4BDDA

Fragment-based screening identifies a new area for inhibitor binding to checkpoint kinase 2 (chk2)
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
304
structure length
281
Chain Sequence
MSVYPKALRDEYIMSKTLEVKLAFERKTCKKVAIKIISKNVETEIEILKKLNHPCIIKIKNFFDAEDYYIVLELMEGGELFDKVVGNKRLKEATCKLYFYQMLLAVQYLHENGIIHRDLKPENVLLSSQEEDCLIKITDFGHSKILTSLMRTLCGTPTYLAPEVLVSVGTAGYNRAVDCWSLGVILFICLSGYPPFSEHRTQVSLKDQITSGKYNFIPEVWAEVSEKALDLVKKLLVVDPKARFTTEEALRHPWLQDEDMKRKFQDLLSEENESTALPQVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SERINE/THREONINE-PROTEIN KINASE CHK2
publication title Fragment-Based Screening Maps Inhibitor Interactions in the ATP-Binding Site of Checkpoint Kinase 2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 88
structure length 281
sequence length 304
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4bddA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4bddA01
2OG8A 3PXYA 4LOOA 4BTJA 4CFWA 4O7ZA 4O7RA 5TR6A 4JBQA 1BX6A 3HV7A 3K3JA 5JFVA 2BZHB 2DYLA 2R3OA 4G17A 2Z7SA 2ITPA 5E90A 4CZUA 5ANIA 3LCDA 4E5AX 2HWOA 3ZUTA 3LXKA 1U54B 4XS2A 3ZYAA 3SVVA 2ITOA 1UWHA 3VJOA 4UZHA 2VWIA 3RAHA 5C1QB 5J7HA 2XNBA 5DT0A 2YM7A 3ZBXA 4YJVA 3C5UA 3UE4A 2YERA 1V1KA 5CEOA 1QCFA 3U6JA 3KEXA 3KC3A 4TL0A 3IOPA 4DEDA 4RIYB 4XRLA 4YZBA 4C4HA 4MXAA 5TOZA 4WOVA 1WBOA 2ZJWA 3BYUA 3BU6A 3EQFA 4F9CA 4LGGA 5LMKC 4TTHB 4BN1A 3T9TA 2VUWA 4JAJA 2GU8A 2V7OA 4YJQA 3OHTA 4FV0A 4UY9A 5CTPA 4ASZA 3ZU7A 4DCAA 3OUNB 4XG9A 4LL5A 5DWRA 4GVJA 3G9LX 3D7TB 4DH5A 2YIYA 3NUSA 3W8LA 4OTRA 5KKRC 5L6WL 2R3NA 5LVOA 4D55A 5FDPA 3B2TA 4PTCA 5HHWA 3TKHA 2C6MA 2E9NA 3DV3A 5LMBA 5LQFA 4K11A 5BMMA 3NUPA 5E8UA 4TN6A 3R9NA 5DLSA 2PMNX 5IEXA 3IOKA 4UALA 4WSYA 2PZRA 4UZDA 5BYLA 5L6OA 1UNLA 3TWJA 5F9EA 3DOGA 5LCJA 3V5PA 1FVTA 3M42A 3NSZA 3ZFMA 3KXMA 5HTBA 5TKDA 5M56A 2XKEA 3E93A 4UB7A 3BV3A 3MFRA 3OW3A 4QP8A 4BC6A 5BPYA 3WYYA 4V04A 3IONA 4ERKA 3TJDA 4CQGA 2W1ZA 3PG3A 4EK4A 3GGFA 3GENA 5J5SA 5J79A 3CY3A 2IZTA 4FIJA 4IB1A 4S33A 5KZIA 3R7EA 3FMKA 2YACA 4GT5A 5BVFA 3R02A 4GYIA 4IAIA 5F4NA 2FSTX 3R73A 2VTIA 4BGGA 3QQFA 3WILA 2GCDA 1I44A 3VO3A 3ANQA 4EKKA 5A4CA 5IH5A 3PZEA 4GS6A 4J8MA 4ACGA 4C37A 3E8EA 4EOLA 1P14A 1OZ1A 2O65A 4E6CA 5IMEA 5AJQA 3RJCA 1UU9A 4ZP5A 5FRIA 2OXXA 3BGQA 3LM0A 4WO5A 4G3CA 5H3QA 5J95A 2HZ4A 3IDBA 3QD0A 1OKYA 3EB0A 3FLWA 5EI2A 3DQXA 3BYVA 5CSXA 4FTNA 2Z7QA 3KQ7A 3MESA 4BWXA 4I6FA 4DG2E 4XG6A 1XQZA 4HCVA 4CFVA 3LM5A 1GZKA 3F88A 5HCXA 3UZTA 1PY5A 5KE0A 4FSWA 3ORTA 1MQBA 3DBDA 4U5JA 3QUPA 3ATSA 4YNOA 4MKCA 1KSWA 1PXOA 3PY1A 2GQSA 4HGSA 4JBVA 3PVGA 4EOKA 1JKLA 2CJMA 1OL2A 3Q4ZA 4LM5A 1GZNA 4N6YA 1FINA 3OCSA 3OG7A 2XRWA 3AC8A 4FTQA 4IE9A 4CLJA 2GNGA 4DH3A 4EHGA 4IZYA 4R7BA 3T3UA 2W4OA 4WBOA 4Z3VA 2PVKA 1WBSA 2CKOA 5JZJA 4F7JA 4AG8A 1ZAOA 1LP4A 2XNPA 4FKRA 1PYEA 2OJIA 2ITWA 4JRVA 4EH8A 5CAOA 1SVGA 1WVXA 2BUJA 3O7LD 3C5IA 5CWZA 3LQ3A 3H0YA 3RZFA 4U45A 5CEPA 4ENXA 2Q0BA 3UVQA 3DFCB 3QA8A 1ZMUA 4FG9A 4FTIA 4MNEB 4O22A 2W1EA 3ZLWA 2VV9A 1XKKA 4D5HA 5AAGA 4I6BA 4RIYA 5J9ZA 4FKWA 4JRNA 1ZRZA 4FIEA 2QURA 3TXOA 5FXRA 3P9JA 4H3PA 3VS2A 4C33A 4YJTA 3N4TA 1E9HA 3CPCA 3FBVA 5JEBA 5I0BA 4CLIA 5FBNC 4CEGA 3VS3A 5JT2A 2V55A 4FKGA 4FL2A 4C34A 1OI9A 3QZIA 4CXAA 2HW7A 2I0YA 1NY3A 2JBOA 3D7TA 3FHRA 5FP6A 1IG1A 4F0IA 5KHWA 2QOBA 4XV9A 3VN9A 1YKRA 4QMZA 3MY5A 4EJ7A 3I4BA 2C6EA 4ZY4A 3OF0A 4BCKA 3E92A 2PY3A 4QNYA 2XKCA 1JQHA 4AW1A 4I6HA 4NCTA 2G15A 4IAFA 3FLZA 4AZSA 1GAGA 3W2RA 4UXQA 2W5BA 3ALNA 3QZFA 5HD7A 4IMYA 3F7WA 5CSHA 2UW4A 5CU2A 3BU3A 3D0EA 2UW6A 5ANGA 3CE3A 3JYAA 4MTAA 3A7FA 4C61A 2QU6A 4B8LA 4RLLA 2WQEA 4QMTA 4F09A 3QCSA 4ZSAA 4D4VA 2ZM4A 4HZRA 5DVRA 2Z60A 4XP0A 4I4FA 2CPKE 2R7IA 3CIKA 4OTIA 4O1PA 3UTOA 4EOOA 2OJGA 4EOJA 3QCXA 3N9XA 3NNWA 4RWLA 2Q0NA 3NAXA 3UO4A 4NEUA 2EB3A 3AQVA 3KFAA 1U59A 1F0QA 4N4SA 4KBKA 4UMQA 5BVOA 3G6GA 4WNPA 5CT0A 4IB0A 1OPLA 1XJDA 2BRMA 2XEYA 3FZTA 3HKOA 5EYCA 4AUAA 4AS0A 1FBNA 2NNWB 4ASEA 3F2NA 3R22A 5CZIA 3ZZWA 2C4GA 3MVLA 3VHEA 5CZHA 5EYMA 1W7HA 4F9AA 4C3PA 4GKIA 1O9UA 5LMAA 3DZOA 2J0LA 4L67A 3F3WA 2R3QA 3EQHA 5I4NA 3I79A 3C4CA 4IB3A 3FZPA 3TDVA 3E8DA 2R3PA 3PY3A 4J53A 5AFVA 3DKGA 4APCA 3CP9A 2PZ5A 5DR2A 4LRKA 3C4ZA 4LYNA 3HRCA 1F5QA 3VW8A 4EOIA 4KAOA 4KIKB 3E3BX 3QLGA 3SLSA 3FMHA 4NJDA 5AUXA 4O27B 3PJ1A 3ZLXA 4DG0E 4QP4A 4AXAA 4FKQA 4KA3A 3WARA 2HZNA 4DFNA 4OR5A 4D2RA 2VTAA 2WQOA 4RZWA 4F7SA 4MQ2A 2RFNA 4ZTHA 1YOMA 5IUIA 4U41A 4BDAA 2WD1A 3RK7A 2WHBA 3L8SA 3DB6A 4NFMA 3W1FA 3TUCA 4OTDA 3QQKA 3OOGA 5HIDA 4J98A 3Q9YA 1B39A 1JOWB 4PL3A 3FXWA 3HUBA 3QRJA 4PNIA 4EH7A 4XP2A 5E8SA 1HCLA 5EI8A 4DFUA 3SG9A 4MNEA 5FDXA 3OS3A 4YLKA 4M15A 3MVMA 4WNKA 5ANKA 3KRJA 5HE2A 2Z7LA 5BVEA 2XK7A 3LPBA 3EQIA 4P5ZA 1IA8A 3I5ZA 3L1SA 4WNOA 2H6DA 3RMFA 2Y6OA 4EH5A 1U5QA 4WUNA 3OY3A 4PY1A 1XBCA 5AP3A 3PIYA 3VRYA 4D5KA 4E93A 5GIPE 4DT8A 2PULA 4AN9A 2C68A 3BZ3A 2RG6A 3ACKA 4A9UA 3CCNA 4BKZA 2PUUA 4UMRA 4KABA 4DLJA 4I22A 3T3VA 3QBNA 4FBXA 3FC1X 3FI4A 5D7AA 4CFFA 4E6DA 5BQ0A 2GHMA 4PMTA 3EL7A 4KSPA 3KXXA 2WGJA 5DRBA 4A7CA 5AAEA 1WBNA 2GQRA 3R0TA 4GFGA 2C6KA 4FUXA 4BBFA 5AR3A 3ITZA 4D2SA 3WZUA 3LMHA 3LFDA 