3HV6A

Human p38 map kinase in complex with rl39
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
349
structure length
331
Chain Sequence
ERPTFYRQELNKTIWEVPERYQNLSPVGSSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 14
publication title Displacement assay for the detection of stabilizers of inactive kinase conformations.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 108
structure length 331
sequence length 349
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2009-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3hv6A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3hv6A01
2WMTA 5EHOA 2AC3A 3AMAA 3QQUA 2C1AA 4MEDA 4NFMA 4AU8A 4O0VA 2UW9A 3QTSA 5IA3A 5DRBA 4D5HA 4JDIA 3MB6A 3ZM4A 4CRSA 4F7NA 2HOGA 3HMMA 4FKSA 4KS7A 3RMFA 4OLIA 4F70A 4R7BA 5GIOE 1ZXEA 3FZTA 3Q6WA 2XK6A 2C3LA 4X2GA 5EH0A 4BTKA 3PXZA 2XKDA 4YPDA 4RX9A 5HICA 3QX2A 3K3JA 5IQFA 3R7UA 2WTIA 3ALOA 3MWUA 5B2KA 1H26A 1OL2A 4FZAB 4UXQA 1XH5A 3COKA 3PG1A 3RJCA 4JI9A 2J0LA 2PVLA 4TYHA 5EHLA 4Z7GA 2FSMX 2QURA 4J97A 2CLXA 3KK9A 3KXHA 5A6NA 3DK6A 4ZTSA 3UIMA 3QXPA 3LLTA 5E4HA 3EL8A 3BE9A 2WXVA 3QZHA 5HTIA 3KFAA 3HX4A 5LCKA 4E26A 4JIAA 3SLSA 4O7NA 5C1QB 4UALA 4GIHA 3V5WA 2VV9A 3I7CA 3Q2MA 3VHKA 4ITHA 5AP2A 1ZOHA 3QCXA 4EK6A 3G9LX 3JS2A 2C6MA 5BVEA 2C6KA 4G6LA 5J7HA 2WTKC 4FKRA 4CCBA 2CKEA 2R5TA 2Z2WA 1H00A 4M97A 5HIBA 3R1SA 5M55A 3OC1A 2VWYA 3ORNA 5BUEA 1NVRA 2JAMA 5TE0A 3QFVA 4CYJA 3NIEA 3BLHA 3H0ZA 3SQQA 4QMTA 4C2WA 2CGXA 4J95A 4A7CA 2BFYA 2OH4A 3VQUA 3BLQA 2PVKA 1GZ8A 4XV9A 5CTPA 5G1XA 3ZRMA 4RWLA 5HG9A 3DAKA 3CR0A 1UKHA 5CENA 5TOZA 3TZ7A 3ULIA 4FODA 4V04A 3LFSA 3RK5A 4ACHA 2YHVA 5I3OA 3PZEA 4BKJA 4O7TA 1VEBA 5IQDA 2NPQA 1OITA 3WZDA 4XG9A 4Q5HA 3IOKA 3RBWA 3KULA 4JAJA 3VS2A 4W4YA 4A9YA 4CKJA 5B2MA 2XKEA 4GJ2A 5E1SA 4BDDA 2OFVA 2PZ5A 3MA6A 4QT1A 4XEYA 4Y46A 5HE3A 3OBJA 4IB3A 3Q2JA 1OBDA 2X2LA 5CAUA 3GCVA 4AGDA 4S32A 4WNMA 1RW8A 2BHEA 3OW4A 3PZHA 4HGEA 4ZJVA 3LMHA 4I1ZA 3GCSA 3R6XA 1P14A 2X9EA 4I24A 3MS9A 1Q41A 4EH4A 4DFYA 5CF6A 1U5QA 2C6LA 2R3IA 3NW5A 3Q04A 3WF6A 4J7BA 3ZBFA 2NRUA 3EKNA 4YHJA 1KSWA 3P7BA 3LFEA 3AMBA 4I21A 3OW3A 4LMUA 4MD9E 3S1HA 5CZIA 5M07A 4KSQA 2DWBA 4JR7A 1LUFA 3PVGA 3NUUA 3VS4A 4YJNA 3PTGA 4ANMA 4FF8A 5EYDA 3LCTA 4MVFA 4RVTA 1YW2A 3FLWA 2WB8A 3G9NA 4PTGA 2XA4A 4NTTA 4RQKA 2RG5A 4MXXA 4FV5A 3DGKA 2X39A 4EORA 4O91A 2ITYA 2CCIA 3F6XA 3FEGA 2WQBA 4IE9A 4YLKA 1ND4A 1QPEA 4RVKA 4FKJA 3R7GA 5CZHA 5AM7A 1H08A 3F5GA 4X3JA 3GOPA 4FSYA 4GH2A 4KIOA 5TR6A 4AGUA 4YBKA 3G51A 3HL7A 4K6ZA 3FI8A 2QI8A 2R7IA 4IADA 3K2LA 4L3PA 5E9EA 5AP3A 5HLWA 2JBOA 3HYHA 4GFGA 5F94A 4XMOA 5GJDA 2UW3A 4RT7A 4ZMEA 4RX8A 4UBAA 2OXYA 4U81A 4GG5A 2JKQA 4PV0A 3PJ1A 3QA0A 3UG2A 1WVWA 1IA8A 4EI4A 4MBLA 4HNFA 4JQ7A 4C33A 1U59A 4DLJA 3AD4A 5IDPA 3FI2A 3KK8A 3MFUA 1MQ4A 5KMOA 4AFJA 2BRHA 2I0HA 5LQFA 1S9JA 2BKKA 1MRUA 4JBOA 2JD5A 2HZIA 1ZY4A 4MCVA 3KN6A 1YOLA 3R2YA 4NL0A 3KRWA 2VAGA 4BCKA 3SG8A 3EQHA 1DM2A 3EWHA 2EVAA 3IONA 3TXOA 1PMUA 3MFTA 3EFJA 3CPCA 3QLFA 1YWRA 4MWHA 3QHRA 3NNXA 3VBVA 3IW5A 5FXRA 2QNJA 3KXGA 5CAOA 5AMNA 5M4CA 5IUGA 3AC3A 4ACGA 3H3CA 4NZWB 3DOGA 5CT0A 4CG9A 4Z7HA 2YCRA 4XRLA 4LOOA 5GZ9A 2G9XA 3F66A 1YWNA 3R21A 1FVTA 4DG3E 3R04A 4P7EA 3TI1A 3BHHA 2JC6A 3QTUA 4DEDA 4HYIA 2BRGA 2VN9A 1SVGA 3JVRA 2JITA 1ERKA 3BYMA 2OG8A 2VWVA 3RCJA 4YHTA 3KREA 3U54A 3PUPA 3G6GA 3PSBA 3DJ6A 4HJOA 1G8AA 2XB7A 3IOPA 3UYTA 3FLSA 3ANRA 4RPVA 5CI7A 2B9HA 2Y4IC 4FTAA 4PMPA 4AT3A 2A4LA 3L8PA 4MQ1A 4CFMA 4O0UA 2OK1A 4H3BA 4DH5A 2C5XA 3Q5ZA 3F5XA 3ZUTA 2BZKB 3A61A 2C5YA 4EOJA 2XNMA 5DPVA 3F3UA 3QXOA 5ITAA 4FYOA 4BDIA 3CKWA 2EXCX 3V8TA 4E5WA 3COIA 3O2MA 2R2PA 3ATTA 3R0TA 4C7TA 2VWUA 3MJ1A 4JOAA 1UKIA 1URCA 1GZKA 4PUZA 3VAPA 5K0KA 1MP8A 4DFZE 3ROCA 1ZWSA 4F9WA 3F2RA 3LFNA 3DAEA 2JDRA 4FV7A 3TV4A 3DBCA 4YO4A 2OW3A 1JPAA 5FUTA 3UO6A 5GIPE 2ZDUA 4FG8A 3R00A 4RJ4A 5HX6A 4O7YA 1JWHA 4FIHA 5D11A 3PVBA 3WF5A 4CQEA 2C3KA 3W55A 4RFZA 3D5UA 3E5AA 4TXCA 5ACBC 2W5BA 4FTOA 4D58A 5IEYA 1TQIA 3FMMA 4ZJIA 3QC9A 4EOLA 5EI2A 5K4JA 3ENHA 2YITA 1Q62A 4O7ZA 2WQEA 4OTHA 4ZLZA 4ASDA 1MQBA 4BBFA 2JIIA 3VUHA 3DT1A 3PP1A 3BZ3A 1ZYDA 2X4ZA 5IH4A 5F4NA 3RAWA 3A4OX 4O7SA 4X6QC 3TEIA 1H8FA 1NVSA 4H36A 1XKKA 5AV3A 5DNRA 5D7AA 2VTTA 4G6OA 4AA5A 2VWXA 5C4KA 3A2CA 2GNHA 5HI2A 1GZNA 2WPAA 4C35A 3IW4A 4G34A 2QOHA 2WIPA 3QRKA 2ZV9A 1XH6A 4PMTA 1E1VA 3V6RA 4L67A 3UDBA 2JKKA 2ZV7A 1XH7A 2WU7A 3GXLA 4O82A 2C6EA 3SG9A 3KXNA 4FX3A 5D7VA 4ORKA 3PY3A 5EDQA 3AT3A 5ANJA 5E8VA 3QD2B 1W82A 1XH4A 2G2IA 4GG7A 4IDTA 3QTXA 4F9CA 5KBQA 3UPZA 5FEDA 2A19B 4LV5A 4UMRA 3QYZA 4JQ8A 3LQ5A 2YM4A 3H9RA 3MTFA 2WAJA 1JAMA 4X3FC 5HD4A 5L3AA 4GYIA 4EYJA 3W2PA 2UVZA 4FZ6A 4G16A 5HD7A 3R7OA 4KRDA 1MRVA 5J87A 2PZPA 1W83A 3WF9A 4WO5A 4FTUA 1U54A 3OCSA 3FQEA 4XCUA 3GEQA 1KE5A 3MPAA 2PHKA 3R9HA 3VUIA 3HP2A 2B9JA 3OCTA 3UJGA 1F3MC 1WBPA 1U4DA 3L9LA 4FZFB 4OTWA 1KOAA 3OBGA 5BX0A 3PG3A 5DVRA 3A99A 3D83A 3QRJA 5CVGA 4RA5A 4RZVA 2WMWA 1OVEA 3UE4A 4KNBA 4EK8A 3KKVA 2PU8A 5HEZA 3NNUA 4H05A 3ODZX 3TUBA 2H34A 2XIZA 3DXPA 3PE2A 3ZO3A 4P5ZA 1YVJA 5C03A 4XP0A 3C4XA 4GUEA 