZSGA 5AP7A 5A6NA 5A4QA 3PRIA 4GT5A 1YI4A 4MF1A 5T3QA 3H9FA 4QYHA 2YABA 3HMMA 3PXRA 2AC5A 4K0YA 3VS1A 4D9TA 2OIBA 4FZDB 1A06A 3FV8A 4NU1A 2BZHB 2R3LA 5KMMA 1FMOE 4J98A 4OBPA 1V0BA 2YIQA 4P5QA 3R8UA 5EQYA 1H24A 1B38A 2YM3A 4I0SA 4X2GA 4JMQA 3KMMA 4XG3A 3V6SA 3UVQA 5D11A 4M8TA 5C9CA 5DR2A 3IGOA 1R1WA 4RWLA 5DFPA 2B9HA 4FR4A 3C0IA 3P79A 4QP4A 5JKGA 5J1VA 4MD7E 3HNGA 2ITNA 3UZRA 3FXXA 4KKHA 5KUPA 4DFLA 3BEAA 4DT8A 1WVWA 4TXCA 4ZZOA 4EH9A 5KHXA 2Z02A 3LQ3A 4J97A 4MXXA 5IQGA 2CGVA 5ANJA 3QQKA 3TDWA 4KRCA 2VZ6A 2BHHA 1GOLA 4LFIA 4XYFA 4U0IA 2F57A 4JBQA 4AE6A 5AM7A 4YTIA 3R7OA 4TTHB 1PYXA 1UU7A 2BPMA 3OEZA 3PSCA 4BDGA 3RWQA 3BYUA 2VO6A 4TL0A 3G0EA 4QMTA 3D14A 3Q4TA 4ACGA 2H34A 5AR3A 4ZMFA 3O8UA 3EB0A 3V01A 5IMXA 2ZB1A 4IAFA 1CSNA 2CKEA 3R8VA 5M55A 3GNIB 4O81A 5HU9A 4X2JA 3UDBA 4E5WA 4FSQA 4BI1A 4ASXA 3A99A 3JVSA 2WEVA 3A61A 3AC1A 4BDKA 4UBAA 5EDPA 5FEQA 4PMSA 2J7TA 2C5XA 3LFCA 4HYIA 3UIXA 5A4EA 3DDQA 4EOSA 5TKDA 4F99A 5A9UA 2PZRA 4KNBA 1DAYA 3H0ZA 4OTPA 4KIOA 4BN1A 3LJ2A 2J5EA 2YDJA 2ZM4A 3R83A 4XOYA 3RNYA 2YCQA 2YM4A 2BZJA 5EDRA 3V3VA 2PYWA 4U6RA 4FGBA 4RIYA 4FX3A 1F0QA 2Y4IC 4BZNA 3EH9A 3DKOA 4GL9A 3PA3A 4PNIA 4BCJA 4USEA 2DYLA 5A54A 4D5KA 3UNKA 4FV3A 1XH4A 2PUUA 4Z7GA 4CFWA 3P23A 2JEDA 4WNPA 3SHEA 4U40A 5DR6A 3W2OA 3LVPA 4HVDA 4QQ5A 2GS2A 3LFQA 4JOAA 2X8EA 3F3WA 2X2MA 3Q9XA 4G6NA 4L68A 4F70A 1NVQA 2GQRA 3RVGA 2XJ0A 2GQSA 2QODA 2R3QA 4LDTA 1OPLA 1REJA 5CT0A 3FHRA 3WBLA 4DH3A 5HG9A 3TNPC 3ZBXA 3D94A 3IECA 5I9WA 4NM7A 1W82A 3GBZA 4WRSA 1XMMA 3ZRLA 3V04A 2VTJA 2V55A 4M0ZA 4FIIA 4EC9A 5CEOA 1YXSA 4KBAA 5EW3A 3V5LA 5L3AA 3R73A 2IEWA 2YAAA 4R6VA 2OFVA 4EYMA 4AFEA 3KULB 3MFSA 4QOXA 4F9CA 3TIYA 5J1WA 4U7ZA 2Y7JA 4N4SA 2HWOA 1F3MC 4H36A 4FTMA 5E8YA 2UV2A 3A7JA 4JNWA 1W83A 4C2VA 4DEAA 2X0OA 2XUUA 3O17A 4HGEA 3BBWA 3BL9A 3W2PA 5FEEA 3HMOA 4DHZA 3PSDA 4ZTNA 3WIKA 5LWMA 3ORXA 4RFMA 2PVLA 2F9GA 4YLJA 4I93A 4EOMA 3W0OA 4UZDA 4G34A 5E7RA 3WZKA 3FMKA 