4BDDA

Fragment-based screening identifies a new area for inhibitor binding to checkpoint kinase 2 (chk2)
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
304
structure length
281
Chain Sequence
MSVYPKALRDEYIMSKTLEVKLAFERKTCKKVAIKIISKNVETEIEILKKLNHPCIIKIKNFFDAEDYYIVLELMEGGELFDKVVGNKRLKEATCKLYFYQMLLAVQYLHENGIIHRDLKPENVLLSSQEEDCLIKITDFGHSKILTSLMRTLCGTPTYLAPEVLVSVGTAGYNRAVDCWSLGVILFICLSGYPPFSEHRTQVSLKDQITSGKYNFIPEVWAEVSEKALDLVKKLLVVDPKARFTTEEALRHPWLQDEDMKRKFQDLLSEENESTALPQVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SERINE/THREONINE-PROTEIN KINASE CHK2
publication title Fragment-Based Screening Maps Inhibitor Interactions in the ATP-Binding Site of Checkpoint Kinase 2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 88
structure length 281
sequence length 304
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4bddA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4bddA01
5LMKC 4QMNA 4HCTA 5IEVA 4Z55A 3EMGA 4JX3A 2IZTA 2X7GA 4OTPA 4BCGA 4GKHA 1W98A 2UW3A 2ZB0A 3QZHA 1UWHA 3C1XA 1KV1A 2R3JA 5HICA 2QOLA 3UBDA 4TNDA 4PX6A 3F7WA 1F3MC 3EFLA 2A19B 3PDTA 3VUTA 4FBXA 3VS4A 2GU8A 3N9XA 5GJGA 3IOKA 4QP7A 2XK6A 4RQKA 1FMKA 4L6QA 4JBVA 5CF4A 3ELJA 3EYGA 2ETKA 4IM0A 4UN0C 5KMIA 4EJ7A 2OKRA 4CZUA 2PUPA 4NK9A 3C0HA 4A9UA 3QTXA 3V5JA 4TWOA 2CCIA 3E3BX 2I0VA 2YN8A 2JDRA 5CENA 4D1XA 2CHLA 5ETFA 4E5BA 5EQYA 4KRCA 3WI6A 3ZH8A 2P55A 2CKQA 3O0GA 3FHIA 2YIQA 3R73A 3D15A 2OGVA 1OPKA 5L6WL 4QMUA 5JFVA 4CFVA 1S9IA 4NU1A 2QC6A 4EK6A 4J98A 3VIDA 4XNEA 3REPA 2F49A 2UZOA 4FKVA 2AYPA 5AV1A 3VUDA 5IDPA 4KRDA 4RZWA 1PHKA 1ZZLA 4FVPA 4KS8A 3W2RA 4YHFA 1GZ8A 5IH5A 4BDEA 5HLNA 4RA4A 2PMLX 4CRSA 3QU0A 1V1KA 2XA4A 4J99A 1ZMWA 5IKWA 4EH2A 3NYVA 4MD8E 2PMIA 5L6OA 2YM5A 4TRLA 4AOIA 5KCVA 1J91A 1G8SA 3JS2A 4WUAA 4DEBA 5GIPE 5DR2A 2BHEA 3G6HA 5IA2A 3DAJA 4RWKA 3ZSGA 3KMUA 2PVLA 1KV2A 1ZMVA 1ZYDA 3DU8A 3PUPA 1AQ1A 5M08A 2QU5A 3PTGA 3QRUA 2UV2A 3JYAA 3OZ6A 4IVDA 3VBWA 4BDFA 1J7IA 3IS5A 4LMUA 1JNKA 4V05A 5DLSA 4BDHA 3LKMA 5BYZA 2P0CA 5H2UA 3VRZA 3ZEWA 5CAQA 4BGGA 3TUCA 1W82A 2UW8A 3KCFA 4U97A 4MBLA 3EN5A 3SA0A 3D0EA 2C1AA 3VS3A 4UMTA 2ZV7A 3BYSA 3GUBA 4QPAA 4CFWA 3ZC5A 4EKKA 5EKOA 2IW8A 4N57A 2R3RA 4ANOA 2BVAA 2C5OA 3KRRA 4YSMA 2C5YA 1FBNA 1PYEA 2GNJA 1L8TA 3AC2A 4HYUA 2VD5A 1YHSA 4TWNA 5AP2A 3TNPC 3KFAA 4AT5A 5JQ5A 4FSYA 4NFMA 4W8EA 1UU9A 5H3QA 5AA9A 4CFXA 3PIXA 1KE5A 1UKHA 3FZTA 3TTJA 4ZSGA 3DOGA 5M55A 4R3CA 2R7BA 3P23A 4IAYA 5J8IA 4ALVA 4E26A 5DRBA 1U59A 3SKCA 3KRXA 2GFSA 2R3QA 2VO3A 3CXWA 3DV3A 3QF9A 4KSQA 4OAVB 4EK5A 3LCOA 4J8NA 3QD0A 3SW4A 2VNWA 3VUGA 4EH3A 4G1WA 4AACA 5C26A 1H28A 1URCA 3NEWA 3QUPA 2OIQA 2C6KA 4E6AA 3EFWA 1H1PA 3ULZA 4O81A 5HNIX 4FV0A 4IACA 1XJDA 3DZOA 3FKOA 4JBQA 3ORTA 1R0EA 2GTMA 2ZV9A 3PLSA 4UWCA 4AZWA 4D4VA 4YJTA 4YNEA 4RX7A 1K3AA 3R22A 2IZSA 3IGOA 5CSWA 3S2PA 3WF7A 5IQIA 4QTCA 5J5TA 4FV1A 4B8LA 3RWPA 3ZO4A 4FODA 4IHPA 3DNEA 2GNLA 3QA0A 4KIQA 4YUQA 2XMYA 4J97A 3V8TA 2BIYA 4BTMA 4RC4A 1WBVA 1SNUA 4MF1A 3KRJA 2EXEA 5CXZA 3R8LA 4N0SA 5DN3A 5GZ8A 1ZY4A 1ZZ2A 5AR5A 4CLIA 4GU9A 3GU4A 3DA6A 5CLPA 4DH7A 2W5BA 3FZPA 4D1SA 4D55A 5FDPA 1OBDA 5D9HA 4IZYA 3MB6A 4JBPA 2B0QA 3TI1A 5CZHA 1YI4A 1XKKA 2YA9A 4YJVA 2WMVA 3RNYA 3KF4A 4CTCA 1PYXA 3FUPA 4IX6A 5L8JA 2W0JA 2UZDA 4DH3A 2G01A 4FT7A 4EH8A 1XO2B 3BWFA 3TUBA 4XHKB 3FMDA 2YLEA 2CNUA 3TKHA 3C4WA 2R5TA 3OTVA 2VTQA 4XLVA 4AGWA 4CT1A 3FMEA 3QCXA 5CNNA 4TKSA 5IA5A 3QHWA 4WG4A 3LAUA 4M67A 5JGDA 4AZSA 2VTLA 5J87A 1OL6A 3AGLA 3NNWA 4S2ZA 4RJ7A 3A8XA 3QKLA 1YRPA 4DH8A 2EUFB 2W17A 4A9TA 4E3CA 3H10A 4CNHA 4O0SA 3Q9WA 5H8GA 2J2IB 2XNBA 4Z3VA 5BVFA 2R3KA 4PRJA 2XJ0A 5HVYA 4BBMA 4OBOA 3QQUA 3RGFA 2B9HA 3CTJA 3CGFA 5CQUA 1QPJA 2C5VA 3VJNA 3FAAA 3Q53A 3HVCA 1Y57A 2W1EA 5IISA 2VO6A 3ORPA 5CT7A 3JPVA 3OT8A 4QPSA 5IEYA 4LGGA 4JAJA 1GZKA 2ITYA 3PYYA 4CQEA 3FWQA 4M12A 3PZEA 4ZEGA 2O5KA 3ZFMA 1GZNA 4AFJA 1JPAA 1MRYA 1U4DA 2CGWA 3PFQA 1GAGA 3V6RA 1VEBA 3UGCA 5CU2A 3H0ZA 2PU8A 4C4GA 4M69A 3ZEPA 3KA0A 4AGDA 3EKNA 2FB8A 3BV2A 4O2PA 4DTKA 2ZDTA 2HCKA 3ZLXA 4TTHB 4AZVA 4UX9A 3FYJX 2WQMA 4GH2A 4O0UA 1R1WA 2R9SA 3BGZA 1FVVA 3WOWA 3RBWA 3T9IA 3ZXTA 5TKDA 4F6UA 4IFGA 3G2FA 1UNHA 3ZRMA 3LM5A 3HRCA 3IQ7A 3D5UA 5JGBA 4HGSA 4DGMA 5DMZA 3UIXA 1RQQA 2XNMA 2BDJA 4DGNA 3SD0A 1Q3WA 2BTRA 1JKSA 4IADA 3ALNA 3NWWA 3OFMA 1P5EA 4RIYB 4BKJA 4DAWA 2JFMA 2J5FA 2X4ZA 5D7VA 3U6IA 1R3CA 1L3RE 3L8PA 5LOHA 2WO6A 4FA2A 4FKQA 3G5DA 4RJ3A 3HDNA 3MPMA 5LARA 3R9OA 2J4ZA 3BYVA 3GCPA 3ZMMA 3A8WA 1FQ1B 1R78A 4IB3A 3VBVA 4QNAA 4YTCA 3SW7A 5AADA 1O6LA 5JRSA 3GENA 1IAHA 4Q5HA 4FKWA 3IKAA 4NTTA 4CVAA 4HNFA 3QTIA 4DINA 4R5SA 4W4WA 1NW1A 2BAJA 4PTGA 3I60A 4X0MA 4YJOA 5I5ZA 5KBQA 2W7XA 4R78A 1VJYA 2QD9A 3DBQA 4L3JA 4K6ZA 2C6LA 1YDTE 3E87A 3MFTA 4USDA 4ANBA 3NUUA 2XS0A 2VX1A 3R7OA 4PMPA 4JG8A 3OOGA 4R3PA 3MA6A 2OIDA 1JVPP 4FZDB 3OXIA 5AAGA 3O17A 3DJ5A 3SQQA 4RQVA 2QO7A 2CJMA 2HWPA 5EFQA 5CSVA 1WAKA 5DH3A 5EQPA 4IVCA 5DEWA 5HG9A 5J9YA 4DG0E 2BZJA 4HVHA 3NGAA 4NUSA 4MBJA 3V3VA 4EONA 3IECA 4W4YA 5CEPA 2YERA 2XRWA 3PRFA 1E1VA 1WCCA 2EB2A 3I79A 5EG3A 4A07A 4ZLYA 1PXIA 2O65A 2GHMA 2HYYA 5CEQA 3TKIA 2WPAA 