3GBZA 4AN3A 4BC6A 4OTGA 2W5AA 4QMUA 3QALE 3HV5A 5ETIA 2NNWB 1V0BA 1CKJA 4D1ZA 2C69A 5BVOA 1IR3A 3R9NA 2OJFE 2V55A 4YBJA 1YOJA 1NY3A 3UC3A 5CX9A 1OZ1A 2V7OA 2Z8CA 5JN2A 4F9AA 2C5VA 1JSTA 5J79A 5AV2A 3I5ZA 4RZWA 2PMOX 3ROYA 5AEPA 1WMKA 1PXMA 1YXVA 2O65A 3EN9A 4HCTA 3LQ3A 3I1AA 4FKGA 3D0EA 3W18A 1KV1A 4C02A 1BL6A 2X7OA 3HMOA 1TQMA 3KRLA 3VC4A 2WMBA 3ZEWA 2CN5A 3OUNB 4D4SA 1WFCA 2OXXA 4GKIA 1UU7A 4GT4A 2Z7QA 4EH5A 2F2UA 3EFKA 3RZFA 3OTVA 3ERKA 3JY9A 4FKVA 3RPRA 3MH2A 5TKDA 2ZAZA 3AC4A 2JAVA 3DXNA 3QWKA 4RIWA 3W2RA 3ZLWA 5CNOA 4FTMA 4PP9A 5EQEA 4IBMA 1J1BA 4BYJA 1FMKA 4E8AA 3F3VA 4F1TA 5KHWA 3ZLXA 4EWHA 5FDXA 4PDSA 1QPJA 4H3PA 4KIKA 2W4OA 3FI4A 3HV6A 3E64A 3HLLA 3BGZA 4DGMA 3QWJA 4EOKA 4IAZA 5L8LA 2ITZA 1Z57A 4MQ2A 5BMMA 2HW7A 5E8SA 3EL7A 4UWCA 4OTFA 3W2OA 3NEWA 2ACXA 3DS6A 2V62A 3B2TA 4GV1A 4ANOA 2R4BA 1I09A 3U55A 3HKOA 3L9MA 4FIEA 3UVRA 3MW1A 2YWPA 4OAUC 5F20A 4KKGA 1M52A 2NO3A 3OEFX 4BBEA 4GRBA 4HYUA 4CMTA 2O3PA 5L2TA 3ATSA 4EK4A 4NJ3A 3R1QA 3QLGA 2ITPA 4YJOA 3IGOA 4UYNA 4OTDA 4J96A 5HORA 1LEZA 2E9OA 4AZTA 2BUJA 1SZMA 1IAHA 4MK0A 4MH7A 4EZ7A 3PLAE 2LAVA 5GINE 1WZYA 1Y91A 2I7QA 2BRBA 5FGKA 2B55A 2VO3A 2WMXA 4ZIMA 4FKLA 3SOCA 5A46A 3SW7A 3UZRA 4A07A 4EC8A 5B2LA 5I9WA 4HOKA 1R78A 4BCIA 2F7XE 3GUBA 2QLUA 1UV5A 3ZZEA 3PRIA 4Q2AA 4EH6A 3LIJA 2YLEA 3GFEA 3RI1A 2EXMA 3TKHA 4FGBA 2W9FB 4IFCA 2VNYA 2E9UA 4QTAA 3Q9YA 3C51A 4BF2A 4BWKA 1S9IA 2YIXA 4YZ9A 2UZEA 4UN0C 4HGTA 2IW6A 3UIXA 2ONLA 1SVHA 4NM7A 4QQJA 5KE0A 4BHZA 1K9AA 2YISA 4NU1A 2OZAB 4O6EA 4FIIA 3FV8A 3HZTA 3RTPA 5FDPA 1VJYA 2BROA 2VNWA 4LOPA 4J98A 4PPAA 5AUVA 3JUHA 4KBKA 4ANSA 2OGVA 3QTIA 3VQHA 5AV4A 2W1CA 2XK7A 3HGKA 3VIDA 1OKYA 4MNFA 1XO2B 2G15A 2R3KA 1CKPA 5AAGA 2R0UA 3A7HA 3GU8A 4IEBA 5EM8A 3E63A 5LJJA 2XBAA 3CD3A 3MY0A 5LOHA 5JGBA 5E8YA 3NCZA 4QMPA 4MNEA 2HENA 3MA3A 2Z7RA 4FV9A 4QP6A 4QTCA 5AUZA 4YMJA 3MVHA 2J5EA 2VZ6A 4QMWA 2G2HA 4MKCA 2BDWA 3EN6A 3FE3A 3G0EA 4NJDA 3UOLA 2YDKA 3HNGA 4M14A 3WE8A 4R78A 1JKSA 4QMVA 3HP5A 3IDBA 4AN2A 4XG4A 4C3FA 1FPUA 1VZOA 4LFIA 4D4YA 2GHMA 2R3JA 3UMWA 3BU6A 4ZY6A 5ETAA 2F57A 4IB5A 3ZRKA 1W0XC 4D4RA 5BYYA 3PP0A 1R1WA 2CKQA 2JIUA 4G17A 4IZ7A 5AR8A 4I0RA 4A4LA 5AUYA 5AX9A 4C3PA 2C47A 4KBCA 5EKNA 5L2SA 2I1MA 3H9OA 3CIKA 4D2PA 3ZFYA 4EH9A 3K5VA 3FZRA 3N4TA 2YCQA 2O0UA 4GJ3A 5FBOA 1Q97A 4FKOA 5IKWA 4IVDA 3I5NA 4U8ZA 4YJQA 5KZ0A 4DGGA 5IDNA 5GJFA 3ANQA 1PW2A 1A48A 3PA5A 1BMKA 1PXKA 3EQFA 1VYZA 2OKRA 5DG5A 5DOSA 1GAGA 4UB7A 4K9YA 4DH3A 1YHVA 5BVFA 4G9RA 2VO0A 5KMIA 3GU6A 3O0GA 2WTDA 4TL0A 5TO8A 3NYXA 4QNAA 1KWPA 3T3VA 4S30A 2B7AA 3SX9A 4EOOA 5EW9A 4E6CA 2XH5A 3N4VA 4JIKA 1RQQA 5T68A 4N57A 1DI9A 2P33A 4R1YA 5KZIA 3ZS5A 2FSOX 2G01A 5HNIX 5E8TA 2J50A 4WSYA 2HELA 4E7WA 3OWJA 3CTHA 4JX3A 2ZMCA 4BCOA 3PSDA 3UIBA 4V01A 3TZ8A 3VRYA 4F63A 4LGHA 2OZOA 3DB6A 3DK7A 5K0XA 4L3LA 4B99A 3B2WA 4DEAA 4D9TA 4FT9A 2Y6OA 2YM7A 4C4FA 2A2AA 1KE8A 4HVSA 3FWQA 2UZLA 3TACA 3L8VA 4BKYA 3GP0A 1SMHA 4LM5A 5KMLA 4WSQA 3LHJA 3MVJA 5HVJA 1SVEA 4GK2A 4I6BA 5HESA 3DU8A 4OT6A 3AC1A 1FINA 4R7HA 4UYAA 3V8SA 4BBMA 3MIAA 4OTRA 3MGYA 4HGLA 1J91A 3ZH8A 3MBLA 1H1PA 1XBCA 4FTTA 3ZFXA 4E5AX 1U5RA 2QKWB 5H8GA 3CP9A 4C38A 5M4IA 3PVWA 2CMWA 3O8PA 4XLIA 3HAMA 3AOXA 4W4VA 3KN5A 3QRTA 4YZDA 5EI6A 5HG7A 5D1JA 5AV0A 1M14A 4BCHA 3OF0A 4CV9A 4EYMA 3BIZA 2ZM4A 2QODA 3COMA 4YJUA 4O0XA 2VWIA 2F9GA 4O1PA 4I23A 4TYEA 4NWMA 2W96B 3ULZA 1GY3A 3D9VA 3UNJA 2GNIA 3JVSA 4DE4A 3FKOA 4G6NA 2BDFA 3FJQE 3DA6A 4YNEA 5AR5A 2FUMA 3WZKA 3OZ6A 4QPAA 4ID7A 4R3CA 1WVXA 4GU9A 3NDMA 4FVPA 4FV2A 4GSBA 4NCTC 3M1SA 2R3MA 3CE3A 1JKKA 4FKIA 4FNYA 4MXAA 4R5SA 2H6DA 3CBLA 3EN4A 4G3FA 4ZY4A 1XBBA 2GQGA 3A7JA 1KV2A 5AJQA 3RCDA 4FUXA 4G3GA 4P90A 3O7LD 3VBQA 2XJ2A 1PMNA 1V0PA 5AR4A 2CN8A 3UMXA 3TUCA 5DRDA 5FTGA 3POOA 4APPA 5JK3A 3NYNA 3QD3A 2FSTX 3I6UA 3H0YA 4IACA 4UZHA 2RG6A 4U6RA 3RNIA 2QOBA 4FSNA 5AP6A 3I4BA 2W4KA 1GZOA 4AUAA 4EOIA 2XIRA 4A9SA 5BPYA 3JR1A 3VJNA 4FVRA 3HV3A 3RM7A 3O7LB 2WEIA 3PXRA 5EHYA 3TCPA 2J4ZA 4KRCA 4PNIA 5CI6A 4L42A 3DNDA 5AUWA 4LV8A 3TG1A 4TRLA 3TNQB 2RF9A 2Y0AA 4YTFA 4NW5A 1GIIA 3PPZA 3BLRA 4Q5EA 2BRMA 2JIVA 3V5JA 5M51A 3TIYA 2O2UA 3UQGA 5C8KA 2J6MA 5H8EA 5KKRB 4GW8A 5KMMA 3NVKI 3AT4A 1XH8A 2WZJA 3TTIA 4EZ5A 2C6DA 3R8MA 3CXWA 3TWJA 3QZIA 5LWNA 1J7LA 4EBWA 4CZTA 3G0FA 5D41A 4Y8DA 4OUCA 4BKZA 1H1RA 3ZHPC 3I0OA 1IA9A 4WHZA 4CD0A 2B9FA 3OOGA 3VS7A 4EOSA 2X2MA 2X9FA 4NKAA 1T45A 3ACJA 3PY0A 4JG7A 5EM7A 4C2VA 3OUKA 3BHYA 4JBQA 3RZBA 4FTIA 2GNGA 4F0FA 5AUTA 1R3CA 4O7LA 2V7AA 3I6WA 4IZAA 2YLFA 2XRWA 3KC3A 4L7SA 4QTBA 5CNNA 2PZRA 3UGCA 2YZAA 4L00A 4S34A 2YWVA 3DFAA 4BI0A 3K54A 4DEIA 4Z16A 2VTNA 4II5A 2IZRA 5ANGA 4TPTA 1KUTA 2WMRA 4DFBA 4K8AA 2C6OA 2Y4PA 1LEWA 4FSZA 3QTQA 3PE1A 4MXOA 4IX4A 5ETCA 2QOKA 3NLBA 5HNBA 5F9EA 3LKMA 3FZSA 3VS5A 5AR2A 4HCVA 4BRXA 2W7XA 4HZSA 1ZLTA 3RWQA 3UC4A 3OFMA 3EQBA 3R8UA 4BWXA 5J7BA 3PY1A 5C8NA 4GT3A 3V5TA 3F3WA 4DBNA 1KE9A 3E3BX 4FTJA 5JRQA 3PWYA 3PJ2A 4H1MA 2I0YA 5AFVA 4F1OA 3TNPC 5IA4A 4MHAA 4JNWA 5ICPA 4FBXA 4FL3A 1RJBA 4RJ3A 3UOJA 2O8YA 3A7IA 1O6YA 3TV7A 3LFBA 4BCMA 4OAVB 3AGLA 3R2BA 3OT8A 4KB8A 