4I5PA 3VUGA 3FY2A 3DJ7A 3WF5A 3PSBA 4AQCA 2JAVA 3HV4A 1U46A 3NGAA 2YCSA 3OY1A 4FOBA 4X2GA 3R00A 5J87A 2VNWA 3ROYA 2OKRA 3W18A 3A60A 4ALUA 3BLRA 3PJCA 3PP0A 3OCBA 2W7XA 2WOUA 2WEIA 5LVNA 3EN5A 4GSBA 1JKTA 3QC4A 3VS0A 3KMMA 4GG5A 5JMSA 1R78A 3E88A 4IDVA 4WBBB 1KE9A 5E9EA 5EK7A 3CPBA 4FV7A 4R3CA 2BRGA 3MV5A 3LMIA 5BMSA 2WIHA 3FI2A 4YJRA 4WUAA 4DH8A 2VTQA 4EWHA 3KXNA 2W5AA 3HUCA 1FQ1B 1KV2A 2WNTA 3SXFA 2ITNA 4KUJA 4ZK5A 4HVHA 5FUTA 3IW8A 4KBAA 5B2LA 4EH6A 4QYYA 4CV9A 2JAMA 3TTIA 3RPYA 3SA0A 3MH3A 2OIBA 3UIUA 3E62A 5HX8A 1URCA 5F1ZA 4E6QA 3QCYA 2VWVA 3KK9A 3QQUA 4PUZA 5JGAA 3OT8A 5CX9A 3EQCA 1W84A 2IN6A 3IW4A 4JX7A 4D0WA 4MD7E 3BEAA 5L2TA 3KMUA 3LFSA 2BCJA 4Q5HA 4KIKA 4J96A 3AD6A 4HNFA 3E8NA 4CRLA 3WZDA 4NZWB 2XKFA 4D2VA 4YJOA 2JITA 3ZS5A 4ANLA 4FYOA 4EZ3A 1OGUA 4R3RA 5L8LA 2XNGA 5EI6A 2R3MA 4X6RA 2XCHA 2QKWB 2QVSE 4C2WA 3EN9A 4CKIA 4K8AA 2WPAA 3WZJA 4OAVB 5DR9A 2F4JA 4BDEA 3FXZA 3UMWA 3WBLA 5ETIA 3DK6A 2I6LA 5EKNA 5L8JA 4MWIA 4QD6A 2PMLX 2ZVAA 4OLIA 3MBLA 2W1HA 3PYYA 4H36A 2W06A 2FB8A 4Q9SA 4GJ3A 3COKA 3VBXA 1PYXA 4B4LA 2YCRA 3ZZEA 4OAUC 4Y72A 3TG1A 4C4GA 5CF8A 5J7BA 3ENMA 3HP5A 3ULZA 2BALA 4CFNA 5D7VA 4FZDB 3ZEWA 4QRCA 3ZUVA 2YJSA 4DCEA 3QQJA 1LR4A 2FSMX 3M11A 3OXIA 2J4ZA 2HY0A 4FKUA 4WRSA 4YPDA 3RALA 2QLUA 3MPTA 3LFFA 1YRPA 4BKJA 4Y85A 5BVKA 2YM3A 4USDA 3V51A 1QPEA 3C4XA 2PHKA 4OTHA 5CSVA 4BDBA 4C2VA 4O84A 2YJRA 4ZMFA 5C4KA 3REPA 4F0FA 5I9ZA 3HRBA 5E92A 5LVMA 4LMUA 4FVQA 4AZFA 3NPCA 5A6NA 1JAMA 4JI9A 4BCPA 3DLSA 4MF0A 2IW8A 5I9XA 3DKFA 1IRKA 3Q5ZA 4HYSA 5BUEA 1VR2A 4DEBA 4R77A 4ACMA 2W5HA 5E1EA 4ANSA 2X4FA 4EQCA 4BZDA 4U7ZA 4LOPA 2XA4A 4U0IA 3G0FA 4OUCA 5TO8A 4MNFA 3ZH8A 3I7BA 4I3ZA 2R3RA 4IHPA 2CNVA 4TWCA 4ZIMA 4E4XA 4LG4A 3LHJA 3PXQA 3FAAA 4FSNA 5DMZA 5KBRA 5FM2A 2WMRA 3DK7A 3NS9A 4FKSA 5I9WA 5IDPA 4L68A 4D28A 2C6DA 4MVFA 4V0GA 4EBWA 1NW1A 3DKCA 2C6TA 3A7IA 2OF4A 4O7YA 4W8DA 4J1RA 2HELA 4DGGA 4O7VA 4FSMA 4S30A 3BKBA 2Y4PA 4W9XA 4ANBA 3JR1A 4IXPA 3BBWA 4FZ7A 3DCVA 4WIHA 5L2QA 1T46A 1XH4A 2BTSA 5CY3A 4IACA 1Q4LA 4DGNA 3GT8A 4ENYA 4FSTA 4QMYA 3R7GA 4TZRA 2PUNA 2QG5A 4R1VA 2OZAB 4GG7A 4RJ7A 3IK3A 4I24A 4YU2A 4EWQA 2PZYA 4LRMA 4IFCA 5HIEA 3BLQA 2VTJA 4D1ZA 4IWDA 3POOA 4MWHA 4NJ3A 4P7EA 4XLIA 3FJQE 3SW4A 3ZC6A 2IG7A 4G3GA 2WTJA 4EQUA 4YJPA 4CG8A 3FEGA 5IZFA 2WMQA 3HMPA 3Q4TA 3UODA 4IWOA 3FSFA 4K77A 4XOYA 2UVYA 4MD9E 3EMGA 3CEKA 2Y9QA 2B52A 4MCVA 4PDYA 2YLEA 2R3LA 1KOAA 2HAKA 5BVWA 4L53A 2PTKA 4AFEA 1SYKA 3CGFA 3EKNA 3C0HA 4G9RA 4TNDA 5HOAA 3VRZA 4IZ5A 5HD4A 5CU6A 1V0BA 5HG5A 2ZV9A 4FSQA 5ANJA 4GIIA 2QR7A 3GU6A 2J90A 3IW7A 4UYNA 3H9OA 3UC3A 4PMSA 4XV1A 4DH1A 5DNRA 5FXQA 4HJOA 1BUHA 3KU2A 3RPOA 4CT2A 5A6OA 5HO7A 2RL5A 5IQBA 2PVRA 4FIGA 4RGJA 2Y4IB 5AUUA 3KA0A 4FEWA 1FOTA 4MD8E 1L3RE 4E73A 4GW8A 4I23A 2XBJA 4O6EA 1M2RA 4EHVA 4EOMA 2EXEA 4JDHA 1W83A 3V04A 4AACA 1BKXA 2PL0A 1ZLTA 1OIYA 1Q8UA 2R2PA 2YHVA 4G31A 4ITJA 3FDNA 4H39A 4LGDA 4K2RA 4YZDA 2JFLA 4CQEA 4J95A 4QQCA 2KTYA 3IKAA 4BDDA 3PE1A 3EYHA 3RK5A 3BELA 3TNHA 3PZHA 4HVSA 4FGRA 1RQQA 4ZS0A 4RVMA 4GK4A 3VF8A 3ZSIA 3E64A 4AOJA 4TWPA 3SG8A 3ZM9A 4BYJA 4BCQA 4ANMA 2BZKB 2F49A 1BLXA 2YM6A 1AGWA 1FVVA 1CKJA 3PXRA 1FVRA 3HEGA 3VBVA 1YI3A 3JXWA 2XIXA 4TYHA 5EW8A 4CYIA 5BVDA 5L2IA 2G01A 2Y6MA 5M09A 2WEVA 4IVCA 4IFGA 5JGBA 3EOCA 5IA2A 2PUPA 5J8IA 1YHSA 3GCQA 2F2CB 3ENHA 3LZBA 4TYIA 5EM6A 3SC1A 2O64A 4B7TA 2BZJA 5BNJA 4JAIA 2BKZA 1M7NA 3RHKA 4O81A 4KKEA 4GL9A 3R8LA 5LCKA 4ITHA 2WU6A 3BHUA 3W32A 2XKDA 4W4XA 4FG7A 4U8ZA 1M7QA 4OTQA 4X21A 4FZ6A 4W8EA 3HV5A 1YWVA 2PE2A 2VTTA 2B54A 5I3RA 4FV3A 4P5QA 4EOSA 2WMUA 3O7LB 3TTJA 1OECA 5LOHA 5AIRA 4L7FA 2RFEA 3R7YA 4QP9A 4YHFA 3MI9A 4L43A 1PMVA 4D1XA 3KULA 3WF6A 3F66A 5D1JA 3BCEA 1ZYSA 5JH6A 1S9IA 3R30A 2RFDA 4FODA 5GZAA 4S34A 5LJJA 2QI8A 2YWVA 1Q5KA 2QU5A 2FGIA 3CTJA 1WBVA 4C35A 3I6WA 4FKPA 4FKLA 3PSDA 1G8AA 2OZAA 2O3PA 5HTIA 3TZ9A 3NUYA 2I0HA 5DOSA 4RQKA 4FTKA 5EHLA 2XJ2A 3OOMA 2XK9A 3RZBA 4YBKA 3FMMA 5M57A 3E5AA 3ZDIA 5A9UA 2GNHA 4M97A 4KINA 2J9MA 5AP5A 1Q8WA 2WTIA 2OIQA 5HZNA 5AEPA 3PUPA 1YDSE 1PXMA 2YZAA 1ZMWA 4GH2A 2GMXA 4S2ZA 3DBEA 5L8KA 3U55A 5B2MA 2YCFA 2H34A 3F5GA 2XS0A 4KSQA 3F82A 4RPVA 3C9WA 5L2WA 2C5NA 3I7CA 2EXMA 4ZLZA 2A19B 4FF8A 3ZFYA 2IVVA 3ORIA 3RNIA 4L00A 2DQ7X 4RLKA 3UZPA 2YLFA 4D4RA 5HQ0A 5J9LA 4DTAA 4BIDA 1XR1A 3EN6A 3PPZA 2VAGA 5HNIX 1HCKA 3MIYA 4AGWA 3UZRA 3W55A 3WIKA 1PF8A 5M06A 2OJ9A 3LOKA 1T45A 3A4OX 2V22A 4LOQA 3IDCA 5CSWA 4BCFA 4FOCA 4JLCA 4G2FA 4O0TA 4UWYA 5IISA 2CCHA 3NCGA 3UC4A 1O6YA 4QPAA 1SNXA 1XH9A 4RX9A 1Y91A 2YIWA 4DEEA 1H27A 3PVBA 2YEXA 5J1WA 1TVOA 3ZBFA 2XK6A 4ZY6A 4RX5A 4DBXA 2ZV7A 2WAJA 3NW6A 3ZHPC 5KMJA 3LCTA 4U79A 2A0CX 1H26A 2BPMA 4X3FC 4IX6A 1WBWA 4I93A 4UXLA 2W1GA 3QTQA 3RAIA 2GNIA 4FTAA 2JKKA 4G5JA 2VGPA 4H3QA 4IB5A 4ITIA 4YNEA 5JFXA 2UZBA 5IDNA 3A7JA 4YJSA 2ETMA 2IJMA 2YABA 4CCUA 3BE9A 4KIPA 5ETCA 5DA3A 3NIEA 4BRXA 3CLYA 2IZUA 3FPMA 3TJCA 2IZSA 3OWLA 4NTSA 1H00A 2ZMDA 3O8PA 3NUXA 4Y73A 1IR3A 4HGTA 4B6LA 2IVUA 2X9FA 3HP2A 3NIZA 5AR7A 4HVIA 2QC6A 4XG4A 1CDKA 3UYTA 4AGUA 4AW5A 4EYMA 3VBTA 5CXHA 4RIWA 3DAEA 4IM0A 1OB3A 4FL3A 4O2ZA 4N70A 4S32A 5CSPA 4AWIA 