3HV6A

Human p38 map kinase in complex with rl39
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
349
structure length
331
Chain Sequence
ERPTFYRQELNKTIWEVPERYQNLSPVGSSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Mitogen-activated protein kinase 14
publication title Displacement assay for the detection of stabilizers of inactive kinase conformations.
pubmed doi rcsb
source organism Homo sapiens
total genus 108
structure length 331
sequence length 349
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2009-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3hv6A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3hv6A01
2GHGA 3IW7A 1G8SA 4QMNA 2OFUA 4JDIA 5K9IA 3GC7A 1GNGA 1M2QA 3VO3A 4AOJA 3QQKA 3ZRMA 2C6OA 4PV0A 4F64A 5BQ0A 1GIIA 4QNYA 3AT2A 4MBJA 1REJA 1OKVA 3JY0A 3MTFA 2RSVA 3UIXA 3ZDUA 5I9WA 2IZTA 2NPQA 4KINA 4EH5A 4ZAUA 2YIWA 3E88A 3FHRA 2YAAA 3ZFXA 1O6YA 5IQBA 4AACA 3HKOA 4BHZA 2KTYA 2I40A 4PY1A 4IX5A 3C0IA 4EC8A 4BCHA 2F57A 1X8BA 4QP1A 1KE8A 3PSCA 4FKTA 4YZNA 3BWFA 1M14A 2QCSA 3D4QA 2OF4A 5CAPA 4Q5EA 3SXSA 1YHWA 4LQMA 1VYZA 2IVVA 3CY2A 3WZKA 1FBNA 4NM5A 4U79A 5AR3A 5F4NA 4ITJA 3K3IA 4CMTA 2VTQA 4FL1A 2VTMA 4QYEA 5E8YA 5B7VA 3CKWA 2OGVA 4G6LA 4U0IA 2LGCA 3LIJA 5AP6A 5M55A 1Q8TA 4ASZA 5E8ZA 5KMKA 2OZAB 4O0RA 5HBHA 5C01A 4USEA 4IADA 4BWPA 3MJ1A 4FZAB 4UBAA 4AOIA 3V04A 3CTQA 4QNAA 3DAKA 3QCSA 4FNZA 2R3OA 4PWNA 3RMFA 5AFVA 3BYSA 3FY2A 3PPJA 1ZYJA 4F9AA 2I1MA 3GCVA 4TY1A 3RK5A 2XH5A 2HAKA 3P9JA 1NW1A 4FE2A 2R3PA 4BC6A 4FV6A 4C0TA 4H3QA 4CQGA 4RFZA 4PTCA 3R7VA 4CV8A 3S00A 4K8AA 4D4VA 3S0OA 1Y8GA 4FTLA 3NNUA 5C8KA 4FA2A 2W05A 2UZEA 3ZZWA 2QHMA 1Q62A 4ANSA 4XUFA 5IQEA 3U9NA 3MESA 5EOLA 4F1TA 5LMKA 4QMPA 4APPA 4KBCA 5JRQA 3PIYA 3ODZX 4YLKA 3NDMA 1MRUA 1V0BA 3NCZA 4W4VA 1JWHA 2XNGA 3CC6A 4UMTA 3SOCA 3HL7A 3S4QA 4MWHA 2B53A 3W32A 4U42A 2G01A 4P2KA 2GNJA 3M2WA 3MVMA 4ALUA 5KKRC 3MPAA 4RT7A 3OWLA 4WNMA 3QRKA 5GZ9A 4K18A 4YLJA 3LCKA 4AGDA 3MSSA 3ZU7A 3FMJA 1K3AA 3F69A 4IFGA 4L52A 5ETFA 2ITPA 4XG3A 4WSQA 3QRTA 2OBJA 4OT6A 2PK9A 3OHTA 1YXVA 1PMNA 1OIRA 5DRBA 2OF2A 3HV5A 3JUHA 3UQGA 4E5BA 4O7TA 2ZV2A 3GC9A 2XNMA 4EONA 2VTTA 3I60A 3MA3A 4ZOGA 4BI2A 3QZGA 4G16A 3G5DA 5HD4A 3GC0A 5IMXA 3DFCB 4ZMEA 4JQEA 3GB2A 4TYHA 4UYNA 4IIRA 1E1XA 4EJNA 3TJDA 2BIKB 3R8VA 1HOWA 2BZJA 4OTIA 5IF1A 3QBNA 2C6TA 3KK9A 3LHJA 4CCBA 3OCSA 2YN8A 4DITA 2GTNA 3EQDA 4QTCA 3BBWA 2I7QA 4CKRA 3IPHA 3PY0A 3KQ7A 2OO8X 4D4SA 3CPCA 2VNYA 3FL4A 3DTCA 4FZFB 4GIIA 5DLSA 3E8CA 4MQ2A 4EWQA 2X6EA 5M09A 1H1RA 4U6RA 3PLSA 5E8VA 3SRVA 4ZJVA 1YKRA 2C0TA 3PFQA 5IUHA 4NUSA 2VWZA 4C2WA 1XH9A 5LCJA 3GT8A 3FMNA 1UNGA 2YCFA 2PE1A 1KV1A 1U4DA 4Q9SA 4Y46A 5CU2A 3W1FA 5HO7A 1H28A 2WU6A 1Q97A 4DBNA 4CLJA 2PVLA 3QGYA 5EYKA 3I79A 3HUCA 4PMPA 4O2PA 4USFA 4R3CA 3PXZA 3U9CA 3C4CA 5BVNA 5CEMA 3LCOA 5BYZA 3OCGA 2HWOA 2O5KA 4AW0A 4EEVA 3F82A 4YZ9A 5TT7A 4FEQA 4KUJA 3GP0A 3RK9A 3RPYA 3AD5A 4FTMA 2JDTA 3PG3A 2R5TA 1ZZ2A 1XH7A 4C4GA 2VNWA 5BYYA 5GHVA 4NSTA 5H3QA 4L46A 1OZ1A 3NGAA 3V51A 2UV2A 4RIXA 2WQEA 1A48A 2Q83A 3UIMA 4BDIA 3HNGA 1NY3A 1FGIA 3E64A 1UWJA 3RPVA 4HYHA 4I94A 5CVHA 3SHEA 4F9BA 4O7LA 5B2MA 4OBPA 4ASEA 3VW6A 3PXKA 3NR9A 3PXFA 4ANOA 1OBGA 4WRSA 4XP3A 5A4EA 2XF0A 4X3FA 5J87A 1Q3WA 4FKPA 2C5XA 4CFWA 3QKLA 3HAMA 5IUGA 4NM0A 2ZV7A 2R3LA 4F1MA 4FV4A 3KXXA 5H8BA 3WZJA 3O8TA 3G0EA 5B2KA 1BI8A 4F70A 3R7IA 2PUPA 2XEYA 3R00A 4LV5A 2BALA 3F3ZA 4ZTHA 4YJOA 2B9FA 5IDNA 5L3AA 3AGLA 3SAYA 3MIAA 4P7EA 2XIZA 4QMVA 1IAHA 3UO6A 3F7ZA 3ORNA 3W2OA 5J5TA 3BYOA 3F6XA 2JDSA 2BCJA 2Z7LA 2YWVA 3T3VA 2Z60A 4FV0A 5HLWA 2XBAA 3UE4A 3V8TA 4C3PA 2QU6A 3Q4ZA 1U54A 3HDNA 1O9UA 3QUEA 1CKIA 5H9BA 2WKMA 4QO9A 5GJDA 4NJDA 4E93A 4NKSA 3C5IA 2ZV8A 1G3NA 1UU9A 4C62A 3BHHA 2HZNA 2BFXA 3ZXZA 4F4PA 5GIOE 4AS0A 4HYUA 5CANA 3PJ8A 4XG2A 2P2HA 5HE3A 4RRVA 5E1SA 2OJJA 2R64A 4HGEA 2C5OA 4PUZA 3G9NA 1UKHA 2C6DA 3NYVA 3FQEA 3H9OA 1ZYSA 4NK9A 3PVBA 3KRLA 3OOGA 4ZS0A 4I5CA 2XKDA 2QONA 2WMBA 4M8TA 3TN8A 4FTUA 2OWBA 5ETCA 4O2ZA 1H1QA 1ZLTA 3DZQA 2PUNA 2UW4A 1ZY4A 4LUDA 3UQCA 5HZNA 1ZMVA 2FH9A 3GC8A 1QMZA 3NMUF 3WARA 2CLQA 2DYLA 2YM7A 5AP5A 3LFFA 1OI9A 3U8WA 2HCKA 4PMSA 3PY1A 4QTBA 1GZKA 2H9VA 3DNEA 3O23A 5L8JA 2AUHA 2WTJA 5CT0A 1OB3A 5K5NA 4L6QA 1NT2A 4MNFA 3VS4A 1SVHA 2WMRA 4H1MA 3LLAA 3Q6WA 3ALOA 4ZZMA 4XBRA 4BYJA 4JQ8A 3FXWA 3IS5A 4A9UA 3SXFA 3Q53A 4YZMA 2YLEA 2EXMA 4BDBA 3LQ8A 1ATPE 4EOPA 3QCXA 2UZOA 2WELA 4I22A 4KA3A 3ZMMA 1K2PA 1OITA 3OOMA 4J53A 1KOAA 4NTSA 4N70A 5F1ZA 2E9VA 4HYIA 2P55A 3KRWA 3LCDA 2XIKA 3PSBA 2ESMA 3FL5A 4GW8A 4YJVA 3TZMA 3SXRA 5IISA 3W33A 3OEZA 3NUPA 1BX6A 1S9JA 1PXNA 5AJQA 2BTRA 2UZTA 4FUYA 5D10A 3T9IA 3GFWA 3RAIA 3R8PA 2BUJA 3B2TA 5CEOA 5KNJA 4JAJA 2P3GX 3L9LA 3W18A 1QCFA 2XJ1A 2OJFE 3W8LA 2NO3A 3R9DA 1CM8A 3C4XA 2Y4IB 2ZB1A 3MYGA 4ITIA 4MWIA 4RWIA 2PVNA 2PVHA 1JVPP 3EN6A 1UKIA 3WBLA 4K33A 4BCJA 1XBBA 5DRDA 2QOQA 3ULZA 5FXSA 2WTWA 3P08A 4BTJA 4HVGA 3BCEA 4IVBA 4ARKA 5GZ8A 4QP4A 1PXOA 4L3LA 1NXKA 1B39A 3ZOSA 3ERKA 2YISA 5C9CA 2ACXA 1KOBA 1MP8A 5LARA 4K0YA 4IB5A 4G34A 3KULA 2QOLA 5CI7A 4WKQA 4JL9A 4BCGA 3RPOA 3N9XA 