3Q04A 4E4MA 5TO8A 1CDKA 4AW2A 4ACCA 3RZBA 4CEGA 3FSFA 4O84A 4YZDA 5A4EA 3MW1A 4ITHA 2NRUA 4M0ZA 5I4NA 3VULA 2ACXA 3TV6A 4GW8A 4IWPA 4QYYA 2EXCX 4PDOA 4OUCA 5EYDA 3Q2JA 3ANQA 4FKRA 4NZWB 4D4SA 5ANGA 4ZY6A 3KRLA 3LFNA 2WGJA 1R0PA 4FK6A 3QTUA 4OTDA 3E92A 4U40A 3SAYA 3K5UA 4FG7A 4RX5A 5JZJA 2Q83A 2V5QA 3VUKA 3PVWA 4ANLA 4ZLOA 1YW2A 3PWDA 3UZPA 4MEDA 3VUIA 2F4JA 4D0XA 2C6OA 3E93A 1V0BA 3OWKA 3DTCA 4IANA 3UPXA 1BKXA 2PE1A 4F1MA 1M14A 4FX3A 4CYIA 3PY1A 2XIXA 4IWOA 4U80A 2VV9A 4UV0A 4BR3A 1TVOA 3QRIA 3OT3A 3OY1A 2XKCA 3HEGA 1PW2A 4RIOA 4UWBA 3W10A 1H25A 3O50A 4P4CA 1Q8WA 2ITOA 1M2RA 1ZOEA 3FJQE 2RL5A 3IGGA 2ITPA 5H8BA 1NVQA 1OECA 4FTLA 2IO6A 3BQRA 4BB4A 2R7IA 2YWVA 3K3JA 4MXXA 3NUAA 4KSPA 5EW9A 3AT3A 3ATSA 2GQRA 3DK6A 4FG9A 1PMUA 2OWBA 3OROA 3KY2A 4ZTNA 2SRCA 1J7UA 4D4YA 2Y4IC 3ZDIA 4BI0A 2R4BA 3HX4A 4XS2A 5HVJA 4EH7A 2C47A 2V7AA 3G33A 3DBEA 4EC8A 4Y8DA 4BDJA 2YM8A 3KU2A 5LVPA 2VWWA 2H6DA 2RIOA 5I9UA 1RW8A 3DB6A 3KMWA 4R1VA 3R71A 3BHHA 3VHKA 4DBNA 5EDQA 5HORA 4RWIA 4I21A 5D10A 1TQIA 2PZ5A 3CPCA 1B38A 3PVUA 3A7IA 3LOKA 1HCKA 4QQJA 3ULIA 4CRLA 2X7OA 2X9FA 2WTJA 5HESA 2VO7A 1G5SA 2C68A 5D1JA 4F9WA 2FSLX 4ACGA 4MD7E 3NW5A 2Y8OA 5LCKA 3LLAA 3UIBA 5AA8A 2B4SB 4AE9A 5CEKA 4HVDA 4ZSAA 2J7TA 5DE2A 5HD4A 4FTNA 4S31A 4QP9A 2BUJA 4FKOA 1WVXA 4H1JA 4FTCA 3RM6A 2YCSA 2XP2A 2W9ZB 3JXWA 4B9DA 5IA4A 5HE1A 3RI1A 2OJGA 1ZYSA 4YJNA 1WBPA 3KKVA 3QQFA 5FLFA 4KWPA 5HO8A 4QP8A 3R7VA 4GCJA 4L00A 2XYNA 4YP8A 4ACMA 3DKOA 3UQGA 5ANDA 3RKBA 1IEPA 4NEUA 5CZIA 3EQCA 3FBVA 2XJ1A 3PXYA 1DAWA 3O8TA 5JH6A 2R3PA 3R1SA 4GUEA 3OP5A 5JN2A 2UVZA 2OF2A 4RIXA 3UP7A 3TG1A 2W1CA 2X81A 2WQOA 2LAVA 2WMBA 3ZYAA 4TY1A 3KRWA 4FSUA 4GSBA 3GI3A 2ETMA 3NW6A 5IPJA 3SG9A 4K0YA 2CN8A 4G3EA 4R77A 1M7QA 3MIAA 3PP0A 3UO5A 2PY3A 5T6KA 4ALUA 2BAQA 5AUTA 3LCTA 3E7OA 3ZS5A 3DBFA 3R28A 2PVFA 2GHLA 4R6VA 1UKIA 1SM2A 1K9AA 4FK3A 5FWKK 3TL8A 3WILA 4HVSA 4RVTA 3LQ8A 1Q5KA 4RFYA 2ESMA 4FTOA 3F2RA 4D1ZA 4DTAA 1CKIA 3FI8A 5ACBC 2UW0A 4YZBA 2B9JA 4X2KA 5BVKA 3A7GA 2PE0A 1PKGA 3U87A 5J79A 2O0UA 3I4BA 2ZYBA 3I6WA 4QMWA 1XHAA 4XG7A 3UO6A 4ZLZA 1VYWA 5C9CA 4AE6A 4G34A 2BRHA 5DWRA 3B2TA 2J9MA 4YNOA 3PXZA 2Z7LA 3L9NA 4CYJA 2FA2A 4F0IA 4BC6A 2QOHA 4NJDA 3C51A 1WVYA 3OF0A 3AT4A 3QHRA 5CNOA 2QG5A 3F69A 5DYJA 3P08A 5GIOE 2RFEA 2H96A 5E8XA 4DFYA 4XMOA 1BLXA 3VC4A 1ZRZA 2CSNA 5HZNA 5A46A 4JR7A 4EYMA 5EHYA 4F9BA 5C1QB 5L6PA 5HCZA 4JG7A 4O6EA 4I1ZA 3KN6A 1JAMA 3R7GA 2FYSA 2OFUA 3KVXA 3Q3BA 5EOBA 3RPVA 2DWBA 3WF5A 4YHJA 4PDYA 4OAUC 3ZCLA 3AQVA 4KBKA 5T3QA 4EBVA 5FTQA 1H07A 3E8CA 4RIXB 1H8FA 3MDYA 4RFMA 4RT7A 5C01A 3TXOA 2F9GA 3ZZEA 4HGEA 2WMAA 1YKRA 2VN9A 3W33A 5HKMA 3VS1A 5D11A 4K9YA 5HE0A 4NM0A 2PULA 3S4QA 3DFAA 3JVRA 3C0GA 4FTRA 4BHZA 4AXAA 4XH6A 5JFXA 5J1VA 4A4OA 4K11A 4D0WA 2HWOA 3AC8A 3QTWA 4O7WA 4C59A 2YHVA 3DQXA 3BLQA 4RX8A 2CLXA 4XRLA 4FSNA 4AW1A 2VAGA 2XK3A 2XK7A 5HCYA 3CTHA 2OZAA 3MVLA 1A9UA 5KMOA 5D7AA 2OW3A 4R8QA 3CC6A 3PVBA 4WIHA 2VZ6A 1H1QA 3CQUA 3F5GA 3WBLA 3NYXA 3P7AA 1KUTA 3BEAA 3OD6X 4JI9A 5DA3A 4E4NA 2W5HA 3F88A 3DCVA 3FSKA 4F99A 2IG7A 2G15A 2X8EA 3OCBA 3O7LD 4MXOA 5JMSA 4CCBA 3GCVA 4BIDA 4JQ8A 1NVRA 4MYGA 4IB0A 1MQBA 2R3NA 4PPCA 4PNIA 4BCFA 4E6CA 2X2LA 5AIKA 2BDWA 2YLFA 1P2AA 2WTVA 5IA0A 4D2TA 3Q6WA 2I0HA 1GNGA 2ITVA 5HLWA 2XNGA 4LOOA 3PY0A 3MH2A 2FSTX 5JSMA 4R3RA 3AMAA 4QT1A 4QD6A 5T68A 1LR4A 4ONAA 3OBGA 2XEYA 4G16A 1PXJA 3EZRA 4I93A 4QYHA 4TYHA 4NW6A 3GU5A 2X4FA 3V6SA 4CMUA 3Q4CA 4QTBA 3ZRLA 1AD5A 3PA4A 3QQKA 3W8LA 4O0RA 3AOXA 2BZHB 5BVWA 3EQBA 4LRKA 1QL6A 3IW4A 4BWKA 3PXQA 4ZMFA 3IK3A 3PA5A 4DFZE 1H00A 5I0BA 3LXNA 2GS7A 4QMZA 4NL0A 3L9LA 3QTQA 3ANRA 4AF3A 4AZEA 5F4NA 3FLNC 4DBXA 4M97A 2RG5A 4L9IA 3DAKA 2DQ7X 4LL0A 2WMRA 5E8VA 3ZO1A 2OZAB 3UZRA 4O82A 1J1BA 1P4FA 4H1MA 5CSHA 5HBEA 2A1AB 3E8DA 2I0EA 3RPSA 4CKIA 4Q9ZA 1Y6BA 4AT4A 3PJ8A 1TQPA 4O21A 4UXQA 2FH9A 5EK7A 4XP0A 2BHHA 4NM5A 4O96A 3RAIA 4KUJA 2DS1A 1RJBA 2OJ9A 5CQWA 3I6UA 2CKPA 4X6RA 3ZM9A 2HXQA 2VU3A 4DH5A 3FMMA 1XBBA 2YIRA 3VWAA 4DEDA 4HVGA 1GJOA 2B53A 4ANQA 2JDTA 4DGLC 5CWZA 4FEXA 1H24A 5IEXA 4XP2A 3VS6A 4FEUA 3LIJA 2QKWB 3C5IA 4NW5A 3W2CA 4CV9A 4U6RA 1GIJA 5ANOA 5CY3A 1JSTA 2BIKB 2FO0A 3O7LB 2KTYA 2OFVA 3QC4A 5EM8A 3NAXA 2QOCA 3FY0A 3ZZWA 3G0FA 3HL7A 2WQEA 3DBCA 3MTFA 3GVUA 4JQ7A 3F2AA 4RMZA 4XG6A 5J5SA 1WVWA 5F9EA 3UQFA 3MFSA 2H9VA 2HENA 2WNTA 2WTCA 2YWPA 3CJGA 4FIJA 4QMLA 4AS0A 4GYGA 3THBA 4RX9A 5TT7A 2VTSA 4IJPA 4CTBA 4WO5A 3LJ0A 4E4XA 4EQMA 4Z7HA 5JEBA 3MB7A 4WD5A 2PVJA 3DS6A 3FMLA 3ET7A 2P33A 2J0JA 3TIYA 5LVOA 5KMMA 5KNJA 3QAME 3OBJA 4UBAA 2ZMCA 5HIBA 4FOBA 1YOLA 2QOIA 2VTRA 3L9PA 3O8PA 3ORZA 5C4KA 4BL1A 2PUUA 4GEOA 4GU6A 4L3PA 4O7ZA 3TIZA 5CANA 1H27A 3R7EA 3LFQA 3VF8A 2RFSA 4O27B 3T3UA 4S32A 2IWIA 3BU6A 4PMSA 4YJUA 4BZDA 3LQ5A 2X8DA 4IH8A 4XBRA 3ETAA 4YHTA 4LG4A 4YPDA 4ZTLA 3SRVA 2X8IA 4PL4A 2XCHA 4DGOA 5EM5A 3LVPA 1DAYA 1WBWA 4DEEA 3V8SA 3QCSA 3U9CA 3GC0A 4W8DA 4BFMA 4IXPA 3BHTA 4E8AA 3NIEA 5E9EA 4KABA 3RK9A 4BCHA 2WMTA 4F70A 3F9NA 4TN6A 4HYSA 1FGKA 2I1MA 2WIHA 3U6JA 2C0OA 3AT2A 5FXQA 5BMMA 3UVRA 2Y7JA 4RPVA 2PL0A 3AXWA 3P7CA 2NRYA 3DGKA 4L43A 4BICA 5IU2A 5L8KA 4DF3A 4A4XA 