3EQDA 4HPTE 4C4IA 4M84A 5AUVA 3F7ZA 3LAUA 1P2AA 1FMOE 2RGPA 4FT5A 1IEPA 2LGCA 2X0GA 3NX8A 2AC3A 2J0JA 3QTUA 3SDJA 2ZAZA 2X8EA 4IWQA 4TWOA 4UMTA 2CGVA 3EYGA 1Y6BA 3UP2A 4U80A 4DF3A 3V01A 2CGWA 2OIDA 2UZLA 3MN3A 1R1WA 5K9IA 3EQRA 1TQMA 4RJ4A 4RZVA 5HLPA 4FT3A 2R3GA 5DI1A 3BYMA 1ZY5A 3SOCA 4C8BA 2VWXA 3QQLA 4KS7A 5H2UA 1R39A 1GOLA 5HLWA 4YZCA 3OTVA 4Z9LA 3UOLA 3N4VA 5CAPA 5K0XA 4CGAA 4G16A 3UPXA 4NL0A 5CU4A 3E7VA 5CLPA 3QGWA 4E4NA 4EK5A 5K4JA 5HU9A 3R7OA 3SXRA 1BL7A 4Z16A 1OITA 3ZOSA 4RVKA 3BGZA 1ZYLA 4KWPA 1K9AA 1KE6A 4JL9A 3DTWA 4L44A 5AV1A 3FI8A 3NEWA 3KXHA 4IEBA 4L46A 2Z8CA 4WT6A 1YXTA 4GKHA 1OMWA 3VS5A 4BDKA 3JS2A 3QAME 2PE0A 2XMYA 3SQQA 4CKJA 1KE8A 2UVZA 4U81A 3C13A 3RHXA 4DEAA 2OH4A 3AOXA 3VUHA 4PMPA 1W98A 4RSSA 5HCYA 5EKOA 4FV6A 2UW7A 3WE4A 2WTDA 3CQUA 2VO3A 4QQJA 4EI4A 2HIWA 3ATTA 2X9EA 3U9CA 5M08A 3ZO3A 2ZDUA 3EHAA 3R6XA 2XNMA 3RNYA 2BHEA 3QL8A 4ASXA 4FVRA 1OPKA 5GHVA 5K0KA 4ZTNA 2HXQA 5IQEA 4ZJJA 2RIOA 5HKMA 3TNIA 4F65A 3SW7A 3R8VA 3DS6A 2I7QA 3UO5A 2X6DA 3KF7A 2OGVA 3V5WA 3NCZA 2WTKC 5E8ZA 3BHYA 4M0YA 3UNJA 3VUMA 4AAAA 3CBLA 4UN0C 5CF5A 4CVAA 3G15A 1JWHA 3HA6A 2X2KA 3ZXZA 1UA2A 5ANDA 1M17A 5HG9A 5FTGA 3LFCA 1JKSA 2QHNA 1CKPA 3QX2A 3TUDA 4EJNA 3ZSHA 4QYHA 4AN3A 4PL4A 3RK9A 4CD0A 2OWBA 4TKSA 1P4OA 3CD3A 2RG5A 4G5PA 3R9OA 5FTOA 3OXZA 3Q9XA 2QD9A 3PIZA 4XEYA 1OBDA 2ITUA 3OD6X 4Y8DA 1FMKA 4C3FA 5I9YA 2X8IA 3EFKA 3R8UA 4QYEA 3U9NA 1KE5A 3G5DA 1W82A 3NRMA 3HV6A 3DQWA 5JKGA 5AP1A 4OTFA 2ERZE 3CKXA 2W9ZB 3KRRA 4FK3A 3AMAA 5EQEA 3UG2A 3QA0A 5TT7A 4A4OA 3UMXA 2ETRA 2Z2WA 3HZTA 1OL5A 4P90A 4YTCA 5EDRA 3LFEA 3KN6A 3H10A 4IZAA 1OUYA 3AMBA 4ZSJA 3JVRA 5M4UA 2UW9A 3EL8A 4ORKA 1MUOA 4JBOA 4QPSA 3ZEPA 4TYEA 5DH3A 3WE8A 5AA8A 4UEUA 4RG0A 5HE1A 3R01A 5DBXA 3PWYA 3FWQA 5EW9A 4TYJA 2ZMCA 4JDIA 5C8NA 2B9HA 2OZOA 3MH1A 3RAKA 4GT4A 1JSTA 2Y4IC 2HENA 4FTCA 4OBQA 3ZO1A 4IX3A 1J7IA 4ZSLA 3R28A 3FI3A 2OFVA 5FEDA 3TKUA 3TT0A 3GU7A 3C4FA 4D9TA 4BKYA 5HORA 2ESMA 4AZVA 2HK5A 2OU7A 3AD4A 2LAVA 4FSRA 4LFIA 3PJ3A 2EXCX 3AC5A 1YI6A 2REIA 2VTMA 5H9BA 4CG9A 3CTQA 2W17A 4FKTA 2WO6A 3E63A 1VYWA 3P7BA 3LXNA 3IO7A 5HG8A 4ZOGA 3R1NA 4AX8A 3QWKA 5TE0A 3K54A 4Z7HA 3PRIA 4D4YA 2CKEA 4ZLOA 1OL6A 1UKIA 2HCKA 4FNWA 4FSUA 1OUKA 1Z9XA 4F7NA 2NRYA 1GIIA 1Q99A 2J0KA 3MS9A 3PP1A 5HE3A 5KMIA 4QTAA 3LE6A 4L45A 4BCOA 3EFWA 2GHGA 4K6ZA 3IS5A 4GJ2A 4M14A 3F5XA 4DINA 2PMIA 4FG8A 4RWJA 5IA3A 4I0RA 4YHTA 2XJ1A 2KULA 3SOAA 2BRHA 2Z7RA 4KRCA 4CV8A 3HAVA 3HX4A 4M66A 3OMVA 4BWPA 4FSYA 2UZNA 4PPBA 2ONLA 3I1AA 4RVLA 5HTCA 1JSUA 5IQHA 3ACJA 3P4KA 3QHRA 5E4HA 4FV2A 5AR2A 3QYWA 2GQGA 2PVJA 3V5JA 5CYIA 2OH0E 3HL7A 3F9NA 1XH8A 2CLXA 2PMOX 5IA5A 3Q60A 4A9TA 3P7CA 1KUTA 4UV0A 5BVNA 3PA5A 4IIRA 3ORZA 4F0GA 4DGOA 1O6LA 2C0OA 2UUEA 3A4PA 3D5UA 4IJ9A 5AX9A 5JZNA 2BIKB 4A4LA 2PVHA 4EC8A 3DFAA 1Y8GA 3RPSA 1PHKA 1H1SA 1PKDA 4ZTMA 4EK6A 2W96B 3PA4A 2XIYA 4O0VA 5M53A 3DPKA 3M2WA 5AUYA 2PPQA 1OKZA 2PZPA 4FR4A 5IMXA 5L2SA 3O71A 4BCNA 3UQGA 4AW0A 3P0MA 2C30A 3GB2A 4HNIA 4F99A 4FIIA 4RA5A 2XVDA 4R1YA 4L6QA 4ONAA 4YTFA 4UYAA 2OICA 5HEZA 3UP7A 2J51A 4RWKA 5M4IA 2YDIA 1Q24A 5CVFA 4F9WA 4M69A 2VD5A 5BYZA 5A4TA 4JJRA 3EN7A 3FMLA 3NVKI 5KHXA 3ZONA 4R8QA 3ERKA 1OIUA 5KMMA 1JVPP 3MH0A 4NIFB 4I5CA 4XBRA 4QMXA 2YAAA 5ETFA 4MBLA 3TEIA 3BYSA 4J99A 3Q52A 4GVAA 1YQJA 3PRFA 4CSVA 2CMWA 2B9JA 2HOGA 4W4YA 3GBZA 4ZZMA 4NM0A 4R7HA 3HMOA 3F2AA 1CTPE 3RINA 3ULIA 2ZB1A 4AA5A 1YHWA 2XF0A 3DB8A 1L8TA 3QKMA 2VX1A 2RKUA 4QMUA 5JRSA 4U40A 3FZ1A 4R7IA 4V0GB 2FVDA 5JRQA 5F95A 4W4WA 1UNHA 3QF9A 3GP0A 1IAJA 5A46A 1GIHA 4J52A 4CMTA 4JIKA 2C47A 2B9FA 3OWJA 1ZOGA 4NW6A 4XUFA 4EH9A 1GJOA 4FT0A 3FYJX 4EK3A 1ZZLA 4PWNA 4FICA 1SNUA 4DE4A 1H1PA 1Q3DA 4NK9A 2C69A 2PVNA 3VBQA 1YOLA 3KREA 2HZIA 4EH2A 3JY0A 1UWJA 3MVHA 3P79A 4H1MA 4E6AA 1H24A 3AT3A 3DTCA 3H0ZA 5IEVA 5K5XA 3PXZA 3TZMA 3BRBA 1W0XC 3GNIB 3Q32A 4MBIA 4TPTA 2BHHA 5K3YA 1GZ8A 1DM2A 4N6ZA 3TV7A 3BLHA 1V0OA 3O23A 3O8TA 2VX3A 3HMMA 4HVGA 4I5MA 2JDRA 5HLNA 1UU8A 3JPVA 2P3GX 3GXLA 2HY81 1WMKA 3S1HA 3A8WA 3CY2A 3NNUA 3BQRA 4DEGA 2UZVA 3DBQA 4L3PA 2A2AA 2JBPA 3G6HA 2VWUA 3FPQA 3UIBA 2ZDTA 4WSQA 1G8SA 3Q9WA 2E9PA 5C4LA 4W4VA 3S3IA 3SKCA 4ZMEA 3UYSA 2J0MB 3TNPC 3KXGA 3IGOA 3RVGA 4TWNA 4ZZOA 4R5SA 4DH7A 4DFBA 1PXLA 5IF1A 3VW6A 2QCSA 4WHZA 4XV2A 5IQIA 4NW5A 3FKLA 2BAJA 2O63A 3HMIA 1F3MC 3F3VA 3TNQB 4ALWA 4XYFA 3DY7A 3LFBA 4DC2A 3TIYA 5ICPA 2IO6A 4RA4A 4ZAUA 2W99B 2NPQA 4OBPA 4CFMA 1CSNA 4BI2A 3M1SA 3L8PA 3ORLA 4YC8A 4EYJA 2G1TA 2QO9A 2PVYA 3QRTA 5CF4A 5IU2A 3Q2JA 5ANOA 2EB2A 4NCTC 3RWQA 4BDHA 3CS9A 5EHOA 1DAWA 5HNBA 2W1FA 2VU3A 4XG8A 3GEQA 4RFZA 2GNJA 2CLQA 3D14A 3KRWA 4H1JA 3IPHA 4NM5A 3IECA 4RIXB 4BCJA 5CAQA 5KKRB 3C4EA 4J71A 2CDZA 5HI2A 2DUVA 4EH3A 4FKOA 5AP7A 2W1CA 4M67A 2P55A 4WD5A 1YXXA 2J2IB 3LJ1A 5FTQA 1BI7A 3DJ6A 4FIFA 3DLZA 4OW8A 4WG3A 4UMUA 1WBPA 2QLQA 2YISA 4EQMA 1KE7A 2IW6A 4QTCA 1BL6A 4NIFA 4ZEGA 2VGOA 3ELJA 4TYHB 4X7QA 5FLFA 5CU0A 3TI1A 3MIAA 4MHAA 1Y8YA 4FV1A 3RP9A 4BY9E 3EN4A 3FLQA 2OBJA 3TZ8A 5IPJA 3Q4CA 3AXWA 4O7TA 4AOIA 3SRVB 5IQAA 5F94A 3KRXA 2WMVA 2PVMA 1Y57A 4R78A 1ZYJA 2A1AB 1SZMA 1STCE 4IH8A 5HNGA 4IWPA 2ONLC 5HICA 