3HV6A

Human p38 map kinase in complex with rl39
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
349
structure length
331
Chain Sequence
b'ERPTFYRQELNKTIWEVPERYQNLSPVGSSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 14
publication title Displacement assay for the detection of stabilizers of inactive kinase conformations.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 108
structure length 331
sequence length 349
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2009-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3hv6A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3hv6A01
2WEIA 4JBOA 4DH8A 3HV5A 4FGRA 4ZSLA 3DLSA 2VTLA 3RAHA 1JLUE 5AX9A 5HBJA 5HQ0A 3MTLA 3NNUA 5K4JA 2JKQA 3DBFA 3QD2B 4EH2A 3OEFX 4HZRA 1Y8YA 2UVYA 3BYVA 5IKWA 3TJDA 1TQPA 3UC4A 1Z9XA 4GK2A 4Y5HA 5I9VA 3R71A 4GKHA 2R9SA 4TWPA 3TDWA 2WFYA 3A2CA 5L6WL 4FKIA 3AG9A 1YRPA 2DWBA 3HGKA 3PXYA 2CKEA 2JITA 3MW1A 5FEEA 2PYWA 4IZ5A 4ZJJA 3Q32A 2ITUA 3S0OA 5I9YA 4O84A 4YLLA 2JFMA 2OJ9A 1M7NA 2I0VA 1GZKA 2HZNA 4Y46A 4RFMA 5EDPA 5KHXA 4L46A 3ZSGA 4FSMA 1J1CA 5CEOA 3F5PA 2FSTX 3PWDA 1Z57A 5HTBA 1OECA 2WTKB 3TZ8A 3TTJA 1H25A 4QNYA 5EYDA 3VBXA 5FP5A 1J7UA 2HIWA 5DN3A 3FZ1A 3U9NA 1JWHA 2W05A 2YWPA 4O0TA 1OGUA 4ANSA 4TNBA 5IMEA 2QODA 4A9TA 3NCGA 3R2YA 2ZOQA 3QF9A 4D2RA 3JUHA 1U54A 2V5QA 2VTTA 3DJ5A 3DA6A 3G2FA 3IECA 3PPKA 4K0YA 5DMZA 4X2NA 3ZC6A 4IAFA 2DYLA 4C3RA 2WQNA 3F88A 4JQEA 4J99A 3WF6A 2BHHA 3ORPA 1A9UA 4LGDA 4XG9A 4FG7A 1PXLA 3AC8A 4FTOA 4FV6A 3KF4A 3TKHA 4X0MA 3VNTA 5HVKA 1NA7A 3VS4A 4JX3A 4AZSA 3MESA 3W18A 3VRZA 1XWSA 4BHZA 4KA3A 4QPSA 4R3PA 2WQMA 4X3FA 4MD8E 3FMLA 3NUUA 3UZPA 2VO7A 3PFQA 3R8PA 4WNOA 3FKNA 3B8QA 4I93A 3KULB 4L44A 2WU7A 4GFMA 3MIYA 4DT9A 4DGOA 4F1OA 4P4CA 2YWVA 4CZTA 3LFCA 3FI8A 4XOYA 4LM5A 2PWLA 3R83A 3QRIA 3RM6A 4F7SA 3MN3A 4RQKA 3WZDA 2B54A 4QMNA 3C0HA 3GGFA 1GZOA 2XNNA 4IACA 5BVKA 2GS7A 4BVUA 3QU0A 4P7EA 4EEVA 4ALWA 5BVWA 3C5UA 2W9FB 3BPRA 3GC9A 4FK6A 4GFGA 4GRBA 4HGTA 1PMVA 4O0UA 4FKRA 4AQCA 2W1CA 1QPDA 5C8NA 5H3QA 4CLJA 1VJYA 2UZEA 3PY3A 3QA0A 2WMVA 3V8WA 2FSLX 