3TKIA 4I1ZA 4W4XA 4RVTA 3O50A 3KVXA 3FYJX 3LE6A 1AD5A 2JBPA 2YDKA 2CNVA 3O96A 4WIHA 4IAAA 5EHOA 2WMWA 4FIEA 2HWPA 1Q24A 2V5QA 3OP5A 1OL6A 1H0VA 5D1JA 5L2QA 3TV4A 1DAYA 3QXOA 2VTIA 1XH5A 3L8PA 4BCKA 2ZVAA 2IVSA 3ETAA 5HIDA 2W0JA 1ZMWA 3HV3A 3LCTA 3DLSA 4I23A 5D7VA 2RFEA 4FKQA 5LJJA 2XIXA 1NVRA 1VZOA 2C6KA 3E5AA 2QLQA 2V55A 1OGUA 4W8EA 3TUBA 4HGSA 4AZSA 1E1VA 4Z9LA 5K4IA 1YW2A 5C4KA 4S2ZA 3MGYA 2R3IA 5LWNA 4TNBA 4EBWA 2X9FA 5JMSA 1GZOA 3QZHA 4QTDA 4H36A 3R8LA 3VC4A 1NVQA 1KSWA 3W8QA 3RP9A 2W17A 3ZSGA 4D2RA 1WBSA 4WHZA 3LJ2A 2ITZA 3NRMA 3QTZA 5LVMA 3FLZA 3G51A 3HV6A 4Y73A 3TWJA 1U5QA 3HMNA 4IDTA 4QYYA 1IAJA 4MNEB 3FZOA 5E90A 4ZTRA 3PUPA 1PMUA 1YQJA 2FSOX 2WMTA 5AMNA 3W10A 1UU7A 1BUHA 5KMOA 5E4HA 4J95A 5LVPA 3SOAA 3KU2A 4LV8A 4FKWA 3DB6A 3LJ0A 4D28A 3LMHA 3ZONA 4JDHA 3UBDA 4EH7A 4ZSGA 4I3ZA 2BVAA 4NM3A 4X6QC 2X4FA 4Q9ZA 5TE0A 1ZARA 2GU8A 1SVEA 1Y6BA 3BEGA 3JPVA 1H0WA 4TWNA 3COKA 3E8DA 2OXYA 1P5EA 3VBYA 3EFLA 3I0QA 2PL0A 4DC2A 4MVFA 3VBXA 4OTPA 1KE5A 3QD2B 2WEIA 3EWHA 5AX9A 4A4XA 2R3MA 3ODYX 3CP9A 3A7GA 3DBQA 3I0OA 3ITZA 4C3FA 4R3RA 2NNWB 2IZRA 4DG3E 4MX9A 4ZSAA 4JBVA 5EI8A 3DBCA 5CQUA 5EK7A 2XS0A 2YITA 4HVHA 4BGGA 4I93A 3QWKA 4MXXA 3PIXA 1IEPA 4O38A 3UNJA 3EQPA 4Y5QA 1I44A 5HD7A 3R2BA 3V5LA 4E6QA 3CQWA 2WMXA 2EUFB 3FZRA 3GU4A 5AV1A 3TG1A 3VS2A 4C35A 2RF9A 2Z2WA 3DXNA 4NCTA 4BVUA 2I0EA 2GS7A 4D5HA 2WMUA 4K2RA 2XIRA 3DV3A 4C8BA 5E8XA 2BAJA 2PE0A 2X39A 5HCZA 4FT9A 5JK3A 5CEIA 5CF5A 2VU3A 4QQ5A 3UZTA 1H08A 3UZPA 5I9XA 2IPXA 3LXNA 3H9FA 3QCQA 2H8HA 4UZDA 4FTAA 2C3JA 3V01A 3QC9A 1WAKA 2ITUA 4JG7A 4KAOA 3FWQA 4BIEA 1H8FA 4FG8A 4G3GA 4OTWA 4J96A 4FKRA 4PL4A 5A4QA 5FDPA 3NVMB 1WVXA 2C0IA 4CFNA 5M08A 4EYJA 3T9TA 3TACA 1GAGA 2BRBA 2I6LA 2YWPA 3QALE 4QP9A 2B9IA 3GNIB 4QMMA 1YDRE 4LL5A 4RQVA 5JFSA 4OBQA 4FSQA 5E8WA 4ZTQA 1H1PA 2WO6A 2PZYA 3D7TB 5IA3A 4DF3A 4IM0A 3F3WA 3D2IA 4FV7A 4QD6A 1FMKA 2P0CA 4R3PA 4AFEA 3DPKA 3HA8A 3NNXA 4IHPA 2HYYA 4QP8A 5JFXA 3DCVA 4AZVA 4DG2E 4OW8A 1OKWA 2GS6A 2W1GA 4AT4A 3KREA 5I5ZA 2Z02A 5C8MA 5IQGA 4GL9A 4IEBA 3KVWA 3PP1A 2VTOA 5JZNA 3ZCLA 4F7LA 4EZ7A 3FC2A 5M06A 3MY5A 2NRUA 1LPUA 3FQHA 5AAFA 5FEEA 3AQVA 4F9YA 1YOLA 2OXXA 3FZSA 2RIOA 1ZOHA 4GMYA 3R9NA 4H3BA 4BCIA 3SDJA 4FT5A 4NIFB 5FP6A 5HI2A 3RM6A 3WF7A 2JGZA 3GENA 4H1JA 3L8SA 3EH9A 4OGRA 4IZYA 2C5NA 5ANEA 3NNWA 3NYOA 5CZHA 5HE2A 4WRGA 2WU7A 4GT5A 1OECA 3U6HA 3BGPA 4QRCA 3SG8A 1STCE 2B1PA 2WTKC 2XJ2A 4BICA 2BIYA 1R1WA 3NUXA 2E9NA 4D5KA 3MN3A 3RINA 1J7UA 2UVYA 5DE2A 3OROA 5KUPA 5ANDA 4ZY5A 3RGFA 2JITA 4IAKA 1XBCA 3SQQA 3O8UA 4A7CA 2GNFA 2XBJA 4G3DA 3A7JA 1H25A 4UYAA 3H0YA 1CTPE 4ZY4A 4JBOA 3RAKA 2X9EA 5AP4A 3UC3A 3ZO1A 5K4JA 3RHKA 4HW7A 3M1SA 5A6NA 4EOKA 3LMIA 3UGCA 4DTAA 1XO2B 3DS6A 2VWIA 4NCTC 2UW3A 4PNKA 3Q2MA 3NSZA 3RZFA 4RFMA 3WYXA 3DKCA 4XP0A 4EHGA 2B7AA 4GYGA 4YU2A 2WD1A 1PMVA 4YC6A 3VUMA 2UW0A 3AC8A 4EHEA 5AEPA 2QLUA 4DINA 3U51A 3ZXTA 4FKJA 4U41A 5CAVA 1YHSA 3MPTA 4TW9A 5BVOA 2ONLC 3LFNA 4ZS4A 1QL6A 2BRGA 2VWWA 3BHVA 3WYYA 3IONA 4FTIA 3VAPA 5EW8A 3VS6A 3DKGA 1F0QA 1TKIA 1GIHA 1H00A 5EQYA 3LMGA 3PXRA 5EKNA 4MEDA 4YNEA 3B2WA 3ZFYA 4L45A 4CTBA 3NWWA 3PP0A 3UP2A 5L6PA 5CU0A 4AA4A 2HZ4A 3FKOA 3OCBA 4FTOA 4GVJA 3U87A 4YJNA 3UNZA 5BVFA 2CGUA 5AM6A 5I9UA 4ANQA 2FSTX 3AMAA 3P7CA 4JG6A 4KRCA 4RX9A 2HXQA 3FLYA 4RX7A 2PZRA 2I0HA 4L3PA 1SNXA 3LFSA 3ORXA 3V8WA 5EG3A 3QA0A 3BIZA 3PJ1A 4OR5A 4D4RA 4Y83A 4ZY6A 1Y91A 4BTFA 4EWHA 3ATTA 1MRVA 3R73A 3FMEA 5IMEA 2YERA 4FOCA 4AE9A 4ASXA 3ORPA 3AGMA 1PJKA 3DJ7A 4IX4A 4MD7E 4PMTA 5DOSA 3ZO4A 2BZKB 3U4UA 4B8MA 3AC2A 3E62A 5AR4A 5IA5A 2J0IA 2VX0A 3PA4A 4W4WA 3TNWA 3WI6A 3UVQA 4DEHA 4L7FA 2O63A 4CRSA 3JVRA 2BAKA 3Q60A 4TZRA 2WHBA 3SV0A 3DXQA 4S33A 4C37A 2FSLX 3DOGA 4QPAA 2CDZA 4DAWA 3L1SA 2VTJA 4LMNA 2JBOA 5J9YA 1ZY5A 5EM6A 2CKEA 3BGQA 5BUEA 5M4IA 4U81A 5AR2A 2QI8A 5F20A 2XK7A 2RFDA 3E93A 5KZIA 3KB7A 5AV2A 4FT0A 4N57A 3HRCA 3R7EA 3IDPA 2YZLA 3LLTA 1GIJA 2PUUA 2XYUA 5CEPA 4E1ZA 5HEZA 2HW7A 3F2NA 3NW5A 4H3PA 5EDPA 4I41A 4Q2AA 2BZIB 3NUAA 4MAOA 4FK3A 4ZJJA 4EH2A 3EZRA 5IH6A 3QF9A 3CS9A 5AAEA 4KS7A 4EOMA 2IZSA 2ZV9A 3EYGA 3KXHA 4FV5A 4QPSA 4V0GB 5AV0A 2UZNA 4MXCA 3ZSIA 4V04A 4DH5A 4O7WA 4YMJA 3II5A 3SD0A 3MJ2A 3SW4A 2WIHA 2RL5A 1JLUE 4KBKA 4N6ZA 3NAXA 4BCNA 4MKCA 4M69B 3VUHA 2GQRA 5HOAA 4FYOA 2CLXA 4IB1A 2VAGA 5ACKA 5JGAA 2QHNA 4LOOA 1BYGA 5EW9A 1M7QA 1V0PA 4XHKB 3FZ1A 5F95A 3IDCA 4TT7A 1WCCA 2PSQA 3C4EA 2P2IA 4RIYA 3VUDA 4KIPA 3CPBA 2R3JA 4EH9A 5ACBC 1YVJA 1ZRZA 2Z7QA 5AR5A 5HCXA 5L2IA 2QO2A 4RC3A 4EK4A 1LEWA 1MQ4A 2PY3A 2YCSA 2YCRA 5J95A 3DGKA 4YUQA 2CKOA 2W1HA 2QQ7A 4A4OA 5G1XA 4RIOA 4XG4A 5ANIA 5IEYA 4FX3A 4I20A 4I92A 4AAAA 1R0PA 4KB8A 2JFMA 3F5UA 4RWKA 4BCFA 3N4UA 2PVJA 2PMLX 1J1BA 3S95A 4D4YA 3GXLA 4R8QA 3RVGA 4E5WA 2ETRA 3Q9WA 2C6LA 3D7ZA 4RC2A 2QOCA 4FKSA 3VWAA 5M4FA 5LVLA 1Y6AA 3GCSA 3P7BA 4XV2A 3ZEPA 3MWUA 4ACGA 5AUUA 1KE9A 3LFBA 3HAVA 4MQ1A 4O83A 4O1PA 2PULA 2WQNA 3QTXA 2XNEA 2RG6A 3MB6A 4O7NA 4CFUA 3BU6A 5BUIA 1P2AA 3QYZA 3RNIA 4XS2A 2ZM3A 5JRSA 1ZMUA 3WZUA 3TM0A 3PZEA 4IFCA 3H3CA 5HO6A 5EDQA 3RALA 4IBMA 5HCYA 2W96B 4YO6A 1KV2A 4C4IA 4HVSA 