4L68A 5DI1A 3S3IA 3CSVA 4FGRA 4AS0A 1UWHA 1XQZA 3PSCA 4OT5A 3KB7A 5CS6A 3VS6A 4IWDA 4FG9A 4Q9SA 4EH2A 1YRPA 2ETRA 4QOXA 5C4LA 2AUHA 4PPBA 2CDZA 3NUNA 4RVMA 3RPOA 3VS0A 3RALA 4C0TA 4DTAA 5E8UA 5L6WL 2WU6A 3A7GA 4U5JA 2RFDA 1JLUE 4I5PA 4RJ6A 2VWZA 3KVWA 1WCCA 4WNOA 3VN9A 4XG8A 2YA9A 3E7VA 4M69B 4O83A 2X7FA 1OIRA 1Z5MA 4BCFA 4E4MA 5M44A 5CSPA 4WRSA 5HTBA 3BU5A 3AT2A 4NM5A 3UZPA 4BTJA 3ZXZA 3R7YA 1IG1A 4E5BA 1J1CA 2BIYA 5G6VA 2A0CX 2REIA 3FKLA 1OB3A 2OH0E 4R77A 4ZOGA 3HRBA 4K18A 4IAAA 4BGGA 2XKCA 2BAJA 3W2SA 2YFXA 4GS6A 5ANEA 4Y73A 4FTLA 4AA4A 2IWIA 3R02A 2YACA 4FZDB 4CZYB 2BIKB 4L43A 3VW8A 3FMDA 4AOIA 2WQOA 3DY7A 2WELA 5FLFA 2H8HA 3BWFA 3P5KA 5BUIA 3IW8A 5CXZA 1YI4A 2X8IA 4JXFA 4IWQA 3IO7A 1ATPE 3DLSA 3NVMB 3U8WA 3ZZWA 2ITWA 3WILA 4QYEA 5HO7A 2PE2A 2W17A 4RFMA 5E8WA 5KMKA 3VUKA 2UZOA 3W2QA 3CTQA 4QPMA 1ZYLA 4D2SA 3CY3A 4JG6A 1ZY5A 2X6DA 4YO6A 5DGZA 4BZDA 3RPYA 1HCLA 4L6QA 4WD5A 4BIEA 2WTKB 4P4CA 4MX9A 4QMQA 3EYGA 3DDPA 3FMLA 3NW6A 2PVRA 2X6EA 4HVHA 3LJ2A 3R28A 5HVKA 4ENYA 2Z02A 3GU4A 4L9IA 2I6LA 2GQRA 3UVPA 4USEA 4ACMA 2GS7A 4ZSJA 5JZJA 4J71A 4UZDA 4BFMA 5IMEA 2YN8A 2P2HA 2OBJA 5CSXA 3MY5A 1FMOE 1HOWA 1UU9A 4KKEA 4UMQA 3P08A 4EWQA 5HG5A 1OIQA 1L8TA 3R7IA 5AIRA 3C4WA 4NT4A 5IA2A 3QF9A 4EQCA 3QHWA 3IKAA 5DT4A 3ZO1A 4EKLA 5CASA 2Z60A 4AZWA 2WOUA 4DTKA 1REJA 5EQPA 1PXLA 2ZB0A 4TYIA 4WKQA 4LG4A 4EQUA 3FQHA 2C0OA 3C5UA 3LOKA 5GJGA 5J1WA 3R8VA 5JQ8A 3QD0A 4GL9A 3A60A 3G33A 4FT3A 3I60A 5HLNA 2OJJA 3UYSA 5DFPA 2VTPA 4PWNA 2J9MA 2UW6A 3OWKA 3Q96A 5K4IA 3CEKA 4ZTRA 3UG1A 5LVNA 4J99A 3GU7A 3OOMA 4RIXB 4U41A 4B0GA 2GTMA 2GHLA 3BBTB 5IQGA 4XRJA 3FYKX 3QGYA 3GC7A 4FIFA 2BPMA 4L7FA 5CQWA 4EH8A 2PMIA 4IX6A 1JVPP 2PMNX 4G3EA 4J8MA 4L46A 1FOTA 5CU4A 2XK4A 2R9SA 3DKCA 3IDPA 3OROA 2W1DA 5CSWA 1TVOA 3E93A 2EB3A 5T6KA 3DB8A 2IZUA 3UPXA 5L2QA 2QR7A 4HNIA 4ALUA 5CU0A 3F88A 4BDGA 4E20A 4KUJA 4AZEA 4AFEA 4JDHA 2VUWA 4DG0E 1BX6A 3WYYA 3KQ7A 5CQUA 5CEQA 2FGIA 5ETFA 2UZUE 3DLZA 5A4EA 2QO9A 1ZYJA 2QOOA 2PUUA 4KA3A 4PL4A 3V3VA 1YXXA 2XCHA 3EB0A 4OBQA 2PVFA 2VTRA 4AF3A 5HHWA 4ZSLA 5A9UA 1J7IA 3TM0A 4AP7A 2W1ZA 5CAVA 1X8BA 3CGFA 3FL4A 3FSKA 5E8ZA 5AUXA 4PDYA 3RWPA 5CYIA 4O2ZA 3UOKA 1J3HA 3KVXA 5M09A 4WBOA 1YOMA 4WUAA 4EH7A 2PZIA 2VO6A 2JBPA 2IN6A 2W1FA 3AC8A 4DT9A 3DNEA 4D2VA 5IQCA 3A7FA 4Z3VA 3EYHA 5HNGA 4QP8A 4RIYB 2IZSA 3EKKA 5IQBA 4IM2A 4IJ9A 4K2RA 2OJGA 1XH9A 3E62A 2QHMA 3FMKA 3MPTA 4PY1A 1NVQA 2BDJA 2GSFA 3NX8A 4NK9A 5DHJA 1OL1A 5H3QA 4BDBA 4KWPA 1OKWA 3IGGA 5L2WA 5D10A 3QUEA 3EQIA 3UO5A 1G3NA 4OBOA 1Y6AA 1UNHA 2CCHA 2J2IB 3BRBA 3BYOA 1GIJA 3LMIA 1UNGA 4FT7A 4QMNA 4QPSA 4F6UA 3JYAA 5IQIA 3BHTA 4FKWA 4QRCA 4U3ZA 4AQCA 4C4GA 4NH1A 3MH3A 4XG3A 3TZ9A 2R3GA 5CEPA 1OBGA 3ZXTA 4KS8A 4CYIA 2R3LA 2ERKA 2Y7JA 2P55A 1KOBA 5CANA 2UZWE 3GQLA 2JKMA 3HMIA 4RC4A 1QCFA 4TYGA 3QX4A 4JQEA 5HE1A 4I6FA 4FEQA 1P4OA 3CD8A 3R71A 4ITIA 2ZM1A 3ZONA 2HZNA 5LMBA 4DEGA 4N6ZA 2PTKA 2R3RA 4BVUA 5LMKA 3AGMA 3QU0A 4A9UA 2IG7A 5TF9A 4DEHA 4YJTA 3R8LA 2OICA 4WRGA 2ETMA 2HW6A 4LL5A 3VBXA 3V5QA 4M7IA 3SOAA 3D5XA 3BHUA 3KMUA 3V51A 3WF7A 2CGWA 3LE6A 2RFNA 4AW5A 5TT7A 5BYZA 4XH6A 2HY81 3R7VA 1K3AA 4ONAA 3UNZA 4YJPA 4LYNA 4FMQA 3VBWA 4F7LA 3HVCA 3PA3A 4D0WA 5IF1A 2GQSA 1XBAA 3T9TA 4OR5A 3EQDA 2BALA 4U9AA 3LFAA 4ANBA 5L6OA 4RC3A 4NIFB 2Y4IB 2UW0A 4FNWA 4BY9E 2UZVA 4JT3A 1Y6BA 4MYGA 4C4IA 4UEUA 2YCSA 3ZUUA 3QC4A 3IW7A 5FTOA 3MIYA 2XJ1A 4CFNA 4ZZNA 2IO6A 2ITTA 2W9ZB 3VF9A 2JLDA 3GI3A 5JGDA 4TW9A 5IA1A 4I4FA 4RQVA 2XMYA 5CEIA 5FM2A 5BMSA 4GVAA 1Q99A 2FA2A 3EIDA 4GK3A 2OZAA 3C9WA 5HE0A 1Q8UA 3IG7A 3S2PA 4BI2A 1B39A 3FQSA 4ZLOA 3BQCA 4DA5A 4DTBA 3R9RA 4F09A 4U7ZA 4V0GB 2BZIB 4G2FA 3P86A 3DQWA 5D12A 5IQEA 4O7WA 3H10A 3HA8A 4J53A 2EXEA 4C4HA 3DBQA 3DBDA 4PP7A 1M17A 4I5CA 5AV1A 4FEXA 4Y95A 2ZDTA 4W4WA 4FOCA 3RVGA 3PRFA 3C50A 3T3UA 3V04A 5AP5A 5GHVA 2W1HA 1PYEA 4BDHA 3HRFA 2ZB1A 1RDQE 5HOAA 4FEUA 2YM6A 3MV5A 3CPBA 3G90X 4A9TA 1Y8YA 5AR7A 2HY0A 4BTMA 4QMMA 5C8MA 2PVHA 4LL0A 4DYMA 3MVMA 3Q6UA 2Y8OA 3VUMA 3LFQA 4D1SA 3BV3A 2XBJA 3F5UA 3AC5A 3BU3A 4MD7E 2WIHA 4FTRA 3D4QA 2HIWA 3QZGA 3VUDA 2HWOA 2Y6MA 3CS9A 3C0HA 4N4SA 4PTEA 3VRZA 4C61A 4ASXA 4AOTA 1ZOEA 5FM3A 2W1IA 3ETAA 3C1XA 4YZCA 5HBEA 5DWRA 2PYWA 4FKUA 1H0WA 1Q8TA 5EKOA 4USFA 4U42A 4F64A 5B0XA 4OTPA 4CT1A 4XBUA 3N51A 3PIXA 3M2WA 3NGAA 3ZFMA 2J51A 3QRIA 3LXPA 4IANA 2OIQA 4W8DA 3LW0A 4YTHA 3DPKA 4BI1A 5CT7A 1H25A 3ODYX 4YZNA 3FLQA 3G15A 4O7RA 3ORPA 5AADA 4CV8A 4FKTA 2CGUA 3OWPA 4GMYA 2QO7A 2HZ4A 4PRJA 1H1QA 2PMLX 3LCOA 1M2PA 4TWPA 4XNEA 5EDPA 3QCYA 4A06A 1Q8YA 3TL8A 3Q53A 4ZS0A 4O2PA 4X3FB 3QBNA 5E8XA 4AE6A 4BDFA 4EKKA 2X7GA 3D7TB 1AQ1A 3C13A 5H9BA 1UWJA 4Y85A 3W33A 5LVOA 4I6QA 3RM6A 4BDEA 2QCSA 4DAWA 4PMSA 4F6WA 3LM0A 3LPBA 4DH1A 4NYEA 2A27A 2OF2A 3SA0A 4RX7A 3E8CA 3SDJA 2JFLA 4FL1A 2PE1A 2BAKA 4ZZMA 3VNTA 3A8XA 4WIHA 2HK5A 1YDSE 4HCUA 5A4LA 3BKBA 3R1NA 5E1EA 2DUVA 1L3RE 4TZRA 3V8WA 4GUBA 4AWIA 2IVVA 4CTCA 2XNEA 3HAVA 3REPA 2XZSA 3UO4A 3R83A 3COHA 4BIBA 3NAYA 3CY2A 4FTQA 3HUBA 3GC0A 4WT6A 4JG8A 2WO6A 4YZBA 5A3XA 4YSJA 4TYJA 1UU8A 4WBBB 2QC6A 2VGOA 3KXZA 4Y5QA 4HYSA 