3ZCLA 4K33A 2VGPA 4LUDA 2YIXA 3UOJA 3KCKA 3UTOA 3W55A 3OHTA 4GJ3A 3OUKA 5FLFA 5AA9A 1UWHA 4U6RA 4YZNA 4U7ZA 3PVBA 1T45A 4AOIA 1IA9A 4FKWA 2PULA 4C2VA 2QOBA 2I7QA 4BCNA 2XIKA 4D2VA 2GCDA 4O21A 5HBEA 5HG5A 3HVCA 1Q8ZA 4RWKA 4FVQA 5IQDA 4G34A 2Y4PA 3TZMA 5IQAA 3BEAA 4K11A 4GL9A 4PDPA 2C0TA 3BIZA 3A4OX 4OTRA 4C61A 2CGVA 3PTGA 3UG1A 4G2FA 4C3PA 4USFA 4YZCA 3O0GA 2VTJA 4E8AA 4Z3VA 3QYZA 3AC5A 5FTOA 3DOGA 5H8GA 1GIJA 4O0SA 4O22A 1Q8YA 4M0ZA 4M7IA 2CN8A 4R7HA 2VWXA 5GZAA 3QGWA 2IVSA 4KWPA 2X1NA 3IW7A 5KMJA 4IB3A 3LIJA 1UNLA 4BICA 4RRVA 4MAOA 1YOLA 3DZOA 3AT3A 1H1QA 2J90A 2WOTA 3GC0A 4OBOA 5DR6A 2DS1A 3O8PA 3VO3A 4IMYA 4NFNA 3TTIA 4BCMA 1H0VA 5AAEA 3ZC5A 4M66A 3PXRA 3UPZA 2W17A 2J51A 3GQLA 5K3YA 3TDVA 2UW7A 3THBA 3AT2A 5D1JA 2IVUA 3RK7A 3VUHA 4CFUA 3FQEA 3SOCA 4NH1A 4RVMA 3NLBA 3F3WA 4IJPA 5CU2A 2WMTA 1FINA 3NUNA 4DFXE 2J0IA 3BKBA 2R3JA 3EQBA 4F0IA 2XIYA 4LGGA 3TG1A 2HOGA 3S1HA 1L8TA 3RJCA 2BDFA 3DNEA 4WSYA 4M0YA 1SVHA 5CZIA 3SLSA 5GNKA 4LRJA 4EOOA 2VTMA 4FVRA 4CEGA 4C58A 4G9CA 2ETRA 4GH2A 2JIVA 3R8LA 4PDYA 4EQUA 2YJSA 3NDMA 4LMNA 2JDVA 3OT3A 3DLZA 5M44A 5HIEA 4IM3A 1KE8A 4O0VA 2PL0A 3G6HA 1PW2A 3BHTA 4O7YA 4Y5QA 3W2RA 2X4ZA 4H05A 1Z5MA 2VTAA 3D15A 3G6GA 4U42A 2JLDA 4HVHA 3EL7A 1Q8TA 3D83A 3E87A 2PE0A 2X81A 1BUHA 4WRGA 4D0XA 4D9TA 4MNEB 2YISA 4DCEA 3UMWA 3WZJA 3OWLA 2XF0A 2AC3A 1URCA 4GT3A 3W2QA 3TV4A 2QKWB 4PMTA 4O6EA 3R7GA 1H08A 1KV1A 4ZTNA 4FKLA 2V22A 3ELJA 1Q99A 4N4SA 3KRWA 3PA4A 1ZOEA 4G3EA 4H36A 4JRNA 4JR7A 5LVOA 3AD4A 4QP3A 3H0ZA 3IW8A 4FV1A 5HIDA 4Y72A 2F7EE 1XH6A 3OC1A 4DTKA 3BGPA 2NRYA 4U40A 5HNGA 3KY2A 3ORXA 2IG7A 4R1VA 3PSCA 4E73A 5CU4A 2Z2WA 3ZLYA 2PVJA 1M2QA 3QCSA 2PMNX 2O3PA 2UZVA 3CD8A 5KZIA 2ZB1A 2WPAA 2PVMA 1AD5A 4BYJA 4FKOA 4QP2A 4ANNA 5CT7A 4D2WA 3WBLA 4O91A 2W06A 4H3BA 4MF1A 4I24A 2UVZA 3PJ1A 3Q3BA 4K9YA 3E8EA 4J7BA 2C1AA 5LVLA 1U46A 2XRWA 3ROYA 4YZBA 3RTPA 4AW1A 4U80A 4BHNA 3NUPA 4MBLA 4Z55A 3QAME 4QQCA 4R8QA 1OPLA 4WHZA 3ZLXA 2BFYA 1H00A 5HCYA 4IC8A 3AMYA 2HYYA 4YJRA 5LMKC 3TNHA 4G6LA 4OBQA 4G3GA 1H07A 4A4OA 3WZEA 4EH9A 5KMKA 1CKJA 5DBXA 3HDMA 3N9XA 4FEQA 