3MI9A 5AV4A 4FGBA 2R3RA 5DGZA 2BILB 3UG2A 4NL0A 1TQMA 4EQUA 1YXTA 3E87A 1T46A 5CAUA 4JRNA 4ANBA 2VD5A 3KF7A 4D0WA 4I6BA 4QMTA 3ZUUA 2ZB0A 4PTGA 1KWPA 3AXWA 3W2QA 2DUVA 3CKXA 1YXSA 4J8NA 2QO7A 4APCA 3I6UA 3DT1A 5DH3A 3TJCA 3B8QA 4R78A 3O7LB 4A9SA 5IQIA 4HVDA 3ZM9A 1ZYDA 3M42A 2QKWB 2UZDA 3ID6C 3DK3A 4DGNA 4LG4A 3R1YA 4BGHA 3VQUA 3PDTA 2I0YA 4DEEA 3P0MA 4K77A 5IEVA 2OJ9A 4LRMA 5HVKA 3OBJA 3NAYA 3COHA 2W5AA 3AG9A 3OZ6A 3CGOA 4HOKA 4XP2A 4IE9A 4CRLA 5ITAA 3HMPA 3ZRKA 4F6UA 3A60A 4IM3A 2R7BA 4C61A 5K3YA 4R6VA 3CXWA 3UTOA 3AMBA 1H1WA 4G3CA 2JKQA 2PE2A 2WMQA 3BYMA 5EDRA 3UPXA 2OIQA 2GHLA 1Z5MA 4IXPA 4BZOA 2W5HA 2RFNA 5E1EA 4I5PA 5HBEA 4JNWA 3MY1A 2GDOA 4GJ2A 1FINA 4RZVA 5HIEA 3BYVA 1Z57A 5A4LA 2YM6A 3BRBA 4UWYA 4GV1A 2XNPA 2BRMA 2A1AB 4M67A 4DCAA 3QYWA 3MDYA 1J91A 4U40A 1M2RA 3HX4A 4FV3A 5B2LA 3ZO2A 5L4QA 3PWDA 2B9JA 4O27B 3GGFA 5LMAA 5IQCA 2GS2A 4ZSEA 5C4LA 3PYYA 5HTIA 4LYNA 4FTKA 4FEXA 4FKIA 2EXEA 1JKKA 3I81A 1OBDA 3NYXA 3CJGA 1QPJA 2NP8A 3MTLA 2UW9A 3QL8A 2BZHB 4GEOA 4YNOA 4AZWA 3LFCA 3ORTA 3KMWA 4LMUA 5BVDA 5FBOA 4RJ8A 4J8MA 2QOBA 4FZDB 4DG0E 4H05A 3WE4A 3LZBA 4XV9A 4YJQA 1EH4A 1RE8A 2XKEA 4UWBA 4AOTA 1FQ1B 4RJ3A 3GI3A 4XLVA 3UDBA 3TDWA 5AM7A 4ENYA 3BLQA 3FXXA 5BNJA 4KBAA 2X7GA 4Z16A 4F6SA 1WBTA 2C0OA 2VO6A 2PMNX 4QT1A 2WEVA 3KKVA 4FKUA 4NWMA 5KO1A 3UQFA 4DFBA 2WQOA 2JD5A 3KN5A 4HPUE 1SM2A 4TRLA 4RLLA 4D55A 3VRYA 5FEDA 1UA2A 2B54A 1PF8A 1ZZLA 4CZUA 3NS9A 4QMQA 3VQHA 4FI1A 4JR3A 2BDFA 4BBMA 3NIZA 5IQAA 1PXMA 1UU3A 2Y4PA 3UJGA 1ZYLA 2A19B 1ERKA 4RVMA 1YI3A 1U59A 4WT6A 4X2JA 2VO7A 5HORA 2QC6A 2H34A 2F7XE 2XVDA 5L2SA 2BHHA 1SMHA 2VN9A 3WZDA 4GU9A 3REPA 3SKCA 2W4KA 1R0EA 2CGWA 4I6HA 4NU1A 5J7HA 4BDCA 3PG1A 3BE9A 3FHIA 3FMMA 5EHLA 3TDVA 5LMKC 2UW6A 2W1CA 5KMJA 4ORKA 5KMLA 4BIDA 3QRJA 2XYNA 4PL3A 3TKUA 4BBFA 3OMVA 4ID7A 4RJ7A 4XBUA 4G6NA 5HE1A 5BMSA 5CSWA 3Q2JA 1UU8A 2OU7A 3PVWA 1H01A 4LGDA 3R1QA 2HENA 4WA9A 4CD0A 3CBLA 5CF4A 3CSVA 2W9FB 1YHVA 3FEGA 2O0UA 2YDJA 1H4LA 2FUMA 2VX3A 4NW6A 4F08A 3VBWA 4F6WA 4L43A 2AC3A 5JGBA 1PXJA 4BZNA 5DMZA 3PJ3A 3GFEA 5BMMA 3F7WA 4KIQA 2G2FA 3A7HA 4M84A 5DI1A 3L9MA 4YSJA 4FK6A 3FI4A 4RWJA 4EYMA 4GYIA 4GJ3A 3SA0A 4IC8A 5DHJA 4U80A 5HQ0A 5EH0A 2OZOA 5E7RA 4DFLA 3UOKA 3MH3A 4BL1A 2WTCA 1URCA 4WO5A 4CLIA 3CQUA 2WMSA 4BDGA 4U8ZA 3ZO3A 1MQBA 5KCVA 3D83A 3TIZA 1H24A 2C5VA 4NW5A 4JX3A 4FT7A 2UZVA 4GUEA 2CN8A 3LFDA 1JKTA 3G33A 1LP4A 3TCPA 2J51A 2JKMA 4UXQA 1WBPA 4AP7A 2HY81 3BHUA 2OH0E 4LM5A 1HCLA 2WPAA 3F2AA 3ZS5A 2PU8A 3F88A 4YHFA 2R3FA 2CCHA 3KRXA 2QOFA 1W82A 4G1WA 5DNRA 4R77A 4ZTMA 5A6OA 4EK3A 3PSDA 5L8KA 3MFSA 1CSNA 4YHTA 4BDKA 3KK8A 4DH1A 4FMQA 3EQGA 3LW0A 5E8UA 5CZIA 3DKOA 2PHKA 4W4YA 3FLWA 4PX6A 1JBPE 4DTBA 1P4OA 5EYMA 2F9GA 2R2PA 4MHAA 5GIPE 1JSTA 3QX2A 3OD6X 2UW7A 4C4FA 3AOXA 4WUNA 5KKRB 3WILA 2PVFA 5B0XA 3D14A 2RG5A 2UUEA 3FSKA 3HYHA 4O96A 3OTVA 5HU3A 4M97A 2CJMA 5AP7A 2DS1A 3KCFA 4OT5A 3A61A 3OG7A 4JIAA 4AX8A 5CEKA 5IA1A 4J1RA 5CSXA 4KIKB 5AA9A 3TUDA 4QP7A 1PXKA 2HELA 3GOPA 3ZTXA 4DYMA 5IG1A 4NT4A 3LFQA 5FRIA 3HRFA 2GQSA 4M14A 5D41A 4XG7A 4DFYA 2IO6A 3EFJA 3SC1A 1KE6A 3TUCA 4F65A 2ZM4A 3PVUA 2X8EA 4I5MA 4GS6A 5CENA 1OMWA 1O6KA 2VWUA 4DT8A 3OTUA 3RNYA 1G5SA 3OC1A 5CXZA 5KMNA 3TT0A 3VS3A 5IH5A 5TO8A 4X3FC 3PE2A 5DYJA 3V6SA 5F9EA 3LCSA 4F9CA 2IVTA 4TKSA 3F2RA 1PKGA 4B99A 1K9AA 3RM7A 4C4JA 1PYXA 4FV9A 3QCYA 3F5GA 4ZTSA 2ZM1A 3AD6A 3GVUA 3RAHA 4AZFA 4BDFA 2UZLA 4FC0A 4AN3A 4C02A 5E92A 5JQ5A 2WB8A 1L3RE 1YWNA 2YM3A 4FIJA 4TWOA 1JQHA 3AT4A 1LUFA 5CT7A 3UIBA 3F5PA 5CASA 3A7IA 1VR2A 2QVSE 4RX5A 4DEDA 3OVVA 2R3NA 3EFKA 3KRJA 3VJNA 5IA4A 3NUYA 2PZPA 4U45A 3D15A 3FYKX 1V1KA 3LOKA 4C57A 4HJOA 3VS0A 4OAUC 1I09A 3MPMA 4I4EA 4WOVA 5FM2A 4BDHA 5GINE 3Q04A 2IJMA 5CSVA 3R1NA 5F94A 2QO9A 1FGKA 3KMMA 4M68A 4N0SA 4FT3A 3COIA 1BLXA 4AE6A 4CFFA 3W55A 4BWXA 4RA5A 1AQ1A 2C1BA 2AYPA 4ANMA 3D0EA 3FMLA 3MFRA 1WBVA 3Q52A 1W84A 4O1OA 4LGHA 4RPVA 2R0IA 4IWPA 2YIYA 3RPSA 3QQLA 4I6QA 1R39A 5L2WA 4EUUA 5HNGA 3ZUTA 1BL7A 4Y95A 2BPMA 3U6JA 3R21A 3DQWA 2X1NA 4IDVA 4UEUA 4C4EA 3V6RA 3R1SA 4EQCA 2OIDA 4AN9A 4F0FA 4PL5A 5M56A 5FTGA 3E3PA 1H27A 3F3VA 4MXAA 3HA6A 4NFMA 5EW3A 2VTRA 4RMZA 4LRJA 5TKDA 4V0GA 2BMCA 3DZOA 3HMIA 2QD9A 1KUTA 3PJ2A 4B6LA 5HX6A 3S2PA 2Y6OA 3EB0A 4AQCA 3E3BX 2XJ0A 4J71A 4O86A 4BCMA 2PPQA 4H39A 4J97A 4AT5A 4JDJA 2XRUA 2Q0BA 2QG5A 3LM5A 4FICA 5EM7A 3EN9A 5T68A 5FUTA 4NEUA 4DFXE 4JJRA 4X7QA 3CIKA 4QMOA 4X6RA 3D5VA 1PRYA 3FBVA 4CFVA 4S34A 3BEAA 3BPRA 4X3JA 2QOIA 2R0UA 4D9TA 3R28A 4PNIA 5DIAA 3OWKA 4U3YA 4JDKA 4HZSA 4NJ3A 2IWIA 4XOZA 1BI7A 1FVTA 2OH4A 4J99A 4QQCA 4EK5A 4ERKA 4TYHB 3Q4UA 3FC1X 1KE7A 5DT4A 2ZDUA 4BCOA 1WVYA 3QZIA 3I7BA 1CKPA 2ITXA 5LMBA 3D9VA 3VUKA 2A0CX 4K6ZA 3NIEA 4TWCA 3TL8A 2P33A 4IVDA 3C51A 3UOHA 3D94A 4XG6A 4YPDA 4L7SA 1B38A 3I7CA 2PZIA 3HV4A 3NLBA 4FKGA 1OIUA 2BRNA 3Q4TA 2OZAA 4FG7A 4GG5A 1YWRA 4IH8A 2V7AA 3N51A 4A9TA 3MH2A 2CNQA 5BVWA 2GNHA 3DJ6A 3SRVB 5GZAA 4FODA 5DT3A 2B52A 5JEBA 3ZM4A 4FV1A 2XEZA 4D0XA 5AUTA 3NUUA 4EORA 3HDMA 4KKHA 5AUVA 2YIRA 4HCUA 1OM1A 3FSFA 2WOUA 4GFGA 5AV3A 3HUBA 4RGJA 4JVGA 4XYFA 5HG7A 1OKYA 