4HYHA 5I9YA 1URWA 2C68A 4FIJA 4MAOA 4CTBA 5EFQA 1IAJA 4FUYA 4JL9A 4MBJA 4PF4A 3RAIA 4ITJA 4ALWA 4L44A 3BEGA 4M84A 2CGVA 4DEEA 2XNNA 4KD1A 5I0BA 4GIIA 5L6PA 3SHEA 1YI6A 2WMAA 3EN7A 5GNKA 4O1OA 4ZS4A 4TKSA 3E8EA 4I0SA 1P5EA 4PL3A 4CLIA 4BGHA 5DEYA 3ORIA 3F9NA 4PDOA 3NPCA 2ZM3A 4OTQA 4E6DA 3CJFA 1MRYA 3GB2A 3R22A 4FTNA 4R3RA 3FMJA 4M8TA 4X7QA 2HCKA 4O86A 2HAKA 4DG2E 3QQHA 5BYLA 4FZ7A 1W8CA 1FVVA 3F2NA 4GYGA 4RIOA 5HVYA 3NNVA 2XF0A 3DBEA 5HU9A 4GKHA 4AXAA 4YTCA 2ESMA 4E93A 2UZNA 1ZRZA 4OBPA 2OIBA 3RK9A 3TIZA 1CKIA 1OUYA 2RFEA 3IQ7A 2ITUA 1Q3DA 2R0IA 4YHFA 2E9PA 2ZVAA 3EQPA 3RHXA 2GPHA 4ACCA 2FYSA 3VBYA 3U9CA 4QMLA 5BUJA 5LWMA 4X2NA 3DZQA 2GHGA 5IQHA 2WMVA 2UW8A 5BVKA 1MUOA 2R3HA 3D2KA 4EHGA 3ZU7A 4ZAUA 1FQ1B 3FSFA 4DH8A 5LXMA 5E90A 4EL9A 2VO7A 4IZ5A 1PXOA 4K0YA 2IW8A 4WOVA 3TN8A 4USDA 3RK7A 1BYGA 3CTJA 2HXQA 5J8IA 1OPJA 3A62A 3L8SA 4QMSA 3DBFA 2VTIA 3PWDA 4GFMA 5CSVA 4E4NA 4DCAA 3FLNC 3W8QA 3RPSA 2B1PA 2WMSA 3GVUA 4WNPA 4FA2A 4DF3A 2VU3A 5CXHA 5CU6A 3DKGA 3W2CA 4NM3A 4JX7A 3QTZA 4N70A 3P78A 5KHXA 3DAJA 4HVIA 3VUGA 1E9HA 3HA6A 4GEOA 3RKBA 4RX5A 3I0QA 5IISA 4CNHA 3Q4ZA 3P79A 2E9VA 2CJMA 4M0ZA 2YCFA 1PJKA 2XK3A 2F49A 2X81A 2GNLA 2BZJA 4R3PA 4IVCA 2P4IA 4TT7A 4F9YA 3N4UA 2OXDA 4EONA 1CSNA 4FT0A 3CCNA 3FY0A 5HKMA 4QMOA 4EJNA 3SRVB 5L4QA 1I44A 2XM9A 4C4JA 1G5SA 4C3RA 4EHVA 3V5LA 2OI4X 3QYWA 4FK3A 4GFOA 3DV3A 4AG8A 1Q8WA 3ZSHA 3FXWA 4ZTQA 3S4QA 2ZOQA 2ZV8A 4X2FA 2XYUA 5E7RA 4FK6A 4JDKA 5HGIA 4EEVA 3BYUA 2J5FA 1R0EA 2P0CA 3PJ3A 4IW0A 4QMXA 4R7IA 3EQRA 4E4XA 3VW6A 2X4FA 4EH3A 4TY1A 3LCKA 5DMZA 2RGPA 5EDRA 2OSCA 4YU2A 2CKPA 4KABA 2C30A 3P1AA 3FPMA 3PA4A 3GENA 4R5YA 4U3YA 2I0EA 4IJPA 2WOTA 2IJMA 2VTQA 2VTMA 4I93A 3W16A 4M3QA 2HZ0A 2OWBA 3ZDIA 4D9UA 1PXPA 3QKLA 2XRUA 2ONLC 4JRVA 4O38A 3VO3A 2ETKA 3KGAA 4AT4A 3BGQA 2O5KA 4K11A 2UW4A 5LVLA 1PRYA 4O7VA 2JDOA 1WBSA 2WTCA 1YDRE 4YNOA 1KE7A 2BRNA 2QHNA 3B8RA 4FSWA 1SM2A 3PPJA 3FY2A 4O81A 3O8TA 1YXUA 2WEVA 1IEPA 4ZSGA 3DKFA 3SKCA 4PTCA 3C0IA 1CMKE 4M69A 3MH1A 4Z55A 3LJ0A 3OWLA 1OUKA 3M11A 5AP4A 4BGQA 5KMNA 3MB7A 5AR3A 3QGWA 5C01A 2QG5A 3THBA 1A06A 3S95A 1JBPE 3NRMA 3UZTA 2PVJA 3MH0A 4IWOA 3QCSA 2XS0A 3OVVA 4LGGA 2VD5A 1ZOGA 3PFQA 2PWLA 3MDYA 4CFUA 3O23A 3OHTA 4AZFA 2P2IA 4XBRA 4DBXA 5AUUA 4Q9ZA 3P0MA 3C4CA 1CDKA 3ORLA 1OL6A 3FZ1A 5J9YA 2VTJA 1J7UA 2WHBA 1YWVA 3C4ZA 1ZARA 2QOIA 4K33A 1VYWA 4D1XA 2ITXA 2XVDA 4JR3A 3KXXA 3F3ZA 4U43A 2WKMA 2UZBA 5KO1A 1XWSA 1H24A 5FEEA 3UVQA 3FDNA 5H2UA 5FQDC 2HXLA 5AM6A 1F0QA 2W99B 3AC2A 3CGOA 3W8LA 2YAKA 3BQRA 4E6AA 4Y5HA 5I9XA 4FV4A 3F82A 2WQMA 2YM8A 4L8MA 2IZTA 3H4JA 3I7BA 5K5NA 2YJSA 4RSSA 3ZMMA 4FT5A 1OMWA 2J0KA 4YSMA 5CVFA 5DYJA 4G31A 5I9VA 3EJ1A 4RC2A 3VJOA 1JSVA 3R73A 3BI6A 2YIYA 4PPCA 4ASZA 2BMCA 1OKVA 3SV0A 5DBXA 3BHVA 2BCJA 4ZXTA 4QQ5A 4QP1A 3WF8A 4AE9A 1DAYA 4IM0A 2FVDA 4I5MA 4LQMA 4YP8A 4PMMA 4RG0A 4XV2A 3TJDA 3QD4A 3KEXA 1YDTE 2XP2A 2ITQA 4FR4A 2XNOA 1OKZA 5HE2A 4DFUA 1FGKA 4D5KA 5AA8A 4ERWA 1OPKA 2PVMA 3LAUA 1PXIA 4P5QA 4PNKA 2YAAA 3MI9A 3RPVA 2C3JA 2WFYA 2J7TA 1Q8ZA 2GU8A 3FZOA 4FSTA 2PSQA 4HZRA 4XOYA 3E8NA 3ET7A 1BKXA 4U44A 2BTRA 1Q61A 5LARA 2UVYA 5ANKA 2OJ9A 4FICA 5AIKA 4XV1A 1M7NA 1JNKA 3U6JA 4RJ8A 4ALVA 3UNKA 3DXQA 1K2PA 2JDTA 2F4JA 3BX5A 4RIXA 4APCA 1W98A 2V0DA 3FHRA 3OMVA 3ZC5A 4I22A 2YDJA 3HRCA 4UV0A 2YIWA 4C59A 5AAEA 3L9NA 3OG7A 1APME 5CU3A 1PY5A 4LMNA 4JAIA 2PL0A 3WZUA 4QO9A 4K1BA 2E2BA 2XIXA 4RJ5A 4QD6A 4U97A 2GS2A 3DJ5A 2W5HA 4YPSA 2GTNA 4DC2A 2ITOA 2C0TA 2GNJA 4CFXA 1NT2A 3L8XA 1Y8GA 2QOFA 2PVNA 4GK4A 4ENXA 2OO8X 1PYXA 4FSRA 4BCNA 3OY1A 4PDPA 2C1BA 5J5TA 2PUNA 5J1VA 3BV2A 4DLIA 2XNBA 3UQCA 2X8EA 4DINA 4IB1A 4DFNA 4QMYA 4BCPA 5C26A 2BHHA 1PKDA 1U46A 2H9VA 5DN3A 5JFSA 3BWJA 3HMNA 3MY1A 4ZMFA 3FPQA 3O50A 3OD6X 4H39A 4G3DA 5FTQA 4E6QA 5EI8A 2W0JA 3GC8A 4ZTLA 3C0GA 4QYFA 5BNJA 4OGRA 4E3CA 2PVYA 4FL2A 2C5OA 3Q3BA 2X8DA 3KMMA 3QAME 4IWPA 4G3CA 3ZLSA 4FV0A 3FLYA 4BR3A 4J52A 4RIYA 3IS5A 2XEZA 4FSUA 5C27A 4UWYA 4CQGA 4ZZOA 3TZMA 4QTEA 1UA2A 3MPMA 3SXSA 2JFMA 5DLSA 4XS2A 3V6SA 3KA0A 3UQFA 4IMYA 4B9DA 5IH6A 2UW5A 3OCGA 1SNXA 5J5SA 4C34A 2UVXA 5CAPA 5IU2A 4LOQA 2J0MB 4CGAA 2IPXA 5I9ZA 1WBOA 3OTUA 3POZA 3TNWA 4N6YA 1PMVA 5KMJA 3F69A 4I3ZA 4I0TA 4AZVA 3P23A 4F6SA 3D5VA 3WE4A 4E1ZA 3FBVA 4U40A 3OP5A 2BR1A 4TTHB 4G5JA 4DCEA 5FRIA 3UODA 3FLZA 5M53A 3BEAA 4QNYA 5HIEA 4U80A 4FYNA 5DE2A 3ZEPA 4RJ7A 3EFLA 5JFWA 3KRRA 3LVPA 5JH6A 4X6RA 2R3QA 4XV3A 5AP0A 2Z7LA 3C7QA 1YHSA 3IK3A 3O17A 4HPUE 2XK8A 2C4GA 3FXZA 4DFXE 3VULA 1F5QA 4JDJA 1OIUA 4Y72A 1R39A 3DCVA 4FSMA 4O21A 3EFWA 4AGCA 4M12A 4XLVA 5AP7A 4OTIA 3OXZA 2Q83A 3VVHA 3OEZA 3ZM9A 1W7HA 3ORMA 2VRXA 3D5WA 4O6LA 3U6IA 1GNGA 2VX1A 4EJ7A 2IVSA 2VTHA 5HX8A 3LFCA 3R8PA 4BCJA 1H27A 1GIHA 3F61A 3MFRA 4NIFA 3QQJA 4AW1A 4GVJA 5A4CA 3C4FA 3L9PA 4QQTA 1UU3A 1P2AA 3Q9ZA 5AAFA 5JFVA 4AT5A 4BDCA 4IC7A 5KUPA 1Y57A 5DIAA 2UZTA 1REKA 3DK3A 4EK3A 2J90A 4ANQA 1BI7A 3Q4TA 4WG5A 1Q24A 3R63A 3MTLA 5JZNA 4D4VA 3E88A 2Q0NA 4UY9A 5KCVA 1ZMVA 4DH7A 3NZ0A 4ZSEA 1PF8A 5FEQA 4M66A 5DT3A 3NCGA 3NMUF 3P7CA 3BBWA 3PXYA 5DA3A 4V0GA 5GZ8A 2PK9A 1H1SA 5H8BA 