4R7IA 4YBJA 4D2RA 3IG7A 5LMAA 3PPZA 5EYKA 3C4FA 2Y4PA 3OG7A 5ANIA 4C61A 4HOKA 2W06A 2UZWE 3CTQA 2UW5A 4EQUA 5HVKA 4M7IA 3CBLA 3EH9A 3AG9A 4G5PA 2VTAA 5IQAA 4FKIA 3OWLA 4ZSJA 1RDQE 1H08A 4QQ5A 4MQ1A 2W1HA 3BE2A 2NPQA 2W1FA 5HTBA 4F7SA 3D7ZA 1ZLTA 4M14A 1LEZA 4F9AA 4G3FA 5A14A 4E6QA 2BCJA 3ATTA 2HZNA 2W1DA 5A3XA 3Q52A 3ORLA 3R2BA 4X3FB 5KUPA 4AW0A 1YXUA 2G9XA 1ND4A 4M0YA 4DC2A 2VX0A 4PUZA 3SRVB 3CQEA 2B7AA 2VGOA 2I0YA 3UE4A 4F6WA 4O7TA 4BCJA 4AG8A 4DA5A 3N4TA 3VNTA 4DEAA 4ORKA 4C4IA 5FUTA 2B55A 2C0IA 4APPA 4F6SA 2R0IA 2ZM1A 1BL7A 4IWDA 4E1ZA 2XNPA 1UV5A 2JAVA 3KXHA 1OPLA 5C4LA 3PPKA 2XM9A 1Q41A 3R8ZA 4GJ3A 4IAIA 4YZNA 4I6HA 3QD3A 2IVTA 4Z7GA 2GDOA 3VBTA 5DOSA 4FVRA 4FV2A 3TUDA 4YC3A 5M44A 5DT3A 3HMOA 3Q6UA 5AP6A 5IUHA 3V5TA 1OL5A 2ONLA 3ZBFA 2I7QA 4Q5EA 2JITA 2JKMA 2PUNA 2ITXA 4JLCA 3R0TA 4C0TA 2EXMA 3PXRA 4YJRA 3U54A 3W55A 3HP2A 4PQNA 1U46A 3ZM4A 1W84A 2F7XE 3BE9A 5B2LA 3CKWA 4G9CA 2XKDA 2XBJA 2C6IA 3UOKA 1WZYA 1YHWA 3L8VA 3OW4A 2OJIA 4RGJA 5I9YA 3GU8A 3TV7A 3TZMA 3LMHA 3RAHA 3OW3A 3QA8A 1WMKA 5LMKA 1MRUA 4F0FA 2G1TA 3TT0A 4GV1A 3DAEA 3ZSIA 4O6LA 5IQGA 2JKQA 2GMXA 2GS6A 2PMOX 5GZ9A 3FMNA 3P5KA 4HZRA 4E6DA 2XBAA 5KBRA 4RVKA 1NXKA 3NW7A 1OKZA 1Q24A 3FZRA 1Z5MA 4N70A 3ZLWA 3GP0A 4HZSA 3V51A 1UA2A 3NRMA 4FKPA 4C2WA 4DGGA 5AV0A 1YWNA 1Q8UA 2OBJA 4I3ZA 3T8OA 3U51A 3TJCA 3FYKX 2BFXA 2JKOA 3UO4A 3A4PA 4L67A 4AA4A 4FSTA 1SVGA 3FI2A 3FLWA 3Q4UA 3MA3A 4HGLA 4MNFA 3FEGA 5HO7A 5E1SA 4X2NA 2QHNA 3GBZA 3NUXA 4B99A 3QWKA 4XOZA 2JAMA 3ZXZA 5DG5A 3LCDA 5DPVA 3TCPA 5LMBA 2HOGA 4J71A 4GVAA 3FI3A 5E8UA 4OGRA 4WNKA 3OEFX 4BCPA 4JIKA 3UVPA 2XYUA 2W4OA 3TACA 4LRJA 3PP1A 2NNWB 3TZ7A 4CFUA 4I6BA 2PZPA 3QRTA 2OLCA 4EKLA 4QMOA 2JFLA 3ZLSA 2ZV2A 2BMCA 4HJOA 2JIUA 3W1FA 2VNYA 5CTPA 5ITAA 5KO1A 1QCFA 5DRDA 2X0GA 3T9TA 4ACHA 4BDDA 4BCQA 3W2PA 4BIBA 5M09A 3OMVA 5HX6A 3GC7A 2HZ0A 2VWIA 4LUDA 4P7EA 4U44A 4GL9A 3AC1A 3AC3A 3QQJA 4NH1A 4PP7A 4FV7A 2VTTA 4U43A 3KEXA 3RCJA 4JR3A 4EZ3A 4JL9A 1BX6A 3Q5ZA 3WZJA 2X6EA 4LOPA 4FUYA 1JBPE 3R9HA 3QRJA 2B54A 2WMUA 5HQ0A 5AWMA 5CYIA 2XB7A 4JDJA 3OWJA 4CCUA 1PXOA 3CEKA 4CFMA 5EKNA 4IQ6A 3BYMA 4NYEA 3NNUA 4I6QA 4GG5A 4OTGA 3NUNA 3CLYA 2HAKA 2PVRA 2WU6A 3LHJA 4RIWA 1NY3A 3BKBA 5AUXA 3HRBA 4DCEA 4I0RA 1CSNA 2Z02A 4OTQA 3HZTA 4JDIA 2YAKA 2HW6A 3I5NA 3MPTA 4BKYA 3BGPA 5M57A 3R9NA 4PV0A 2OXYA 4WT6A 4C8BA 1APME 5DGZA 1UWJA 1W83A 3NUYA 3DXPA 5DVRA 5L2IA 2ZAZA 1BUHA 4QRCA 4MBIA 4CMOA 5FDXA 5M4UA 1U54A 4FIHA 2IZRA 4J95A 4XV2A 2EWAA 3PJ3A 4EBWA 3EQIA 5HNBA 4IVAA 3Q9ZA 4W4XA 5EDRA 5IQFA 4H3QA 2WOUA 3UPZA 1DM2A 3I7CA 3FLSA 4D58A 4W4VA 2QQ7A 2YIXA 4GK2A 1YWRA 3F82A 3H9FA 3MGYA 4QP1A 4TPTA 3RPYA 4AW5A 3E8EA 3GGFA 3B8RA 3PXFA 4FSMA 4HYIA 4L7SA 4W9WA 5A4LA 2ITTA 3P86A 2WZJA 4C36A 2OSCA 3A60A 3P1AA 4X2JA 5BX0A 5A6NA 4RVLA 3NUSA 3MVJA 4USFA 3EWHA 4U3YA 4C35A 2Q0NA 1MP8A 4BZNA 1UU7A 3VW8A 3FMKA 3ORMA 3MESA 3R2YA 4G3DA 2Z7QA 1R39A 1QPEA 4IVBA 5I3RA 2UZEA 5K5XA 2ITWA 3Q2MA 5HEZA 4FKJA 3LQ3A 4RIWB 4F09A 3D2IA 3RTPA 3NYOA 3ITZA 4L68A 5KKRC 3OCTA 5K4JA 4UMUA 2JEDA 3EHAA 3EQGA 4I6FA 5ANEA 5HIEA 4UYNA 3EKKA 1ZWSA 4IC7A 4P90A 1FINA 3IW8A 4CZYB 1IRKA 2XF0A 3F3TA 4RC2A 5CVGA 5DR9A 2PZYA 3GC8A 2J0MB 5E7RA 5ETAA 5TOZA 1JWHA 1U54B 2UZTA 3FPMA 3C0IA 4QPMA 5HNGA 5EYCA 4DYMA 5TR6A 4DT9A 4GFOA 4GYIA 3A99A 3HNGA 4G5JA 3PSDA 5CI6A 5K3YA 2OK1A 3BWJA 5EI8A 4LM5A 3EIDA 3D94A 1A48A 4GIIA 4IM3A 2C6DA 4EEVA 2QURA 4LFIA 1M2QA 4AA0A 4O7VA 5JKGA 1GIHA 3FI4A 2ITUA 5H8EA 3RVGA 4ZTQA 1YXXA 3M1SA 2W4JA 4GG7A 3RK5A 4YZ9A 2CGXA 1OM1A 4FKGA 2E9PA 5E91A 4M69B 3RK7A 3G0EA 4RJ8A 5M4FA 4C4FA 4FI1A 1ZARA 5HCXA 5AV3A 4K77A 4R7BA 3A4OX 1H4LA 2GHGA 3RP9A 1ZYLA 5HG5A 3V01A 3LPBA 3F66A 4ID7A 2BROA 3PXKA 4GVJA 3GOKA 3VBQA 2QHMA 3VS7A 2YCFA 3E3PA 2IVSA 5C8KA 2BFYA 3W2QA 4ZTSA 4DTBA 3WZEA 4GKIA 4X6QC 2OI4X 3IOPA 4KINA 5EDPA 4L3LA 4O7NA 2PZRA 1SZMA 3H9OA 3QQLA 4K1BA 4QNYA 4AWIA 3E5AA 3M2WA 1XBCA 5DT0A 4E5WA 4TZRA 4AQCA 4R1YA 4FTTA 4MQ2A 2C3LA 4RFZA 4CMTA 2F7EE 2GFCA 5EHLA 1OGUA 4EZ5A 4U79A 4CXAA 4OTHA 4FIFA 4FMQA 5BUEA 2GNIA 3QYWA 4XOYA 1URWA 4DG3E 3FQHA 4YLJA 3OHTA 4U7ZA 3SXRA 3ZDUA 2BAKA 3II5A 2H34A 2WIPA 3DT1A 5CEMA 1H1WA 4IX5A 4QYGA 3W8QA 3R21A 4QO9A 3R30A 3BPRA 4BTFA 1OB3A 2O64A 2CNQA 2O3PA 2CGUA 2BRNA 4F7LA 4PTEA 2ITQA 2IW6A 4PNKA 3P4KA 5AAEA 1STCE 3R02A 2JGZA 4ITIA 4E5AX 3CIKA 3NX8A 3LFDA 4L52A 4PPAA 3UG2A 3FC1X 4JRNA 3VAPA 3VN9A 4DN5A 4C7TA 4HPTE 1KOBA 1HCLA 3LW0A 4D4RA 3FPQA 1I09A 3OEZA 5CI7A 2W99B 4RSSA 2JIIA 3MH0A 2XNEA 5CVHA 4EHGA 3AGMA 4KKEA 1OMWA 5A54A 3JVSA 4F7NA 4IJ9A 4ENXA 5LCJA 2QR8A 4F63A 4FYOA 3U8WA 4E93A 3TWJA 1DS5A 3ZFXA 4KB8A 4KBAA 2YZAA 5IH4A 4IFCA 3KF7A 1M2PA 5A4QA 5CF6A 4S33A 4DG2E 5J9ZA 1Q62A 4QMQA 3ENHA 3BLHA 5EH0A 3KULA 4O7RA 2OG8A 2VWZA 3PVGA 5AFVA 4Y46A 1WBNA 1AGWA 4I22A 4ANMA 1IA9A 2ZDUA 4KS7A 3UNKA 2YAAA 2FUMA 3FV8A 1REJA 4XEYA 4DFNA 3UQCA 3WIGA 3HECA 4CKRA 2BZIB 3KQ7A 2R64A 3C4XA 1PMNA 2W1IA 4Y73A 5HTIA 3GQLA 4JNWA 4BZOA 5FTOA 3RPOA 5I9WA 1Q97A 2J90A 4YTIA 2OO8X 4O0YA 4AFEA 2R3IA 3OC1A 5TE0A 4FICA 4G3CA 3R8VA 3ZUUA 3F5XA 5AUYA 5KMLA 1Q8ZA 4EOLA 3WF6A 3KB7A 4EOPA 4FF8A 5AMNA 4H58A 4APCA 3OTUA 2B9IA 3ZOSA 