5LVOA 5HG5A 3TV6A 1ZWSA 4FV1A 3ZONA 5ETIA 4PTGA 2KTYA 3M2WA 3RM7A 3N4TA 3MVHA 1B39A 1CM8A 4JQ8A 3LAUA 3GCQA 3JY0A 1QPCA 5CS6A 3DAEA 2QOHA 4FG9A 5E8ZA 1TFFA 2XAOA 5E8WA 3MB6A 3UPZA 4AQKA 1OGUA 3MIAA 3QXPA 3GU8A 4BRXA 4RIWA 1I09A 4UX9A 3WIGA 1YXVA 2XARA 3ML1A 5FBNC 3BLHA 5DT3A 3EJ1A 1VR2A 4D2WA 5BYYA 3UDSA 4XOZA 4BCNA 3VRZA 2FVDA 3DOGA 3ERKA 4KIPA 4WUAA 3QD2B 3FI4A 2UVYA 4TYHB 2JKMA 5ETAA 3NFGB 2Q0NA 2R0UA 4BI2A 1P4OA 4CMTA 1LR4A 4CT2A 1UNLA 1GZ8A 3VBYA 3WYYA 3F69A 5BUJA 3IS5A 1Q97A 4M69A 5IQAA 5HIBA 3OBGA 3HV3A 4ANSA 4K77A 2XJ1A 5GZ8A 2YCRA 4L46A 4OGRA 5CU4A 5HORA 4AWIA 2PULA 5KKRB 2C3IB 4FV8A 4PNKA 2WAJA 4H05A 3ETAA 1OL2A 4WBBB 3VF9A 4AA5A 3RPYA 4KKGA 4WG5A 3RKBA 4FSNA 1YRPA 2OZOA 5EW9A 3SXSA 4F0IA 4B9DA 3U6IA 5CEKA 2JAVA 4ACHA 3QQFA 4YJUA 2HENA 1UWJA 3EFLA 3CPCA 3B2WA 3AD5A 4I5CA 5HU3A 4C62A 4QMLA 1STCE 2XK9A 5EM5A 4U9AA 3ZO2A 1IR3A 4EK3A 3LJ1A 3F2NA 3U6JA 3HP5A 3QUEA 4RLKA 4BKZA 1H26A 4YZDA 5DRBA 2NYAA 3W2CA 3VUKA 2GQGA 4MXZA 3D5XA 2UW0A 3UIMA 2XB7A 4GT3A 4JX7A 4L45A 3EQHA 4WUNA 2X8IA 2CNUA 5M09A 1SNXA 4A4XA 4G31A 1L8TA 3EKKA 3BU3A 4J8NA 3I6WA 4CCUA 4HZSA 3DY7A 4HNFA 4L52A 5KMJA 4ZS4A 3T8OA 4IZAA 2YIWA 4LMUA 3NCGA 3VF8A 2OLCA 3NUSA 3DBEA 3H30A 4RA5A 3AT2A 4AXAA 1H25A 1H08A 3SRVA 4RVLA 3LCOA 1Q5KA 5HOAA 5J5SA 4GVJA 4H3PA 5JGAA 2GFCA 2XF0A 2RG5A 3HYHA 4FV2A 4O4CA 2F4JA 4BIDA 4O7ZA 4DLJA 3BKBA 5M07A 4RT7A 3MBLA 5E8TA 4E26A 3B8QA 4TYIA 4E4LA 5LQFA 1TQPA 2J51A 2FSOX 1CKJA 5DPVA 5CAOA 2ZV9A 1X8BA 3NUUA 3O8TA 3SOAA 2XEYA 2Z8CA 1J7IA 1O6KA 2YFXA 3DKGA 2BROA 4QT1A 3T9IA 4G9CA 5AV1A 4DEIA 3EQCA 3PFQA 4D4YA 5IF1A 3HRCA 2YN8A 1OITA 1KE7A 4JRNA 3SW7A 4PY1A 2W5HA 2ITPA 4HGLA 1OKYA 4DGLC 2X2LA 3TM0A 4NZWB 4U45A 3CC6A 4KB8A 1NA7A 4LUEA 1URWA 2ONLC 2WMSA 3FDNA 4GT4A 1L3RE 4XLIA 1H1PA 1IAJA 4CKIA 2Y9QA 1BX6A 3QQLA 1UU9A 2YLFA 3COMA 3VRYA 4R77A 3DNDA 4EH8A 2PL0A 1UU8A 4GK3A 4RVKA 5B7VA 1WVYA 1YDRE 2PVHA 3HECA 4JAIA 2YJSA 2C6MA 5M57A 3FMDA 3KXNA 