1PKGA 2R3NA 4A4XA 4H58A 3NYVA 1A9UA 3R30A 4FV6A 4XX9A 3FC1X 3G6HA 1TQPA 2OU7A 3B8QA 5HCXA 3Q9WA 5T3QA 2WGJA 3R8ZA 4AACA 3MSSA 2JGZA 4CKIA 4IAFA 3PIZA 3BYSA 1IRKA 4EUUA 4Z9LA 4BDAA 3TKIA 5CF8A 4ZP5A 1H28A 2X2KA 5JFXA 3KMWA 4WG4A 4AW0A 4IVAA 3RNYA 3WIKA 1O6KA 1GOLA 4Y83A 2GS6A 4B8LA 3QKKA 4F1MA 4CFVA 3TTJA 5JSMA 2UW7A 4MF0A 3P4KA 4G9CA 2YIRA 5E92A 1R0PA 5HU3A 4D55A 2WTVA 3P9JA 4ARKA 5AX3A 3NIZA 3A8WA 4D28A 3K5UA 5A54A 1B38A 2HYYA 3T9IA 1NXKA 1ZYSA 5DR6A 2GMXA 4M67A 5I4NA 3AD6A 4WA9A 2CPKE 4TYHB 3C4EA 3EZRA 5HTCA 3U51A 4FV3A 3PXQA 3VF8A 4ACDA 4QYHA 4F7JA 3QTRA 4A9RA 2XNPA 4TNDA 4KBAA 4X2JA 4DGOA 4ZY5A 3DTCA 3ZO2A 4MTAA 5EYCA 5C9CA 4E73A 3NS9A 4HPTE 3HECA 4RRVA 4RVLA 2UZDA 4IVBA 2I40A 5CF4A 3GU5A 2HWPA 5CEKA 4QP4A 2V5QA 5EYKA 4YTIA 5BVDA 5JRSA 5ACKA 4JRNA 3IW6A 1YQJA 4MXYA 5FP5A 5CAQA 2E9NA 3GT8A 2ZMDA 3OXTA 5B7VA 5BVNA 1LPUA 5CVHA 4X3FA 2C0IA 5FXQA 3D7TA 3D7ZA 3NUSA 3O71A 3WIGA 2QD9A 4S31A 3EH9A 5A4TA 3Q9XA 3ZCLA 2OFUA 4FC0A 5IG1A 5IPJA 3GCPA 3QUPA 3K3IA 3S00A 3I81A 4BL1A 3KCFA 5A6OA 3F2AA 4RBLA 4NEUA 2FH9A 4WG3A 3LFFA 2C6IA 4B7TA 2CNVA 4EC9A 2RSVA 3KULB 2BKZA 2W06A 1DI8A 4JBPA 3VWAA 4I41A 4HGSA 3H30A 4BICA 5I3RA 3II5A 3FMNA 4CFFA 5KBRA 5J95A 2XKFA 2RKUA 5I9UA 2V22A 4DGNA 4CMOA 2SRCA 1Z9XA 4BZOA 2F7ZE 3Q4UA 4XOZA 5JQ5A 5JT2A 5FWKK 2PPQA 5IZFA 3ZSIA 4CKRA 3UBDA 2PE0A 4IX3A 4HVGA 2YERA 4DT8A 3TNHA 4W9WA 1STCE 4RMZA 5FBNC 5EM6A 2ZJWA 4U0IA 5HIDA 4MD8E 4ZTMA 2PULA 4PQNA 3ZOSA 3DFCB 3EOCA 4XHKB 4KIQA 4WUNA 4FVQA 2R3FA 5HCZA 3HMPA 2NP8A 2ZV2A 1YXTA 4IZYA 4D2WA 4LRJA 5IEXA 4O22A 3W10A 5DR9A 3IDCA 5CU2A 5JEBA 3SXRA 4FTKA 3TDWA 5EOLA 5M08A 1OPLA 3LQ8A 2WTJA 3VUTA 2RFSA 3UOHA 4O0SA 3F3TA 2J0JA 5IUIA 1EH4A 4FI1A 3SW4A 3TUDA 4EOQA 3ALNA 4IB0A 3W1FA 4R8QA 4F0IA 2W1GA 1WBTA 3HV7A 3OXIA 4EOPA 4PL5A 4O0TA 2GFCA 4YGAA 5IA5A 3ZO4A 4ZJJA 4C4EA 2XIKA 3KF7A 1WVYA 3NNWA 4C57A 4F65A 5EM5A 3R1YA 4FV8A 3O96A 1JKLA 3Q32A 2VGPA 3WZEA 3ID6C 4XJ0A 3PPKA 2QOQA 3LLAA 4R1VA 1Q5KA 1ZMWA 2KULA 3AD5A 4C8BA 4DHFA 3QQGA 4ZK5A 4YJRA 4FTCA 4HW7A 2YM3A 4NKSA 4CEGA 4C36A 3HEGA 4C37A 2RL5A 3QRUA 3MN3A 2XYNA 3Q4CA 2BILB 4I94A 4XP3A 2EUFB 3MJ2A 4YLLA 1WAKA 2OF4A 3D15A 4AGWA 4F99A 2FSLX 3PXKA 3R9OA 4M15A 3SXFA 1W84A 4IHPA 3VBTA 1GJOA 2QVSE 2R3PA 5EK7A 3BPRA 4ZTHA 1ZMUA 3ZSGA 1CTPE 5ANDA 2GNFA 3D94A 1RE8A 1XR1A 1BUHA 3LCSA 3L1SA 4YC8A 4BWPA 4ANNA 2FB8A 5JMSA 1NA7A 3QTWA 4YC3A 2CNQA 4MF1A 3NW7A 4FNZA 4IM3A 3E7OA 3ELJA 4QP7A 1DAWA 3CC6A 3QL8A 5K3YA 4C62A 3GNIB 3Q52A 5M4UA 2YIQA 2A1AB 2XNGA 3F7ZA 1PMEA 4YJVA 2W05A 1B6CB 2Z7SA 4O0RA 2JKOA 2P3GX 4FSQA 4EZ3A 3RGFA 3ORZA 2YDIA 3PJ8A 5CALA 4ZTNA 4EHEA 4S33A 3EHAA 4XG6A 3N9XA 1M2QA 4DN5A 4G5PA 1AGWA 3D14A 4R6VA 3ZDUA 4CRLA 4F4PA 3AXWA 3PYYA 3WOWA 3KU2A 4KSPA 5KX8A 2DQ7X 3ORTA 5LMKC 4BB4A 5E91A 2QU6A 4FG7A 3KRXA 2AC5A 2VTAA 3SRVA 3UTOA 4XG2A 5JKGA 2JDSA 4LUEA 3D2IA 5LCJA 5LVMA 2O63A 4O84A 3GFWA 4BCQA 4ZLYA 4QP9A 5M4FA 5HBHA 5JGAA 1Q3WA 3SVVA 5EW3A 2G1TA 5DT0A 3LFDA 4YR8A 2CNUA 4QYYA 1PHKA 4UXLA 3U87A 5K9IA 5KNJA 4D2TA 3TJCA 1LP4A 1H1WA 3KF4A 4LRMA 3ITZA 3KRJA 4I5HA 5AWMA 2ERZE 4N0SA 2CHLA 3EN5A 4FV1A 3FL5A 2AYPA 4S2ZA 4U45A 2BTSA 5HZNA 3Q5IA 3BCEA 3TT0A 3QQFA 4BDJA 4LUDA 1O9UA 4MXCA 4XP2A 3QQKA 4O96A 4BTFA 4QP3A 4LI5A 3KL8A 5CLPA 4UX9A 2R64A 2VX0A 3JPVA 1OM1A 2B54A 3R9DA 3EZVA 4WNKA 5IQAA 4KKHA 3GCQA 1FVRA 3P7AA 5FP6A 4AAAA 4QMZA 3T8OA 2Q0BA 3F7WA 4NW6A 4RGJA 4CSVA 3FKNA 4F0GA 3QCQA 5HLPA 4G1WA 2C5NA 4IDVA 2UV2A 3R01A 3FMEA 5DR2A 3MVLA 1KE6A 3CQEA 4AOJA 3LJ1A 3GOKA 1TKIA 4MBIA 3AG9A 5J9LA 5F1ZA 2W4JA 4MXZA 4BN1A 3QUDA 4F9BA 3CJGA 1BI8A 3ORKA 3HUCA 3PXFA 4YJSA 4AX8A 4UMTA 4JLCA 2QLQA 2QQ7A 1ZZLA 4BHNA 4EOMA 4JBVA 1OIYA 4O0YA 2CLQA 2J0IA 2CKOA 5EW8A 2YABA 3NSZA 3LM5A 3O51A 3WBLA 1YHWA 3H9FA 2LGCA 2B0QA 2DYLA 4BIDA 4E4LA 5ANOA 2XIYA 1OL5A 2FO0A 3BELA 4IAKA 5FXSA 1JQHA 1FBNA 3U4UA 2QKRA 2XJ0A 3LXKA 4QYGA 4YC6A 5HQ0A 2VWWA 1DS5A 1OGUA 3KY2A 3BYVA 2WMUA 4IH8A 4KINA 4QQCA 5DEWA 2YZLA 3G5DA 2I0VA 5L8KA 4CXAA 3FZPA 3IECA 1PXJA 2O64A 4YLJA 3FXXA 3JY0A 1P4FA 4ERKA 4CMUA 5IEVA 2B52A 3E3PA 1AD5A 3UP7A 5CY3A 4YUQA 3RP9A 4FOBA 3UIUA 2UUEA 2VWBA 5M56A 3U6HA 1ZYCA 3PIYA 5CEOA 1XJDA 3V01A 4AW2A 5IH5A 4H3QA 2F7EE 4JJRA 4P2KA 5BVWA 4CVAA 4DEBA 5IUHA 3ORXA 4RFYA 4UMPA 4HVDA 2GCDA 3LXLA 4B8MA 2BAQA 4K77A 2QOLA 2VTOA 4JVGA 2PUIA 1T46A 1U54B 2PUPA 3KXMA 2YJRA 4I6HA 4L53A 2DS1A 3ZTXA 3EMGA 1ZZ2A 1BLXA 2H96A 2JEDA 4EUTA 5F95A 5I5ZA 1M7QA 3A4PA 3HDMA 1OL7A 2QOCA 3BGPA 4XG7A 2QR8A 5L8JA 4IAYA 3NAXA 4J1RA 3JXWA 2CSNA 2IW9A 3NYOA 2VTSA 3FUPA 4C58A 4W8EA 4ANLA 5D9HA 4CT2A 1JOWB 1O6LA 3W32A 4QP2A 4B4LA 4BDKA 4YURA 4W9XA 4NCTA 3DKOA 4RWKA 4H1JA 3CKXA 4CLJA 2YM5A 4IQ6A 4IFGA 2BZHB 4IXPA 1V0OA 1WBVA 1YKRA 1OI9A 2XUUA 4IC8A 2WQNA 3GQIA 4M0YA 4TNBA 3ZRLA 2OIDA 3FYJX 2EB2A 4JS8A 3HV4A 3LZBA 1XHAA 3QZFA 3DDQA 1QPCA 2QO2A 4UMUA 4EK5A 2OLCA 3VS1A 2RIOA 1PXNA 2ITVA 1H0VA 4W4XA 4KIPA 4NM0A 1VR2A 4EHZA 4I20A 2NRYA 3ZLYA 3U4WA 3GC9A 1E1XA 4AZSA 5FG8A 3TDVA 3CLYA 4J8NA 2EU9A 1UNLA 1WBNA 2YEXA 3OCBA 4MWIA 3GGFA 3NUYA 3TNIA 3DZOA 4PX6A 3SD0A 3IPHA 4M68A 3PJCA 4I4EA 1WBWA 4LGDA 3WZJA 5AP1A 