4U8ZA 5M4IA 3F7ZA 4OLIA 4I94A 3UYTA 4DT8A 3FZSA 5K9IA 4A7CA 4FE2A 3LFEA 2GSFA 5L2QA 1P14A 2HY0A 4ACDA 4ZTMA 2VUWA 3GFWA 4QTAA 4U45A 3VS2A 2V62A 4ZY5A 3W32A 1Y8GA 2XK8A 5BMSA 3R1QA 1PMEA 3WIKA 2PTKA 5FXSA 4O7YA 2E9NA 4F64A 2UZNA 3CSVA 5AP5A 4JDKA 4XG8A 2IVUA 3W16A 3FKNA 1FOTA 4FT5A 5FM3A 5E8SA 4WSYA 4UYAA 1PF8A 2C6TA 3GC9A 3KULB 3R8PA 3A62A 4BCMA 5A4CA 4O83A 4C3RA 4JOAA 4TYGA 1Q3DA 2ZOQA 3BRBA 3MIYA 3P79A 4FEQA 4HPUE 2R3LA 5M4CA 2X2KA 4KA3A 4EHEA 3OS3A 3LXPA 4EOJA 2G2IA 3DZQA 1U5RA 4OTRA 2QOBA 2Y6OA 3QCYA 5AR7A 3SV0A 2PHKA 3R8UA 1KOAA 3FLZA 5HU9A 5K0KA 4RZVA 4ZZMA 2PZIA 5IQEA 4BDGA 3FY2A 4JJRA 4FTKA 5LWMA 3RHKA 2V0DA 2YCRA 4H36A 2XEZA 3RNIA 3PJ2A 4BDIA 3BCEA 5FEDA 3T3VA 2HXLA 4FTQA 4KIKA 4C57A 2PWLA 3BYUA 4ASDA 1PXKA 4L7FA 3CKXA 4BRXA 2X1NA 5IMXA 2OJJA 4FSQA 4ZS0A 3SOCA 3WYXA 3VQUA 4KKGA 3TNHA 3SXSA 1PMVA 4BKZA 4JG6A 4EUTA 3VS0A 4MK0A 2AC5A 2X39A 2VWYA 4IDVA 2ITNA 4MAOA 4R5YA 2IZUA 2WTKC 3ZONA 4O0WA 4GK4A 5J1WA 4AT3A 2QLQA 2VTOA 4IZ5A 5DNRA 4DHFA 5KZ0A 4RJ4A 3UNJA 4RLLA 4FZ6A 5HG7A 2QO9A 3R01A 2E9VA 4OTWA 4AX8A 5GZAA 3D4QA 1UU3A 3EL8A 3A2CA 3ACKA 4F1TA 3AD6A 3S00A 4C4HA 3W2OA 3IPHA 3QGWA 4JX7A 3ID6C 4CG8A 5EM6A 3F5UA 2C6EA 5DIAA 3LE6A 4F0GA 1V0OA 5E90A 1H26A 4OTIA 4MKCA 3TV4A 2Z2WA 5BQ0A 4FIEA 3I0OA 2BZKB 2OZOA 4MHAA 5HLPA 5I9VA 5ANKA 3NVMB 2C5NA 3KREA 4GFMA 5A6OA 4DFLA 4QTEA 3DXNA 4AGUA 3TDVA 5HE3A 2Y4IB 5M07A 4KIKB 5BVNA 1IR3A 4MVFA 5AUUA 4M84A 2EB3A 3FL5A 5IMEA 4AP7A 2WELA 3EN9A 3QUEA 5IF1A 3CGOA 2JDOA 3QXPA 3RMFA 2GNHA 2JIVA 3ZFYA 4BIEA 4FTIA 5E8ZA 4O7LA 3D5WA 3PJ1A 2B9FA 4LGDA 3MPAA 4G6OA 4S30A 3NZ0A 5E8YA 5C27A 3LM0A 4WUNA 4DFXE 3U55A 1OZ1A 4I4FA 2VWBA 4IAAA 1E1XA 1YOJA 3TNIA 4U3ZA 3KXNA 4D2SA 3UOJA 2J5EA 3O8UA 2QONA 3WE8A 3QKKA 5FP5A 4QYEA 3IDCA 3VW6A 4CG9A 2YM4A 3WE4A 1KE9A 1JKKA 4FNZA 4L42A 2RGPA 3ZHPC 2WAJA 3TNQB 5E1EA 4BCOA 2G2FA 4FKUA 4NIFA 5DEYA 4H3BA 5HBJA 2W1GA 2WKMA 1NVSA 4OTFA 5CU4A 2R3FA 3NYNA 4GJ2A 3EYHA 3WF8A 5KMKA 2XCKA 2RG6A 3A7JA 4ZK5A 4E4LA 4ERKA 2WFYA 3MY0A 3W2SA 5KX8A 3IW7A 4XUFA 3OVVA 4QP4A 4FG8A 3NNXA 3SOAA 3GU7A 4S34A 3KXXA 4M66A 5M51A 4X2FA 3SHEA 4ZZOA 2CMWA 4XX9A 3GQIA 3R9RA 1I44A 5C8NA 5KHXA 5FRIA 4XV1A 3F6XA 2NP8A 3PY3A 5L2TA 4M68A 1JOWB 5JK3A 5D12A 3PE2A 4V04A 3ZO2A 5IA3A 3PSBA 5FP6A 4EJNA 4IX3A 3G51A 4GRBA 3UODA 3D7TA 3P9JA 5CAPA 5CALA 3I7BA 1JSVA 3BBWA 5D41A 4LUEA 3UDBA 4EK4A 4C62A 2XRUA 4C4EA 2NO3A 5CU0A 2WXVA 3AD5A 4TYHB 4NJ3A 4RRVA 1OIUA 3DBDA 4GT4A 1ZXEA 2VO0A 5DI1A 1KE8A 3PPJA 3R7IA 4TWPA 2YEXA 3QUDA 4FVQA 2C1BA 1O6YA 3PSCA 2QR7A 3QTSA 4GUBA 5AM7A 5EW3A 1J7LA 3H3CA 1DI9A 3HKOA 4YJPA 3DXQA 2BR1A 3FXZA 1PXNA 2QLUA 3C9WA 2Z8CA 4IWQA 3OXZA 2UZLA 3GCQA 2W4KA 1PXLA 4FZAB 1OPJA 3NR9A 3WYYA 4A9YA 2PYWA 4I0SA 1GOLA 2AC3A 3L1SA 4QMPA 4D5KA 3COKA 4FL3A 2CCHA 3K2LA 2Z7SA 4MXYA 4F65A 1OI9A 3RM7A 5BVDA 3VF9A 2J6MA 1H0VA 2Q0BA 4WNOA 3UIMA 4AOTA 2KULA 3QRKA 4O0VA 3M42A 2ZMDA 2ERKA 2V7OA 3CY3A 3O2MA 2UW7A 4D9TA 3GU6A 1OITA 4CSVA 3NCGA 4AOJA 4BY9E 4C3FA 4FV3A 3NS9A 4LOQA 1H1RA 4AAAA 5JRQA 4H05A 4ASZA 4G6LA 2A27A 5EM7A 1LUFA 3H0YA 3JY0A 3SXFA 2JLDA 4LQMA 2ZJWA 2UZBA 4I4EA 3ORKA 5CAOA 4HGTA 2WTKB 2E9OA 5BVOA 5AJQA 4C3PA 5C8MA 3PLAE 1KWPA 5IQCA 5LVNA 4KNBA 3K3IA 4LV8A 2VTMA 4WBBB 5ANJA 5FEQA 5IA1A 1JSUA 4YC8A 4O38A 5J7BA 5BPYA 4OBPA 3LFSA 5DFPA 4XYFA 2O2UA 4AN3A 4D2VA 3DKGA 4TL0A 3SLSA 1Q61A 4CFFA 2VTIA 5JGAA 2XK4A 2Z7RA 3Q60A 4H39A 3ROCA 4BVUA 5AX3A 4C34A 4I0TA 2EU9A 3RHXA 4KD1A 4XRJA 4DH1A 4L45A 2UZUE 4PDPA 5IDNA 3LMGA 4RJ5A 3O71A 4MXAA 3Q96A 2BRMA 5AP1A 5FGKA 3LLTA 2P3GX 3QWJA 1LEWA 2J0KA 3F61A 3MVHA 3E63A 2XIRA 2PMNX 3CJFA 4NSTA 4PMTA 5L3AA 1UNGA 3QALE 4DITA 5A9UA 1XH5A 2BALA 3CS9A 4Z9LA 2BKZA 1OUKA 3R7UA 4D5HA 3Q9XA 5BUJA 4QMTA 1CM8A 4FV5A 3QCQA 2UUEA 3BI6A 3F2NA 5IH6A 2E9UA 1QPCA 1K2PA 3LFCA 4TT7A 4XP3A 4CLJA 3NVKI 1BMKA 3H4JA 1JKTA 2HELA 1ZAOA 2YM6A 5ACKA 4KIPA 3LMIA 2C4GA 1BYGA 3PIYA 4AN9A 1E9HA 4RVMA 3GXLA 2G2HA 3VBXA 1UNLA 3GCSA 2GNFA 4DE4A 2Z60A 4ITJA 3C5UA 2UZVA 4Z16A 1A06A 2YACA 1Y91A 5F95A 3IO7A 1OKWA 2PUIA 1T46A 3UTOA 3E7VA 4RJ6A 2PSQA 3C4CA 4QOXA 3FL4A 3ODYX 5CF8A 5F94A 4YR8A 3L9MA 4CGAA 4I5MA 3EQPA 4LL5A 2QKRA 3COHA 5JFSA 2CKEA 2IN6A 3KCKA 1YWVA 5FD2A 2FSMX 1OL7A 3MSSA 4FC0A 3R9DA 4Q2AA 4ZP5A 3CD3A 3OCGA 5AIRA 3IW5A 2VWUA 3DK3A 4UMPA 3N4UA 3NIZA 4D9UA 4WG3A 4EOOA 4HNIA 3DTWA 4U5JA 4MWIA 3TZ8A 2OH4A 5I9XA 4XV3A 2PVNA 4ZSLA 3AMBA 4MX9A 4YURA 1YXVA 5AP3A 3VUHA 1MUOA 4JQEA 2Y6MA 3V5QA 4OBQA 5IUGA 4IAKA 4ZSEA 4BHNA 2XIZA 1CTPE 4EOSA 4EOQA 1XH9A 2ZV8A 3UMXA 4IB1A 4ASXA 3RAKA 4JDHA 4C4JA 3V5PA 4EOIA 3KXMA 4CV8A 4EOKA 2VTNA 5EYMA 1KE7A 4EWQA 4QP2A 4GK3A 5HX8A 1OIRA 4O86A 5AR8A 3PA3A 1PRYA 3PZHA 3U4WA 3COMA 3IDPA 5AP7A 4EHZA 4TYJA 5LQFA 3FXXA 5GJFA 2REIA 3TEIA 3EQFA 1NT2A 4FZFB 4EUUA 5JZNA 3B2WA 3K5VA 4V0GA 2QODA 3A7FA 3O51A 1YOMA 4C38A 2BDFA 3E8NA 4BYJA 5IG1A 1IASA 4E7WA 5HOAA 2BRGA 3LJ2A 3F5PA 4GS6A 4MWHA 5AV4A 3EFJA 4J96A 4NT4A 3FZOA 1REKA 1M17A 3R6XA 3QD4A 2JD5A 4BCIA 4C02A 4EQCA 5CASA 2X2MA 4OT5A 5M53A 3RJCA 4RWLA 2UW4A 3OCSA 4FKTA 5HTCA 4IDTA 3JUHA 4ASEA 2PVMA 2C6MA 3HV3A 5CAVA 3PWYA 4HCVA 4PMMA 4U42A 4CKJA 2DYLA 3EL7A 2EVAA 3PRIA 4N4SA 