4QMNA 4CNHA 1B38A 1RW8A 3ZRKA 4ANOA 3BPRA 4RIOA 3QQHA 5E8TA 2C5OA 1UKHA 4P4CA 4IC8A 4XBUA 2J5EA 2BFYA 3EFLA 4XG3A 4YBJA 3ZO2A 4MXZA 4AA0A 2X7FA 2YFXA 3TNWA 1OIRA 5IEYA 3AC1A 5K5NA 3R2YA 5DEWA 4QMPA 2XYUA 5AV3A 4BTKA 4FV8A 2JKMA 2YM4A 2OJFE 5FG8A 3KULB 1ZXEA 3ZRMA 3LVPA 4FZAB 1PXPA 1XBBA 2BDJA 2UZEA 4TY1A 2OXYA 4JT3A 3UOKA 3VHKA 1NXKA 3V5QA 4XG7A 1H1QA 5G6VA 3GVUA 3UDBA 2WMXA 4RQVA 4X2FA 3W2QA 2OFUA 5HGIA 5FD2A 4IW0A 2P33A 3VBYA 4U3YA 5A14A 2V7AA 4GCJA 2R0UA 3QTIA 3DBFA 3I5NA 3MPAA 2UW8A 2VTNA 5KZ0A 3N51A 1E1XA 1Q8TA 3W2CA 3WF8A 4FKJA 2W0JA 3FMDA 4C0TA 4CMUA 3V8WA 5IQFA 2BRNA 4XRJA 3O96A 1Q3WA 3MDYA 5A4EA 1P4FA 2V5QA 4HCTA 3IQ7A 5K4IA 1UU7A 4IAZA 3O8UA 1WFCA 4AP7A 2XRUA 3ANRA 1U5RA 3FSKA 3OVVA 3GUBA 2VO6A 2W4JA 2OXDA 3VS7A 4L42A 3OBJA 1E1VA 1H08A 3F69A 4KRDA 4G34A 3TDWA 4ALVA 3BIZA 4Q5EA 2YAKA 4HYUA 2R4BA 4QTBA 2VO7A 4MXOA 4X0MA 3MTLA 4EH4A 2QR8A 2R64A 3F3UA 4BZOA 4LQMA 4D2PA 4EKLA 3OW4A 1GNGA 4FV9A 4GUEA 3MFTA 4JG8A 2PVFA 4FT9A 4MQ1A 4BR3A 2XYNA 3W10A 3ZDUA 4BYIA 2JDSA 4D9UA 4O1OA 4KNBA 3G0EA 3TACA 3GCVA 3QGYA 5EH0A 4RIXA 2BIYA 4H3BA 2JLDA 1TQPA 4NTTA 5HVKA 5ITAA 4HYIA 3A7HA 4NYEA 2CCIA 3C50A 4TNBA 4BDCA 4F63A 3VS4A 3CTHA 3DAJA 3EIDA 3FL5A 5CS6A 3IG7A 4QQTA 4JR7A 4OTGA 1M2QA 4M7IA 5F20A 3HGKA 4PQNA 5EFQA 3D4QA 3QD2B 3FMNA 5ACKA 4FEUA 3MA3A 4AW2A 4ERWA 4ID7A 3QRKA 5DRDA 4ZS4A 2FYSA 4LV8A 4FGBA 1YOJA 4LV5A 4TRLA 3U51A 4BCIA 3SRVA 3BQCA 3AG9A 1SVEA 3HV3A 5CU3A 3E87A 4AU8A 4C36A 2ZOQA 4YSJA 1YI4A 5I3OA 2WTCA 4G3FA 3ZLSA 2BROA 4F1OA 3WIGA 4RIWB 1XBAA 4JNWA 3H9RA 5CANA 2QOQA 4NU1A 2C3KA 4EHEA 3KGAA 3C1XA 2AC5A 3UQCA 4B8MA 3DGKA 3PJ8A 4JOAA 2G2IA 2C3IB 4YC6A 5C01A 5H8EA 3ORMA 4O7LA 4O0YA 4QMQA 2W1DA 5KX8A 4CT1A 3ORNA 4ZTQA 3K5UA 4EL9A 2HYYA 3FMJA 5M4CA 3TCPA 4CFXA 3MSSA 3O2MA 4XG2A 5A3XA 5M4FA 1PXIA 5CI7A 3WZKA 3THBA 3L8VA 3EQBA 3PWDA 2VTLA 2FO0A 4AT5A 2JIVA 2QQ7A 5E8YA 5HBEA 3A2CA 5IA0A 4O21A 3CSVA 4O38A 2OO8X 5IKWA 4BBMA 3LJ2A 3ZSGA 3NYNA 4QP1A 5E91A 3IDPA 4IQ6A 4X6QC 4PF4A 1J3HA 4IJPA 3QKLA 5C9CA 2XK3A 3T9IA 3QTRA 3UPZA 3R8PA 5E8XA 3H9FA 2PYWA 4OBOA 5JK3A 5FXSA 1I09A 4O83A 3COHA 2RF9A 3PE2A 4CTBA 5CVHA 3GOPA 4R3PA 4F6WA 4EK8A 4HVDA 5CQWA 4M0ZA 2WMTA 2IVSA 4JQ8A 4BIEA 3DXPA 4U97A 4F7LA 5AAFA 4EZ7A 4Z7GA 4R5YA 2XP2A 3TUBA 2G2FA 3OEFX 3TKIA 4AZTA 2R3HA 4MXXA 2BKKA 2QOFA 4IX4A 4JS8A 4RC4A 2VN9A 3UOJA 1URWA 3DA6A 5CALA 1QL6A 3KCKA 4RC3A 1MQ4A 2GFSA 5AWMA 4BTMA 3DZQA 4O0RA 3UQFA 2J0IA 3V6RA 5CAVA 2HZ0A 3QFVA 1UNGA 1OL1A 2JFMA 2V62A 2F57A 1J7UA 3LCSA 3QWJA 2PK9A 5H8GA 4DBNA 4BI1A 3COMA 4MAOA 4E4LA 3R7IA 5CF6A 1G3NA 3HNGA 3SXSA 3VUDA 2J6MA 4M13A 2QNJA 4AT4A 4QTDA 3HVCA 1H25A 3POZA 5EW3A 4J7BA 1PXJA 4FEVA 1XWSA 4HGLA 5KMOA 4UBAA 3LXPA 3U87A 2H8HA 3P5KA 3CKWA 4YPSA 3UBDA 4ACHA 3MH2A 3PVWA 5CNNA 3HA8A 4FA2A 4TYGA 3D94A 3I6UA 3OWKA 1Q62A 1QPJA 3DU8A 4PDOA 4A9RA 2XNNA 3NR9A 3ORPA 2YM8A 2F7EE 3EFJA 4G3DA 3LFAA 5HO8A 4I94A 1J1BA 1GY3A 3F5PA 1Q41A 4JDJA 2UZWE 2YITA 5GZ8A 2X7GA 4E8AA 2E2BA 3LCKA 5HO6A 3C51A 3D7ZA 3KY2A 4O96A 2BRBA 3GI3A 5FQDC 5KMKA 1J7LA 3TM0A 4MH7A 4IAAA 2ZM1A 3QRUA 5AP0A 2XK4A 5CEIA 4PNKA 4LUEA 4YMJA 4DTBA 1UU3A 3P86A 4C4JA 1IA9A 4K0YA 4BHZA 4BICA 2GHLA 1JBPE 2B0QA 3PG1A 4QYGA 3GCUA 2W1IA 4FSZA 4G6NA 4WG5A 5JSMA 4O0WA 5M51A 3FLYA 2X81A 2VTOA 4EOQA 1AD5A 4X2NA 1HOWA 1J1CA 2XM8A 3ZC5A 5IA1A 3A7GA 2CN8A 4O91A 1BMKA 1ZOHA 5EM7A 1NT2A 2YDJA 4RJ6A 2FUMA 4A9YA 1UV5A 3ZUUA 4F70A 4F64A 3AD5A 5IUHA 1VJYA 1PKGA 4QT1A 2XIRA 3EZVA 3W2OA 4XP3A 4V05A 2GS6A 4FIHA 3BWFA 3ORXA 3ROCA 3ZO4A 4YJNA 3TZ7A 4QTEA 2O5KA 3LFNA 3RTPA 4EZ5A 4G6LA 1PJKA 2ITTA 2P2HA 2VRXA 4ZTLA 1TQIA 4FNXA 4D1SA 4PX6A 2JDOA 4EUUA 4HOKA 4BF2A 4CTCA 2P0CA 4D2WA 1Q8YA 4AZEA 1XH6A 3UVPA 1VZOA 1XHAA 5GJGA 4DYMA 2BDWA 2C0IA 4BL1A 4I21A 3R83A 5DPVA 3FXXA 2AYPA 1APME 2QOCA 3IW5A 1ZYCA 2F2UA 3FKOA 4HGEA 3OC1A 2VO0A 4Y83A 2F9GA 5D9HA 3S00A 2WOTA 2Y0AA 5KNJA 3ETAA 3U6HA 1H1RA 3QUDA 1PMNA 1DI9A 3H3CA 2JKQA 4IM3A 2BDFA 4RFMA 4FKIA 4F1TA 4DHFA 3A61A 2XK8A 3NYVA 2XJ0A 3MFSA 2YM5A 3U54A 1WBTA 4XOZA 5E8WA 4FC0A 5BUIA 3GQLA 4QO9A 2G9XA 4PDPA 5DT4A 2GSFA 3QTZA 5IH6A 4MX9A 1B6CB 2WMWA 2JC6A 4JXFA 5DE2A 3S95A 4E5WA 3PIXA 3LFQA 4CKRA 4HW7A 3OBGA 2NRUA 1M52A 2ITVA 5AP6A 4X2KA 3UG1A 2C6IA 2P2IA 4IAYA 4YP8A 3A99A 4AT3A 2E9VA 4C4EA 1KOBA 3P7AA 4H05A 3AC3A 4A07A 4NH1A 5HVJA 3KN5A 4DEIA 4JVGA 3A8XA 3DAKA 2BTRA 3DKOA 1XH7A 3QLFA 3KF4A 2WTVA 4BVUA 2C3JA 4FT7A 2X7OA 3NW5A 3UIMA 2HW6A 4FKVA 3D2IA 4EC9A 2B4SB 2UW5A 3HMNA 3VS6A 3RPRA 2QG7A 4BHNA 3VQUA 3U4WA 3MB6A 3MY0A 3FY0A 3ODYX 4WRGA 1H0WA 3BWJA 2VWWA 3CC6A 3VF9A 4UWCA 3LLTA 4DAWA 4S31A 4YTHA 3Q3BA 2BVAA 2UZUE 4WG4A 2QOOA 4BDJA 2YDKA 3OCGA 3VQHA 3TL8A 4I41A 2RFSA 3RI1A 5KMLA 3QTXA 3SGCA 3F2RA 4M69B 3CXWA 4E20A 1ZYDA 3DNDA 2VTHA 5A4LA 1SMHA 1LEZA 3SX9A 4BWKA 5B7VA 5L6PA 4KB8A 5T6KA 2HXLA 3OROA 5ETAA 1ZZ2A 3VS1A 4D58A 4NFNA 5CASA 4CZYB 3PVUA 3KL8A 2XCKA 4C4FA 1U54A 2YA9A 4YC3A 3GC9A 5GIOE 4U6RA 3L9PA 3UNZA 3ET7A 3PLAE 2PVLA 4FMQA 4BGQA 5CEMA 2IPXA 1OIQA 3RWPA 1MRUA 3RGFA 3HECA 4OT6A 3V3VA 1JPAA 2DS1A 3UGCA 3LKMA 2YIXA 3MFUA 5LVLA 4FNZA 5DIAA 4KIQA 3JY9A 3DK3A 3Q53A 3E7OA 5DN3A 3B8QA 2NO3A 3NAYA 2A4LA 