3UP2A 5J9ZA 3AMYA 3WI6A 2PZYA 3I79A 3ZC6A 4FKPA 4NFNA 1H07A 1V1KA 4RIWB 4TN6A 3SC1A 3TV6A 1SYKA 2XEYA 5A4QA 3PDTA 5LVPA 4QTDA 1UVRA 2XM8A 5EG3A 5BQ0A 1LR4A 5AA9A 2X0GA 2R3OA 3ZYAA 4L45A 5HBJA 4DITA 2KTYA 4RLKA 4L01A 4KIKB 1YXSA 3CQUA 5EOBA 4FIGA 4FEVA 5CEMA 2QU5A 3VS3A 4AN9A 3LCDA 5FD2A 2G2FA 3MFSA 4GU6A 5M57A 4YZMA 4IIRA 2XCKA 3VHEA 4TWNA 4D2RA 1ZAOA 4DFLA 5GZAA 3BE2A 1FGIA 4XYFA 4FKQA 1YI3A 2B53A 2QONA 5KKRC 4RWJA 5IMXA 5CSHA 2B4SB 4F08A 1M2RA 4U79A 3G2FA 3RAHA 2X1NA 1G8SA 5HCYA 3NR9A 2C3IB 3DQXA 4CCUA 4ZSAA 3OS3A 2JDVA 5K5XA 2WD1A 3MYGA 4LRKA 3RAKA 4X21A 3PLSA 2BVAA 3R7EA 3NUAA 3TKUA 4O27B 4TWCA 2WMQA 2W1EA 1JSUA 3MESA 1IASA 3E87A 4FE2A 4FEWA 2R7BA 2GFSA 3OT3A 4CG8A 4EQMA 1H01A 5HO8A 2IVTA 3RINA 4RWIA 3FC2A 3LXNA 3OY3A 5DH3A 4RLLA 3EQCA 4CFWA 2Y9QA 3QKMA 4XUFA 4BZNA 5ANIA 3FMHA 3U9NA 4DGLC 2B9IA 5HO6A 2OJIA 3EQGA 3WARA 1JKTA 2ZYBA 3GCUA 4RA4A 2C6TA 4OW8A 3RHKA 4BYIA 3CQWA 1QPDA 3V5PA 4GT5A 4L52A 3C5IA 2XK9A 4GCJA 1QMZA 3ZUVA 5EYMA 2VX3A 1OECA 3ENMA 1QL6A 4CZUA 4I92A 3E92A 1BL7A 3S0OA 3FHIA 5LMAA 2WTWA 4V05A 2WNTA 2PY3A 4X0MA 5L2IA 4NUSA 2IVUA 3ZBXA 4FNXA 4O0WA 4D0XA 1CM8A 5EQYA 3KCKA 4UWBA 4A4OA 4F7SA 1H4LA 2QG7A 4IX5A 3NUPA 3FAAA 3NWWA 3QQLA 4ASEA 2VTLA 1HCKA 1Q4LA 3WYXA 2GDOA 5CWZA 3NUXA 2F2CB 4TWOA 5A14A 3LMGA 4X2KA 5CF5A 3E8DA 3DTWA 3SGCA 3ACKA 4KAOA 4M13A 4MNEB 2EWAA 5HG8A 4ZEGA 3AQVA 3HDNA 4EBVA 4L3JA 3Q60A 4BCGA 5IA0A 2BFXA 4NTSA 3QA8A 5M06A 1SNUA 4AA0A 3DJ7A 1NW1A 4NSTA 3O8UA 3PVUA 3F5PA 2ITNA 3M42A 4B6LA 4IAIA 3SAYA 3FI3A
chains in the Genus database with same CATH superfamily
2WMTA 5EHOA 2AC3A 3AMAA 3QQUA 2C1AA 4MEDA 4NFMA 4AU8A 3AKKA 4O0VA 2UW9A 3QTSA 5IA3A 5DRBA 3KIOC 4D5HA 4JDIA 3MB6A 3ZM4A 4CRSA 4F7NA 2HOGA 3HMMA 4FKSA 4KS7A 3RMFA 4OLIA 4F70A 4R7BA 5GIOE 1ZXEA 3FZTA 3Q6WA 2XK6A 2C3LA 4X2GA 5EH0A 4BTKA 3PXZA 2XKDA 4YPDA 4RX9A 5HICA 3QX2A 3K3JA 5IQFA 3R7UA 2WTIA 3ALOA 3MWUA 5B2KA 1H26A 1OL2A 4FZAB 4UXQA 1XH5A 3COKA 3PG1A 3RJCA 4JI9A 2J0LA 2PVLA 4TYHA 5EHLA 4Z7GA 2FSMX 2QURA 4J97A 2CLXA 3W0NA 3KK9A 3KXHA 5A6NA 3DK6A 4ZTSA 3UIMA 3QXPA 3LLTA 5E4HA 3EL8A 3BE9A 2WXVA 3QZHA 5HTIA 2IF8A 3KFAA 3HX4A 5LCKA 4E26A 4JIAA 3SLSA 4O7NA 5C1QB 4UALA 4GIHA 3V5WA 2VV9A 3I7CA 3Q2MA 3VHKA 4ITHA 5AP2A 1ZOHA 3QCXA 4EK6A 3G9LX 3JS2A 2C6MA 5BVEA 2C6KA 4G6LA 5J7HA 2WTKC 4FKRA 4CCBA 2CKEA 2R5TA 2Z2WA 1H00A 4M97A 5HIBA 3R1SA 5M55A 3OC1A 2VWYA 3ORNA 5BUEA 1NVRA 2JAMA 5TE0A 3QFVA 4CYJA 3NIEA 3BLHA 3H0ZA 3SQQA 4QMTA 4C2WA 2CGXA 4J95A 4A7CA 2BFYA 2OH4A 3VQUA 3BLQA 2PVKA 1GZ8A 4XV9A 5CTPA 5G1XA 3ZRMA 4RWLA 5HG9A 3DAKA 3CR0A 1UKHA 5CENA 5TOZA 3TZ7A 3ULIA 4FODA 4V04A 3LFSA 3RK5A 4ACHA 2YHVA 5I3OA 3PZEA 4BKJA 4O7TA 1VEBA 2XAOA 5IQDA 2NPQA 1OITA 3WZDA 4XG9A 4Q5HA 3IOKA 3RBWA 3KULA 4JAJA 3VS2A 4W4YA 4A9YA 4CKJA 5B2MA 2XKEA 4GJ2A 5E1SA 4BDDA 2OFVA 2PZ5A 3MA6A 4QT1A 4XEYA 4Y46A 5HE3A 3OBJA 4IB3A 3Q2JA 1OBDA 3PFYA 2X2LA 5CAUA 3GCVA 4AGDA 4S32A 4WNMA 1RW8A 2BHEA 3OW4A 3PZHA 1W2CA 4HGEA 4ZJVA 3LMHA 4I1ZA 3GCSA 5BV3A 3R6XA 1P14A 2X9EA 4I24A 3MS9A 1Q41A 4EH4A 4DFYA 5CF6A 1U5QA 2C6LA 2R3IA 3NW5A 3Q04A 3WF6A 4J7BA 3ZBFA 2NRUA 3EKNA 4YHJA 1KSWA 3P7BA 3LFEA 3AMBA 4I21A 3OW3A 4LMUA 4MD9E 1W2DA 3S1HA 5CZIA 5M07A 4KSQA 2DWBA 4JR7A 1LUFA 3PVGA 3NUUA 3VS4A 4YJNA 3PTGA 4ANMA 4FF8A 5EYDA 3LCTA 4MVFA 4RVTA 1YW2A 3FLWA 2WB8A 3G9NA 4PTGA 2XA4A 4NTTA 4RQKA 2RG5A 4MXXA 4FV5A 3DGKA 2X39A 4EORA 4O91A 2ITYA 2CCIA 3F6XA 3FEGA 2WQBA 4IE9A 4YLKA 1ND4A 3BLAA 1QPEA 4RVKA 4FKJA 3R7GA 5CZHA 3W0MA 5AM7A 1H08A 3F5GA 4X3JA 3GOPA 4FSYA 4GH2A 4KIOA 5TR6A 4AGUA 4YBKA 3G51A 3HL7A 4K6ZA 3FI8A 2QI8A 2R7IA 4IADA 3K2LA 4L3PA 5E9EA 5AP3A 5HLWA 2JBOA 3HYHA 4GFGA 5F94A 4XMOA 5GJDA 2UW3A 4RT7A 4ZMEA 4RX8A 4UBAA 2OXYA 4U81A 4GG5A 2JKQA 4PV0A 3PJ1A 3QA0A 3UG2A 1WVWA 1IA8A 4EI4A 4MBLA 4HNFA 4JQ7A 4C33A 1U59A 4DLJA 3AD4A 5IDPA 3FI2A 3KK8A 3MFUA 1MQ4A 5KMOA 2XALA 4AFJA 2BRHA 2I0HA 5LQFA 1S9JA 2BKKA 1MRUA 4JBOA 4MUQA 2JD5A 2HZIA 1ZY4A 4MCVA 3KN6A 1YOLA 3R2YA 4NL0A 3KRWA 2VAGA 4BCKA 3SG8A 3EQHA 1DM2A 3EWHA 2EVAA 3IONA 3TXOA 1PMUA 3MFTA 3EFJA 3CPCA 3QLFA 1YWRA 4MWHA 3QHRA 3NNXA 3VBVA 3IW5A 5FXRA 2QNJA 3KXGA 5CAOA 5AMNA 5M4CA 5IUGA 3AC3A 4ACGA 3H3CA 4NZWB 3DOGA 5CT0A 4CG9A 4Z7HA 2YCRA 4XRLA 4LOOA 5GZ9A 2G9XA 3F66A 1YWNA 3R21A 1FVTA 4DG3E 3R04A 4P7EA 3TI1A 3BHHA 2JC6A 3QTUA 4DEDA 4HYIA 2BRGA 2VN9A 1SVGA 3JVRA 2JITA 1ERKA 3BYMA 2OG8A 2VWVA 3RCJA 4YHTA 3KREA 3U54A 3PUPA 3G6GA 3PSBA 4BJJB 3DJ6A 4HJOA 1G8AA 2XB7A 3IOPA 3UYTA 3FLSA 3ANRA 4RPVA 5CI7A 2B9HA 2Y4IC 4FTAA 4PMPA 4AT3A 2A4LA 3L8PA 4MQ1A 4CFMA 4O0UA 2OK1A 4H3BA 4DH5A 2C5XA 3Q5ZA 3F5XA 3ZUTA 2BZKB 3A61A 2C5YA 4EOJA 2XNMA 5DPVA 3F3UA 3QXOA 5ITAA 4FYOA 4BDIA 3CKWA 2EXCX 3V8TA 4E5WA 3COIA 3O2MA 2R2PA 3ATTA 3R0TA 4C7TA 2VWUA 3MJ1A 4JOAA 1UKIA 1URCA 1GZKA 4PUZA 3VAPA 5K0KA 1MP8A 4DFZE 3ROCA 1ZWSA 4F9WA 3F2RA 3LFNA 3DAEA 2JDRA 4FV7A 3TV4A 3DBCA 4YO4A 2OW3A 1JPAA 5FUTA 3UO6A 5GIPE 2ZDUA 4FG8A 3R00A 4RJ4A 5HX6A 4O7YA 1JWHA 4FIHA 5D11A 3PVBA 3WF5A 4CQEA 2C3KA 3W55A 3NFGB 4O4DA 4RFZA 3D5UA 3E5AA 4TXCA 5ACBC 2W5BA 4FTOA 4D58A 5IEYA 1TQIA 3FMMA 4ZJIA 3QC9A 4EOLA 5EI2A 5K4JA 