4RC3A 3RALA 4CZTA 5CU3A 4EC9A 2CNVA 2C3JA 3PIZA 2B52A 2WB8A 3WZKA 5E4HA 3BZ3A 3HLLA 4RLKA 1KSWA 4YTFA 5K4IA 4QQTA 5L2SA 2R3OA 2WQBA 3CR0A 2QO2A 3HDMA 5F20A 3BIZA 4UALA 2WMWA 2UW9A 2E2BA 5ETIA 2FVDA 3ZBXA 4WBOA 4E20A 4JT3A 2XH5A 3Q4TA 4AU8A 2XM8A 1IAJA 4JS8A 4M15A 3FE3A 4F9YA 2W96B 2PVHA 3DFCB 3FC2A 4XG2A 2F2UA 2YDKA 3GT8A 3TTIA 4C58A 4F1OA 4U81A 3C4ZA 1XH7A 4YO6A 3POZA 5FXRA 5FQDC 4XG3A 2IPXA 4MF0A 2WTWA 4PWNA 5CSPA 2QCSA 3HMNA 1YDRE 3E64A 1GZOA 4D28A 3MY5A 3QXOA 4DFBA 2GPHA 1IG1A 4QMXA 4FTMA 1U5QA 5F1ZA 5HO6A 4FTUA 4V0GB 1Q8YA 3QLGA 1Q99A 4UMQA 3VBYA 2QOQA 5AUZA 5HBHA 4FSWA 4MXZA 1H0WA 2JDSA 4E73A 2JBPA 3D14A 2UVYA 3HV6A 3NDMA 4O0TA 3FLQA 5GHVA 1XBAA 4PDSA 1ZYJA 4C33A 1G3NA 3I1AA 1O9UA 4I92A 4UY9A 2GQGA 2F2CB 3CQWA 4JIAA 1BI7A 3F3UA 3VS5A 4GT5A 4K33A 4RIYA 3VO3A 4RWJA 2H8HA 3KC3A 3D5VA 4ZTHA 4DEGA 4BF2A 4QTDA 5LVLA 2YITA 5JQ8A 4USEA 4ZZNA 2C5XA 1WFCA 4QP3A 5K5NA 5HG8A 5BYYA 5GINE 1FVTA 3DQWA 4M3QA 5CX9A 1LP4A 3NNVA 5AP0A 3M11A 4Y5HA 2C30A 4B6LA 4YMJA 3QZFA 4Q9SA 5B2KA 2HW7A 4XJ0A 4JBOA 1YXSA 4O7SA 4ARKA 3ZU7A 3POOA 2XKFA 5HIDA 4G9RA 4UZHA 3HV7A 3ERKA 5AM6A 3UVQA 2ITZA 2J50A 5BNJA 3Q32A 4ZJVA 4YZMA 4YGAA 3HMMA 3RPRA 4BI2A 1JQHA 5G1XA 3V5LA 2FSOX 3QTZA 2QG7A 3S0OA 3RZFA 3G9NA 5LJJA 3EQHA 4FSRA 4X3JA 4IBMA 5AP4A 4DLJA 4P5ZA 3TZ9A 4IX4A 2Y0AA 5BUIA 3HAVA 4QMVA 3A61A 3D9VA 4GFGA 2I40A 4O22A 3SX9A 2JDVA 2FGIA 4EWHA 4Y5QA 4ALWA 2YDIA 4LI5A 5KHWA 4FTJA 2WHBA 3COIA 5LWNA 4FL1A 5LXMA 1MQ4A 4BTJA 1F0QA 4HVIA 3MV5A 3ALOA 4FL2A 4M8TA 1WBSA 3IW6A 4XBUA 1OL1A 2J0IA 4O91A 4QMMA 5E8TA 4B0GA 5CAUA 3CP9A 4XCUA 5J9LA 3FKLA 3DDQA 3BBTB 1OBGA 5IZFA 4ZXTA 1CKPA 3HRFA 5EHOA 3V5WA 5HHWA 3GNIB 3MTLA 2CGVA 3H9RA 3QKMA 3OWPA 3EJ1A 3TN8A 4Y72A 3O96A 4I5HA 4F7JA 5KMJA 4D2WA 2X7FA 4GIHA 4JXFA 5L4QA 4DCAA 2ZM3A 4J53A 2WMQA 4IMYA 5LVMA 5IQBA 4TYEA 3AC4A 4C37A 4L53A 2YISA 2WMXA 3CPBA 2OXXA 4P5QA 4FUXA 4O0XA 3PE1A 5M56A 2XK9A 4YO4A 5A4TA 3HUBA 1P4OA 2YFXA 5FBNC 2R3HA 4O1PA 4ANNA 4FR4A 1WBOA 4PL3A 3U6HA 3ZRKA 3BX5A 4ZTRA 1XH8A 2WD1A 4UXLA 3JY9A 3DK7A 4IZ7A 3HAMA 3BU3A 4YU2A 3NLBA 1YXTA 5AR4A 2PPQA 4FKSA 3VUMA 4DEIA 2PK9A 4O2ZA 4G6NA 2QOKA 3GFEA 1XR1A 2W9FB 4LMNA 4WNPA 4W9XA 2P2IA 3WZDA 3K54A 2HZIA 3AC5A 4C2VA 4X7QA 4FT3A 3ORNA 4WG5A 1H01A 4F08A 5CEIA 3FLYA 4IIRA 4F4PA 1T45A 3GEQA 1YVJA 3LJ1A 3EZVA 5E92A 4LYNA 1QPDA 4OW8A 1NA7A 3R1NA 5DBXA 1G8AA 3OY3A 4ZS4A 2B1PA 3G15A 4FTAA 3UG1A 5J7HA 2GTNA 2OXDA 4CT2A 4BDCA 1H1SA 1V0PA 4ENYA 2A4LA 2OU7A 4ERWA 1YHVA 4ZIMA 2XNNA 4OR5A 2RKUA 3QBNA 5I3OA 2HIWA 3BYOA 3E88A 3C7QA 4NKAA 3BGQA 4JAIA 1OKVA 3N51A 4PPBA 3HP5A 4BBFA 4BDAA 4YLLA 3I5ZA 3FDNA 3PJCA 2YJRA 4J1RA 4GMYA 4PY1A 1OL2A 4FKLA 1SVEA 3HA6A 3QYZA 4KKHA 4MTAA 2WTIA 2JKKA 4I5CA 4PTCA 5FEEA 4R7HA 4A9RA 2WU7A 3ZTXA 3SC1A 3EB0A 3UOLA 3OOMA 3N4VA 3D83A 5J95A 3MFRA 2QU6A 4J52A 3R04A 4A4LA 2VX3A 4UWYA 4OT6A 4KAOA 4L44A 5AR3A 3MJ1A 3ENMA 3UOHA 2X9EA 3KL8A 4H3PA 4FIGA 4FNXA 4TWCA 2C3KA 1Z9XA 2VTHA 2X6DA 2XVDA 3EFKA 3I81A 1ERKA 3QZGA 4N6ZA 3ZC6A 4EH4A 4X2GA 4B8MA 4NCTC 2OIBA 4RA5A 4LV5A 4QMSA 2OICA 5K0XA 2DUVA 2OF4A 4D2PA 2O63A 4EL9A 4B4LA 4FT9A 2CN5A 3GCUA 5IUIA 1SMHA 4FV9A 4N6YA 4FEWA 1ZY5A 3ODZX 5AAFA 1OUYA 2HK5A 4IAZA 2V22A 3NPCA 4NTSA 4YZCA 3LZBA 2WOTA 3DJ6A 5EOLA 2AUHA 3HV4A 3ACJA 3OXTA 4K18A 5HE2A 5ICPA 5L8LA 4EH5A 3VHEA 1HOWA 3HUCA 4NM3A 5E8WA 5EQEA 2CPKE 4QP6A 2CDZA 3VQHA 1VR2A 1RE8A 1Z57A 5AV2A 3UP2A 4XG9A 1OIQA 4FYNA 5CF5A 3KK8A 5KKRB 4I5PA 3U4UA 3DB8A 4WRGA 3VVHA 3UJGA 3EN7A 5CEOA 1PJKA 3HV5A 1TKIA 3P7BA 3E62A 4EK8A 3R00A 3V8WA 4IEBA 2W05A 3LXKA 4BWXA 3P78A 3S3IA 1WBTA 5FG8A 4FNWA 2P2HA 4FV6A 5EI2A 5AX9A 4EH9A 1B6CB 5GNKA 5CU6A 4II5A 1PY5A 1TQMA 1FMOE 1XH6A 1W8CA 3U9NA 3ZUTA 3MS9A 4AZFA 4F9CA 3VJOA 4B7TA 2ETRA 4MH7A 5EI6A 3EQDA 5AUWA 1YI3A 4Y95A 4WSQA 3KVWA 2VWXA 4G17A 4I41A 4U0IA 4WA9A 4XG4A 4CD0A 5B7VA 1Q8TA 4BN1A 3LFFA 3BHYA 3DPKA 2XKEA 3QL8A 3S1HA 2LGCA 4NKSA 5AUVA 5BVEA 4EYJA 3KXGA 1CMKE 2XNOA 3S95A 2W5AA 1JKLA 1M7NA 5KZIA 2YJSA 2CKOA 3BV3A 2VWVA 4BDBA 4LGHA 4PF4A 3F3WA 3CE3A 3L8XA 1VYZA 5GJDA 3FQSA 2XJ2A 4BTKA 1JLUE 3V04A 4DLIA 3UIUA 4LRMA 3F3ZA 4FIIA 4WRSA 3TDWA 5DHJA 4I23A 5CT0A 2F57A 2QOOA 3EOCA 4MNEA 5DR6A 4NFNA 4EH6A 1OKYA 4P2KA 3UNZA 4BGQA 4BDKA 1SYKA 1ZYCA 2QI8A 4NCTA 4QQCA 5KMNA 4AZTA 3SVVA 3FHRA 3DY7A 2QOFA 1FPUA 3BU5A 1ZOHA 4NM7A 3AMYA 1J1CA 1LPUA 4NWMA 5FBOA 4EZ7A 2WEVA 3UYSA 2J51A 2IVVA 4U9AA 2GNGA 5FTGA 4TNBA 3BEGA 5M06A 1O6KA 4YSJA 2YIYA 1EH4A 4HCUA 1FVRA 4MXCA 5DT4A 3UC3A 3NMUF 3KGAA 4O1OA 2VGPA 4PL5A 3G90X 3Q4ZA 2RSVA 4CQGA 4IM2A 1ZOGA 2O8YA 3C13A 3C4EA 3MJ2A 2GS2A 3HYHA 5B0XA 5TF9A 1GIIA 2XIYA 4WOVA 3OUNB 3SDJA 3UC4A 4IC8A 4ZY4A 2P4IA 1PXPA 1KE6A 1BI8A 3P0MA 3RAWA 3DJ7A 3Q5IA 4TYIA 1BL6A 4AGCA 2YDJA 4HYHA 3DKCA 3MVMA 3QC9A 5IQDA 3BLRA 3QQGA 3QLFA 3EN6A 1W0XC 3DLSA 3TM0A 3KK9A 4M13A 4EHVA 1J3HA 3OUKA 2C3IB 3NSZA 3KN5A 3ZO3A 4Y85A 2RFDA 4TXCA 3MWUA 4EORA 2HY81 3PG1A 4MNEB 2ERZE 3SG8A 3MI9A 1S9JA 1XQZA 4ZAUA 4RG0A 5H9BA 2RF9A 3FMJA 3QX4A 3JR1A 3ZSHA 3R8MA 3R7YA 4X3FC 3EN4A 4G31A 1UU8A 4IB5A 2YABA 5I9ZA 2Y9QA 3RINA 3BQCA 3D5XA 1YQJA 3QX2A 3NUPA 3HGKA 3VRYA 3BHUA 4MCVA 4EI4A 4V01A 3HA8A 2R3MA 