4QQ5A 4DT9A 2C5XA 4QP7A 2R3JA 2XBAA 4QNAA 2GTMA 5E1SA 3W16A 1SM2A 2RSVA 4KIOA 3OFMA 3MWUA 2QHMA 5LWNA 3OTUA 1OKVA 3ZLYA 2R0IA 4QYFA 3TIZA 4XMOA 4XLVA 2YIQA 4APPA 4DEHA 3RAWA 3C0GA 4E3CA 5JGDA 3UO6A 5M07A 2JEDA 3D9VA 3Q5IA 2PE1A 3HRFA 4CCBA 1YDRE 5LWMA 3C7QA 3KVWA 4QMLA 1W8CA 3SAYA 4EOPA 1FGIA 3ZTXA 3GC7A 3HLLA 4NSTA 2BZIB 3MB7A 1JSVA 5KCVA 4E7WA 1CKIA 1WVYA 2ETKA 2NP8A 2QO2A 3WYXA 4B0GA 4NKSA 4BGHA 2O2UA 1H4LA 1Q97A 4C3RA 5IQDA 4CMOA 2CNUA 2C5VA 4U9AA 3EQGA 3FQSA 3I0OA 3NZ0A 4V01A 5CEKA 1GZOA 4FTMA 3O50A 3R1SA 3CJGA 2WMAA 4PP9A 3TV6A 2XNEA 5GJFA 3Q6WA 4YHJA 4LUDA 3LLAA 2XH5A 4IVDA 2JGZA 4GU9A 5A54A 4GU6A 3EKKA 3BYOA 3UIXA 5FGKA 5I9UA 1ZMVA 3KXZA 3NYXA 4G6OA 4E5BA 1RJBA 3KB7A 1RDQE 4RJ3A 4PPCA 2C1AA 2V0DA 5AR8A 4ACCA 4O0UA 3FUPA 2X2LA 5C27A 2WIPA 2Y8OA 3GU5A 3PXKA 1YWNA 3Q9ZA 4H58A 4MEDA 4CZTA 4O7NA 4BZNA 4RT7A 4KD1A 1PMUA 2IVTA 3F5UA 4FTRA 4GRBA 4L52A 4BCMA 2JIUA 4MF1A 2WU7A 5FP5A 5L4QA 2GNLA 4FL1A 1REJA 4TW9A 4YJUA 2X4ZA 2YN8A 4XV3A 5FEEA 3ZFXA 3QTWA 4DFXE 2XZSA 4FV5A 4I20A 4IVAA 1LUFA 4FV4A 3VJNA 2B7AA 3WI6A 3MY1A 3ODZX 4IVBA 4PPAA 2O8YA 2W05A 1BYGA 1WCCA 3R2BA 4FI1A 4PTGA 4QMSA 1OVEA 5L3AA 3R1QA 2R3KA 4P2KA 3KKVA 2H9VA 4FX3A 4NKAA 3R9HA 4Y5QA 2VWZA 2I1MA 3QTSA 4GMYA 4PMMA 5HVYA 2FA2A 3F6XA 5FEQA 3LW0A 4RC2A 3A62A 5LARA 2WQNA 3NMUF 4BCHA 1EH4A 4X2JA 3CR0A 5EM5A 3VAPA 4GV1A 2I0VA 4AA4A 2X2MA 4AE6A 3PSCA 4FEQA 3EJ1A 4EEVA 5JFWA 4YURA 5BX0A 5BYYA 3QYZA 2HWPA 4PL5A 4ZSEA 3TV4A 1NA7A 3FYKX 4KS8A 4O7SA 2WQMA 2ITYA 5HU3A 3V8SA 3D5XA 3V5TA 2UZOA 4K1BA 4BFMA 3CJFA 3GC0A 4QMMA 4RVTA 3N4UA 1PRYA 5I9VA 4QMVA 4F1MA 3R9RA 2CNQA 4G1WA 5KO1A 2QO7A 3UNKA 2B55A 2Z02A 3K2LA 3FC2A 5IUGA 4GIHA 2Q83A 3O17A 3VULA 5AP4A 5DT3A 4FTJA 4C62A 4HZSA 2C5YA 5AUWA 4ZSGA 4U44A 3AC4A 5HBHA 3RCDA 4DA5A 4IDTA 3WF7A 5AR5A 3R7UA 3GFEA 3KCFA 4AN2A 3CQWA 3B8RA 2WFYA 1H8FA 3QZHA 4RX8A 5ANEA 2FSOX 5EHYA 1A9UA 2C1BA 1YW2A 4JR3A 4ANQA 4TT7A 3FZSA 2QODA 4F9YA 2XB7A 1H0VA 5DGZA 4BTFA 3R71A 1YHVA 1ZWSA 2H96A 3R9DA 1YWRA 2PWLA 2UW3A 4E26A 4YO4A 3NDMA 1DAYA 3U6IA 1KWPA 3II5A 3HAMA 1Q61A 3BHTA 1RE8A 2J50A 3AGMA 1ND4A 1P5EA 3KVXA 4FUYA 3G9NA 2B53A 2JDVA 3QU0A 4Q2AA 5EYDA 3ZM4A 4IADA 4BDGA 3O0GA 1FPUA 4DFLA 4UMPA 3ORKA 5AP2A 2J7TA 4FTOA 3VIDA 4F9BA 4II5A 3R8ZA 4Z55A 4GYGA 4M8TA 4EONA 3FL4A 4NWMA 4XX9A 4YSMA 4A9SA 5D12A 3GU4A 4ACDA 5LXMA 2R3IA 3R1YA 4I0SA 1VEBA 2YWPA 3GCSA 3TN8A 4GFOA 4Y95A 4EHZA 4D4SA 3NNXA 5C26A 3Q96A 3D83A 2UZTA 2W4KA 4WNMA 1OBGA 1ERKA 2QOLA 1R3CA 1YDTE 2VWBA 3DJ5A 3QC9A 2YIRA 3E8CA 3PY0A 3BV2A 5JQ8A 5GINE 4X3FB 2I0EA 3JUHA 1WVWA 3WOWA 1U4DA 2BAKA 2XUUA 4BBEA 4UX9A 4DGLC 3LCOA 5A4QA 2VZ6A 1WAKA 2PSQA 2OSCA 2R9SA 3W2PA 2WTWA 3LQ8A 2DWBA 2GFCA 3BBTB 3I81A 4KKHA 5KUPA 1M14A 2QOIA 5AMNA 1S9JA 4L3JA 3CQEA 1ZY4A 1AQ1A 3IW6A 4L01A 3R63A 4EORA 3OP5A 4FTLA 1O6KA 4Y46A 1NVRA 1WZYA 2ITXA 3W33A 3OWPA 4FNYA 4ZY5A 5AUTA 3LXLA 2ITQA 4LI5A 4MXCA 3L9MA 3MVJA 4OGRA 1PW2A 3H4JA 3PLSA 2BILB 3NWWA 4DFYA 5EYKA 4ZJVA 4JDKA 1XO2B 5BUJA 5CAUA 2QKRA 2AUHA 4FTUA 4FYNA 2WMSA 4N0SA 3EZRA 2ZYBA 3RM7A 2PUIA 3KK8A 4AGDA 5AV4A 3G90X 3ZCLA 3PTGA 4I0TA 2CKQA 1REKA 3P08A 5HIBA 4LL0A 5DR6A 2EVAA 1XH5A 2WKMA 3OEZA 3QX4A 3K5VA 3PJ2A 3FQHA 3V8TA 4J97A 3UOHA 4FEXA 4PP7A 3R7VA 3BHHA 3NNVA 3BU5A 4F6UA 1QMZA 3C0IA 3HDNA 2GS2A 4G3EA 4GFMA 3RPVA 4YO6A 5AX3A 3EH9A 3UJGA 4YLLA 4RBLA 4RJ5A 3S2PA 5H8BA 1YXUA 4I4EA 4NUSA 2IZRA 3PPJA 2OLCA 5CT7A 4ZTSA 3VUIA 4F4PA 2IWIA 4EUTA 3QRIA 4IANA 5C8KA 4O86A 2OJJA 3MYGA 4HYHA 3LMGA 3MJ1A 1X8BA 3OUKA 3OXTA 5D11A 5C8MA 1CM8A 3AMYA 4C7TA 3BX5A 3DNEA 4O2PA 4DFZE 4O7WA 2QOKA 2O0UA 5G1XA 4C57A 3F3ZA 4X3JA 4JBPA 3QD4A 2WMBA 4J8NA 2CN5A 5HCZA 2ITZA 2CKPA 4XHKB 3LQ5A 3MJ2A 2I40A 1PXNA 4O82A 4USEA 4RMZA 4LRJA 3RCJA 5AR4A 1OM1A 2R7BA 4NM3A 1IAHA 4FZFB 2R5TA 5CI6A 3EWHA 3PFQA 4EBVA 1OL7A 2BFXA 4N57A 5AIKA 1Z57A 5AV2A 4B99A 1H01A 3D5WA 5CVGA 3U4UA 3GFWA 2FSLX 3AC2A 2E9UA 3PA3A 1OKWA 2JKOA 4L7SA 1YVJA 3H30A 1JNKA 3SV0A 2C6OA 4F6SA 2CGUA 2VX0A 5KMNA 4YLJA 5D10A 1Q8ZA 4PV0A 3F61A 2WZJA 3FE3A 2WTKB 4QP6A 4B9DA 2PU8A 3P23A 3ZRLA 1DI8A 3FHIA 3EQPA 4G9CA 1FGKA 3NVMB 4A4XA 2QOHA 4IC7A 3L9NA 3MGYA 1LEWA 3U8WA 4IM2A 3VUKA 4BIBA 4NM7A 1UVRA 3ZMMA 3NW7A 5GNKA 3CGOA 3MTFA 3VBWA 4X3FA 4CFUA 5LVPA 1K3AA 2UVXA 3W8QA 1ATPE 5E8VA 2C0TA 3QZGA 1J91A 3AT4A 4C02A 4XNEA 3DXNA 3QD3A 5DEYA 5DG5A 4AOTA 4BI0A 3Q4UA 2F7ZE 3NUNA 4QP3A 4I1ZA 1KV1A 3QHWA 2OW3A 3MW1A 3IGGA 4U3ZA 3SD0A 3QUEA 4HPUE 4IX5A 4MYGA 4ASDA 4F08A 3PXFA 3D2KA 4DG3E 5IH4A 1A48A 3ZXTA 4C38A 4QOXA 4XJ0A 3CD8A 5CEQA 3BHVA 3LIJA 4IZ7A 4WKQA 4U42A 5I5ZA 4PTEA 5HESA 4JIAA 4ZZNA 5EDQA 4K18A 3G33A 1A06A 5LMKA 4NT4A 2VNYA 1ZOEA 5AUZA 5JFSA 5AADA 1YXVA 2OK1A 2X1NA 4O0XA 4AZWA 4KBCA 1V0PA 5DHJA 4RX7A 4YGAA 1OPJA 4R6VA 4YUQA 3VUTA 1PMEA 2R3FA 3I60A 3QALE 5CXZA 3VVHA 2FH9A 4L8MA 5B0XA 5EQYA 3AGLA 3GCPA 4FVPA 5DYJA 3FQEA 3K3IA 4O0SA 2YZLA 2G2HA 3ID6C 4DITA 2GS7A 3DDQA 4YZNA 2JDTA 3FMEA 2X6EA 1GIJA 3P1AA 4ZJIA 5HE0A 5HX6A 3T8OA 1K2PA 3E3PA 3R04A 3QCQA 3V6SA 4PDSA 4OT5A 3D15A 3GC8A 4JQ7A 4YZ9A 2UV2A 5AA9A 3GU8A 4DGMA 3B2WA 2XNOA 4GT3A 2WB8A 3OCTA 1LPUA 4QPMA 3LJ0A 2XEZA 5IA4A 1NVSA 4O6LA 3RKBA 5GZ9A 