5CSHA 5FWKK 3TNWA 4NSTA 2V62A 3EQDA 3FL5A 3VWAA 3L8PA 2XKDA 3OXZA 4UWCA 3L1SA 2XK8A 3V5QA 5AUTA 5IQBA 2UW8A 5BUEA 2REIA 5AR4A 5CALA 2WTDA 3LXPA 3WF9A 4HNFA 2VU3A 3ZEWA 2OK1A 3ZUVA 4FZAB 1UWJA 4C4EA 5BVOA 4QPMA 3ZOSA 3I5NA 4BRXA 3KXNA 2OJGA 4NK9A 1SYKA 4C4FA 2HENA 4AW0A 4YMJA 4C8BA 3VVHA 4WNPA 3A7IA 3LOKA 3PZEA 3VUGA 4WIHA 2X0GA 3UO6A 3R8ZA 4GFOA 3KVWA 3WF5A 4DLIA 3IW4A 3RK9A 2PZYA 4AXAA 5J5SA 2IZSA 2YZAA 4NWMA 4QMZA 4MXAA 3QFVA 5CT0A 5HLPA 4BDEA 4D1ZA 4DH7A 4PRJA 3OFMA 4DG0E 5M51A 4O2ZA 1OZ1A 2CKPA 4TYIA 3HNGA 2JBPA 2GNHA 5HI2A 1Y57A 3O8TA 4EOMA 2QO7A 2B4SB 3PIXA 3QHWA 4L8MA 4YPDA 1M52A 5C01A 5LMAA 4FV5A 5FTGA 5J9ZA 4YR8A 3I7CA 3RAIA 4X3FB 1RQQA 4FV4A 5JZNA 3FAAA 2WO6A 1P4OA 5E8ZA 2ZV7A 4XLVA 2BILB 1UA2A 1YWVA 1FGIA 3HA6A 3CD3A 4G6NA 2ITXA 4M68A 2WQBA 2JIIA 4L3JA 4ZTLA 4PL3A 4G1WA 4ZSEA 2RF9A 4KRDA 1VR2A 5AP3A 2WQOA 2YABA 4OT6A 4P2KA 4R7IA 5CSXA 5EQYA 3FI3A 4CXAA 3Q04A 3S3IA 3LPBA 5LMBA 4EK4A 3QCXA 5AP1A 3QZIA 4XJ0A 2XCHA 4FA2A 1KV2A 4FTRA 4OTGA 5A4TA 1REKA 4C34A 4OUCA 4OW8A 4F6UA 3GU8A 5GZ8A 3ENMA 3L9NA 1UVRA 3AD6A 4FIEA 1A06A 1YKRA 3DQWA 2X6EA 1W98A 3FQSA 2QURA 1LEWA 2B53A 4RZWA 4F63A 4A7CA 4K8AA 3F82A 4RVKA 5M56A 3NMUF 2YM3A 3S00A 5BUIA 4XG6A 4W4XA 3OUNB 3CY3A 3EFWA 4X6QC 1SNXA 4LV8A 3QUDA 2BFXA 1E1VA 1ZRZA 3GU5A 4E4NA 3R73A 5D41A 1JKSA 2V55A 3DZQA 4QP9A 3SW4A 1YDTE 1URWA 4E6QA 4FZFB 5BYZA 3RINA 4X3FC 4R3CA 5H9BA 4CKRA 3ALOA 3CEKA 3ORKA 2VTNA 5EFQA 4ZZMA 3SG9A 4F1TA 4FTJA 4IB1A 4DEDA 4C37A 4RSSA 1VZOA 4U3YA 5DPVA 3HMMA 3ZXZA 5BVFA 5LXMA 3PJ3A 4FYOA 3RAKA 1XH5A 4MF0A 4TTHB 2Z7SA 2QD9A 3MDYA 3QWJA 3M1SA 3CTHA 3RZFA 4CKJA 3SVVA 3I81A 4RX5A 2EXCX 4RPVA 3P7AA 1FGKA 4I5HA 2C68A 4APPA 2C6LA 2VV9A 3ZMMA 4ZMEA 2QOQA 3NZ0A 4DH5A 2BDJA 4QMOA 3TEIA 3CC6A 4GVAA 2BTRA 2VWBA 5FTQA 1K3AA 2QLQA 5CTPA 3SXSA 4LOQA 5KMOA 4BDAA 3VUMA 4ORKA 3FZRA 3F2AA 4V04A 2EB3A 2P0CA 2W99B 3F6XA 3OW3A 4NT4A 4FGBA 3OTVA 3HECA 3O51A 2OJIA 2GNFA 3MV5A 3V04A 4ITIA 2PMOX 3G9NA 4OTFA 3WIGA 3QXPA 3LMGA 4R7BA 4YHTA 3QALE 5KMIA 3R21A 5E8TA 1OIYA 2C6DA 1CKIA 2C5OA 4MCVA 4ITJA 2YAKA 4V0GA 4O6LA 3PJ2A 4ACHA 3ZO4A 