4ZMEA 2PVYA 3MH3A 3LXLA 1GY3A 2JBOA 2RFNA 3ORIA 1FGIA 1VZOA 1YI6A 3DLZA 4WKQA 3WZUA 4BWPA 3BHVA 3G6GA 4FGRA 5EW8A 4YTHA 2IW9A 2YM7A 3WARA 2QNJA 4FOCA 2I6LA 4K8AA 3GOPA 4WHZA 3D2KA 4GT3A 5HGIA 5AEPA 3G9LX 5HD7A 5JFWA 2VTJA 2C0TA 4L8MA 4JRVA 2XIKA 3RCDA 2WEIA 3TKUA 5HI2A 2UW6A 4Y83A 2QVSE 1UVRA 3CD8A 4FZ7A 4XV9A 3MN3A 2F7ZE 3CCNA 3QD2B 3TJDA 2YIWA 4BCNA 4UMRA 3O23A 2BRBA 1DI8A 3MH1A 3FMHA 4IAFA 4IW0A 4MD9E 2IJMA 2HZ4A 4DEHA 3IONA 2OH0E 2R3GA 4IE9A 4JVGA 4YC6A 2C69A 3ROYA 3UZTA 3LCKA 2OJFE 3AD4A 3NAYA 4AA5A 3EQRA 3ZLYA 2UVXA 1CKJA 3RWQA 3C50A 4YLKA 1PKDA 1PXMA 5G6VA 3KMMA 2YM3A 4XLIA 5C03A 5B2MA 3LCSA 3NCZA 1MRVA 2PE2A 2VRXA 3LFBA 4K2RA 2ZB1A 4A9SA 1F5QA 3B8QA 3QGYA 3DNDA 3L8SA 3ZUVA 2GQSA 1Y6AA 2J0LA 3MBLA 4L01A 4AUAA 5CSXA 3QFVA 4TW9A 1ZMUA 4NIFB 4FEVA 4WNMA 5CVFA 3FZ1A 4DFUA 4G3GA 4BCKA 3F3VA 4KBCA 3R63A 1OVEA 3QZIA 4BYIA 3FXWA 5L2WA 4BBEA 2BKKA 3R83A 5FM2A 3W18A 4ANSA 4J8MA 3KXZA 3DKFA 4UB7A 4YJSA 3TNWA 4EK3A 3SGCA 3MFUA 4G2FA 2A2AA 1B39A 4RBLA 4ZOGA 3FQEA 4BGHA 4I24A 2JC6A 4J7BA 3A7HA 4HW7A 4U41A 2VTPA 3HMPA 3UMWA 2WQNA 1YDSE 2R0UA 3QQHA 1Q4LA 4YJQA 4YPSA 5AR2A 2CLQA 3QTRA 2ZVAA 3R1YA 4FGBA 3ORXA 2A0CX 2XZSA 3Q9YA 5JT2A 5CS6A 4A06A 3HMIA 3IDBA 1OIYA 2GCDA 2XUUA 3I0QA 3MYGA 3PG3A 4L46A 3LFAA 4FT0A 5HU3A 4CFNA 2WTDA 2YZLA 4YBKA 4ZJJA 1SVHA 2BPMA 4QYFA 1SNXA 3D7TB 3MY1A 4ZJIA 3BELA 4EOMA 2ONLC 1XH4A 4QMYA 4X21A 1ATPE 4FNYA 2W1ZA 4KIOA 4AN2A 4X3FA 2BILB 1XWSA 3CY2A 4UZDA 5IQHA 2R2PA 4UEUA 2PVKA 5ETCA 2ZM4A 4BI1A 2WMSA 4FSZA 5KE0A 3GB2A 1W7HA 4FV8A 2BTSA 3DDPA 5BYLA 1X8BA 4FV4A 3H30A 2V55A 1IA8A 3WF9A 1QMZA 1Y8YA 2YCQA 4I20A 4IZAA 5CXHA 4PP9A 1M52A
chains in the Genus database with same CATH superfamily
5LMKC 4QMNA 4HCTA 5IEVA 4Z55A 3EMGA 4JX3A 2IZTA 2X7GA 4OTPA 4BCGA 4GKHA 1W98A 2UW3A 2ZB0A 3QZHA 1UWHA 3C1XA 1KV1A 2R3JA 5HICA 2QOLA 3UBDA 4TNDA 4PX6A 3F7WA 1F3MC 3EFLA 2A19B 3PDTA 3VUTA 4FBXA 3VS4A 2GU8A 3N9XA 5GJGA 3IOKA 4QP7A 2XK6A 4RQKA 1FMKA 4L6QA 4JBVA 5CF4A 3ELJA 3EYGA 2ETKA 4IM0A 4UN0C 5KMIA 4EJ7A 2OKRA 4CZUA 2PUPA 4NK9A 3C0HA 4A9UA 3QTXA 3V5JA 4TWOA 2CCIA 3E3BX 2I0VA 2YN8A 2JDRA 5CENA 4D1XA 2CHLA 5ETFA 4E5BA 5EQYA 4KRCA 3WI6A 3ZH8A 2P55A 2CKQA 3O0GA 3FHIA 2YIQA 3R73A 3D15A 2OGVA 1OPKA 5L6WL 4QMUA 5JFVA 4CFVA 1S9IA 4NU1A 2QC6A 4EK6A 4J98A 3VIDA 4XNEA 3REPA 2F49A 2UZOA 4FKVA 2AYPA 5AV1A 3VUDA 5IDPA 4KRDA 4RZWA 1PHKA 1ZZLA 4FVPA 4KS8A 3W2RA 4YHFA 1GZ8A 5IH5A 2XARA 4BDEA 5HLNA 4RA4A 2PMLX 4CRSA 3QU0A 1V1KA 2XA4A 4J99A 1ZMWA 5IKWA 4EH2A 3NYVA 4MD8E 2PMIA 5L6OA 2YM5A 4TRLA 4AOIA 5KCVA 1J91A 1G8SA 3JS2A 4WUAA 4DEBA 5GIPE 5DR2A 2BHEA 3G6HA 5IA2A 3DAJA 4RWKA 3ZSGA 3KMUA 2PVLA 1KV2A 1ZMVA 1ZYDA 3DU8A 3PUPA 1AQ1A 5M08A 2QU5A 3PTGA 3QRUA 2UV2A 3JYAA 3OZ6A 4IVDA 3VBWA 4BDFA 1J7IA 3IS5A 4LMUA 1JNKA 4V05A 5DLSA 4BDHA 3LKMA 5BYZA 2P0CA 5H2UA 3VRZA 3ZEWA 5CAQA 4BGGA 3TUCA 1W82A 2UW8A 3KCFA 4U97A 4MBLA 3EN5A 3SA0A 3D0EA 2C1AA 3VS3A 4UMTA 2ZV7A 3BYSA 3GUBA 4QPAA 4CFWA 3ZC5A 4EKKA 5EKOA 2IW8A 4N57A 2R3RA 4ANOA 1ST0A 2BVAA 2C5OA 3KRRA 4YSMA 2C5YA 1FBNA 1PYEA 2GNJA 1L8TA 3AC2A 4HYUA 2VD5A 1YHSA 4TWNA 5AP2A 3TNPC 3KFAA 4AT5A 5JQ5A 4FSYA 4NFMA 4W8EA 1UU9A 5H3QA 5AA9A 4CFXA 2X0QA 3PIXA 1KE5A 1UKHA 3FZTA 3TTJA 4ZSGA 3DOGA 5M55A 4R3CA 3TYKA 2R7BA 3P23A 4IAYA 5J8IA 4ALVA 4E26A 5DRBA 1U59A 3SKCA 3KRXA 2GFSA 2R3QA 2VO3A 3CXWA 3DV3A 3QF9A 4KSQA 4OAVB 4EK5A 3LCOA 4J8NA 3QD0A 3SW4A 2VNWA 3VUGA 4EH3A 4G1WA 4AACA 5C26A 1H28A 1URCA 3NEWA 3QUPA 2OIQA 2C6KA 4E6AA 3EFWA 1H1PA 3ULZA 4O81A 5HNIX 4FV0A 4IACA 1XJDA 3DZOA 3FKOA 4JBQA 3ORTA 1R0EA 2GTMA 2ZV9A 3PLSA 4UWCA 4AZWA 4D4VA 4YJTA 4YNEA 4RX7A 1K3AA 3R22A 2IZSA 3IGOA 5CSWA 3S2PA 3WF7A 5IQIA 4QTCA 5J5TA 4FV1A 4B8LA 3RWPA 3ZO4A 4FODA 4IHPA 3DNEA 2GNLA 3QA0A 4KIQA 4YUQA 2XMYA 4J97A 3V8TA 2BIYA 4BTMA 4RC4A 1WBVA 1SNUA 4MF1A 3KRJA 2EXEA 5CXZA 3R8LA 4N0SA 5DN3A 5GZ8A 1ZY4A 1ZZ2A 5AR5A 4CLIA 4GU9A 3GU4A 3DA6A 5CLPA 4DH7A 2W5BA 3FZPA 4D1SA 4D55A 5FDPA 1OBDA 5D9HA 4IZYA 3MB6A 4JBPA 2B0QA 3TI1A 5CZHA 1YI4A 1XKKA 2YA9A 4YJVA 2WMVA 3RNYA 3KF4A 4CTCA 1PYXA 3FUPA 4IX6A 5L8JA 2W0JA 2UZDA 4DH3A 2G01A 4FT7A 4EH8A 1XO2B 3BWFA 3TUBA 4XHKB 3FMDA 2YLEA 2CNUA 3TKHA 3C4WA 2R5TA 3OTVA 2VTQA 4XLVA 4AGWA 4CT1A 3FMEA 3QCXA 5CNNA 4TKSA 5IA5A 3QHWA 4WG4A 3LAUA 4M67A 5JGDA 4AZSA 2VTLA 5J87A 1OL6A 3AGLA 3NNWA 4S2ZA 4RJ7A 3A8XA 3QKLA 1YRPA 4DH8A 2XAOA 2EUFB 2W17A 4A9TA 4E3CA 3H10A 4CNHA 4O0SA 3Q9WA 5H8GA 2J2IB 2XNBA 4Z3VA 3P5JC 5BVFA 2R3KA 4PRJA 2XJ0A 5HVYA 4BBMA 4OBOA 3QQUA 3RGFA 2B9HA 3CTJA 3CGFA 5CQUA 1QPJA 2C5VA 3VJNA 3FAAA 3Q53A 3HVCA 1Y57A 2W1EA 5IISA 2VO6A 3ORPA 5CT7A 3JPVA 3OT8A 4QPSA 5IEYA 4LGGA 4JAJA 1GZKA 2ITYA 3PYYA 4CQEA 3FWQA 4M12A 3PZEA 4ZEGA 2O5KA 3ZFMA 1GZNA 4AFJA 1JPAA 1MRYA 1U4DA 2CGWA 3PFQA 1GAGA 3V6RA 1VEBA 3UGCA 5CU2A 3H0ZA 2PU8A 4C4GA 4M69A 3ZEPA 3KA0A 4AGDA 3EKNA 2FB8A 3BV2A 4O2PA 4DTKA 2ZDTA 2HCKA 3ZLXA 4TTHB 4AZVA 4UX9A 3FYJX 2WQMA 4GH2A 4O0UA 1R1WA 2R9SA 3BGZA 1FVVA 3WOWA 3RBWA 3T9IA 3ZXTA 5TKDA 4F6UA 4IFGA 3G2FA 1UNHA 3ZRMA 3LM5A 3HRCA 3IQ7A 3D5UA 5JGBA 4HGSA 4DGMA 5DMZA 3W0SA 3UIXA 1RQQA 2XNMA 2BDJA 4DGNA 3SD0A 1Q3WA 2BTRA 1JKSA 4IADA 3ALNA 3NWWA 3OFMA 1P5EA 