2C3LA 2X39A 4ZXTA 4JG7A 2ZB0A 5EM8A 2XM9A 4AE9A 1YXSA 4ZLYA 4CRSA 4RJ8A 1VYZA 3MPMA 4I6QA 5AV0A 3AT2A 3VNTA 4Q9ZA 2WELA 2GNFA 5T68A 4GK2A 2JD5A 2JIIA 4AFJA 4BCGA 2BR1A 2C6LA 3L9LA 4QMOA 1R0EA 4OTWA 3P78A 2CHLA 3GOKA 2EWAA 4BDFA 3C4WA 2BAQA 1JLUE 4D2TA 4M12A 4DLIA 5C03A 3FZRA 4KKGA 5EDPA 1MRYA 2ACXA 1PXKA 4HCUA 1H28A 3O51A 5FWKK 3FKNA 4MXYA 1H1WA 4BDIA 1JKKA 4LGHA 4JG6A 3MA6A 4GK3A 4K9YA 3Q2MA 4QP2A 4Y5HA 2XIKA 2VTPA 4L3LA 3NYOA 2ERKA 1MRVA 1IASA 5AM7A 3WZEA 4RWIA 3VWAA 2ZV2A 3HDMA 3JVSA 2ZV8A 1Z5MA 5DFPA 5IG1A 2GTNA 3FLSA 3FLNC 3Q04A 4LMNA 4WA9A 3GQIA 5EQPA 5TF9A 2VTRA 3UVRA 5E7RA 3OT3A 5CNOA 3VC4A 4GEOA 3SHEA 2EUFB 4JX3A 2W9FB 4W9WA 4JQEA 5J1VA 2OF2A 5M44A 3PDTA 2WXVA 2F7XE 2ZM3A 5M55A 3OZ6A 4U43A 5IQCA 5D41A 2CGXA 4I92A 2VTSA 3NUUA 5EG3A 5JQ5A 1Y6AA 2CSNA 2P4IA 3KRLA 4A06A 4YTIA 5JN2A 4IAKA 4ARKA 4XCUA 4IBMA 3BE2A 5FBOA 4AF3A 5KBQA 2UZDA 5IQGA 3BEGA 1DS5A 2X8DA 3KMWA 3QXOA 3NUAA 4XH6A 3RBWA 5AM6A 2Y7JA 2PZIA 5J9YA 4FTTA 2YCQA 1H07A 3PPKA 3L8XA 5B2KA 4UWBA 4C58A 2B1PA 3COIA 4TXCA 3DT1A 4USFA 5ACBC 1MP8A 4ANNA 2GDOA 2B9IA 2GPHA 5FM3A 4ZTRA 3BI6A 1CMKE 3QKKA 3HYHA 3I0QA 2EU9A 1TKIA 2VWYA 4CYJA 4QMWA 4M68A 5EOBA 3R8MA 5GJDA 3G51A 3FZOA 2A27A 2SRCA 4M3QA 3QQGA 3DXQA 3S4QA 3Q6UA 4E1ZA 4GUBA 1G5SA 1QPCA 3S0OA 4OTPA 4MBJA 4PRJA 3FV8A 4AGCA 2BMCA 1R0PA 5T3QA 4L9IA 3WF9A 1QPDA 2E9OA 3NLBA 3R21A 3QXPA 3DBCA 3DDPA 1SVHA 3W2SA 4D0XA 5HG7A 4C59A 3BGPA 4E4MA 4I5HA 4DTKA 2UW0A 5CENA 4BB4A 4YR8A 5CQUA 2WQBA 3G2FA 1ZARA 2J5FA 3V5LA 1NVQA 1M2PA 3RM6A 2OI4X 2QONA 5J5TA 1BI8A 4FK6A 4K33A 4FE2A 3F3TA 4DN5A 4MK0A 4RRVA 2XIZA 3D5VA 4RFYA 3ALOA 5EOLA 2IW9A 5HBJA 4YZMA
chains in the Genus database with same CATH superfamily
2OG8A 3PXYA 4LOOA 4BTJA 4CFWA 4O7ZA 4O7RA 5TR6A 4JBQA 1BX6A 3HV7A 3K3JA 5JFVA 2BZHB 2DYLA 2R3OA 4G17A 2Z7SA 2ITPA 5E90A 4CZUA 5ANIA 3LCDA 4E5AX 2HWOA 3ZUTA 3LXKA 1U54B 4XS2A 3ZYAA 3SVVA 2ITOA 1UWHA 3VJOA 4UZHA 2VWIA 3RAHA 5C1QB 5J7HA 2XNBA 5DT0A 2YM7A 3ZBXA 4YJVA 3C5UA 3UE4A 2YERA 1V1KA 5CEOA 1QCFA 3U6JA 3KEXA 3KC3A 4TL0A 3IOPA 4DEDA 4RIYB 4XRLA 4YZBA 4C4HA 4MXAA 5TOZA 4WOVA 1WBOA 2ZJWA 3BYUA 3BU6A 3EQFA 4F9CA 4LGGA 5LMKC 4TTHB 4BN1A 3T9TA 2VUWA 4JAJA 2GU8A 2V7OA 4YJQA 3OHTA 4FV0A 4UY9A 5CTPA 4ASZA 3ZU7A 4DCAA 3OUNB 4XG9A 4LL5A 5DWRA 4GVJA 3G9LX 3D7TB 4DH5A 4QDEA 2YIYA 3NUSA 3W8LA 4OTRA 5KKRC 5L6WL 2R3NA 5LVOA 4D55A 5FDPA 3B2TA 4PTCA 5HHWA 3TKHA 2C6MA 2E9NA 3DV3A 5LMBA 5LQFA 4K11A 5BMMA 3NUPA 5E8UA 4TN6A 3R9NA 5DLSA 2PMNX 5IEXA 3IOKA 4UALA 4WSYA 2PZRA 4UZDA 5BYLA 5L6OA 1UNLA 3TWJA 5F9EA 3DOGA 5LCJA 3V5PA 1FVTA 3M42A 3NSZA 3ZFMA 3KXMA 5HTBA 5TKDA 5M56A 2XKEA 3E93A 4UB7A 3BV3A 3MFRA 3OW3A 4QP8A 4BC6A 5BPYA 3WYYA 4V04A 3IONA 4ERKA 3TJDA 4CQGA 2W1ZA 3PG3A 4EK4A 3GGFA 3GENA 5J5SA 5J79A 3CY3A 2IZTA 4FIJA 4IB1A 4S33A 5KZIA 3R7EA 3W0PA 2X0OA 3FMKA 2YACA 4GT5A 5BVFA 3R02A 4GYIA 4IAIA 5F4NA 2FSTX 3R73A 2VTIA 4BGGA 3QQFA 3WILA 2GCDA 1I44A 3VO3A 3ANQA 4EKKA 5A4CA 5IH5A 3PZEA 4GS6A 4J8MA 4ACGA 4C37A 3E8EA 4EOLA 1P14A 1OZ1A 2O65A 4E6CA 5IMEA 5AJQA 3RJCA 1UU9A 4ZP5A 5FRIA 2OXXA 3BGQA 3LM0A 4WO5A 4G3CA 5H3QA 5J95A 2HZ4A 3IDBA 3QD0A 1OKYA 3EB0A 3FLWA 5EI2A 3DQXA 3BYVA 5CSXA 4FTNA 2Z7QA 3KQ7A 3MESA 4BWXA 4I6FA 4DG2E 4XG6A 1XQZA 4HCVA 4CFVA 3LM5A 1GZKA 3F88A 5HCXA 3UZTA 1PY5A 5KE0A 4FSWA 3ORTA 1MQBA 3DBDA 4U5JA 3QUPA 3ATSA 4YNOA 4MKCA 1KSWA 1PXOA 3PY1A 2GQSA 4HGSA 4JBVA 3PVGA 4EOKA 1JKLA 2CJMA 1OL2A 3Q4ZA 4LM5A 1GZNA 4N6YA 1FINA 3OCSA 3OG7A 2XRWA 3AC8A 4FTQA 4IE9A 4CLJA 2GNGA 4DH3A 4EHGA 4IZYA 4R7BA 3T3UA 2W4OA 4WBOA 4Z3VA 2PVKA 1WBSA 2CKOA 5JZJA 4F7JA 4AG8A 1ZAOA 1LP4A 2XNPA 4FKRA 1PYEA 2OJIA 2ITWA 4JRVA 4EH8A 5CAOA 1SVGA 1WVXA 2BUJA 3O7LD 3C5IA 5CWZA 3LQ3A 3H0YA 3RZFA 4U45A 5CEPA 4ENXA 2Q0BA 3UVQA 3DFCB 3QA8A 1ZMUA 4FG9A 4FTIA 4MNEB 4O22A 2W1EA 3ZLWA 2VV9A 1XKKA 4D5HA 5AAGA 4I6BA 4RIYA 5J9ZA 4FKWA 4JRNA 1ZRZA 4FIEA 2QURA 3TXOA 5FXRA 3P9JA 4H3PA 3VS2A 4C33A 4YJTA 3N4TA 1E9HA 3CPCA 3FBVA 5JEBA 5I0BA 4CLIA 5FBNC 4CEGA 3VS3A 5JT2A 2V55A 4FKGA 4FL2A 4C34A 1OI9A 3QZIA 4CXAA 2HW7A 2I0YA 1NY3A 2JBOA 3D7TA 3FHRA 5FP6A 1IG1A 4F0IA 5KHWA 2QOBA 4O4EA 4XV9A 4AXEA 3VN9A 1YKRA 4QMZA 3MY5A 4EJ7A 3I4BA 2C6EA 4ZY4A 3OF0A 4BCKA 3E92A 2PY3A 4QNYA 2XKCA 1JQHA 4AW1A 4I6HA 4NCTA 2G15A 4IAFA 3FLZA 4AZSA 1GAGA 3W2RA 4UXQA 2W5BA 3ALNA 3QZFA 5HD7A 4IMYA 3F7WA 5CSHA 2UW4A 4AXDA 5CU2A 3BU3A 3D0EA 2UW6A 5ANGA 3CE3A 3JYAA 4MTAA 3A7FA 4C61A 2QU6A 4B8LA 4RLLA 2WQEA 4QMTA 4F09A 3QCSA 4ZSAA 4D4VA 2ZM4A 4HZRA 5DVRA 2Z60A 4XP0A 4I4FA 2CPKE 2R7IA 3CIKA 4OTIA 4O1PA 3UTOA 4EOOA 2OJGA 4EOJA 3QCXA 3N9XA 3NNWA 4RWLA 2Q0NA 3NAXA 3UO4A 4NEUA 2EB3A 3AQVA 3KFAA 1U59A 1F0QA 4N4SA 4KBKA 4UMQA 5BVOA 3G6GA 4WNPA 5CT0A 4IB0A 1OPLA 1XJDA 2BRMA 2XEYA 3FZTA 2IF8A 3HKOA 5EYCA 4AS0A 4AUAA 1FBNA 2NNWB 4ASEA 3F2NA 3R22A 5CZIA 3ZZWA 2C4GA 3MVLA 3VHEA 5CZHA 5EYMA 1W7HA 4AQKA 4F9AA 4C3PA 4GKIA 1O9UA 5LMAA 3DZOA 2J0LA 4L67A 3F3WA 2R3QA 3EQHA 5I4NA 3I79A 2A98A 3C4CA 4IB3A 3FZPA 3TDVA 3E8DA 2R3PA 3PY3A 4J53A 5AFVA 3DKGA 4APCA 3CP9A 2PZ5A 5DR2A 4LRKA 3C4ZA 4LYNA 3HRCA 1F5QA 3VW8A 4EOIA 4KAOA 4KIKB 3E3BX 3QLGA 3SLSA 3FMHA 4NJDA 5AUXA 4O27B 3PJ1A 3ZLXA 4DG0E 