3ENHA 2YITA 1Q62A 4O7ZA 2WQEA 4OTHA 4ZLZA 4ASDA 1MQBA 4BBFA 2JIIA 3VUHA 3DT1A 3PP1A 4LDTA 3BZ3A 1ZYDA 2X4ZA 5IH4A 5F4NA 3RAWA 3A4OX 1W2FA 4O7SA 4X6QC 3TEIA 1H8FA 1NVSA 4H36A 1XKKA 5AV3A 5DNRA 5D7AA 2VTTA 4G6OA 4AA5A 2VWXA 5C4KA 3A2CA 2GNHA 5HI2A 1GZNA 2WPAA 4C35A 3IW4A 4G34A 2QOHA 2WIPA 3QRKA 2ZV9A 4AXFA 1XH6A 4PMTA 1E1VA 3V6RA 4L67A 3UDBA 2JKKA 2ZV7A 1XH7A 2WU7A 3GXLA 4O82A 2C6EA 3SG9A 3KXNA 4FX3A 5D7VA 4ORKA 3PY3A 5EDQA 3AT3A 5ANJA 5E8VA 3QD2B 1W82A 1XH4A 2G2IA 4GG7A 4IDTA 3QTXA 4F9CA 5KBQA 3UPZA 5FEDA 2A19B 4LV5A 4UMRA 3QYZA 4JQ8A 3LQ5A 2YM4A 3H9RA 3MTFA 2WAJA 1JAMA 4X3FC 5HD4A 5L3AA 4GYIA 4EYJA 3W2PA 2UVZA 4FZ6A 4G16A 5HD7A 3R7OA 4KRDA 1MRVA 5J87A 2PZPA 1W83A 3WF9A 4WO5A 4FTUA 1U54A 3OCSA 3FQEA 4XCUA 3GEQA 1KE5A 3MPAA 2X0OA 2PHKA 3R9HA 3VUIA 3HP2A 2B9JA 3OCTA 3UJGA 1F3MC 1WBPA 1U4DA 3L9LA 4FZFB 4OTWA 1KOAA 3OBGA 5BX0A 3PG3A 5DVRA 3A99A 3D83A 3QRJA 5CVGA 4RA5A 4RZVA 2WMWA 1OVEA 3UE4A 4KNBA 4EK8A 3KKVA 2PU8A 5HEZA 3NNUA 4H05A 3ODZX 3TUBA 2H34A 2XIZA 3DXPA 3PE2A 3ZO3A 4P5ZA 1YVJA 5C03A 4XP0A 3C4XA 4GUEA 3GBZA 4AN3A 4BC6A 4OTGA 2W5AA 4QMUA 3QALE 3HV5A 5ETIA 2NNWB 1V0BA 1CKJA 4D1ZA 2C69A 5BVOA 1IR3A 3R9NA 2OJFE 2V55A 4YBJA 1YOJA 1NY3A 3UC3A 5CX9A 1OZ1A 2V7OA 2Z8CA 5JN2A 4F9AA 4I6LA 2C5VA 1JSTA 5J79A 5AV2A 3I5ZA 4RZWA 2PMOX 3ROYA 5AEPA 1WMKA 1PXMA 1YXVA 2O65A 3EN9A 4HCTA 3LQ3A 3I1AA 4FKGA 3D0EA 3W18A 1KV1A 4C02A 1BL6A 2X7OA 3HMOA 1TQMA 3KRLA 3VC4A 2WMBA 3ZEWA 2CN5A 3OUNB 4D4SA 1WFCA 2OXXA 4GKIA 1UU7A 4GT4A 2Z7QA 4EH5A 2F2UA 3EFKA 3RZFA 3OTVA 3ERKA 3JY9A 4FKVA 3RPRA 3MH2A 5TKDA 2ZAZA 3AC4A 2JAVA 3DXNA 3QWKA 4RIWA 3W2RA 3ZLWA 5CNOA 4FTMA 4PP9A 5EQEA 4IBMA 1J1BA 4BYJA 3AKJA 1FMKA 4E8AA 3F3VA 4F1TA 5KHWA 3ZLXA 4EWHA 5FDXA 4PDSA 1QPJA 4H3PA 4KIKA 2W4OA 3FI4A 3HV6A 3E64A 3HLLA 3BGZA 4DGMA 3QWJA 4EOKA 4IAZA 5L8LA 2ITZA 1Z57A 4MQ2A 5BMMA 2HW7A 5E8SA 3EL7A 4UWCA 4OTFA 3W2OA 3NEWA 2ACXA 3DS6A 2V62A 3B2TA 4GV1A 4ANOA 2R4BA 1I09A 4QDVA 3U55A 3HKOA 3L9MA 4FIEA 3UVRA 3MW1A 2YWPA 4OAUC 5F20A 4KKGA 1M52A 2NO3A 3OEFX 4BBEA 4GRBA 4HYUA 4CMTA 2O3PA 5L2TA 3ATSA 4EK4A 4NJ3A 3R1QA 3QLGA 2ITPA 4YJOA 3IGOA 4UYNA 4OTDA 4J96A 5HORA 1LEZA 2E9OA 4AZTA 2BUJA 1SZMA 1IAHA 4MK0A 4MH7A 1TFFA 4EZ7A 3PLAE 2LAVA 5GINE 1WZYA 1Y91A 2I7QA 2BRBA 5FGKA 2B55A 2VO3A 2WMXA 4ZIMA 4FKLA 3SOCA 5A46A 3SW7A 3UZRA 4A07A 4EC8A 5B2LA 5I9WA 4HOKA 1R78A 4BCIA 2F7XE 3GUBA 2QLUA 1UV5A 3ZZEA 3PRIA 4Q2AA 4EH6A 3LIJA 2YLEA 3GFEA 3RI1A 2EXMA 3TKHA 4FGBA 2W9FB 2A98A 4IFCA 2VNYA 2E9UA 4QTAA 3Q9YA 3C51A 4BF2A 4BWKA 1S9IA 2AEGA 2YIXA 4YZ9A 2UZEA 4UN0C 4HGTA 2IW6A 3UIXA 2ONLA 1SVHA 4NM7A 4QQJA 5KE0A 4BHZA 1K9AA 2YISA 4NU1A 2OZAB 4O6EA 4FIIA 3FV8A 3HZTA 3RTPA 5FDPA 1VJYA 2BROA 2VNWA 4LOPA 4J98A 4PPAA 5AUVA 3JUHA 4KBKA 4ANSA 2OGVA 3QTIA 3VQHA 5AV4A 2W1CA 2XK7A 3HGKA 3VIDA 1OKYA 4MNFA 1XO2B 2G15A 2R3KA 1CKPA 5AAGA 2R0UA 3A7HA 3GU8A 4IEBA 5EM8A 3E63A 5LJJA 2XBAA 3CD3A 3MY0A 5LOHA 5JGBA 5E8YA 3NCZA 4QMPA 4MNEA 2HENA 3MA3A 2Z7RA 4FV9A 4QP6A 4QTCA 5AUZA 4YMJA 3MVHA 2J5EA 2VZ6A 4QMWA 2G2HA 4MKCA 2BDWA 3EN6A 3FE3A 3G0EA 4NJDA 3UOLA 2YDKA 3HNGA 4M14A 3WE8A 4R78A 1JKSA 4QMVA 3HP5A 3IDBA 4AN2A 4XG4A 4C3FA 1FPUA 1VZOA 4LFIA 4D4YA 2GHMA 2R3JA 3UMWA 3BU6A 4ZY6A 5ETAA 2F57A 4IB5A 3ZRKA 1W0XC 4D4RA 5BYYA 3PP0A 1R1WA 2CKQA 2JIUA 4G17A 4IZ7A 5AR8A 4I0RA 4A4LA 5AUYA 5AX9A 4C3PA 2C47A 4KBCA 5EKNA 5L2SA 2I1MA 3H9OA 3CIKA 4D2PA 3ZFYA 4EH9A 3K5VA 3FZRA 3N4TA 2YCQA 2O0UA 4GJ3A 5FBOA 1Q97A 4FKOA 5IKWA 4IVDA 3I5NA 4U8ZA 4YJQA 5KZ0A 4DGGA 5IDNA 5GJFA 3ANQA 1PW2A 1A48A 3PA5A 1BMKA 1PXKA 3EQFA 1VYZA 2OKRA 5DG5A 5DOSA 1GAGA 4UB7A 4K9YA 4DH3A 1YHVA 5BVFA 4G9RA 2VO0A 5KMIA 3GU6A 3O0GA 2WTDA 4TL0A 5TO8A 3NYXA 4QNAA 1KWPA 3T3VA 4S30A 2B7AA 3SX9A 4EOOA 5EW9A 4E6CA 2XH5A 3N4VA 4JIKA 1RQQA 5T68A 4N57A 1DI9A 2P33A 4R1YA 5KZIA 3ZS5A 2FSOX 2G01A 5HNIX 5E8TA 2J50A 4WSYA 2HELA 4E7WA 3OWJA 3CTHA 4JX3A 2ZMCA 4BCOA 3PSDA 3UIBA 4V01A 3TZ8A 3VRYA 4F63A 4LGHA 2OZOA 3DB6A 3DK7A 5K0XA 4L3LA 4B99A 3B2WA 4DEAA 4D9TA 4FT9A 2Y6OA 2YM7A 4C4FA 2A2AA 1KE8A 4HVSA 3FWQA 2UZLA 3TACA 3L8VA 4BKYA 4F78A 2XAMA 3GP0A 1SMHA 4LM5A 5KMLA 4WSQA 3LHJA 3MVJA 5HVJA 1SVEA 4GK2A 4I6BA 5HESA 3DU8A 4OT6A 3AC1A 1FINA 4R7HA 4UYAA 3V8SA 4BBMA 3MIAA 4OTRA 3MGYA 4HGLA 1J91A 3ZH8A 3MBLA 1H1PA 1XBCA 4FTTA 3ZFXA 4E5AX 1U5RA 2QKWB 5H8GA 3CP9A 4C38A 5M4IA 3PVWA 2CMWA 3O8PA 4XLIA 3HAMA 3AOXA 4W4VA 3KN5A 3QRTA 4YZDA 5EI6A 5HG7A 5D1JA 5AV0A 1M14A 4BCHA 3OF0A 4CV9A 4EYMA 3BIZA 2ZM4A 2QODA 3COMA 4YJUA 4O0XA 2VWIA 2F9GA 4O1PA 4I23A 4TYEA 4NWMA 2W96B 3ULZA 1GY3A 3D9VA 3UNJA 2GNIA 3JVSA 4DE4A 3FKOA 4G6NA 2BDFA 3FJQE 3DA6A 4YNEA 5AR5A 2FUMA 3WZKA 3OZ6A 4QPAA 4ID7A 4R3CA 1WVXA 4GU9A 3NDMA 4FVPA 4FV2A 4GSBA 4NCTC 3M1SA 2R3MA 3CE3A 1JKKA 4FKIA 4FNYA 4MXAA 4R5SA 2H6DA 3CBLA 3EN4A 4G3FA 4ZY4A 1XBBA 2GQGA 3A7JA 1KV2A 5AJQA 3RCDA 4FUXA 4G3GA 4P90A 3TYKA 3O7LD 3VBQA 2XJ2A 1PMNA 1V0PA 4O4EA 5AR4A 2CN8A 3UMXA 3TUCA 5DRDA 5FTGA 3POOA 4APPA 5JK3A 3NYNA 3QD3A 2FSTX 3I6UA 3H0YA 4IACA 4UZHA 2RG6A 4U6RA 3RNIA 2QOBA 4FSNA 5AP6A 3I4BA 2W4KA 1GZOA 4AUAA 4EOIA 2XIRA 4A9SA 5BPYA 3JR1A 3VJNA 4FVRA 3HV3A 3RM7A 3O7LB 