4IJPA 5H8GA 4HVIA 3OY3A 2PVRA 3O71A 2W1ZA 5KX8A 4FZ6A 3VUGA 4TWPA 3V5QA 4I6FA 3V8SA 4PDYA 3BHTA 4E5AX 3GU8A 2VTSA 3IG7A 4FUXA 3ZHPC 3A4PA 5CEQA 3EN5A 3PY3A 1WFCA 3NPCA 2C4GA 5J1VA 1Q8ZA 5E8SA 3EKNA 2WXVA 4M3QA 3P7AA 3R02A 4UALA 4EBVA 4E6CA 4HCTA 4MBLA 3ZRLA 1TQIA 3ZFMA 5J79A 4KSPA 4HYSA 2F2UA 4QMZA 5JT2A 4O7RA 1NA7A 5EM8A 3PTGA 2CPKE 2PVYA 2PVMA 2IW9A 3WOWA 3EQHA 3DU8A 3PIZA 4RIXB 2YFXA 2XNNA 1QPDA 5EQPA 3OXTA 4U7ZA 5DWRA 2JDRA 4JOAA 5FD2A 2QOHA 3OWPA 4U3ZA 1OUKA 3R8ZA 1UNHA 3EFWA 2X8DA 3FV8A 4FL2A 4FSZA 4IZAA 4D2VA 4ZLOA 2J6MA 3V5TA 2FVDA 2UZWE 2OK1A 2X81A 3MV5A 4JBPA 4KRDA 4CQEA 3MH1A 1W98A 3L9NA 4EOQA 4OAVB 3ATSA 3QQGA 2BROA 1YOMA 3CD8A 3H0ZA 2VZ6A 3LPBA 2VWVA 4O0XA 4RZWA 4YJTA 4BTKA 1IG1A 2OJIA 5BUJA 1ND4A 5LXMA 3JS2A 3VJOA 2BRHA 3V3VA 3FY0A 4EZ5A 4XEYA 4NYEA 3HV7A 3GU6A 2XK4A 3A62A 3ACKA 3IKAA 3MB7A 2RKUA 4YSMA 4BBEA 5C1QB 4DA5A 5CY3A 3ZYAA 4FZ7A 2BDJA 4OLIA 4CT2A 2GCDA 2C6EA 3R30A 5DFPA 4AN2A 1M17A 4BI1A 2OLCA 5J8IA 4FEVA 2J0JA 5AX3A 4C36A 4UMPA 5T3QA 1NVSA 3HECA 1U54B 4V01A 4L53A 4WBBB 4QYHA 2P4IA 5HIBA 1OL2A 1OKZA 4IZ7A 1ZXEA 2XM8A 2VTAA 4TXCA 1REKA 5DVRA 1FMOE 5HVYA 4FSRA 1URWA 3QX4A 1HCKA 3EQIA 4QMLA 4O7YA 4TYEA 4O0UA 3FKNA 1M2PA 2ZYBA 1MUOA 2WMVA 3KF4A 2GMXA 3C1XA 4L3JA 5EOBA 5CSPA 5AUYA 4IX3A 3PLAE 1JKLA 4I0SA 3P86A 5BVEA 1GJOA 4CKIA 1GOLA 1YOJA 3H4JA 3HZTA 1PY5A 4QP6A 2V22A 4EQMA 1FVVA 2R9SA 3GU5A 3QQUA 3NZ0A 1WBWA 5ANKA 3RBWA 3VBVA 4CFXA 4YZCA 5FTQA 2J2IB 4GFMA 3DA6A 4YTCA 4TNDA 4R7BA 2CCIA 3E8EA 3WIGA 5KMMA 4CZTA 4X21A 3MFUA 4TYGA 4C4HA 3HEGA 1Q8YA 4O22A 4S30A 3R9RA 4HGTA 4IQ6A 3O8PA 4TYJA 2WTDA 2JIVA 4E4XA 3QQJA 2VTHA 3QLFA 3RPRA 4A9YA 2VWXA 4BIBA 4YGAA 3PA5A 3CR0A 4PDSA 4BRXA 4AUAA 3F61A 3ZUVA 4TTHB 4ZSJA 4O84A 3C7QA 2W1IA 4E4LA 3A8WA 3QQFA 4BCQA 4QMUA 4XH6A 1BL6A 2ZMCA 3MW1A 1SNUA 3BE2A 4AWIA 3ZC5A 4DEGA 3JVSA 4AG8A 3TEIA 1A9UA 1XH4A 4MD9E 4EKLA 3KMUA 2C3IB 5HICA 4C7TA 1PKDA 3QHWA 4CYIA 4FV8A 2ERZE 3OWJA 5K0KA 2X0GA 3QD4A 4ACHA 4MF0A 4BHNA 4ENXA 1RW8A 4ZLZA 3U55A 5A3XA 1WMKA 4HZRA 4QTAA 2EVAA 2W1EA 4EL9A 2CMWA 2O8YA 3FI2A 1Y8YA 2ITVA 3I5NA 3Q4CA 4FVQA 3C4ZA 4BB4A 3W16A 3O2MA 1WBNA 1YI4A 4N4SA 5AP1A 4DTKA 3DXPA 1XKKA 2HOGA 4M0YA 5AA8A 5BX0A 3F66A 2J0LA 2A27A 3HLLA 3K54A 1JAMA 2OKRA 1OL1A 3DJ5A 4LI5A 4K11A 4BTMA 4EZ3A 2B9HA 1XHAA 4EUTA 2ZOQA 2GTMA 3PA3A 5EM5A 3DNDA 2FO0A 2CSNA 2ITNA 2WNTA 3ET7A 4JLCA 4UB7A 4V05A 3FPQA 3UIUA 1LEZA 3VS7A 3VUIA 4LRKA 4E3CA 2EB2A 4WG3A 3EN7A 1R3CA 3MIYA 2R7IA 2IW8A 5DT0A 3TV6A 4ZTLA 4CT1A 3TV7A 3KULB 5EI6A 5I3RA 4RJ5A 2H6DA 2W5BA 3PRFA 3R7YA 3GBZA 4LUEA 4PQNA 1XR1A 2QURA 1VYWA 2C69A 1FPUA 3V5JA 5IA0A 4RLKA 5LVNA 4FBXA 3P1AA 5AR8A 5I9VA 3TTIA 1ZAOA 2F4JA 4G2FA 2OJGA 5KHXA 2ITQA 3TNQB 5JH6A 3QUDA 4PPBA 2JDOA 3TZ7A 4RJ6A 3P23A 4G6OA 4EOSA 4GKIA 5ICPA 3U54A 3ROYA 4YHJA 2CNUA 3AC5A 2I0VA 4AGCA 4ACCA 3CD3A 2PMOX 3R22A 4EK6A 2ITYA 3TNIA 4Z55A 4ZTNA 4IW0A 4IAFA 4BDAA 3IQ7A 3RHXA 3LXLA 4DGOA 5A14A 1PXLA 5M4UA 1SVGA 2WOTA 3SGCA 2Z8CA 4RFYA 4IM2A 2F7EE 3AT3A 3EQFA 1APME 3QA8A 2JC6A 2ZJWA 3ZLXA 4XCUA 3CTJA 4NTTA 4R7HA 3AC1A 3G6HA 3R63A 3S1HA 1DAWA 4I24A 4ZZOA 4FIIA 2Z7SA 1Y57A 3DFAA 4GU6A 4UY9A 4YJRA 3FXZA 5GJGA 4EOIA 2X2KA 2XCHA 3IK3A 4G9CA 5FLFA 2ZMDA 4O0SA 3FQSA 1DM2A 1OPJA 1PYEA 2GFSA 2DWBA 4O7SA 3QWJA 3FMDA 3ZC6A 3OXZA 4FIHA 3H30A 4AA0A 4XX9A 2NRYA 3EIDA 3OW3A 4XV1A 1IR3A 3CQEA 5HHWA 4ZXTA 4XRJA 1CKJA 3VF8A 2GNGA 4ACDA 3UO5A 3BQCA 1G8AA 4DFUA 3G6GA 2VX1A 3KC3A 5DR2A 4EKKA 3UODA 1OL7A 1J1CA 3Q6UA 3V5WA 1RQQA 3Q3BA 5E9EA 3IW4A 1W83A 5EYCA 4EOOA 5LQFA 4BDJA 4F1OA 2YEXA 5LCKA 3JY9A 5IQDA 2XP2A 3OFMA 3BX5A 3MS9A 5HG9A 4JI9A 3TXOA 3MY0A 2X2MA 3FI3A 2JIUA 5EQEA 2HZ0A 2WTKB 5CF8A 2W1DA 2ITOA 4RIWB 3FE3A 2A2AA 4I0RA 2XNOA 3P5KA 2YM5A 3L8XA 4BKZA 4CXAA 2QR8A 4B4LA 2BR1A 3C9WA 2C6MA 4DEBA 1QPEA 4D1ZA 2X8IA 1YXXA 4CV9A 4NM7A 3FPMA 4MF1A 5HKMA 3RCDA 5D9HA 2C1AA 2ZAZA 2J4ZA 5AUWA 3GQIA 4RVLA 5M57A 1UNLA 4IACA 2YM4A 4YZDA 2VV9A 3A7FA 4LOPA 4U5JA 4AF3A 4HNIA 4O6EA 4XOYA 2REIA 4IX6A 3VF9A 1Q99A 3PVGA 4MD8E 3EOCA 3LFAA 4BGQA 5HVJA 5IA2A 3BBTB 2QODA 4QTEA 2Y7JA 3OT8A 3RWPA 1JOWB 4NH1A 1VJYA 4MTAA 2QOOA 4IB3A 1MRYA 4ZEGA 2XA4A 2RGPA 3KA0A 3KEXA 5IH4A 2OG8A 3A8XA 3ENHA 4FTQA 2YM8A 4IVAA 4D9UA 1PW2A 3FZTA 2O65A 3IDBA 4J98A 3UC4A 5CNNA 4CGAA 4Z7HA 5FXRA 1W8CA 3CLYA 3ORZA 3A2CA 4ANNA 1YI6A 5HNIX 3DK7A 5HG8A 2JDVA 3KGAA 3BGZA 4IMYA 2PMIA 4S32A 3C4FA 4MNEA 4DGMA 3UP7A 1P14A 3FDNA 2BDWA 4P4CA 4WG4A 2HY0A 3A99A 4WUAA 2G2IA 4E4MA 3SW7A 3TZ9A 5L8LA 3LQ3A 2HXLA 3QC4A 5A54A 5DEYA 4OTGA 4B8LA 3NEWA 3VBQA 5AP3A 4E26A 1JKSA 4PDPA 3IW5A 1WZYA 2IZUA 4DT9A 5HESA 3WF9A 3H10A 2V62A 4CCUA 5AP0A 2F49A 5T6KA 3VIDA 5CTPA 4EK8A 5DA3A 4YJUA 2A4LA 4WNOA 4RX8A 5AUXA 3MBLA 4MBIA 1XJDA 4PP7A 3POOA 4BN1A 4YR8A 4F99A 4BY9E 5HE0A 5A4CA 5JZJA 4YC8A 1OPLA 2YA9A 4LGGA 3ACJA 3OT3A 3QXPA 2HIWA 3W2PA 5K5XA 2XKFA 5CYIA 4O81A 3GU7A 3RZBA 1F5QA 5CU6A 4G17A 3ALNA 4IWDA 2Y4IC 2B0QA 1OPKA 2X6DA 5C26A 1OL5A 3OF0A 4K9YA 5JQ8A 2GNLA 1V0OA 3PZHA 5J5SA 4RSSA 4C34A 5LOHA 4YURA 2UZBA 3CCNA 4R1YA 1Q5KA 3SG9A 2BTSA 2R4BA 2XNBA 3BHYA 2B4SB 3IOKA 2UVZA 4G3FA 5D12A 3ORMA 