1ST0A 4QP4A 4AXAA 4FKQA 4KA3A 3WARA 2HZNA 4DFNA 4OR5A 4D2RA 2VTAA 2WQOA 4RZWA 4F7SA 4MQ2A 2RFNA 4ZTHA 1YOMA 5IUIA 4U41A 2X0PA 4BDAA 2WD1A 3RK7A 2WHBA 3L8SA 3DB6A 4NFMA 3W1FA 3TUCA 1G8JA 4OTDA 3QQKA 3OOGA 5HIDA 4J98A 3Q9YA 1B39A 1JOWB 4PL3A 3FXWA 3HUBA 3QRJA 4PNIA 4EH7A 4XP2A 5E8SA 1HCLA 5EI8A 4DFUA 3SG9A 4MNEA 5FDXA 3OS3A 4YLKA 4M15A 3MVMA 4WNKA 5ANKA 3KRJA 5HE2A 2Z7LA 5BVEA 2XK7A 3LPBA 3EQIA 4P5ZA 1IA8A 3I5ZA 3L1SA 4WNOA 2H6DA 3RMFA 2Y6OA 4EH5A 1U5QA 4WUNA 3OY3A 4PY1A 1XBCA 5AP3A 3PIYA 3VRYA 4D5KA 4E93A 5GIPE 4DT8A 2PULA 4AN9A 2C68A 3BZ3A 2RG6A 3ACKA 4A9UA 3CCNA 4BKZA 2PUUA 4UMRA 4KABA 4DLJA 4I22A 3T3VA 3QBNA 4FBXA 3FC1X 3FI4A 5D7AA 4CFFA 3W0MA 4E6DA 5BQ0A 2GHMA 4PMTA 3EL7A 4KSPA 3KXXA 2WGJA 5DRBA 4A7CA 5AAEA 1WBNA 2GQRA 3R0TA 4GFGA 2C6KA 4FUXA 4BBFA 3O5AA 5AR3A 3ITZA 4D2SA 3WZUA 3LMHA 3LFDA 4I5PA 3VUGA 3FY2A 3DJ7A 3WF5A 3PSBA 4AQCA 2JAVA 3HV4A 1U46A 3NGAA 2YCSA 3OY1A 4FOBA 4X2GA 3R00A 5J87A 2VNWA 3ROYA 2OKRA 3W18A 3A60A 4ALUA 4DHZA 3BLRA 3PJCA 3PP0A 3OCBA 2W7XA 2WOUA 2WEIA 5LVNA 3EN5A 4GSBA 1JKTA 3QC4A 3VS0A 3KMMA 4GG5A 5JMSA 1R78A 3E88A 4IDVA 4WBBB 1KE9A 5E9EA 5EK7A 3CPBA 4FV7A 4R3CA 2BRGA 3MV5A 3LMIA 5BMSA 2WIHA 3FI2A 4YJRA 4WUAA 4DH8A 2VTQA 4EWHA 3KXNA 2W5AA 3HUCA 1FQ1B 1KV2A 2WNTA 3SXFA 2ITNA 4KUJA 4ZK5A 4HVHA 5FUTA 3IW8A 4KBAA 5B2LA 4EH6A 4QYYA 4CV9A 2JAMA 3TTIA 3RPYA 3SA0A 3MH3A 2OIBA 3UIUA 3E62A 5HX8A 1URCA 5F1ZA 4E6QA 3QCYA 2VWVA 3KK9A 3QQUA 4PUZA 5JGAA 3OT8A 5CX9A 3EQCA 1W84A 2IN6A 3IW4A 4JX7A 4D0WA 4MD7E 3BEAA 5L2TA 3KMUA 3LFSA 2BCJA 4Q5HA 4KIKA 4J96A 3AD6A 4HNFA 3E8NA 4CRLA 3WZDA 4NZWB 2XKFA 4D2VA 4YJOA 2JITA 3ZS5A 4ANLA 4FYOA 4EZ3A 1OGUA 4R3RA 5L8LA 2XNGA 5EI6A 2R3MA 4X6RA 2XCHA 2QKWB 2QVSE 4C2WA 3EN9A 4CKIA 4K8AA 2WPAA 3WZJA 4OAVB 5DR9A 2F4JA 4BDEA 3FXZA 3UMWA 3WBLA 5ETIA 3DK6A 2I6LA 5EKNA 5L8JA 4MWIA 4QD6A 2PMLX 2ZVAA 4OLIA 3MBLA 2W1HA 3PYYA 4H36A 2W06A 2FB8A 4Q9SA 4GJ3A 3COKA 3VBXA 1PYXA 4B4LA 2YCRA 3ZZEA 4OAUC 4Y72A 3TG1A 4C4GA 5CF8A 5J7BA 3ENMA 3HP5A 3ULZA 2BALA 4DDIA 4CFNA 5D7VA 4FZDB 3ZEWA 4QRCA 3ZUVA 2YJSA 4DCEA 3QQJA 1LR4A 2FSMX 3M11A 3OXIA 2J4ZA 2HY0A 4FKUA 4WRSA 4YPDA 3RALA 2QLUA 3MPTA 3LFFA 1YRPA 4BKJA 4Y85A 5BVKA 2YM3A 4USDA 3V51A 1QPEA 3C4XA 2PHKA 4OTHA 5CSVA 4BDBA 4C2VA 4O84A 2YJRA 4ZMFA 5C4KA 3REPA 4F0FA 5I9ZA 3HRBA 5E92A 5LVMA 4LMUA 4FVQA 4AZFA 3NPCA 5A6NA 1JAMA 4JI9A 4BCPA 3DLSA 4MF0A 2IW8A 5I9XA 3DKFA 1IRKA 3Q5ZA 4HYSA 5BUEA 1VR2A 4DEBA 4R77A 4ACMA 2W5HA 5E1EA 4ANSA 2X4FA 4EQCA 4BZDA 4U7ZA 4LOPA 2XA4A 4U0IA 3G0FA 4OUCA 5TO8A 4MNFA 3ZH8A 3I7BA 4I3ZA 2R3RA 4IHPA 2CNVA 4TWCA 4ZIMA 4E4XA 4LG4A 3LHJA 3PXQA 3FAAA 4FSNA 5DMZA 5KBRA 5FM2A 2WMRA 3DK7A 3NS9A 4FKSA 5I9WA 5IDPA 4L68A 4D28A 4DHJA 2C6DA 4MVFA 4V0GA 4EBWA 1NW1A 3DKCA 2C6TA 3A7IA 2OF4A 4O7YA 4W8DA 4J1RA 2HELA 4DGGA 4O7VA 4FSMA 4S30A 3BKBA 2Y4PA 4W9XA 4ANBA 3JR1A 4IXPA 3BBWA 4FZ7A 3DCVA 4WIHA 5L2QA 1T46A 1XH4A 2BTSA 5CY3A 4IACA 1Q4LA 4DGNA 3GT8A 4ENYA 4FSTA 4QMYA 3R7GA 4TZRA 2PUNA 2QG5A 4R1VA 2OZAB 4GG7A 4RJ7A 3IK3A 4I24A 4YU2A 4EWQA 2PZYA 4LRMA 4IFCA 5HIEA 3BLQA 2VTJA 4D1ZA 4IWDA 3POOA 4MWHA 4NJ3A 4P7EA 4XLIA 3FJQE 3SW4A 3ZC6A 2IG7A 4G3GA 2WTJA 4EQUA 4YJPA 4CG8A 3FEGA 5IZFA 2WMQA 3HMPA 3Q4TA 3UODA 4IWOA 3FSFA 4K77A 4XOYA 2UVYA 4MD9E 3EMGA 3CEKA 2Y9QA 2B52A 4MCVA 4PDYA 2YLEA 2R3LA 1KOAA 2HAKA 5BVWA 4L53A 2PTKA 4AFEA 1SYKA 3CGFA 3EKNA 3C0HA 4G9RA 4TNDA 5HOAA 3VRZA 4IZ5A 5HD4A 5CU6A 1V0BA 5HG5A 2ZV9A 4FSQA 5ANJA 4GIIA 2QR7A 3GU6A 2J90A 3IW7A 4UYNA 3H9OA 3UC3A 4PMSA 4XV1A 4DH1A 5DNRA 5FXQA 4HJOA 1BUHA 3KU2A 3RPOA 4CT2A 5A6OA 5HO7A 2RL5A 5IQBA 2PVRA 4FIGA 4RGJA 2Y4IB 5AUUA 3KA0A 4FEWA 1FOTA 1VLRA 4MD8E 1L3RE 4E73A 4GW8A 4I23A 2XBJA 4O6EA 1M2RA 4EHVA 4EOMA 2EXEA 4JDHA 1W83A 3V04A 4AACA 1BKXA 2PL0A 1ZLTA 1OIYA 1Q8UA 2R2PA 2YHVA 4G31A 4ITJA 3FDNA 4H39A 4LGDA 3W0SA 4K2RA 4YZDA 2JFLA 4CQEA 4J95A 4QQCA 2KTYA 3IKAA 4BDDA 3PE1A 3EYHA 3RK5A 3BELA 3TNHA 3PZHA 4HVSA 4FGRA 4DDGA 1RQQA 4ZS0A 4RVMA 4GK4A 3VF8A 3ZSIA 3E64A 4AOJA 4TWPA 3SG8A 3ZM9A 4BYJA 4BCQA 4ANMA 2BZKB 2F49A 1BLXA 2YM6A 1AGWA 1FVVA 1CKJA 3PXRA 1FVRA 3HEGA 3VBVA 1YI3A 3JXWA 2XIXA 4TYHA 5EW8A 4CYIA 5BVDA 5L2IA 2G01A 2Y6MA 5M09A 2WEVA 4IVCA 4IFGA 5JGBA 3EOCA 5IA2A 2PUPA 5J8IA 1YHSA 3GCQA 2F2CB 3ENHA 3LZBA 4TYIA 5EM6A 3SC1A 2O64A 4B7TA 2BZJA 5BNJA 4JAIA 2BKZA 1M7NA 3RHKA 4O81A 4KKEA 4GL9A 3R8LA 5LCKA 4ITHA 2WU6A 3BHUA 3W32A 2XKDA 4W4XA 4FG7A 4U8ZA 1M7QA 4OTQA 2AQXA 4X21A 4FZ6A 4W8EA 3HV5A 1YWVA 1TZDA 2PE2A 2VTTA 2B54A 5I3RA 4FV3A 4P5QA 4EOSA 2WMUA 3O7LB 3TTJA 1OECA 5LOHA 5AIRA 4L7FA 2RFEA 3R7YA 4QP9A 4YHFA 3MI9A 4L43A 1PMVA 4D1XA 3KULA 3WF6A 3F66A 5D1JA 3BCEA 1ZYSA 5JH6A 1S9IA 3R30A 2RFDA 4FODA 5GZAA 4S34A 5LJJA 2QI8A 2YWVA 1Q5KA 2QU5A 2FGIA 3CTJA 1WBVA 4C35A 3I6WA 4FKPA 4FKLA 3PSDA 1G8AA 2OZAA 2O3PA 5HTIA 3TZ9A 3NUYA 2I0HA 5DOSA 4RQKA 4FTKA 5EHLA 2XJ2A 3OOMA 2XK9A 3RZBA 4YBKA 3FMMA 5M57A 3E5AA 3ZDIA 5A9UA 2GNHA 4M97A 4KINA 2J9MA 5AP5A 1Q8WA 2WTIA 2OIQA 5HZNA 3BLAA 5AEPA 3PUPA 1YDSE 1PXMA 2YZAA 1ZMWA 4GH2A 2GMXA 4S2ZA 3DBEA 5L8KA 3U55A 5B2MA 2YCFA 2H34A 3F5GA 2XS0A 4KSQA 3F82A 4RPVA 3C9WA 5L2WA 2C5NA 3I7CA 2EXMA 4ZLZA 2A19B 4FF8A 3ZFYA 2IVVA 