3O96A 5EOBA 3ZZWA 5KMIA 2ETRA 2EB3A 4RGJA 4NJ3A 1AQ1A 4RWKA 4BDBA 1V0OA 1OI9A 3GUBA 3L8XA 5EHOA 3UTOA 2WIPA 2V22A 3AMAA 3ULIA 3E63A 3HV7A 4TW9A 5AA8A 2CLQA 2R4BA 3ZFYA 2BAJA 2UVXA 4TKSA 1RJBA 3Q6WA 4NK9A 4QP1A 4TZRA 3DGKA 2R3NA 3VVHA 3TI1A 3SXFA 4Q9ZA 4MKCA 3HVCA 4FL2A 4QYGA 5C1QB 4KRDA 3LJ0A 2WTKC 1YDTE 3VJOA 4USDA 4DH7A 1S9JA 3PP1A 5T6KA 1OKZA 4RBLA 4ZEGA 5I3OA 5J95A 3ZC6A 2WQMA 4CRLA 2YDIA 1XR1A 1OL6A 1MP8A 1QL6A 3R8MA 5CF8A 3DXQA 1BI8A 2WQNA 3SD0A 4TYGA 1VYZA 2BVAA 5ETFA 4QPAA 2W5AA 4UV0A 4NTSA 4NKAA 3P5KA 2BHEA 3OOGA 4GVAA 3MVLA 4MAOA 5LARA 3TN8A 4ERKA 5AEPA 4FVQA 4F9BA 5IQBA 1ZMVA 3R1NA 4BFMA 3Q9YA 4O83A 4B0GA 4ZMEA 5M06A 4OTWA 4FE2A 3MSSA 3KN5A 1YQJA 5FTOA 1ZOEA 1YOJA 2X4ZA 3BIZA 3F5GA 2EXCX 3UODA 1G8JA 2XK6A 5CVGA 1Q62A 4JX3A 3TZ8A 3V5WA 1U54B 5KKRC 3NW6A 4O7SA 2B53A 3LFBA 4Y83A 4MTAA 4QPSA 3ODYX 2WTWA 3BWJA 4CFXA 4BCHA 1OB3A 3BX5A 3JUHA 3D0EA 5TF9A 2KULA 4LUDA 1RW8A 4ZAUA 4FTRA 3CTJA 2FB8A 5ANDA 4ANMA 3MH0A 2OIQA 3Q2MA 2QU5A 4QMWA 5BQ0A 4MHAA 2EVAA 2GTMA 3ENMA 4MQ1A 5GZAA 2CLXA 4K1BA 5AV4A 3D5VA 3IQ7A 3PLSA 2Z7SA 1OMWA 5CSHA 2WMRA 5TT7A 3NAXA 4YJNA 3ORIA 2QOIA 1TVOA 1G3NA 3OEFX 4C0TA 3NGAA 4DITA 3AC4A 5K9IA 5LJJA 3DLSA 4JT3A 3CQWA 2W0JA 4RQVA 3ZLXA 3AOXA 4PTCA 4AOJA 4EWHA 2BDWA 3M42A 3TZ7A 3TV4A 4QP2A 5LXMA 3Q60A 2PZ5A 4NFNA 3KK9A 4YMJA 4S33A 4TWNA 2UW5A 2PVRA 4NCTA 5KMOA 2OGVA 2HZ0A 5CVFA 4EOOA 3RAIA 3IGGA 4CYIA 4F9WA 3WARA 4FTTA 4FZFB 3ACKA 3BV2A 3NYOA 4MX9A 4PL3A 1JWHA 2J9MA 1KE5A 2W17A 2XJ2A 4FT5A 4Z7HA 4ACMA 4DH8A 5ITAA 1XWSA 3TNWA 1W2DA 2PE1A 3FXWA 2CGUA 2VU3A 4N6YA 4YHFA 3UNJA 5DMZA 2X6EA 1Q3WA 3PE1A 5AP6A 4F78A 4YHTA 1HCKA 3FMJA 1TQMA 4R3CA 2QU6A 3TKIA 4HJOA 4QMMA 3IK3A 4H3BA 4YJVA 4QDEA 3EFWA 3T3VA 3V5JA 5F1ZA 3IOPA 3F5UA 3D7ZA 3R2YA 3QWKA 3R6XA 4E5AX 4E6CA 3AT4A 3S2PA 5BUEA 1KV1A 3IO7A 3FMEA 5G6VA 2XM8A 3FMMA 4CCBA 3LKMA 4KS8A 2W1IA 3FY2A 1SMHA 5AADA 5J9YA 1TZDA 3GENA 4IB0A 2NNWB 2A2AA 3QGYA 4YJTA 4BCIA 4FIEA