2R3HA 2GSFA 4FEWA 4EHVA 3DTWA 3NX8A 4CVAA 1SYKA 3OEFX 4UZHA 2V7OA 3D5WA 1LR4A 4Y5HA 3KFAA 3QUPA 5C8NA 5CXHA 4R1VA 4AW2A 3KN6A 4P5ZA 4I21A 4F63A 2O2UA 4C58A 2J90A 3SLSA 4O0YA 4YBKA 2XK8A 4I0TA 4FNXA 2YLFA 2OFVA 3PPKA 3WIKA 2R3KA 3R7OA 2VTNA 4RG0A 2PVKA 2C68A 3HGKA 4MH7A 4E4NA 4F9WA 4A4LA 4X2FA 5IU2A 3NYNA 2WZJA 2VTLA 5AP2A 5C03A 3QTUA 3MH0A 3VW8A 4F7JA 4QMXA 4DEAA 4LOQA 4J52A 2O3PA 3AC3A 3C0HA 4YTHA 1UVRA 3WZEA 3R2YA 5KZ0A 2QNJA 3DKFA 4BZDA 4PDOA 3ORIA 4QP3A 3BI6A 3G15A 5CALA 1H07A 4LL0A 3QQHA 4IAZA 4S31A 4O82A 2IW6A 5HLPA 2EU9A 4GFOA 1ZOGA 3DDPA 4GSBA 3D7TA 2FA2A 4QMWA 4QQJA 4WNKA 5ETIA 1TQPA 3EQBA 4YLLA 5DPVA 4WBOA 5L6WL 4UX9A 4CMOA 3ZLWA 4XMOA 3IW6A 4GK3A 5I9YA 5K0XA 3RK7A 4BI0A 4Z3VA 3MVJA 3QD0A 3R9HA 4JG8A 3FLNC 5CWZA 3I1AA 3FMHA 2E9UA 4NZWB 3E7OA 4IAYA 2C6IA 5CLPA 3VBTA 4YTIA 4C33A 4DEIA 4DN5A 2Y8OA 4E7WA 4FTJA 4KIOA 5HNBA 2SRCA 3ZSHA 2PTKA 1H26A 5FXQA 4MCVA 3Q96A 3T8OA 4F7SA 4GH2A 2J7TA 3C13A 4ALWA 2X2LA 5CNOA 1P4FA 2XK9A 2XZSA 4G9RA 5E91A 2VUWA 2C47A 3DDQA 4RQKA 2RFSA 3UOLA 4JXFA 2C5YA 3M11A 2FB8A 4NIFA 4U9AA 4CMUA 2YAKA 3HRBA 3NW6A 3QFVA 3BELA 5AUZA 5HTCA 2VTPA 3Q5ZA 2XMYA 4L8MA 4FGRA 3GCQA 4M12A 1ZWSA 3D2KA 1M7NA 3D5XA 2X7OA 3VS5A 2UW5A 3QAME 4ACMA 4CSVA 4D58A 4Z7GA 5J9LA 2C30A 3TKHA 3CGFA 2R3QA 4D1XA 2XKCA 4XG9A 1JSVA 4FTTA 4KSQA 3K2LA 3OY1A 3LQ5A 2FSMX 4QMSA 3CEKA 2G2HA 3R8MA 5LWMA 1L8TA 1Q8UA 3C4WA 2ZDTA 1F3MC 4KKGA 4JAIA 5M44A 3NNVA 2W06A 3PRIA 5CSHA 2YJRA 3QZFA 4F0GA 4JR7A 1IRKA 3I5ZA 3BQRA 4Q5HA 4U44A 2YACA 3NCGA 4GRBA 2LAVA 3PJCA 3IGOA 4L9IA 2W7XA 4RC4A 5AIKA 1IASA 1FVRA 3L8VA 3MVLA 5IQHA 3KCKA 4GVAA 4CEGA 3K3JA 3VS1A 5AAGA 3DAJA 3S3IA 2VO3A 4UXLA 4DHFA 2WTIA 4EOLA 3BLRA 5CAQA 3OUNB 1U5RA 1JSUA 1OUYA 3H9RA 1W0XC 2ETMA 4J7BA 4BFMA 5CAOA 4AGUA 5TOZA 4R5YA 4IWOA 5HTBA 3K5VA 3W2RA 4W9WA 5BVKA 2QOKA 3DB8A 3BU3A 4E8AA 4RIYB 4A06A 4FSUA 5ETAA 3DBEA 5A4TA 4X2NA 3R8UA 3UYTA 4ANLA 4FKOA 1YDTE 4O7VA 5M4CA 4FVPA 4ZZNA 2VGOA 4PRJA 1AGWA 4QYFA 1CDKA 2XM9A 1XH6A 5JSMA 4XJ0A 3G9LX 4RA4A 2FGIA 3UG1A 4AW1A 1CMKE 2CKQA 3VULA 4B0GA 3E63A 4KKEA 3LFEA 3THBA 1R78A 4BYIA 2WQBA 3UMWA 5BPYA 3BLHA 4ERWA 4GCJA 3PE1A 4RVKA 1YDSE 2WMAA 4MXYA 3C0GA 3I6WA 4CTCA 3QGWA 4ZSLA 4CFMA 4E20A 4W9XA 4MXZA 3KY2A 4FL3A 1IA9A 4FOBA 3U4WA 4O91A 2ETKA 5G6VA 5L2TA 4QPMA 5L6OA 2W99B 3QD3A 5ANJA 3OXIA 4OTHA 3VHEA 3EL8A 1XBAA 2PZ5A 3ZEWA 3SX9A 2XK6A 2EWAA 3BV2A 5I9ZA 5M51A 5J7BA 1XH8A 4DFNA 3FLSA 3RKBA 2AC5A 2XCKA 4JT3A 5DR6A 4M7IA 1DI9A 4PP9A 4R5SA 4YO4A 4I5HA 4G5PA 3F5XA 3ANQA 4ZLYA 3OW4A 4Y72A 2OXDA 1WBOA 2IN6A 2VRXA 4FIGA 4QQTA 2YIQA 3BKBA 3WF8A 2OICA 2Y0AA 4X0MA 4TL0A 5IDPA 4JIKA 3IOPA 3TI1A 5HBJA 3QTWA 4Y85A 3G0FA 2YZAA 4XG8A 2EXCX 4L01A 3DLZA 5D7AA 5H8EA 5C27A 3IGGA 3DBFA 3LXKA 4OBOA 3R01A 2WQMA 5HLNA 5DG5A 3LJ1A 3KXGA 4FG9A 4KABA 5IKWA 3ULIA 1DI8A 1PMEA 5CU3A 5AADA 4D2SA 2CKPA 2H96A 1PXIA 2UW8A 3PXYA 3HP5A 1YWVA 4OTDA 1QPCA 1VEBA 3DBDA 3LXPA 3R9OA 4CYJA 5JGDA 4M69A 4A07A 4L44A 5EFQA 5ANGA 3E8NA 4NKAA 5FWKK 3VN9A 4YJSA 4DBXA 2QU5A 4FV2A 2G9XA 1DS5A 2E2BA 3DY7A 3EQRA 3I4BA 4DLIA 4FR4A 4PPAA 3IECA 4PMMA 3R7UA 4AXAA 3QTSA 2O64A 1Q4LA 3FZPA 4AZEA 4BCPA 3SVVA 2ERKA 3ZH8A 2JFLA 3QHRA 4IANA 3TTJA 2EB3A 3EKKA 4DE4A 3C5UA 3FLQA 4JX7A 2WAJA 5DEWA 4KD1A 2HZIA 2CGXA 4KWPA 4PTEA 3L9PA 3P4KA 4EJ7A 1RDQE 3TNHA 2ITWA 3WF6A 3QRIA 1XQZA 5CI6A 5IPJA 3V5PA 4CG9A 5CF6A 4FSTA 1Q41A 5JKGA 4FKLA 2C3LA 3GCUA 4GG7A 3HMMA 3BU5A 4IAIA 1PXPA 2CN5A 4ZK5A 3GOKA 3Q9YA 3NVKI 2BHEA 1U46A 3G2FA 3N4VA 3CJFA 3NUNA 3UMXA 2YJSA 2HK5A 4TN6A 3JXWA 2F7ZE 3DK6A 5AR7A 4L00A 5HX8A 5FP5A 2PYWA 3R0TA 4X2KA 2G1TA 3AC4A 1S9IA 3AMYA 4CG8A 4RIWA 2JAMA 2YCQA 2E9OA 3PXQA 4TYIA 5AWMA 3N4TA 3KXNA 1WVWA 3PPZA 4FSNA 4UMUA 5CVGA 3FJQE 2Q0NA 3HVCA 5JN2A 5I4NA 4IC7A 1TVOA 4GK4A 2JAVA 3EZVA 3Q5IA 4JBQA 3RCJA 2R3GA 4IVCA 2UZUE 4UWCA 3ROCA 3Q9ZA 4WSYA 5ANOA 5FGKA 4F7NA 4L67A 1J7LA 2OI4X 4L42A 4AT3A 3ZDIA 1T45A 4FSWA 4W8DA 4CNHA 3R6XA 4GUBA 4FNYA 3TZ8A 3VVHA 3EN4A 4NFNA 2QG7A 3BYUA 4BR3A 3OS3A 5BYLA 2WTVA 4YP8A 4YBJA 1GZ8A 1M52A 3LVPA 4G5JA 5FBNC 3UZRA 5DBXA 3E7VA 2ONLA 3HP2A 2GQGA 3QTRA 2JEDA 4PPCA 5JFVA 1GY3A 3WE8A 3QKMA 5IZFA 4HGLA 3F9NA 4FIFA 4USDA 3PWYA 5GJFA 4EOJA 5FM3A 3T3UA 4XNEA 3NUSA 5J9ZA 2CHLA 4QYGA 4WNPA 1J3HA 1IA8A 2JKOA 4MXOA 4K1BA 4G3EA 4OTRA 4II5A 4DH8A 4FEUA 4X3FB 3GUBA 2J0KA 4AZTA 4QMYA 4EC9A 3FMKA 4FSMA 4JS8A 2Y6MA 3HMOA 4XLIA 4FNWA 4HNFA 3RTPA 5M53A 4B7TA 1W7HA 5I3OA 2F2CB 5D11A 2QKRA 2JLDA 1UV5A 2PWLA 4IWQA 4OUCA 5DN3A 2IVUA 3R7GA 4DFZE 4F0IA 2ITTA 4O0WA 5H2UA 2UVXA 1B6CB 5I0BA 3MVHA 2BKZA 4JQ7A 5KE0A 4CZYB 2WFYA 3ENMA 3IO7A 4YJPA 4EH6A 4D2TA 4C38A 5EI2A 1A06A 4BWKA 5LVOA 2GHMA 4YTFA 4MYGA 2CGVA 4RWLA 4BKYA 4R7IA 4KNBA 4DGGA 4OTQA 2E9PA 2XUUA 1PHKA 2DQ7X 3ZBXA 2X7FA 3GEQA 1O6LA 2BFYA 4ALVA 4M13A 2VWBA 3RJCA 2HW6A 3P78A 4C3RA 4L68A 5KBQA 5CU4A 5KMIA 3ELJA 4EI4A 3EJ1A 2XK3A 5DR9A 5HG5A 5IQFA 2WIPA 2XIYA 3TIYA 3UVRA 3VUTA 1ZYCA 4M15A 2VWYA 4PF4A 4YC3A 3OBGA 3O17A 4AA5A 3EMGA 2JIIA 3QLGA 4UMRA 3UPZA 3E92A 3RI1A 4OTFA 4E6DA 1RJBA 4O7ZA 5CX9A 4AGWA 2W4JA 4JRVA 5JFWA 5E8TA 4HCVA 4WD5A 4MK0A 4G31A 4LFIA 3D5UA 1GZNA 