3ORIA 1TFFA 3RNIA 4L00A 2DQ7X 4RLKA 3UZPA 2YLFA 4D4RA 5HQ0A 5J9LA 4DTAA 4BIDA 1XR1A 3EN6A 3PPZA 2VAGA 5HNIX 1HCKA 3MIYA 4AGWA 3UZRA 3W55A 3WIKA 1PF8A 3AKLA 4O4FA 5M06A 2OJ9A 3LOKA 1T45A 3A4OX 2V22A 4LOQA 3IDCA 5CSWA 4BCFA 4FOCA 4JLCA 4G2FA 4O0TA 4UWYA 5IISA 2CCHA 3NCGA 3UC4A 1O6YA 4QPAA 1SNXA 1XH9A 4RX9A 1Y91A 2YIWA 4DEEA 1H27A 3PVBA 2YEXA 5J1WA 1TVOA 3ZBFA 2XK6A 4ZY6A 4RX5A 4DBXA 2ZV7A 2WAJA 3NW6A 3ZHPC 5KMJA 3LCTA 4U79A 2A0CX 1H26A 2BPMA 4X3FC 4IX6A 1WBWA 4I93A 4UXLA 2W1GA 3QTQA 3RAIA 2GNIA 4FTAA 2JKKA 4G5JA 2VGPA 4H3QA 4IB5A 4ITIA 4YNEA 5JFXA 2UZBA 1G8KA 5IDNA 3A7JA 4YJSA 2ETMA 2IJMA 2YABA 4CCUA 3BE9A 4KIPA 5ETCA 5DA3A 3NIEA 4BRXA 3CLYA 2IZUA 3FPMA 3TJCA 2IZSA 3OWLA 4NTSA 1H00A 2ZMDA 3O8PA 3NUXA 4Y73A 1IR3A 4HGTA 4B6LA 3AKJA 2IVUA 2X9FA 3HP2A 3NIZA 5AR7A 4HVIA 2QC6A 4XG4A 1CDKA 3UYTA 4AGUA 4AW5A 4EYMA 2XAMA 3VBTA 5CXHA 4RIWA 3DAEA 4IM0A 1OB3A 4FL3A 4O2ZA 4N70A 4S32A 5CSPA 4AWIA 3EQDA 4HPTE 4C4IA 4M84A 5AUVA 3F7ZA 3LAUA 1P2AA 1FMOE 2RGPA 4FT5A 1IEPA 2LGCA 2X0GA 3NX8A 2AC3A 2J0JA 3QTUA 3SDJA 2ZAZA 2X8EA 4IWQA 4TWOA 4UMTA 2CGVA 3EYGA 1Y6BA 3UP2A 4U80A 4DF3A 3V01A 2CGWA 2OIDA 2UZLA 3MN3A 1R1WA 5K9IA 3EQRA 1TQMA 4RJ4A 4RZVA 5HLPA 4FT3A 2R3GA 5DI1A 3BYMA 1ZY5A 3SOCA 4C8BA 2VWXA 3QQLA 4KS7A 5H2UA 1R39A 3W0RA 1GOLA 5HLWA 4YZCA 3OTVA 4Z9LA 3UOLA 3N4VA 5CAPA 5K0XA 4FJVA 4G16A 3UPXA 4NL0A 5CU4A 3E7VA 5CLPA 3QGWA 4E4NA 4EK5A 5K4JA 5HU9A 3R7OA 3SXRA 1BL7A 4Z16A 1OITA 3ZOSA 4RVKA 3BGZA 1ZYLA 4KWPA 1K9AA 1KE6A 4JL9A 3DTWA 4L44A 5AV1A 3FI8A 3NEWA 3KXHA 4IEBA 4L46A 2Z8CA 4WT6A 1YXTA 4BJJA 4GKHA 1OMWA 3VS5A 4BDKA 3JS2A 3QAME 2PE0A 2XMYA 3SQQA 4CKJA 1KE8A 2UVZA 4U81A 3C13A 3RHXA 4DEAA 2OH4A 3AOXA 3VUHA 4PMPA 1W98A 3NFGB 4RSSA 5HCYA 5EKOA 4FV6A 2UW7A 3WE4A 2WTDA 3CQUA 2VO3A 4QQJA 4EI4A 2HIWA 3ATTA 2X9EA 3U9CA 5M08A 3ZO3A 2ZDUA 3EHAA 3R6XA 2XNMA 3RNYA 2BHEA 3QL8A 4ASXA 4FVRA 1OPKA 5GHVA 5K0KA 4ZTNA 2HXQA 5IQEA 4ZJJA 2RIOA 5HKMA 3TNIA 4F65A 3SW7A 3R8VA 3DS6A 2I7QA 4FRFA 3UO5A 2X6DA 3KF7A 2OGVA 3V5WA 3NCZA 2WTKC 5E8ZA 3BHYA 4M0YA 3UNJA 3VUMA 4AAAA 3CBLA 4UN0C 5CF5A 4CVAA 3G15A 1JWHA 3HA6A 2X2KA 3ZXZA 1UA2A 5ANDA 1M17A 5HG9A 5FTGA 3LFCA 1JKSA 2QHNA 1CKPA 3QX2A 3TUDA 4EJNA 3ZSHA 4QYHA 4AN3A 4PL4A 3RK9A 4CD0A 2OWBA 4TKSA 1P4OA 3CD3A 2RG5A 4G5PA 3R9OA 5FTOA 3OXZA 3Q9XA 2QD9A 3PIZA 4XEYA 1OBDA 2ITUA 3OD6X 4Y8DA 1FMKA 4O4CA 4C3FA 5I9YA 2X8IA 3EFKA 3R8UA 4QYEA 3U9NA 1KE5A 3G5DA 1W82A 3NRMA 3HV6A 3DQWA 5JKGA 5AP1A 4OTFA 2ERZE 3CKXA 2W9ZB 3KRRA 4FK3A 3AMAA 5EQEA 3UG2A 3QA0A 5TT7A 4A4OA 3UMXA 2ETRA 2Z2WA 3HZTA 1OL5A 4P90A 4YTCA 5EDRA 3LFEA 3KN6A 3H10A 4IZAA 1OUYA 3AMBA 4ZSJA 3JVRA 5M4UA 2UW9A 3EL8A 4ORKA 1MUOA 4JBOA 4QPSA 3ZEPA 4TYEA 5DH3A 3WE8A 5AA8A 4UEUA 4RG0A 5HE1A 3R01A 5DBXA 3PWYA 3FWQA 5EW9A 4TYJA 2ZMCA 4JDIA 5C8NA 2B9HA 2OZOA 3MH1A 3RAKA 4GT4A 1JSTA 2Y4IC 2HENA 4FTCA 4OBQA 3ZO1A 4IX3A 1J7IA 4ZSLA 3R28A 3FI3A 2OFVA 5FEDA 3TKUA 3TT0A 3GU7A 3C4FA 4D9TA 4BKYA 5HORA 2ESMA 4AZVA 2HK5A 2OU7A 3AD4A 2LAVA 4FSRA 4LFIA 3PJ3A 2EXCX 3AC5A 1YI6A 2REIA 2VTMA 5H9BA 4CG9A 3CTQA 2W17A 4FKTA 2WO6A 3E63A 1VYWA 3P7BA 3LXNA 3IO7A 5HG8A 4ZOGA 3R1NA 4AX8A 3QWKA 5TE0A 3K54A 4Z7HA 3PRIA 4D4YA 2CKEA 4ZLOA 1OL6A 1UKIA 2HCKA 4FNWA 4FSUA 1OUKA 1Z9XA 4F7NA 2NRYA 1GIIA 1Q99A 2J0KA 3MS9A 3PP1A 5HE3A 5KMIA 4QTAA 3LE6A 4L45A 4BCOA 3EFWA 2XARA 2GHGA 4K6ZA 3IS5A 4GJ2A 4M14A 3F5XA 4DINA 2PMIA 4FG8A 4RWJA 5IA3A 4I0RA 4YHTA 2XJ1A 2KULA 4MUQA 3SOAA 2BRHA 2Z7RA 4KRCA 4CV8A 3HAVA 3HX4A 4M66A 3OMVA 4BWPA 4FSYA 2UZNA 4PPBA 2ONLA 3I1AA 4RVLA 5HTCA 1JSUA 5IQHA 3ACJA 3P4KA 3QHRA 5E4HA 3BL7A 4FV2A 5AR2A 3QYWA 2GQGA 2PVJA 3V5JA 3TMOA 5CYIA 2OH0E 3HL7A 3F9NA 1XH8A 2CLXA 2PMOX 5IA5A 3Q60A 3PFYA 4A9TA 3P7CA 1KUTA 4UV0A 5BVNA 3PA5A 4IIRA 3ORZA 4F0GA 4DGOA 1O6LA 2C0OA 2UUEA 3A4PA 3D5UA 4IJ9A 5AX9A 5JZNA 2BIKB 4A4LA 2PVHA 4EC8A 3DFAA 1Y8GA 3RPSA 1PHKA 1H1SA 1PKDA 4ZTMA 4EK6A 2W96B 3PA4A 2XIYA 4O0VA 5M53A 3DPKA 3M2WA 5AUYA 2PPQA 1OKZA 2PZPA 4FR4A 5IMXA 5L2SA 3O71A 4BCNA 3UQGA 4AW0A 3P0MA 2C30A 3GB2A 4HNIA 4F99A 4FIIA 4RA5A 2XVDA 4R1YA 4L6QA 4ONAA 4YTFA 4UYAA 2OICA 5HEZA 3UP7A 2J51A 4RWKA 5M4IA 2YDIA 1Q24A 5CVFA 4F9WA 4M69A 2VD5A 5BYZA 5A4TA 4JJRA 3EN7A 3FMLA 3NVKI 5KHXA 3ZONA 4R8QA 3ERKA 1OIUA 5KMMA 1JVPP 3MH0A 4NIFB 4I5CA 4XBRA 4QMXA 2YAAA 5ETFA 4MBLA 3TEIA 3BYSA 4J99A 3Q52A 4GVAA 1YQJA 3PRFA 4CSVA 2CMWA 2B9JA 2HOGA 4W4YA 3GBZA 4ZZMA 4NM0A 4R7HA 3HMOA 3F2AA 1CTPE 3RINA 3ULIA 2ZB1A 4AA5A 1YHWA 2XF0A 3DB8A 1L8TA 3QKMA 2VX1A 2RKUA 4QMUA 5JRSA 4U40A 3FZ1A 4R7IA 4V0GB 2FVDA 5JRQA 5F95A 4W4WA 1UNHA 3QF9A 3GP0A 1IAJA 5A46A 1GIHA 1OGYA 4J52A 4CMTA 4JIKA 2C47A 2B9FA 3OWJA 1ZOGA 4NW6A 4XUFA 4EH9A 1GJOA 4FT0A 3FYJX 4EK3A 1ZZLA 4PWNA 4FICA 1SNUA 4DE4A 1H1PA 1Q3DA 4NK9A 2C69A 2PVNA 3VBQA 1YOLA 3KREA 2HZIA 4EH2A 3JY0A 1UWJA 3MVHA 3P79A 4H1MA 4E6AA 1H24A 3AT3A 3DTCA 3H0ZA 5IEVA 5K5XA 3PXZA 3TZMA 3BRBA 1W0XC 3GNIB 3Q32A 4MBIA 4TPTA 2BHHA 5K3YA 1GZ8A 1DM2A 4N6ZA 3TV7A 3BLHA 1V0OA 3O23A 3O8TA 2VX3A 3HMMA 4HVGA 4I5MA 2JDRA 5HLNA 1UU8A 3JPVA 2P3GX 3GXLA 2HY81 1WMKA 3S1HA 3A8WA 3CY2A 3NNUA 3BQRA 4DEGA 2UZVA 3DBQA 4L3PA 2A2AA 2JBPA 2X0QA 2VWUA 3G6HA 3FPQA 2ZDTA 4WSQA