3GNIB 1NT2A 4KIPA 1H28A 1SNUA 4F7JA 3DCVA 3R8MA 2C4GA 4LOOA 2WQEA 4DGLC 1H26A 2WTIA 4DEBA 1W82A 2PVRA 4X7QA 3CJFA 3EWHA 3P7BA 1YI3A 5J1VA 3NEWA 4IWPA 5IDPA 2BZKB 5CI6A 3ODYX 4S31A 1MRUA 4BCOA 4O27B 3BRBA 1BLXA 5L2SA 3H10A 4NCTA 2J0MB 2YLFA 3LHJA 5IH5A 5JRSA 5JFSA 2HWOA 3W8QA 4ZK5A 3FLZA 3KFAA 2QC6A 4TYEA 5ANOA 3MTFA 2H6DA 4H3QA 5DHJA 4AZTA 3F2NA 3MBLA 3MPTA 5HORA 4ZLZA 1PKDA 4QP8A 3NAYA 4BCKA 5HO6A 2W4JA 3R9HA 1BX6A 1ZMWA 3UVQA 3E62A 3QLGA 5H8EA 4N6YA 1U5RA 3KN6A 1REJA 4JNWA 4PNIA 3L8VA 4QTCA 4FV2A 4DEIA 5JZJA 2I0YA 4AUAA 1CSNA 1OIQA 3DB8A 3TNPC 4ZSAA 5HLNA 3LM5A 4K77A 5L6OA 2ITYA 3R04A 4FE2A 3KU2A 1FMKA 4J95A 3OROA 3VUKA 3EJ1A 4RWJA 3QGYA 3HMPA 3A7FA 4BI2A 5ITAA 3BWFA 2NO3A 4RVLA 5CEPA 4FSRA 3AC2A 5IH6A 4MXZA 1CMKE 2FGIA 4RC4A 3P7CA 3LFSA 2JDOA 2XJ2A 1ZOHA 1M14A 4RA4A 2XKEA 2JC6A 3OY1A 2ZYBA 4AWIA 4EH5A 3TUCA 4F9YA 4F9CA 4M3QA 4F99A 2IZRA 3F5XA 3F66A 4BKYA 2GQSA 3FKLA 4I6QA 4ALUA 4XV3A 2BRHA 4G5PA 2VWVA 4NTSA 5CSWA 4D0WA 4UX9A 2XIZA 5AR2A 4I0RA 4QNAA 3MFTA 3UDBA 3ZS5A 5CU0A 3CTJA 4ANBA 5J9YA 3OCBA 4AZFA 4YNEA 1B39A 4LL0A 3AOXA 2QI8A 5HE3A 4B9DA 3FC2A 1IAHA 4GIIA 5K4IA 1M2PA 2A4LA 2BVAA 3MI9A 4FX3A 4ZP5A 4DF3A 2YM4A 3L9LA 4IW0A 1OPJA 4IH8A 3L8SA 4XV1A 2LAVA 4USEA 1IAJA 4C7TA 3A8WA 1PF8A 4XV9A 4ZZNA 4USDA 5JEBA 3B2WA 3SG8A 3IS5A 3R22A 4RIXA 4F9BA 1OI9A 3PZHA 1W84A 1X8BA 4FL3A 1PRYA 4L3LA 4KSQA 3NW5A 3HV7A 3VS1A 3OT8A 3EQHA 1UKHA 4IHPA 4TYJA 3FUPA 1Y6BA 2QO2A 3E8NA 3C50A 4IX5A 3VS2A 2YM6A 5A6OA 4EZ3A 1AGWA 3FXZA 4RJ7A 4O82A 4S34A 4XG8A 4YURA 2WTVA 4YLJA 4O38A 4U97A 2VWYA 4FV0A 2VWUA 4BBMA 1LP4A 3R01A 2YN8A 3K5UA 4NW5A 5LJJA 3HL7A 3HP2A 4EQMA 3ZHPC 2X8DA 4J8NA 3PXFA 3UQGA 4EBWA 2VO6A 2DQ7X 4CVAA 4YLKA 3QTUA 4AT4A 3TV7A 3BYUA 2FUMA 3GCUA 4I4EA 4AGWA 3NVKI 5FUTA 4ZJVA 3E7OA 4W9XA 2J0LA 3CJGA 5EM8A 3LCSA 4B6LA 5AP2A 2FA2A 3VHEA 2X9FA 2GNLA 3DXQA 3S4QA 1YHWA 4F9AA 2OJFE 2R3LA 4JDIA 4EHVA 2A27A 2PVNA 4DFYA 2UW0A 5BYLA 4BCJA 1JAMA 2BPMA 5G6VA 5JQ5A 2HZIA 3Q9YA 3QTQA 1YXXA 4MKCA 2OXDA 3QUEA 4JDKA 3V5TA 4F9WA 4NUSA 4TYHA 5AMNA 2Y7JA 4FKJA 4ANOA 1P4FA 3LFQA 4ZIMA 5FG8A 1JVPP 3KVXA 