4M66A 2YDIA 3KL8A 3O0GA 4FTCA 1SZMA 2W9ZB 1YXUA 2YIXA 3RAWA 4UN0C 1BMKA 2J5FA 4DH7A 4AW5A 1YRPA 3EQCA 1Q8WA 3LM0A 3A4OX 5CQWA 4BDEA 4FYNA 4U97A 1Q3DA 3RWQA 3COMA 2W4OA 4XRLA 3ZLYA 4FF8A 2J9MA 3ZBFA 3W2CA 4F09A 1FOTA 4DLJA 2IG7A 4FTRA 4H58A 1XWSA 4O0TA 3QTQA 2Y9QA 3EHAA 3KXZA 4C59A 3ZLSA 3EYHA 4ZP5A 3R04A 4C2VA 4CKJA 3UNKA 5FQDC 2FYSA 3P79A 2OIBA 4YPSA 2Z7RA 2J50A 5FTOA 4YZBA 5GNKA 2BAQA 5KBRA 3K5UA 4O21A 4E6AA 2OSCA 3UOJA 4O6LA 4FTNA 1Z9XA 2B55A 2G15A 3GCPA 5EHYA 3BZ3A 3KXMA 4GT4A 4KS8A 4ZJIA 4BDDA 4EHZA 5HU9A 2J5EA 4X2GA 4E73A 4D2PA 4I4FA 3FKLA 3Q9XA 1OIYA 5FG8A 4EH4A 3ANRA 4P90A 5J1WA 4AFJA 4ZIMA 4D1SA 4Y8DA 4ONAA 3LAUA 4GIHA 3G90X 5CS6A 5EYDA 3UVPA 2QR7A 3GQLA 2YABA 4HPTE 4EH3A 2KULA 4GK2A 2YHVA 2BKKA 5M07A 5FEQA 4XV3A 3CTHA 2PUIA 2GNIA 3QRUA 4D2WA 3U6IA 1E9HA 4GT3A 3EL7A 3BV3A 4QP2A 3VRZA 4IB0A 3UYSA 3R83A 2WGJA 4A9RA 3JYAA 5TR6A 3ORKA 3F3TA 4DCEA 3FI8A 3BWJA 3AD4A 5IUIA 3WF5A 3JR1A 1OVEA 4P5QA 3O7LD 4AU8A 4RJ4A 1Q61A 4DH3A 5A46A 4RBLA 4N6YA 4UV0A 2GPHA 2VO0A 3IW8A 5CVFA 3FUPA 5HO8A 5KHWA 1JNKA 1H1SA 3B8RA 3VNTA 3ORLA 4ASDA 3FAAA 4BF2A 3CE3A 1UWHA 1BKXA 4FSYA 4QOXA 4B9DA 4BKJA 3MA6A 4IJ9A 2JKKA 4GKHA 3QTIA 4EH8A 2W1FA 5AIRA 3VHKA 2X4ZA 3OCTA 2XRWA 5FDXA 3W2SA 5IEXA 2GFCA 2OW3A 3MFTA 2J0MB 5A9UA 1J7IA 3POZA 3UO4A 3TNPC 3DAEA 3CY3A 3F3UA 4IZ5A 4U43A 1OIQA 3Q32A 5TF9A 2V0DA 5HGIA 4UMQA 1ZOEA 3KRRA 4M0ZA 1JPAA 2VGPA 3LKMA 3NW7A 4KIKA 2C3KA 4FKVA 4FVRA 4WG5A 3O51A 4DGLC 3QKKA 4ZMFA 5EKOA 4TPTA 3R71A 2XB7A 3DQXA 4ITHA 4O0VA 3ZZEA 3OUKA 3QU0A 3C50A
chains in the Genus database with same CATH superfamily
2GHGA 3IW7A 1G8SA 4QMNA 2OFUA 4JDIA 5K9IA 3GC7A 1GNGA 1M2QA 3VO3A 4AOJA 3QQKA 3ZRMA 2C6OA 4PV0A 4F64A 5BQ0A 1GIIA 4QNYA 3AT2A 4MBJA 1REJA 1OKVA 3JY0A 3MTFA 2RSVA 3UIXA 3ZDUA 5I9WA 2IZTA 2NPQA 4KINA 4EH5A 4ZAUA 2YIWA 3E88A 3FHRA 2YAAA 3ZFXA 1O6YA 5IQBA 4AACA 3HKOA 4BHZA 2KTYA 2I40A 4PY1A 2XARA 4IX5A 3C0IA 4EC8A 4BCHA 2F57A 1X8BA 4QP1A 1KE8A 3PSCA 4FKTA 4YZNA 3BWFA 1M14A 2QCSA 3D4QA 2OF4A 5CAPA 4Q5EA 3SXSA 1YHWA 4LQMA 1VYZA 2IVVA 3CY2A 3WZKA 1FBNA 4NM5A 4U79A 5AR3A 5F4NA 4ITJA 3K3IA 4CMTA 2VTQA 4FL1A 2VTMA 4QYEA 5E8YA 5B7VA 3CKWA 2OGVA 4G6LA 4U0IA 2LGCA 3LIJA 5AP6A 5M55A 1Q8TA 4ASZA 5E8ZA 5KMKA 2OZAB 4O0RA 5HBHA 5C01A 4USEA 4IADA 4BWPA 3MJ1A 4FZAB 4UBAA 4AOIA 3V04A 3CTQA 4QNAA 3DAKA 3QCSA 4FNZA 2R3OA 4PWNA 3RMFA 5AFVA 3BYSA 3FY2A 3PPJA 1ZYJA 4F9AA 2I1MA 3GCVA 4TY1A 3RK5A 2XH5A 2HAKA 3P9JA 1NW1A 4FE2A 2R3PA 4BC6A 4FV6A 4C0TA 4H3QA 4CQGA 4RFZA 4PTCA 3R7VA 4CV8A 3S00A 4K8AA 4D4VA 3S0OA 1Y8GA 4FTLA 3NNUA 5C8KA 4FA2A 2W05A 2UZEA 3ZZWA 2QHMA 1Q62A 4ANSA 4XUFA 5IQEA 3U9NA 3MESA 5EOLA 4F1TA 5LMKA 4QMPA 4APPA 4KBCA 5JRQA 3PIYA 3ODZX 4YLKA 3NDMA 1MRUA 1V0BA 3NCZA 4W4VA 1JWHA 2XNGA 3CC6A 4UMTA 3SOCA 3HL7A 3S4QA 4MWHA 2B53A 3W32A 4U42A 2G01A 4P2KA 2GNJA 3M2WA 3MVMA 4ALUA 5KKRC 3MPAA 4RT7A 3OWLA 4WNMA 3QRKA 5GZ9A 4K18A 4YLJA 3LCKA 4AGDA 3MSSA 3ZU7A 3FMJA 1K3AA 3F69A 4IFGA 4L52A 5ETFA 2ITPA 4XG3A 4WSQA 3QRTA 2OBJA 4OT6A 2PK9A 3OHTA 1YXVA 1PMNA 1OIRA 5DRBA 2OF2A 3HV5A 3JUHA 3UQGA 4E5BA 4O7TA 2ZV2A 3GC9A 2XNMA 4EONA 2VTTA 3I60A 3MA3A 4ZOGA 4BI2A 3QZGA 4G16A 3G5DA 5HD4A 3GC0A 5IMXA 3DFCB 4ZMEA 4JQEA 3GB2A 4TYHA 4UYNA 4IIRA 1E1XA 4EJNA 3TJDA 2BIKB 3R8VA 1HOWA 2BZJA 4OTIA 5IF1A 3QBNA 2C6TA 3KK9A 3LHJA 4CCBA 3OCSA 2YN8A 4DITA 2GTNA 3EQDA 4QTCA 3BBWA 2I7QA 4CKRA 3IPHA 3PY0A 3KQ7A 2OO8X 4D4SA 3CPCA 2VNYA 3FL4A 3DTCA 4FZFB 4GIIA 5DLSA 3E8CA 4MQ2A 4EWQA 2X6EA 5M09A 1H1RA 4U6RA 3PLSA 5E8VA 3SRVA 4ZJVA 1YKRA 2C0TA 3PFQA 5IUHA 4NUSA 2VWZA 4DHIB 4C2WA 1XH9A 5LCJA 3GT8A 3FMNA 1UNGA 2YCFA 2PE1A 1KV1A 1U4DA 4Q9SA 4Y46A 5CU2A 3W1FA 3W0PA 5HO7A 1H28A 2WU6A 1Q97A 4DBNA 4CLJA 2PVLA 3QGYA 5EYKA 3I79A 3HUCA 4PMPA 4O2PA 4USFA 4R3CA 3PXZA 3U9CA 3C4CA 5BVNA 5CEMA 3LCOA 5BYZA 3OCGA 2HWOA 2O5KA 4AW0A 4EEVA 3F82A 4YZ9A 5TT7A 4FEQA 4KUJA 3GP0A 3RK9A 3RPYA 3AD5A 4FTMA 2JDTA 3PG3A 2R5TA 1ZZ2A 1XH7A 4C4GA 2VNWA 5BYYA 5GHVA 1TFFA 4NSTA 5H3QA 4L46A 1OZ1A 3NGAA 3V51A 2UV2A 4RIXA 2WQEA 4DDGA 1A48A 2Q83A 3UIMA 4BDIA 3HNGA 1NY3A 1FGIA 3E64A 1UWJA 3RPVA 4FRFA 4HYHA 4I94A 5CVHA 3SHEA 4F9BA 4O7LA 5B2MA 4OBPA 4ASEA 3VW6A 3PXKA 3NR9A 3PXFA 4ANOA 1OBGA 4WRSA 4XP3A 5A4EA 2XF0A 4X3FA 5J87A 1Q3WA 4FKPA 2C5XA 4CFWA 3QKLA 3HAMA 5IUGA 4NM0A 2ZV7A 2R3LA 4F1MA 4FV4A 3KXXA 5H8BA 3WZJA 3O8TA 3G0EA 5B2KA 1BI8A 4F70A 3R7IA 2PUPA 2XEYA 3R00A 4LV5A 2BALA 3F3ZA 4ZTHA 4YJOA 2B9FA 5IDNA 5L3AA 3AGLA 3SAYA 3MIAA 4P7EA 2XIZA 4QMVA 1IAHA 3UO6A 3F7ZA 3ORNA 3W2OA 5J5TA 3BYOA 3F6XA 2JDSA 2BCJA 2Z7LA 2YWVA 3T3VA 2Z60A 4FV0A 5HLWA 2XBAA 3UE4A 3V8TA 4C3PA 2QU6A 3Q4ZA 1U54A 3HDNA 1O9UA 3QUEA 1CKIA 5H9BA 2WKMA 4QO9A 5GJDA 4NJDA 4E93A 4NKSA 3C5IA 2ZV8A 1G3NA 1UU9A 4C62A 3BHHA 2HZNA 2BFXA 3ZXZA 4F4PA 5GIOE 4AS0A 4HYUA 5CANA 3PJ8A 4XG2A 2P2HA 5HE3A 4RRVA 5E1SA 2OJJA 2R64A 4HGEA 2C5OA 4PUZA 3G9NA 1UKHA 2C6DA 3NYVA 3FQEA 3H9OA 1ZYSA 4NK9A 3PVBA 3KRLA 3OOGA 4ZS0A 4I5CA 2XKDA 2QONA 2WMBA 4M8TA 3TN8A 4FTUA 2OWBA 5ETCA 4O2ZA 1H1QA 1ZLTA 3DZQA 2PUNA 2UW4A 1ZY4A 4LUDA 3UQCA 5HZNA 1ZMVA 2FH9A 3GC8A 1QMZA 3NMUF 3WARA 2CLQA 2DYLA 2YM7A 5AP5A 