4RIYB 4BKJA 4DAWA 2JFMA 2J5FA 2X4ZA 5D7VA 3U6IA 1R3CA 1L3RE 3L8PA 5LOHA 2WO6A 4FA2A 4FKQA 3G5DA 4RJ3A 3HDNA 3MPMA 5LARA 3R9OA 2J4ZA 3BYVA 3GCPA 3ZMMA 3A8WA 1FQ1B 1R78A 4IB3A 3VBVA 4QNAA 4YTCA 3SW7A 5AADA 1O6LA 5JRSA 3GENA 1IAHA 4Q5HA 4FKWA 3IKAA 4NTTA 4CVAA 4HNFA 3QTIA 4DINA 4R5SA 4W4WA 1NW1A 2BAJA 4PTGA 3I60A 4X0MA 4YJOA 5I5ZA 5KBQA 2W7XA 4R78A 1VJYA 2QD9A 3DBQA 4L3JA 4K6ZA 2C6LA 1YDTE 3E87A 3MFTA 4USDA 4ANBA 3NUUA 2XS0A 2VX1A 3R7OA 4PMPA 4JG8A 3OOGA 4R3PA 3MA6A 2OIDA 1JVPP 4FZDB 3OXIA 5AAGA 3O17A 3DJ5A 3SQQA 4RQVA 2QO7A 2CJMA 2HWPA 5EFQA 5CSVA 1WAKA 5DH3A 5EQPA 4IVCA 5DEWA 5HG9A 5J9YA 4DG0E 2BZJA 4HVHA 3NGAA 4NUSA 4MBJA 3V3VA 4EONA 3IECA 4W4YA 5CEPA 2YERA 2XRWA 3PRFA 1E1VA 1WCCA 2EB2A 3I79A 5EG3A 4A07A 4ZLYA 1PXIA 2O65A 2GHMA 2HYYA 5CEQA 3TKIA 2WPAA 3Q04A 4E4MA 5TO8A 1CDKA 4AW2A 4ACCA 3RZBA 4CEGA 3FSFA 3PFYA 4O84A 4YZDA 5A4EA 3MW1A 4ITHA 2NRUA 4M0ZA 5I4NA 3VULA 2ACXA 3TV6A 4GW8A 4IWPA 4QYYA 2EXCX 4PDOA 4OUCA 5EYDA 3Q2JA 3ANQA 4FKRA 4NZWB 4D4SA 5ANGA 4ZY6A 3KRLA 3LFNA 2WGJA 1R0PA 4FK6A 3QTUA 4OTDA 3E92A 4U40A 3SAYA 3K5UA 4FG7A 4RX5A 5JZJA 2Q83A 2V5QA 3VUKA 3PVWA 4ANLA 4ZLOA 1YW2A 3PWDA 3UZPA 4MEDA 3VUIA 2F4JA 4D0XA 2C6OA 3E93A 1V0BA 3OWKA 3DTCA 4IANA 3UPXA 2XANA 1BKXA 2PE1A 4F1MA 1M14A 4FX3A 4CYIA 3PY1A 2XIXA 4IWOA 4U80A 2VV9A 4UV0A 4BR3A 1TVOA 3QRIA 4DHIB 3OT3A 3OY1A 2XKCA 3HEGA 1PW2A 4RIOA 4UWBA 3W10A 1H25A 3O50A 4P4CA 1Q8WA 2ITOA 1M2RA 1ZOEA 3FJQE 2RL5A 3IGGA 2ITPA 5H8BA 1NVQA 1OECA 4FTLA 2IO6A 3BQRA 4BB4A 2R7IA 2YWVA 3K3JA 4MXXA 3NUAA 4KSPA 5EW9A 3AT3A 3ATSA 2GQRA 3DK6A 4FG9A 1PMUA 2OWBA 3OROA 3KY2A 4ZTNA 2SRCA 1J7UA 4D4YA 2Y4IC 3ZDIA 4BI0A 2R4BA 3HX4A 2X0PA 4XS2A 5HVJA 2C47A 2V7AA 3G33A 3DBEA 4EC8A 4EH7A 4Y8DA 4BDJA 2YM8A 3KU2A 5LVPA 2VWWA 2H6DA 2RIOA 5I9UA 1RW8A 3DB6A 3KMWA 4R1VA 3R71A 3BHHA 3W0NA 3VHKA 4DBNA 5EDQA 5HORA 4RWIA 4I21A 5D10A 1TQIA 2PZ5A 3CPCA 1B38A 3PVUA 3A7IA 3LOKA 1HCKA 4QQJA 3ULIA 4CRLA 2X7OA 2X9FA 2WTJA 5HESA 2VO7A 1G5SA 2C68A 5D1JA 4F9WA 2FSLX 4ACGA 4MD7E 3NW5A 2Y8OA 5LCKA 3LLAA 3UIBA 5AA8A 2B4SB 4AE9A 3W0MA 5CEKA 4HVDA 4ZSAA 2J7TA 5DE2A 5HD4A 4FTNA 4S31A 4QP9A 2BUJA 4FKOA 1WVXA 4H1JA 4FTCA 3RM6A 2YCSA 2XP2A 2W9ZB 3JXWA 4B9DA 5IA4A 5HE1A 3RI1A 2OJGA 1ZYSA 4YJNA 1WBPA 3KKVA 3QQFA 5FLFA 4KWPA 5HO8A 4QP8A 3R7VA 4GCJA 4L00A 2XYNA 4YP8A 4ACMA 3DKOA 3UQGA 5ANDA 3RKBA 1IEPA 4NEUA 5CZIA 3EQCA 3FBVA 2XJ1A 3PXYA 1DAWA 3O8TA 5JH6A 2R3PA 3R1SA 4GUEA 1W2CA 3OP5A 5JN2A 2UVZA 2OF2A 4RIXA 3UP7A 3TG1A 2W1CA 2X81A 2WQOA 2LAVA 2WMBA 3ZYAA 4TY1A 3KRWA 4FSUA 4GSBA 3GI3A 2ETMA 3NW6A 5IPJA 3SG9A 4K0YA 2CN8A 4G3EA 4R77A 1M7QA 3MIAA 3PP0A 3UO5A 2PY3A 5T6KA 4ALUA 2BAQA 5AUTA 3LCTA 3E7OA 3ZS5A 3DBFA 3R28A 2PVFA 2X0OA 2GHLA 4R6VA 1UKIA 1SM2A 1K9AA 4FK3A 5FWKK 3TL8A 3WILA 4HVSA 4RVTA 3LQ8A 1Q5KA 4RFYA 2ESMA 4FTOA 3F2RA 4D1ZA 4DTAA 1CKIA 3FI8A 5ACBC 2UW0A 4YZBA 2B9JA 4X2KA 5BVKA 3A7GA 2PE0A 1PKGA 3U87A 5J79A 2O0UA 3I4BA 2ZYBA 3I6WA 4QMWA 1XHAA 4XG7A 3UO6A 4ZLZA 1VYWA 5C9CA 4AE6A 4G34A 2BRHA 5DWRA 3B2TA 2J9MA 4YNOA 3PXZA 2Z7LA 3L9NA 4CYJA 2FA2A 4F0IA 4BC6A 2QOHA 4NJDA 3C51A 1WVYA 3OF0A 3AT4A 3QHRA 5CNOA 2QG5A 3F69A 5DYJA 3P08A 5GIOE 2RFEA 2H96A 5E8XA 4DFYA 2A98A 1BLXA 4XMOA 1ZRZA 2CSNA 3VC4A 5HZNA 5A46A 4JR7A 4EYMA 5EHYA 4F9BA 5C1QB 5L6PA 5HCZA 4JG7A 4O6EA 4I1ZA 3KN6A 4LV7A 1JAMA 3R7GA 2FYSA 2OFUA 3KVXA 3Q3BA 5EOBA 3RPVA 2DWBA 3WF5A 4YHJA 4PDYA 4OAUC 3ZCLA 3AQVA 4KBKA 5T3QA 4EBVA 5FTQA 1H07A 3E8CA 4RIXB 1H8FA 3MDYA 4RFMA 4RT7A 5C01A 3TXOA 2F9GA 3ZZEA 4HGEA 2WMAA 1YKRA 2VN9A 3W33A 5HKMA 3VS1A 5D11A 4K9YA 5HE0A 4NM0A 2PULA 3NFGB 3S4QA 3DFAA 3JVRA 3C0GA 4FTRA 4BHZA 4AXAA 4XH6A 5JFXA 5J1VA 4A4OA 4K11A 4D0WA 4AAYA 2HWOA 3AC8A 3QTWA 4O7WA 4C59A 2YHVA 3DQXA 3BLQA 4RX8A 2CLXA 4XRLA 4FSNA 4AW1A 2VAGA 2XK3A 2XK7A 5HCYA 3CTHA 2OZAA 3MVLA 1A9UA 5KMOA 5D7AA 2OW3A 4R8QA 3CC6A 3PVBA 4WIHA 2VZ6A 1H1QA 3CQUA 3F5GA 3WBLA 3NYXA 3P7AA 1KUTA 3BEAA 3OD6X 4JI9A 5DA3A 4E4NA 2W5HA 3F88A 3DCVA 3FSKA 4F99A 2IG7A 2G15A 2X8EA 3OCBA 3O7LD 4MXOA 5JMSA 4CCBA 3GCVA 4BIDA 4JQ8A 1NVRA 4MYGA 4IB0A 1MQBA 2R3NA 4PPCA 4PNIA 4BCFA 4E6CA 2X2LA 5AIKA 2BDWA 2YLFA 1P2AA 2WTVA 5IA0A 4D2TA 3Q6WA 2I0HA 1GNGA 2ITVA 5HLWA 2XNGA 4LOOA 3PY0A 3MH2A 2FSTX 5JSMA 4R3RA 3AMAA 4QT1A 4QD6A 5T68A 1LR4A 4QEBA 4ONAA 3OBGA 2XEYA 4G16A 1PXJA 3EZRA 4I93A 4QYHA 4TYHA 4NW6A 3GU5A 2X4FA 3V6SA 4CMUA 3Q4CA 4QTBA 3ZRLA 1AD5A 3PA4A 3QQKA 4O4DA 3W8LA 4O0RA 3AOXA 2BZHB 5BVWA 3EQBA 4LRKA 1QL6A 3IW4A 4BWKA 3PXQA 4ZMFA 3IK3A 3PA5A 4DFZE 1H00A 5I0BA 3LXNA 2GS7A 4QMZA 4NL0A 3L9LA 3QTQA 3ANRA 4AF3A 4AZEA 5F4NA 3FLNC 4DBXA 4M97A 2RG5A 4L9IA 3DAKA 2DQ7X 4LL0A 2WMRA 5E8VA 3ZO1A 2OZAB 3UZRA 4O82A 1J1BA 1P4FA 4H1MA 5CSHA 5HBEA 2A1AB 3E8DA 2I0EA 3RPSA 4CKIA 4Q9ZA 1Y6BA 4AT4A 3PJ8A 1TQPA 4O21A 4UXQA 2FH9A 5EK7A 4XP0A 2BHHA 4NM5A 4O96A 3RAIA 4KUJA 2DS1A 1RJBA 2OJ9A 5CQWA 3I6UA 2CKPA 4X6RA 3ZM9A 2HXQA 2VU3A 4DH5A 3FMMA 1XBBA 2YIRA 3VWAA 4DEDA 4HVGA 1GJOA 2B53A 4ANQA 2JDTA 4DGLC 5CWZA 4FEXA 1H24A 5IEXA 4XP2A 3VS6A 4FEUA 3LIJA 2QKWB 3C5IA 4NW5A 3W2CA 4CV9A 4U6RA 1GIJA 5ANOA 5CY3A 1JSTA 2BIKB 2FO0A 3O7LB 4AXEA 2KTYA 2OFVA 3QC4A 5EM8A 3NAXA 2QOCA 3FY0A 3ZZWA 3G0FA 