4NJ3A 4I1ZA 2OJJA 5HGIA 4ZSGA 5CEIA 2ETKA 1B38A 4WNKA 3RK5A 2WIHA 3R9NA 3F2RA 3RVGA 4ZLOA 4EH4A 2R3MA 4BCHA 4IWQA 2EXEA 2C1BA 2XNMA 5M53A 3HAMA 2J5FA 3GU7A 4FTMA 2OU7A 2RL5A 4A9YA 3EOCA 3PDTA 4XEYA 2HZ4A 3C1XA 4TKSA 4UALA 3SQQA 1ATPE 4V01A 2Y8OA 2O65A 3BU6A 5CNNA 5I9ZA 4E5BA 2C5XA 5G1XA 3JYAA 3TKIA 2W4KA 3QX2A 4E7WA 4LRMA 4WOVA 1BKXA 3WOWA 4DH1A 1SZMA 4W8DA 5CYIA 4DEEA 3MFUA 4GG5A 4L52A 4AN9A 2B9HA 4WG3A 5ANGA 3UMXA 5CXZA 4FTUA 3HMNA 1LR4A 4YO4A 4QYGA 3CXWA 4M12A 3LCTA 2HXLA 3GQIA 4L67A 1A48A 2UZDA 3R1QA 4I6FA 3POOA 4BTFA 4E4LA 2GHMA 2KULA 2J6MA 4BKJA 4I20A 4EOIA 3LQ5A 3LQ8A 4HCUA 4Z16A 3KXGA 1MQ4A 4XBUA 4O86A 2ZM4A 5FM3A 5LWNA 3WF8A 3BZ3A 1WVWA 2GPHA 2GMXA 3RWPA 4G17A 4QOXA 3VC4A 3V5WA 3E92A 3R7EA 5JGDA 1RJBA 2WNTA 5EQEA 4JT3A 3MVLA 4EK8A 5J8IA 4ACDA 4BN1A 3QTZA 3QZFA 3LQ3A 4QMPA 3GBZA 1KUTA 1GIHA 3KA0A 3QXOA 3CKWA 3RHXA 4FG8A 5AV1A 4E6CA 4QYHA 3F5GA 4J96A 4A9SA 4RIYA 1F0QA 2WKMA 3LXKA 2XVDA 3W2SA 3TIYA 4QMMA 4HCVA 4OT5A 4XP3A 5HO7A 3IK3A 4G3FA 3ATSA 3WZKA 4FT0A 4V0GB 3CQEA 3RBWA 4PX6A 5CENA 2JFLA 3B8RA 1H1SA 3MA6A 1Y6AA 3PP1A 4C4HA 5AP0A 3BGZA 1DS5A 4R5SA 3QD3A 2Q0NA 3DGKA 4M84A 3CP9A 4YJPA 4K2RA 3H0YA 4NJDA 5BMMA 3FXXA 3TL8A 4DITA 4D9UA 4E26A 3TM0A 4B7TA 2HK5A 2WMUA 3IOKA 2BZJA 4UZHA 4YTIA 2XNPA 3EN9A 4IDVA 5M09A 5GZ9A 5D11A 2BKKA 2IN6A 4ZTQA 1TQIA 5IISA 3CQWA 5HESA 5GJGA 2G01A 3OBJA 2Y4IB 3SX9A 5AUUA 2UZLA 3COIA 3DBCA 4MVFA 4FTKA 4IAZA 2XNGA 3ULIA 2R3QA 3JXWA 4BDCA 2YIQA 3KGAA 1J7IA 2KTYA 4BY9E 4I3ZA 1LEZA 5HD4A 4XG4A 3LFAA 3R63A 2DUVA 4TRLA 5HKMA 2OIQA 3NVMB 1JSTA 2PUNA 4ASZA 4NL0A 4QT1A 1ZMVA 3ANRA 3HA8A 5C03A 1OKYA 3A4PA 4C36A 4UMPA 4BYIA 3QBNA 2QQ7A 4L53A 4M8TA 4KIQA 4IVCA 3EQGA 4E6AA 3EFKA 4ZAUA 5K5XA 5ANIA 2PMLX 4FSNA 3NUXA 2X2MA 3UO4A 3WYYA 4QQTA 5J5TA 2BZIB 3A61A 4FEXA 2VN9A 3SW7A 2OXXA 2YFXA 3QTSA 4RX9A 4KBCA 5A3XA 3C9WA 4DG2E 3MFRA 4ITHA 3OZ6A 4IZYA 5AP6A 4EWHA 4C2WA 2R64A 3VBYA 4Y73A 3LJ1A 2CNUA 2NRUA 2H96A 3CY2A 3E93A 4NM0A 2UV2A 4NKSA 3ZO2A 4A9RA 4BIBA 1Y91A 5HZNA 2E9PA 4ANQA 3WZUA 4F7NA 3ZUUA 2GSFA 4NCTC 2GQRA 4XG7A 4O2PA 3VHKA 3JR1A 1YXVA 2HXQA 5D7VA 