3LFFA 1OI9A 3U8WA 2HCKA 4PMSA 3PY1A 4QTBA 1GZKA 2H9VA 3DNEA 3O23A 5L8JA 2AUHA 2WTJA 5CT0A 1OB3A 5K5NA 4L6QA 1NT2A 4MNFA 3VS4A 1SVHA 2WMRA 4H1MA 3LLAA 3Q6WA 3ALOA 4ZZMA 4AXDA 4XBRA 4BYJA 4JQ8A 3FXWA 3IS5A 4BJJA 4A9UA 3SXFA 3Q53A 4YZMA 2YLEA 2EXMA 4BDBA 3LQ8A 1ATPE 4EOPA 3QCXA 2UZOA 2WELA 4I22A 4KA3A 3ZMMA 1K2PA 1OITA 3OOMA 4J53A 1KOAA 4NTSA 4N70A 5F1ZA 2E9VA 4HYIA 2P55A 3KRWA 3LCDA 2XIKA 3PSBA 2ESMA 3FL5A 4GW8A 4YJVA 3TZMA 3SXRA 5IISA 3W33A 3OEZA 3NUPA 1BX6A 1S9JA 1PXNA 5AJQA 2BTRA 2UZTA 4FUYA 5D10A 3T9IA 3GFWA 3RAIA 3R8PA 2BUJA 3B2TA 5CEOA 5KNJA 4JAJA 2P3GX 3L9LA 3W18A 1QCFA 2XJ1A 3W0RA 2OJFE 3W8LA 2NO3A 3R9DA 1CM8A 3C4XA 2Y4IB 2ZB1A 3MYGA 4ITIA 4MWIA 4RWIA 2PVNA 2PVHA 1JVPP 3EN6A 1UKIA 3WBLA 4K33A 4BCJA 1XBBA 5DRDA 2QOQA 3ULZA 5FXSA 2WTWA 3P08A 4BTJA 4HVGA 3BCEA 4IVBA 4ARKA 5GZ8A 4QP4A 1PXOA 4L3LA 1NXKA 1B39A 3ZOSA 3ERKA 2YISA 5C9CA 2ACXA 1KOBA 1MP8A 5LARA 4K0YA 4IB5A 4G34A 3KULA 2QOLA 5CI7A 4WKQA 4JL9A 4BCGA 3RPOA 3N9XA 3TKIA 4I1ZA 4W4XA 4RVTA 3O50A 3KVXA 3FYJX 3LE6A 1AD5A 2JBPA 2YDKA 2CNVA 3O96A 4WIHA 4IAAA 5EHOA 2WMWA 4FIEA 2HWPA 1Q24A 2V5QA 3OP5A 1OL6A 1H0VA 5D1JA 5L2QA 3TV4A 1DAYA 3QXOA 2VTIA 1XH5A 3L8PA 4BCKA 2ZVAA 2IVSA 3ETAA 5HIDA 2W0JA 1ZMWA 3HV3A 3LCTA 3DLSA 4I23A 5D7VA 2RFEA 4FKQA 5LJJA 2XIXA 1NVRA 3VONA 1VZOA 2C6KA 3E5AA 2QLQA 2V55A 1OGUA 4W8EA 3TUBA 4HGSA 4AZSA 1E1VA 4Z9LA 5K4IA 1YW2A 5C4KA 4S2ZA 3MGYA 2R3IA 5LWNA 4TNBA 4EBWA 2X9FA 5JMSA 1GZOA 3QZHA 4QTDA 4H36A 3R8LA 3VC4A 1NVQA 1KSWA 3W8QA 3RP9A 2W17A 3ZSGA 4D2RA 1WBSA 4WHZA 2X0OA 2ITZA 3LJ2A 3NRMA 3QTZA 5LVMA 3FLZA 3G51A 3HV6A 4Y73A 3TWJA 1U5QA 3HMNA 4IDTA 4QYYA 1IAJA 4MNEB 3FZOA 5E90A 4ZTRA 3PUPA 1PMUA 1YQJA 2FSOX 2WMTA 5AMNA 3W10A 1UU7A 1BUHA 5KMOA 5E4HA 4J95A 5LVPA 3SOAA 3KU2A 4LV8A 4FKWA 3DB6A 3LJ0A 4D28A 3LMHA 3ZONA 4JDHA 3UBDA 4EH7A 4ZSGA 4I3ZA 2BVAA 4NM3A 4X6QC 2ZFYA 2X4FA 4Q9ZA 5TE0A 1ZARA 2GU8A 1SVEA 1Y6BA 3BEGA 3JPVA 1H0WA 4TWNA 3COKA 3E8DA 2OXYA 1P5EA 3VBYA 3EFLA 3I0QA 2PL0A 4DC2A 4MVFA 3VBXA 4OTPA 1KE5A 3QD2B 2WEIA 3EWHA 5AX9A 4A4XA 2R3MA 3ODYX 3CP9A 3A7GA 3DBQA 3I0OA 3ITZA 4C3FA 4R3RA 2NNWB 2IZRA 4DG3E 4MX9A 4ZSAA 4JBVA 5EI8A 3DBCA 5CQUA 5EK7A 2XS0A 2YITA 4HVHA 4BGGA 4I93A 3QWKA 4MXXA 3PIXA 1IEPA 4O38A 3UNJA 3EQPA 4Y5QA 1I44A 5HD7A 3R2BA 3V5LA 4E6QA 3CQWA 2WMXA 2EUFB 3FZRA 3GU4A 5AV1A 3TG1A 3VS2A 4C35A 2RF9A 2Z2WA 3DXNA 4NCTA 4BVUA 2I0EA 2GS7A 4D5HA 2WMUA 4K2RA 2XIRA 3DV3A 4C8BA 5E8XA 2BAJA 2PE0A 2X39A 5HCZA 4FT9A 5JK3A 5CEIA 5CF5A 2VU3A 4QQ5A 3UZTA 1H08A 3UZPA 5I9XA 2IPXA 3LXNA 3H9FA 3QCQA 2H8HA 4UZDA 4FTAA 2C3JA 3V01A 3QC9A 1WAKA 2ITUA 4JG7A 4KAOA 3FWQA 4BIEA 1H8FA 4FG8A 4G3GA 4OTWA 4J96A 4FKRA 4PL4A 5A4QA 5FDPA 3NVMB 1WVXA 2C0IA 4CFNA 5M08A 4EYJA 3T9TA 3TACA 1GAGA 2BRBA 2I6LA 2YWPA 3QALE 4QP9A 2B9IA 3GNIB 4QMMA 1YDRE 4LL5A 4RQVA 5JFSA 4OBQA 4FSQA 5E8WA 4ZTQA 1H1PA 2WO6A 2PZYA 3D7TB 5IA3A 4DF3A 4IM0A 3F3WA 3D2IA 4FV7A 4QD6A 1FMKA 2P0CA 4R3PA 4AFEA 3DPKA 3HA8A 3NNXA 4IHPA 2HYYA 4QP8A 5JFXA 3DCVA 4AZVA 4DG2E 4OW8A 1OKWA 2GS6A 2W1GA 4AT4A 3KREA 5I5ZA 2Z02A 5C8MA 5IQGA 4GL9A 4IEBA 3KVWA 3PP1A 2VTOA 5JZNA 3ZCLA 4F7LA 4EZ7A 3FC2A 5M06A 3MY5A 2NRUA 1LPUA 3FQHA 5AAFA 5FEEA 3AQVA 4F9YA 1YOLA 2OXXA 3FZSA 2RIOA 1ZOHA 4GMYA 3R9NA 4H3BA 4BCIA 3SDJA 4FT5A 4NIFB 5FP6A 5HI2A 3RM6A 3WF7A 2JGZA 3GENA 4H1JA 3L8SA 3EH9A 4OGRA 4IZYA 2C5NA 5ANEA 3NNWA 3NYOA 5CZHA 5HE2A 4WRGA 2WU7A 4GT5A 1OECA 3U6HA 3BGPA 4QRCA 3SG8A 1STCE 2B1PA 2WTKC 2XJ2A 4BICA 2BIYA 1R1WA 3NUXA 2E9NA 4D5KA 3MN3A 3RINA 1J7UA 2UVYA 5DE2A 3OROA 5KUPA 5ANDA 4ZY5A 3RGFA 2JITA 4IAKA 1XBCA 3SQQA 3O8UA 4A7CA 2GNFA 2XBJA 4G3DA 3A7JA 1H25A 4UYAA 3H0YA 1CTPE 4ZY4A 4JBOA 3RAKA 2X9EA 5AP4A 3UC3A 3ZO1A 5K4JA 3RHKA 4HW7A 3M1SA 5A6NA 4EOKA 3LMIA 3UGCA 4DTAA 1XO2B 3DS6A 2VWIA 4NCTC 2UW3A 4PNKA 3Q2MA 3NSZA 3RZFA 4RFMA 3WYXA 3DKCA 4XP0A 4EHGA 2B7AA 4GYGA 4YU2A 2WD1A 1PMVA 4YC6A 3VUMA 2UW0A 3AC8A 4EHEA 5AEPA 1G8JA 2QLUA 4DINA 3U51A 3ZXTA 4FKJA 4U41A 5CAVA 1YHSA 3MPTA 4TW9A 5BVOA 2ONLC 3LFNA 4ZS4A 1QL6A 2BRGA 2VWWA 3BHVA 3WYYA 3IONA 4FTIA 3VAPA 5EW8A 3VS6A 3DKGA 1F0QA 1TKIA 1GIHA 1H00A 5EQYA 3LMGA 3PXRA 5EKNA 4MEDA 4YNEA 3B2WA 3ZFYA 4L45A 4CTBA 3NWWA 3PP0A 3UP2A 5L6PA 5CU0A 4AA4A 2HZ4A 3FKOA 3OCBA 4FTOA 4GVJA 3U87A 4YJNA 3UNZA 5BVFA 2CGUA 5AM6A 5I9UA 4ANQA 2FSTX 3AMAA 3P7CA 4JG6A 4KRCA 4RX9A 2HXQA 3FLYA 4RX7A 2PZRA 1W2DA 2I0HA 4L3PA 1SNXA 3LFSA 3ORXA 3V8WA 5EG3A 3QA0A 3BIZA 3PJ1A 4OR5A 4D4RA 4Y83A 4ZY6A 1Y91A 4BTFA 4EWHA 3ATTA 1MRVA 3R73A 3FMEA 5IMEA 2YERA 4FOCA 4AE9A 4ASXA 3ORPA 3AGMA 1PJKA 3DJ7A 4IX4A 4MD7E 4PMTA 5DOSA 3ZO4A 2BZKB 3U4UA 4B8MA 3AC2A 3E62A 5AR4A 5IA5A 2J0IA 2VX0A 3PA4A 4W4WA 3TNWA 3WI6A 4QDEA 3UVQA 4DEHA 4L7FA 2O63A 4CRSA 3JVRA 2BAKA 3Q60A 4TZRA 2WHBA 3SV0A 3DXQA 4S33A 4C37A 2FSLX 3DOGA 4QPAA 2CDZA 4DAWA 3L1SA 2VTJA 4LMNA 2JBOA 5J9YA 1ZY5A 5EM6A 2CKEA 3BGQA 5BUEA 5M4IA 4U81A 5AR2A 2QI8A 5F20A 2XK7A 2RFDA 3E93A 5KZIA 3KB7A 5AV2A 3BLAA 4FT0A 4N57A 3HRCA 3R7EA 3IDPA 2YZLA 3LLTA 1GIJA 2PUUA 2XYUA 5CEPA 4E1ZA 5HEZA 2HW7A 3F2NA 3NW5A 4H3PA 5EDPA 4I41A 4Q2AA 2BZIB 3NUAA 4MAOA 4FK3A 4ZJJA 4EH2A 3EZRA 5IH6A 3QF9A 3CS9A 5AAEA 