1W2FA 2WQEA 3DBCA 3HL7A 3GVUA 3MTFA 3F2AA 4JQ7A 4RMZA 4XG6A 1WVWA 5F9EA 3UQFA 3MFSA 2H9VA 2HENA 2WNTA 2WTCA 2YWPA 3CJGA 4FIJA 4QMLA 4AS0A 4GYGA 3THBA 4RX9A 5TT7A 2VTSA 4IJPA 4CTBA 4WO5A 3LJ0A 4E4XA 4EQMA 4Z7HA 5JEBA 3MB7A 4WD5A 2PVJA 3DS6A 3FMLA 3ET7A 2P33A 2J0JA 3TIYA 5LVOA 5KMMA 5KNJA 3QAME 3OBJA 4UBAA 2ZMCA 5HIBA 4FOBA 1YOLA 2QOIA 2VTRA 3L9PA 3O8PA 3ORZA 5C4KA 4BL1A 2PUUA 4GEOA 4GU6A 4L3PA 4O7ZA 3TIZA 5CANA 3W0PA 1H27A 3R7EA 3LFQA 3VF8A 2RFSA 4O27B 3T3UA 4S32A 2IWIA 3BU6A 4PMSA 4YJUA 4BZDA 3LQ5A 2X8DA 4IH8A 4XBRA 3ETAA 4YHTA 4LG4A 4YPDA 4ZTLA 3SRVA 2X8IA 4PL4A 2XCHA 4JMQA 3KIOC 4DGOA 5EM5A 3LVPA 1DAYA 1WBWA 4DEEA 3V8SA 3QCSA 3U9CA 3GC0A 4W8DA 4BFMA 4IXPA 3BHTA 4E8AA 3NIEA 5E9EA 4KABA 3RK9A 4BCHA 2WMTA 4F70A 3F9NA 4TN6A 4HYSA 1FGKA 2I1MA 2WIHA 3U6JA 2C0OA 3AT2A 5FXQA 5BMMA 3UVRA 2Y7JA 4RPVA 1XMMA 2PL0A 3AXWA 3P7CA 2NRYA 3DGKA 4L43A 4BICA 5IU2A 5L8KA 4DF3A 4A4XA 4R7IA 4YBJA 4D2RA 3IG7A 5LMAA 3PPZA 5EYKA 3C4FA 2Y4PA 3OG7A 5ANIA 4C61A 4HOKA 2W06A 2UZWE 3CTQA 2UW5A 4EQUA 5HVKA 4M7IA 3CBLA 3EH9A 3AG9A 4G5PA 2VTAA 5IQAA 4FKIA 3OWLA 4ZSJA 1RDQE 3ML1A 1H08A 4QQ5A 4MQ1A 2W1HA 3BE2A 2NPQA 2W1FA 5HTBA 4F7SA 3D7ZA 1ZLTA 4M14A 1LEZA 4F9AA 4G3FA 5A14A 4E6QA 2BCJA 3ATTA 2HZNA 2W1DA 5A3XA 3Q52A 3ORLA 3R2BA 4X3FB 5KUPA 4AW0A 1YXUA 2G9XA 1ND4A 3VONA 4M0YA 4DC2A 3W0QA 2VX0A 4PUZA 3SRVB 3CQEA 2B7AA 2VGOA 2I0YA 3UE4A 4F6WA 4O7TA 4BCJA 4AG8A 4DA5A 3N4TA 3VNTA 4DEAA 4ORKA 4C4IA 5FUTA 2B55A 2C0IA 4APPA 4F6SA 2R0IA 2ZM1A 1BL7A 4IWDA 4E1ZA 2XNPA 1UV5A 2JAVA 3KXHA 1OPLA 5C4LA 3PPKA 2XM9A 1Q41A 3R8ZA 4GJ3A 4IAIA 4YZNA 4I6HA 3QD3A 2IVTA 4Z7GA 2GDOA 3VBTA 5DOSA 4FVRA 4FV2A 3TUDA 4YC3A 5M44A 5DT3A 3HMOA 3Q6UA 5AP6A 5IUHA 3V5TA 1OL5A 2ONLA 3ZBFA 2I7QA 4Q5EA 2JITA 2JKMA 2PUNA 2ITXA 4JLCA 3R0TA 4C0TA 2EXMA 3PXRA 4YJRA 3U54A 3W55A 3HP2A 4PQNA 1U46A 3ZM4A 1W84A 2F7XE 3BE9A 5B2LA 3CKWA 4G9CA 2XKDA 2XBJA 2C6IA 3UOKA 1WZYA 1YHWA 3L8VA 3OW4A 2OJIA 4RGJA 5I9YA 3GU8A 4QDVA 3TV7A 3TZMA 3LMHA 3RAHA 3BL9A 3OW3A 3QA8A 1WMKA 5LMKA 1MRUA 4F0FA 2G1TA 3TT0A 4GV1A 3DAEA 3ZSIA 4O6LA 5IQGA 2JKQA 2GMXA 2GS6A 2PMOX 5GZ9A 3FMNA 3P5KA 4HZRA 4E6DA 2XBAA 5KBRA 4RVKA 1NXKA 3NW7A 1OKZA 1Q24A 3FZRA 1Z5MA 4N70A 3ZLWA 3GP0A 4HZSA 3V51A 1UA2A 3NRMA 4FKPA 4C2WA 4DGGA 4O4EA 5AV0A 1YWNA 1Q8UA 2OBJA 4I3ZA 3T8OA 3U51A 3TJCA 3FYKX 2BFXA 2JKOA 3UO4A 3A4PA 4L67A 4AA4A 4FSTA 1SVGA 3FI2A 3FLWA 3Q4UA 3MA3A 4HGLA 4MNFA 3FEGA 5HO7A 5E1SA 4X2NA 2QHNA 3GBZA 3NUXA 4B99A 3QWKA 4XOZA 2JAMA 3ZXZA 5DG5A 3LCDA 5DPVA 3TCPA 5LMBA 2HOGA 4J71A 4GVAA 3FI3A 5E8UA 4OGRA 4WNKA 3OEFX 4BCPA 4JIKA 3UVPA 2XYUA 2W4OA 3TACA 4LRJA 3PP1A 2NNWB 3TZ7A 4CFUA 4I6BA 2PZPA 3QRTA 2OLCA 4EKLA 4QMOA 2JFLA 3ZLSA 2ZV2A 2BMCA 4HJOA 2JIUA 3W1FA 2VNYA 5CTPA 5ITAA 5KO1A 1QCFA 5DRDA 2X0GA 3T9TA 4ACHA 4BDDA 4BCQA 3W2PA 4BIBA 5M09A 3OMVA 5HX6A 3GC7A 2HZ0A 2VWIA 4LUDA 4P7EA 4U44A 4GL9A 3AC1A 3AC3A 3QQJA 4NH1A 4PP7A 4FV7A 2VTTA 4U43A 3KEXA 3RCJA 4JR3A 4EZ3A 4JL9A 1BX6A 3Q5ZA 3WZJA 2X6EA 4LOPA 4FUYA 1JBPE 3R9HA 3QRJA 2B54A 2WMUA 5HQ0A 5AWMA 5CYIA 2XB7A 4JDJA 3OWJA 4CCUA 1PXOA 3CEKA 4CFMA 5EKNA 4IQ6A 3BYMA 4NYEA 3NNUA 4I6QA 4GG5A 4OTGA 3NUNA 3CLYA 2HAKA 2PVRA 2WU6A 3LHJA 4RIWA 1NY3A 3BKBA 5AUXA 3HRBA 4DCEA 4I0RA 1CSNA 2Z02A 4OTQA 3HZTA 4JDIA 2YAKA 2HW6A 3I5NA 3MPTA 4BKYA 3BGPA 5M57A 3BL7A 3R9NA 4PV0A 2OXYA 4WT6A 4O4FA 4C8BA 3UDSA 1APME 5DGZA 1UWJA 1W83A 3NUYA 3DXPA 5DVRA 5L2IA 2ZAZA 1BUHA 4QRCA 4MBIA 4CMOA 5FDXA 5M4UA 1U54A 4FIHA 2IZRA 4J95A 4XV2A 2EWAA 3PJ3A 4EBWA 3EQIA 5HNBA 4IVAA 3Q9ZA 4W4XA 5EDRA 5IQFA 4H3QA 2WOUA 3UPZA 1DM2A 3I7CA 3FLSA 4D58A 4W4VA 2QQ7A 2YIXA 4GK2A 4AXFA 1YWRA 3F82A 3H9FA 3MGYA 4QP1A 4TPTA 3RPYA 4AW5A 3E8EA 3GGFA 3B8RA 3PXFA 4FSMA 4HYIA 4L7SA 4W9WA 5A4LA 2ITTA 3P86A 2WZJA 4C36A 2OSCA 3A60A 3P1AA 4X2JA 5BX0A 5A6NA 4RVLA 2ZFYA 3NUSA 3MVJA 4USFA 3EWHA 4U3YA 4C35A 2Q0NA 1MP8A 4BZNA 1UU7A 3VW8A 3FMKA 3ORMA 3MESA 3R2YA 4I6LA 4G3DA 2Z7QA 1R39A 1QPEA 4IVBA 4AQKA 5I3RA 2UZEA 5K5XA 2ITWA 3Q2MA 5HEZA 4FKJA 3LQ3A 4RIWB 4F09A 3D2IA 3RTPA 4FJVA 3NYOA 3ITZA 4L68A 5KKRC 3OCTA 5K4JA 4UMUA 2JEDA 3EHAA 3EQGA 4I6FA 5ANEA 5HIEA 4UYNA 3EKKA 1ZWSA 4IC7A 4P90A 1FINA 3IW8A 4CZYB 4F78A 1IRKA 2XF0A 3F3TA 4RC2A 5CVGA 5DR9A 2PZYA 3GC8A 2J0MB 5E7RA 5ETAA 5TOZA 1JWHA 1U54B 2UZTA 3FPMA 3C0IA 4QPMA 5HNGA 5EYCA 4DYMA 5TR6A 4DT9A 4GFOA 4GYIA 3A99A 3HNGA 4G5JA 3PSDA 5CI6A 5K3YA 2OK1A 3BWJA 5EI8A 4LM5A 3EIDA 3D94A 1A48A 4GIIA 4IM3A 2C6DA 4EEVA 2QURA 4LFIA 1M2QA 4AA0A 4O7VA 5JKGA 1GIHA 3FI4A 2ITUA 5H8EA 3RVGA 4ZTQA 1YXXA 3M1SA 2W4JA 4GG7A 3RK5A 4YZ9A 2CGXA 1OM1A 4FKGA 2E9PA 5E91A 4M69B 3RK7A 3G0EA 4RJ8A 5M4FA 4C4FA 4FI1A 1ZARA 5HCXA 5AV3A 4K77A 4R7BA 3A4OX 1H4LA 2GHGA 3RP9A 1ZYLA 5HG5A 3V01A 3LPBA 3F66A 4ID7A 2BROA 3PXKA 4GVJA 3GOKA 3VBQA 2QHMA 3VS7A 2YCFA 3E3PA 2IVSA 5C8KA 2BFYA 3W2QA 4ZTSA 4DTBA 3WZEA 4GKIA 4X6QC 2OI4X 3IOPA 4KINA 5EDPA 4L3LA 4O7NA 2PZRA 1SZMA 3H9OA 3QQLA 4K1BA 4QNYA 4AWIA 3E5AA 3M2WA 1XBCA 5DT0A 4E5WA 4TZRA 4AQCA 4DHJA 4R1YA 5HU3A 4FTTA 4MQ2A 2C3LA 4RFZA 4CMTA 2F7EE 2GFCA 5EHLA 1OGUA 4EZ5A 4U79A 4CXAA 4OTHA 4FIFA 4FMQA 5BUEA 2GNIA 3QYWA 4XOYA 1URWA 4DG3E 3FQHA 4YLJA 3OHTA 4U7ZA 3SXRA