4AA5A 2Y4IC 3TZ9A 3FPMA 5DR9A 3I4BA 2BKZA 4QMYA 4BKZA 1W7HA 1CDKA 2JDTA 4HYSA 1GAGA 2J0KA 3I0OA 5A6NA 4K18A 3F7ZA 2SRCA 5AIRA 5IA3A 4X2JA 4QD6A 2XZSA 5ETCA 2Z8CA 4UEUA 5FBNC 2CGXA 2WZJA 3DAEA 1W0XC 3FYKX 3NGAA 3K2LA 2FB8A 2PUUA 4YHJA 2PY3A 4ID7A 4QP4A 4KAOA 5BVNA 3BQRA 4QMLA 2GNJA 2XCKA 4J97A 4MXXA 1JKTA 4RIXB 5L2WA 4AW2A 2QLUA 1BYGA 4UYAA 4CCUA 4ZTMA 3A62A 5CLPA 2H8HA 3G33A 3JS2A 4RGJA 3MS9A 4AA0A 4ASXA 4L6QA 4E6DA 5B2LA 5DT3A 4FEVA 5CEMA 4E5WA 4RLKA 2YIWA 3G5DA 2PVKA 2IVVA 3OS3A 3ZUTA 3D5WA 3UVRA 4DA5A 3VQUA 4DGNA 3EQCA 3Q60A 4FKQA 5E90A 4JQ8A 3UJGA 2WXVA 4YJOA 2OH0E 4HOKA 1FOTA 2VTOA 3HV3A 3O17A 4FTCA 3W1FA 1PXNA 1WBOA 4UV0A 3D5XA 3ZBFA 2R3IA 5CEQA 3QD4A 4XP0A 4F6WA 4U79A 4QP1A 2PUIA 3PY1A 2O2UA 1NXKA 2O8YA 4FTQA 1XH8A 3AC1A 3W2PA 2VRXA 4XV2A 4ZY4A 4X21A 3SAYA 3KKVA 3SGCA 3MIAA 2WMRA 3ZFXA 4IAAA 4ZY6A 3ZM4A 3O8UA 5A4QA 4DTAA 4I4FA 2R5TA 2W4OA 2Z7LA 3ZZEA 4C57A 3DXNA 4QQ5A 2J50A 1KOBA 4UXLA 5AR8A 4PP9A 4BIDA 5F1ZA 2VO0A 2XBAA 1J7LA 3FC1X 2XB7A 3LFNA 2JEDA 1QPJA 5CU6A 2XMYA 5EW8A 2EB2A 4PL5A 4TWCA 1APME 4FYNA 2F7ZE 2J0JA 3MY1A 4NM3A 4TYHB 5DRDA 3PRIA 3DTCA 3OBGA 4QP7A 3KXXA 5HG8A 1IEPA 4LOPA 2WTWA 4AE6A 5DI1A 3DBEA 3PVUA 4Y8DA 3ZBXA 4IVDA 4DN5A 3P1AA 3LLAA 4FNYA 1E9HA 3C4EA 3P08A 5L2QA 4LG4A 4BTKA 4G5JA 3VBVA 4MWIA 4MX9A 5CXHA 4YJNA 4O1PA 3RPVA 4QMQA 5BNJA 2VD5A 3FL4A 2W1FA 4CZUA 2W5AA 3MY5A 1W8CA 3PPZA 1KE6A 4JI9A 4U45A 2PZPA 4JLCA 3U4UA 2OF4A 4BFMA 1JSUA 3BHVA 1R1WA 1Q62A 3BEGA 3I1AA 5M55A 5IUGA 3ZO1A 3NCZA 3UP7A 3ORZA 2BUJA 4DFLA 2C3LA 3Q52A 3Q9WA 5IPJA 4KKGA 4MXYA 2O63A 4TWNA 2W7XA 1SVEA 5E8YA 3RAWA 4XRJA 4AZWA 5BMSA 2G1TA 4NM5A 3CQUA 2R2PA 4FVPA 4MEDA 4U41A 3RPRA 5B7VA 5CASA 4FKGA 3TNIA 1HOWA 3F3VA 5FM2A 4F0GA 2I0HA 5LVMA 3QX4A 2QO9A 3RCDA 3OP5A 3ORNA 3QZGA 5BPYA 1Q41A 3EQIA 4LFIA 5EHOA 5AFVA 1KE7A 1WZYA 5AR3A 3ZH8A 2BRBA 4PPAA 1Q3WA 4GK4A 5HVYA 4EJ7A 4PWNA 3QC9A 4FODA 3FMMA 3PE2A 2XJ1A 3UO5A 4FTIA 3PWYA 3RP9A 3U55A 4RC3A 3UIBA 4O7LA 3HMOA 2QOHA 5KMMA 2EU9A 5J7BA 4FZ7A 2B1PA 1OL7A 4ZY5A 4A4XA 2ITWA 2CN5A 2F9GA 2R3NA 1SMHA 3P79A 3F69A 1H27A 3LJ0A 2VWZA 2HW6A 3BYOA 