2WEIA 3PXRA 5EHYA 3TCPA 2J4ZA 4KRCA 4PNIA 5CI6A 4L42A 3DNDA 5AUWA 4LV8A 3TG1A 4TRLA 3TNQB 2RF9A 2Y0AA 4YTFA 4NW5A 1GIIA 3PPZA 3BLRA 4Q5EA 2BRMA 2JIVA 3V5JA 5M51A 3TIYA 2O2UA 3UQGA 5C8KA 2J6MA 5H8EA 5KKRB 4GW8A 5KMMA 3NVKI 3AT4A 1XH8A 2WZJA 3TTIA 4EZ5A 3NFFB 2C6DA 3R8MA 3CXWA 3TWJA 3QZIA 5LWNA 1J7LA 4EBWA 4CZTA 3G0FA 5D41A 4Y8DA 4OUCA 4BKZA 1H1RA 3ZHPC 3I0OA 3AKLA 1IA9A 4WHZA 4QDEA 4CD0A 2B9FA 3OOGA 3VS7A 4EOSA 2X2MA 2X9FA 4AAYA 4NKAA 1T45A 3ACJA 3PY0A 4JG7A 5EM7A 4C2VA 3OUKA 3BHYA 4JBQA 3RZBA 4FTIA 2GNGA 4F0FA 5AUTA 1R3CA 4O7LA 2V7AA 3I6WA 4IZAA 2YLFA 2XRWA 3KC3A 4L7SA 4QTBA 3O5AA 5CNNA 2PZRA 3UGCA 2YZAA 4L00A 4S34A 2YWVA 3DFAA 4BI0A 3K54A 4DEIA 4Z16A 2VTNA 4II5A 2IZRA 5ANGA 4TPTA 1KUTA 2WMRA 4DFBA 4K8AA 2C6OA 2Y4PA 1LEWA 4FSZA 3QTQA 3PE1A 4MXOA 4IX4A 5ETCA 2QOKA 3NLBA 5HNBA 5F9EA 3LKMA 3FZSA 3VS5A 5AR2A 4HCVA 4BRXA 2W7XA 4HZSA 1ZLTA 3RWQA 3UC4A 3OFMA 3EQBA 3R8UA 4BWXA 5J7BA 3PY1A 5C8NA 4GT3A 3V5TA 3F3WA 4DBNA 3W0RA 1KE9A 3E3BX 4FTJA 5JRQA 3PWYA 3PJ2A 4H1MA 2I0YA 5AFVA 4F1OA 3TNPC 5IA4A 4MHAA 4JNWA 5ICPA 4FBXA 4FL3A 1RJBA 4RJ3A 3UOJA 2O8YA 3A7IA 1O6YA 3TV7A 3LFBA 4BCMA 4OAVB 3AGLA 3R2BA 3OT8A 4KB8A 4L68A 5DI1A 3S3IA 3CSVA 4FGRA 4AS0A 1UWHA 1XQZA 3PSCA 4OT5A 3KB7A 5CS6A 3VS6A 4BJJA 4IWDA 4FG9A 4Q9SA 4EH2A 1YRPA 2ETRA 4QOXA 5C4LA 2AUHA 4PPBA 2CDZA 3NUNA 4RVMA 3RPOA 3VS0A 3RALA 4C0TA 4DTAA 5E8UA 5L6WL 2WU6A 3A7GA 4U5JA 2RFDA 3VONA 1JLUE 4I5PA 4RJ6A 2VWZA 3KVWA 1WCCA 4WNOA 3VN9A 4XG8A 2YA9A 3E7VA 4M69B 4O83A 2X7FA 1OIRA 1Z5MA 4BCFA 4E4MA 5M44A 5CSPA 4WRSA 5HTBA 3BU5A 3AT2A 4NM5A 3UZPA 4BTJA 3ZXZA 3R7YA 1IG1A 4E5BA 1J1CA 2BIYA 5G6VA 1XMLA 2A0CX 2REIA 3FKLA 1OB3A 2OH0E 4R77A 4ZOGA 3HRBA 4K18A 4IAAA 4BGGA 2XKCA 2BAJA 3W2SA 2YFXA 4GS6A 5ANEA 4Y73A 4FTLA 4AA4A 2IWIA 3R02A 2YACA 4FZDB 4CZYB 2BIKB 4L43A 3VW8A 3FMDA 4AOIA 2WQOA 3DY7A 2WELA 5FLFA 2H8HA 3BWFA 3P5KA 5BUIA 3IW8A 5CXZA 3UDZA 1YI4A 2X8IA 4JXFA 4IWQA 3IO7A 1ATPE 3DLSA 3NVMB 3U8WA 3ZZWA 2ITWA 3WILA 4QYEA 5HO7A 2PE2A 2W17A 4RFMA 5E8WA 5KMKA 3VUKA 2UZOA 4O4FA 3CTQA 4QPMA 1ZYLA 3W2QA 3CY3A 4JG6A 1ZY5A 2X6DA 4YO6A 5DGZA 4BZDA 3RPYA 1HCLA 4L6QA 4WD5A 4BIEA 2WTKB 4P4CA 4MX9A 4QMQA 3EYGA 3DDPA 3FMLA 3NW6A 2PVRA 2X6EA 4HVHA 3LJ2A 3R28A 5HVKA 4ENYA 2Z02A 3GU4A 4L9IA 2I6LA 2GQRA 3UVPA 4USEA 4ACMA 2GS7A 4ZSJA 5JZJA 4J71A 4UZDA 4BFMA 5IMEA 2YN8A 2P2HA 1TZDA 2OBJA 5CSXA 3MY5A 1FMOE 1HOWA 1UU9A 4KKEA 4UMQA 3P08A 4EWQA 5HG5A 1OIQA 1L8TA 3R7IA 5AIRA 3C4WA 4NT4A 5IA2A 3QF9A 4EQCA 3QHWA 3IKAA 5DT4A 3ZO1A 4EKLA 5CASA 2Z60A 4AZWA 2WOUA 4DTKA 1REJA 5EQPA 1PXLA 2ZB0A 4TYIA 4WKQA 4LG4A 4EQUA 3FQHA 2C0OA 3C5UA 3LOKA 5GJGA 5J1WA 3R8VA 5JQ8A 3QD0A 4GL9A 3A60A 3G33A 4FT3A 3I60A 5HLNA 2OJJA 3UYSA 5DFPA 2VTPA 4PWNA 2J9MA 2UW6A 3OWKA 3Q96A 5K4IA 3CEKA 4ZTRA 3UG1A 5LVNA 4J99A 3GU7A 3OOMA 4RIXB 4U41A 4B0GA 2GTMA 2GHLA 3BBTB 5IQGA 4XRJA 3FYKX 3QGYA 3GC7A 4FIFA 2BPMA 4L7FA 5CQWA 4EH8A 2PMIA 4IX6A 1JVPP 2PMNX 4G3EA 4J8MA 4L46A 1FOTA 5CU4A 2XK4A 2R9SA 3DKCA 3IDPA 3OROA 2W1DA 5CSWA 1TVOA 3E93A 2EB3A 5T6KA 3DB8A 2IZUA 3UPXA 5L2QA 2QR7A 4HNIA 4ALUA 5CU0A 3F88A 4BDGA 4E20A 4KUJA 4AZEA 4AFEA 4JDHA 2VUWA 4DG0E 1BX6A 3WYYA 3KQ7A 5CQUA 5CEQA 2FGIA 5ETFA 2UZUE 3DLZA 5A4EA 2QO9A 1ZYJA 2QOOA 2PUUA 4KA3A 4PL4A 3V3VA 1YXXA 2XCHA 3EB0A 4OBQA 2PVFA 2VTRA 4AF3A 5HHWA 4ZSLA 5A9UA 1J7IA 3TM0A 4AP7A 2W1ZA 5CAVA 1X8BA 3CGFA 3FL4A 3FSKA 5E8ZA 5AUXA 4PDYA 3RWPA 5CYIA 4O2ZA 3UOKA 1J3HA 3KVXA 5M09A 4WBOA 1YOMA 4WUAA 4EH7A 2PZIA 2VO6A 2JBPA 2IN6A 2W1FA 3AC8A 4DT9A 3DNEA 4D2VA 5IQCA 3A7FA 4Z3VA 3EYHA 5HNGA 4QP8A 4RIYB 2IZSA 3EKKA 5IQBA 4IM2A 4IJ9A 4K2RA 2OJGA 1XH9A 3E62A 2QHMA 3FMKA 3MPTA 4PY1A 1NVQA 2BDJA 2GSFA 3NX8A 4NK9A 5DHJA 1OL1A 5H3QA 4BDBA 4KWPA 3UDSA 1OKWA 3IGGA 5L2WA 5D10A 3QUEA 3EQIA 3UO5A 1G3NA 4OBOA 1Y6AA 1UNHA 2CCHA 2J2IB 3BRBA 3BYOA 1GIJA 3LMIA 1UNGA 4FT7A 4QMNA 4QPSA 4F6UA 3JYAA 5IQIA 3BHTA 4FKWA 4QRCA 4U3ZA 4AQCA 4C4GA 4NH1A 3MH3A 4XG3A 3TZ9A 2R3GA 5CEPA 1OBGA 3ZXTA 4KS8A 4CYIA 2R3LA 2ERKA 2Y7JA 2P55A 1KOBA 5CANA 2UZWE 3GQLA 2JKMA 3HMIA 4RC4A 1QCFA 4TYGA 3QX4A 4JQEA 5HE1A 4I6FA 4FEQA 1P4OA 3CD8A 3R71A 4ITIA 2ZM1A 3ZONA 2HZNA 5LMBA 4DEGA 4N6ZA 2PTKA 2R3RA 4BVUA 5LMKA 3AGMA 3QU0A 4A9UA 2IG7A 3W0OA 5TF9A 4DEHA 4YJTA 3R8LA 2OICA 4WRGA 2ETMA 2HW6A 4LL5A 3VBXA 3V5QA 4M7IA 3SOAA 3BL9A 3D5XA 3BHUA 3KMUA 3V51A 3WF7A 2CGWA 4FRFA 3LE6A 2RFNA 4AW5A 5TT7A 5BYZA 4XH6A 2HY81 3R7VA 1K3AA 4ONAA 3UNZA 4YJPA 4LYNA 4FMQA 3VBWA 4F7LA 2X0QA 3HVCA 3PA3A 4D0WA 5IF1A 4DDIA 2GQSA 1XBAA 3T9TA 4OR5A 3EQDA 2BALA 4U9AA 3LFAA 4ANBA 5L6OA 4RC3A 4NIFB 2Y4IB 2UW0A 4FNWA 4BY9E 2UZVA 4JT3A 1Y6BA 4MYGA 4C4IA 4UEUA 2YCSA 3ZUUA 3QC4A 3IW7A 5FTOA 3MIYA 2XJ1A 4CFNA 4ZZNA 3BL7A 2IO6A 3ML1A 2ITTA 2W9ZB 3VF9A 2JLDA 3GI3A 5JGDA 4TW9A 5IA1A 4I4FA 4RQVA 2XMYA 5CEIA 5FM2A 5BMSA 4GVAA 1Q99A 2FA2A 3EIDA 4GK3A 2OZAA 3C9WA 5HE0A 1Q8UA 3IG7A 3S2PA 4BI2A 1B39A 3FQSA 4ZLOA 3BQCA 4DA5A 4DTBA 3R9RA 4F09A 4U7ZA 4V0GB 2BZIB 4G2FA 3P86A 3DQWA 5D12A 5IQEA 4O7WA 3H10A 3HA8A 3TMOA 4J53A 2EXEA 4C4HA 3DBQA 3DBDA 4PP7A 1M17A 4I5CA 5AV1A 4FEXA 4Y95A 2ZDTA 4W4WA 4FOCA 3RVGA 3PRFA 3C50A 3T3UA 3V04A