4KS7A 4EOMA 2IZSA 2ZV9A 3EYGA 3KXHA 4FV5A 4QPSA 4V0GB 5AV0A 2UZNA 4MXCA 3ZSIA 4V04A 4DH5A 4O7WA 4YMJA 3II5A 3SD0A 3MJ2A 3SW4A 2WIHA 2RL5A 1JLUE 4KBKA 4N6ZA 3NAXA 4BCNA 4MKCA 4M69B 3VUHA 2GQRA 5HOAA 4FYOA 2CLXA 4IB1A 2VAGA 5ACKA 5JGAA 2QHNA 4LOOA 1BYGA 5EW9A 1M7QA 1V0PA 4XHKB 3FZ1A 5F95A 3IDCA 4TT7A 1WCCA 2PSQA 3C4EA 2P2IA 4RIYA 3VUDA 4KIPA 3CPBA 2R3JA 4EH9A 5ACBC 1YVJA 1ZRZA 2Z7QA 5AR5A 5HCXA 5L2IA 2QO2A 4RC3A 4EK4A 1LEWA 1MQ4A 2PY3A 2YCSA 2YCRA 5J95A 3DGKA 4YUQA 2CKOA 2W1HA 2AEGA 2QQ7A 4A4OA 5G1XA 4RIOA 4XG4A 5ANIA 5IEYA 4FX3A 4I20A 4I92A 4AAAA 1R0PA 4KB8A 2JFMA 3F5UA 4RWKA 4BCFA 3N4UA 2PVJA 3PFYA 2PMLX 1J1BA 3S95A 4D4YA 3GXLA 4R8QA 3RVGA 4E5WA 2ETRA 3Q9WA 2C6LA 3D7ZA 4RC2A 2QOCA 4FKSA 3VWAA 5M4FA 5LVLA 1Y6AA 3GCSA 3P7BA 4XV2A 3ZEPA 3MWUA 4ACGA 5AUUA 1KE9A 3LFBA 3HAVA 4MQ1A 4O83A 4O1PA 2PULA 2WQNA 3QTXA 2XNEA 2RG6A 3MB6A 4O7NA 4CFUA 3BU6A 5BUIA 1P2AA 3QYZA 3RNIA 4XS2A 2ZM3A 5JRSA 1ZMUA 3WZUA 3TM0A 3PZEA 4IFCA 3H3CA 5HO6A 5EDQA 3RALA 4IBMA 5HCYA 2W96B 4YO6A 1KV2A 4C4IA 4HVSA 3MI9A 5AV4A 4O4EA 4FGBA 2R3RA 5DGZA 2BILB 3UG2A 4NL0A 1TQMA 4EQUA 1YXTA 3E87A 1T46A 5CAUA 4JRNA 4ANBA 2VD5A 3KF7A 4D0WA 4I6BA 4QMTA 3ZUUA 2ZB0A 4PTGA 1KWPA 3AXWA 3W2QA 2DUVA 3CKXA 1YXSA 4J8NA 2QO7A 4APCA 3I6UA 3DT1A 5DH3A 3TJCA 3B8QA 4R78A 3O7LB 4A9SA 5IQIA 4HVDA 3ZM9A 1ZYDA 3M42A 2QKWB 2UZDA 3ID6C 3DK3A 4DGNA 4LG4A 3R1YA 4BGHA 3VQUA 3PDTA 2I0YA 4DEEA 3P0MA 4K77A 5IEVA 2OJ9A 4LRMA 5HVKA 3OBJA 3NAYA 3COHA 2W5AA 3AG9A 3OZ6A 3CGOA 4HOKA 4XP2A 4IE9A 4CRLA 5ITAA 3HMPA 3ZRKA 4F6UA 3A60A 4IM3A 2R7BA 4C61A 5K3YA 4R6VA 3CXWA 3UTOA 3AMBA 1H1WA 4G3CA 2JKQA 2PE2A 2WMQA 3BYMA 5EDRA 3UPXA 2OIQA 2GHLA 1Z5MA 4IXPA 4BZOA 2W5HA 2RFNA 5E1EA 4I5PA 5HBEA 4JNWA 3MY1A 2GDOA 4GJ2A 1FINA 4RZVA 5HIEA 3BYVA 4LV7A 1Z57A 5A4LA 4DHZA 2YM6A 3BRBA 4UWYA 4GV1A 2XNPA 2BRMA 2A1AB 4M67A 4DCAA 3QYWA 3MDYA 1J91A 4U40A 3VUIA 1M2RA 3HX4A 4FV3A 5B2LA 2XAMA 3ZO2A 5L4QA 3PWDA 2B9JA 4O27B 3GGFA 5LMAA 5IQCA 2GS2A 4ZSEA 3TMOA 5C4LA 3PYYA 5HTIA 4LYNA 4FTKA 4FEXA 4FKIA 2EXEA 1JKKA 3I81A 1OBDA 3NYXA 3CJGA 1QPJA 2NP8A 3MTLA 2UW9A 3QL8A 2BZHB 4GEOA 4YNOA 4AZWA 3LFCA 3ORTA 3KMWA 4LMUA 5BVDA 5FBOA 4RJ8A 4J8MA 2QOBA 4FZDB 4DG0E 4H05A 3WE4A 3LZBA 4XV9A 4YJQA 1EH4A 1RE8A 2XKEA 4UWBA 4AOTA 1FQ1B 4RJ3A 3GI3A 4XLVA 3UDBA 3TDWA 5AM7A 4ENYA 3BLQA 3FXXA 5BNJA 4KBAA 2X7GA 4Z16A 3ML1A 4F6SA 1WBTA 2C0OA 2VO6A 2PMNX 4QT1A 2WEVA 3KKVA 4FKUA 4NWMA 5KO1A 3UQFA 4JMQA 4DFBA 2WQOA 2JD5A 3KN5A 4HPUE 1SM2A 4TRLA 4RLLA 4D55A 3VRYA 5FEDA 1UA2A 2B54A 1PF8A 1ZZLA 4CZUA 3NS9A 4QMQA 3VQHA 4FI1A 4JR3A 2BDFA 4BBMA 3NIZA 5IQAA 1PXMA 1UU3A 2Y4PA 4O4CA 1ZYLA 2A19B 1ERKA 4RVMA 1YI3A 1U59A 4WT6A 4X2JA 2VO7A 5HORA 2QC6A 2H34A 2F7XE 2XVDA 5L2SA 2BHHA 1SMHA 2VN9A 3WZDA 4GU9A 3REPA 3SKCA 2W4KA 1R0EA 2CGWA 4I6HA 4NU1A 5J7HA 4BDCA 3PG1A 3BE9A 3FHIA 3FMMA 5EHLA 3TDVA 5LMKC 2UW6A 2W1CA 5KMJA 4ORKA 5KMLA 1G8KA 4BIDA 3QRJA 2XYNA 4PL3A 3TKUA 4BBFA 3OMVA 4ID7A 4RJ7A 3P5JC 4XBUA 4G6NA 5HE1A 5BMSA 5CSWA 3Q2JA 1UU8A 2OU7A 3PVWA 1H01A 4LGDA 3R1QA 2HENA 4WA9A 4CD0A 3CBLA 5CF4A 3CSVA 2W9FB 1YHVA 3FEGA 2O0UA 2YDJA 2XANA 1H4LA 2FUMA 2VX3A 4NW6A 4F08A 3VBWA 4F6WA 4L43A 2AC3A 5JGBA 1PXJA 4BZNA 5DMZA 3PJ3A 3GFEA 5BMMA 3F7WA 4KIQA 2G2FA 3A7HA 4M84A 5DI1A 3L9MA 4YSJA 4FK6A 3FI4A 4RWJA 4EYMA 4GYIA 4GJ3A 3SA0A 3BL7A 4IC8A 5DHJA 4U80A 5HQ0A 5EH0A 2OZOA 5E7RA 4DFLA 3UOKA 3MH3A 4BL1A 2WTCA 1URCA 4WO5A 4CLIA 3CQUA 2WMSA 4BDGA 4U8ZA 3ZO3A 1MQBA 5KCVA 3D83A 3TIZA 1H24A 2C5VA 4NW5A 4JX3A 4FT7A 2UZVA 4GUEA 2CN8A 3LFDA 1JKTA 3G33A 1LP4A 3TCPA 2J51A 2JKMA 4UXQA 1WBPA 4AP7A 2HY81 3BHUA 2OH0E 4LM5A 1HCLA 2WPAA 3F2AA 3ZS5A 2PU8A 3F88A 4YHFA 2R3FA 2CCHA 3KRXA 2QOFA 1W82A 4G1WA 5DNRA 4R77A 4ZTMA 5A6OA 4EK3A 3PSDA 5L8KA 3MFSA 1CSNA 4YHTA 4BDKA 3UDSA 3KK8A 4DH1A 4FMQA 3EQGA 3LW0A 5E8UA 5CZIA 3DKOA 2PHKA 4QDVA 4W4YA 3FLWA 4PX6A 1JBPE 4DTBA 1P4OA 5EYMA 2F9GA 2R2PA 4MHAA 5GIPE 1JSTA 3QX2A 3OD6X 2UW7A 4C4FA 3AOXA 4WUNA 5KKRB 3WILA 2PVFA 5B0XA 3D14A 2RG5A 2UUEA 3FSKA 3HYHA 4O96A 3OTVA 5HU3A 4M97A 2CJMA 5AP7A 2DS1A 3KCFA 4OT5A 3A61A 3OG7A 4JIAA 4AX8A 5CEKA 5IA1A 4J1RA 5CSXA 4KIKB 5AA9A 3TUDA 4QP7A 1PXKA 2HELA 3GOPA 3ZTXA 4DYMA 5IG1A 4NT4A 3LFQA 5FRIA 3HRFA 2GQSA 4M14A 5D41A 4XG7A 4DFYA 2IO6A 3EFJA 3SC1A 1KE6A 3TUCA 4F65A 2ZM4A 3PVUA 2X8EA 4I5MA 4GS6A 5CENA 1OMWA 1O6KA 2VWUA 4DT8A 3OTUA 3RNYA 1G5SA 3OC1A 5CXZA 5KMNA 3TT0A 3VS3A 5IH5A 5TO8A 4X3FC 3PE2A 5DYJA 3V6SA 5F9EA 3LCSA 4F9CA 2IVTA 4TKSA 3F2RA 1PKGA 4B99A 1K9AA 3RM7A 4C4JA 1PYXA 4FV9A 3QCYA 3F5GA 4ZTSA 2ZM1A 3AD6A 3GVUA 3RAHA 4AZFA 4BDFA 2UZLA 1W2FA 4FC0A 4AN3A 4C02A 5E92A 3AKKA 5JQ5A 2WB8A 1L3RE 1YWNA 2YM3A 4FIJA 4TWOA 1JQHA 3AT4A 1LUFA 5CT7A 3UIBA 3F5PA 5CASA 3A7IA 1VR2A 2QVSE 4RX5A 4DEDA 3OVVA 2R3NA 3EFKA 3KRJA 3VJNA 5IA4A 3NUYA 2PZPA 4U45A 3D15A 3FYKX 1V1KA 3LOKA 4C57A 4HJOA 3VS0A 4OAUC 1I09A 3MPMA 4I4EA 4WOVA 5FM2A 4BDHA 5GINE 3Q04A 2IJMA 5CSVA 3R1NA 5F94A 2QO9A 1FGKA 3KMMA 4M68A 4N0SA 4FT3A 3COIA 1BLXA 4AE6A 4CFFA 3W55A 4BWXA 4RA5A 1AQ1A 2C1BA 2AYPA 4ANMA 3D0EA 3FMLA 3MFRA 1WBVA 3Q52A 1W84A 4O1OA 4LGHA 4RPVA 2R0IA 4IWPA 2YIYA 3RPSA 3QQLA 4I6Q