4QYFA 3LFDA 2P33A 5CZHA 3NPCA 4XRLA 2XM9A 4UB7A 2CNQA 4RIYB 1MRVA 2Z60A 5HE2A 1HCKA 3A60A 3KRXA 4ZTSA 3NNXA 4FV9A 4KB8A 3LJ2A 2YLEA 5EI6A 5K0KA 5HO8A 2JBOA 2W1HA 3EH9A 3U4WA 1ZXEA 2CSNA 2OBJA 3OG7A 4HCTA 4OTPA 2XRUA 4RJ6A 1BMKA 3OCTA 4IX3A 2VTRA 3UZTA 2YDKA 3HLLA 4UZDA 4XBRA 4E4XA 3NRMA 2BTSA 5HIBA 3TV6A 3IPHA 3AMBA 4MYGA 4OTQA 4FKUA 3IG7A 3DFAA 2C6MA 3E64A 4Q9ZA 3HRBA 4GIHA 5M57A 3I60A 4NM7A 1P14A 1WBWA 4RMZA 3TIZA 3E63A 3R7VA 4YTHA 1U54B 1L3RE 3FZPA 4QMSA 1O6LA 3V6SA 2GTMA 2YM7A 4O0WA 5IEXA 3Q2JA 3H9OA 4XX9A 5E8WA 1YHSA 3Q4ZA 2NP8A 3F61A 5IA5A 4AAAA 2OGVA 4X2FA 2ITVA 4BZNA 4D55A 4QYEA 5IMXA 1UKIA 4BB4A 3NWWA 3TN8A 2BALA 2QOOA 5GINE 3Q4UA 2HELA 3B2TA 4O7VA 4OGRA 4I5PA 3GCVA 4C38A 4CTCA 4FIFA 2RFDA 5HE1A 3ERKA 3SDJA 4EH8A 3O2MA 2F2CB 3QRUA 4RC2A 4YBKA 1F3MC 3LCKA 5DH3A 5AAFA 4J71A 5A46A 3O96A 4MNFA 4Z7GA 3QUPA 3M42A 1ZZ2A 5HEZA 4GVJA 5M4FA 4O81A 4IE9A 4IIRA 3FMJA 3NUSA 5ETIA 2EUFB 2QCSA 4BDHA 3LE6A 1QCFA 2C6KA 5EHYA 4ASEA 5CQUA 4DYMA 2WIPA 5IEVA 1UU8A 3K3JA 1ZAOA 3FLWA 4ALVA 4RZVA 3GUBA 3UC3A 2ZV9A 1OM1A 1ZOGA 3ZEPA 3EMGA 4EKLA 5JQ8A 1MP8A 2XK3A 3BV2A 2UZOA 4TT7A 2CKQA 1RE8A 3D14A 1O6YA 5CNOA 4Q5EA 2Z02A 3ATTA 2YDJA 5L8LA 2OH4A 3LCOA 2IWIA 4FNWA 3FBVA 3ORMA 5HD7A 4R78A 2OWBA 3VBWA 3U6HA 4JAJA 5M4CA 3QQJA 5IQCA 4BWXA 3FMNA 4PPCA 3D9VA 5CX9A 2JKOA 5TR6A 3UNJA 5IA2A 3A7HA 3DT1A 4I0TA 5EOLA 4Y85A 2YAAA 4A06A 3PPJA 4IEBA 3RMFA 4RJ5A 1R39A 2G2HA 5E7RA 5DA3A 4XMOA 3F7WA 3BE2A 3FSFA 5CVGA 5EKOA 3VRYA 3WE4A 4EC9A 1TKIA 4RA5A 2VNYA 2C5NA 4NZWB 5CVFA 1YW2A 5AJQA 4CNHA 5CF4A 2XK9A 4JBQA 5C9CA 2WMBA 4JIAA 3JY9A 5EI8A 3ZONA 3GCPA 2PHKA 4Z9LA 5JN2A 2CHLA 2I1MA 4TPTA 1FQ1B 3FY0A 4YZ9A 1OUKA 4GUEA 2X8EA 2B7AA 3O71A 4N6ZA 5C4KA 4GU6A 3ZLWA 2VO3A 5D12A 1Q5KA 3H4JA 1ZY5A 1YXSA 2RG5A 4I5MA 4P5ZA 2UZUE 3H9RA 2XM8A 2YIRA 3BELA 4II5A 5CAQA 3C7QA 2C6TA 3LFFA 5M06A 4BDJA 4EYJA 2F2UA 4QO9A 1ZMUA 3FSKA 2JDRA 2ZMCA 3OW4A 3PRFA 3HRFA 4QP6A 3S2PA 1RDQE 3TXOA 1B6CB 1XH4A 1VYWA 5B2KA 3R8UA 3DKCA 2PSQA 3OVVA 4L01A 4WT6A 3FMHA 4C4IA 5AV0A 3FJQE 5IUHA 2V7OA 4YZMA 3E8DA 4XNEA 5HE0A 3OCSA 3C13A 3RCJA 2GFSA 2XNEA 4IANA 4IWDA 4G6OA 5L2TA 4O7ZA 3DTWA 3ODZX 1OITA 4D2TA 4O83A 4U3ZA 4HVIA 2QG7A 5GHVA 3Q96A 4FIGA 3D2KA 2XK4A 4QMUA 2NPQA 4IZ7A 3SC1A 4K1BA 2UUEA 5EW9A 2HAKA 5JRQA 3MVJA 4RX7A 5K5NA 5FP6A 2VTPA 3VAPA 3RKBA 1CKPA 4EOSA 2C3KA 3O7LD 4XG2A 1KSWA 1G3NA 3DQXA 3KK8A 1GNGA 3W10A 4G16A 4L7SA 3DKOA 2PVYA 2YM8A 4IAKA 3ZDUA 4DLJA 4FOBA 2CGWA 4QYYA 4BWPA 3DJ7A 3OWPA 4QMWA 4O7SA 5LCKA 5AADA 3AGLA 2OLCA 2WGJA 1YDRE 4LMUA 3I6UA 4YTCA 2ETMA 4O7RA 3ROCA 2PVFA 4FG9A 2YHVA 4M13A 3H9FA 4XUFA 5M4IA 1YXUA 4ZS4A 4NIFA 4YC8A 3NSZA 4AE9A 5A4LA 1GZNA 2CCIA 4MBJA 4ZMFA 3F5UA 4WKQA 4S30A 3MJ2A 1IASA 4X2KA 4QMTA 5AUYA 3ZU7A 1ZZLA 4APCA 2J2IB 4O1OA 4JG7A 3H30A 4EK6A 2ITTA 4EONA 4TXCA 3ZZWA 4U0IA 3MB7A 4H1MA 4A4LA 5EOBA 5I3RA 2HY0A 3BU3A 5CEKA 3EQFA 1OB3A 2BZHB 2I0EA 4JS8A 4KIOA 4G9RA 4LI5A 4KBAA 1VEBA 4EORA 4UYNA 5ANJA 4BTJA 3VS0A 1QPEA 3RPYA 3R7YA 3GOPA 3PY0A 1FVTA 4AACA 2R3RA 2H9VA 4CG9A 3DPKA 1PMEA 3DB6A 4IAIA 2I40A 4FKSA 3DK6A 3FEGA 3FMEA 3PUPA 4EJNA 2YZLA 3KQ7A 3TACA 3M2WA 3PA5A 4IM0A 1UNHA 2RKUA 4AT5A 5KE0A 2AYPA 3BHUA 3N4VA 3COKA 3WILA 5IQFA 3VS3A 3Q6UA 4GSBA 3VF8A 5IU2A 2UW9A 1F5QA 3P4KA 4IQ6A 3I5ZA 2UW5A 4OBPA 5AV4A 4WG5A 4EYMA 4X2GA 3KULA 2CLXA 4TY1A 1BI8A 4B99A 1IR3A 2XP2A 1ZYCA 3GENA 3MPMA 4FIIA 2YERA 3PLAE 3DNDA 1PKGA 4H39A 2VWWA 5DG5A 3LMIA 5IUIA 2R0IA 5BX0A 2ITPA 2CNVA 3PA3A 4HGEA 1YWRA 5CQWA 4ZTHA 3V5LA 4WO5A 3HUBA 4CFMA 1ZYSA 4F7LA 1WVYA 3KN5A 3MYGA 4FBXA 1WBTA 4RFYA 1FMOE 4L42A 5DR2A 3AC3A 5I0BA 1STCE 3K5VA 2WEVA 3T3UA 3D5UA 3VBTA 2VAGA 3U54A 2FO0A 3EFLA 4EH7A 3OOMA 3PJCA 5JKGA 4NYEA 3P9JA 4YO6A 4CZYB 3DAJA 4D5HA 4NEUA 4U81A 3UYTA 2A0CX 4X6RA 5DLSA 4D5KA 3A8XA 4CMUA 5BUJA 3KC3A 4E93A 2Z7RA 1XJDA 4WUNA 3WE8A 4BCFA 5EHLA 4KINA 3VULA 2W5BA 5CF8A 3R7OA 4I41A 3V01A 4BI0A 4EKKA 4HVGA 5B0XA 1OBDA 4ONAA 3U9CA 3R00A 3KK9A 5CY3A 4PPBA 3EN6A 3SXFA 2C30A 2X2LA 3KMUA 2ACXA 3D7TA 4GT5A 1PMUA 3IKAA 4KBKA 3R30A 5AP4A 2UVXA 4ACMA 3GC7A 4RX8A 4C0TA 4EUTA 4PMPA 4JQ7A 3R28A 1ZYJA 2C6EA 5EI2A 3R7IA 3I7BA 4KUJA 1XBBA 2J4ZA 3C4CA 2B9FA 5FGKA 5TO8A 5CANA 3HAVA 4O7TA 4CG8A 4GKIA 4FKPA 1KWPA 1SVGA 2R7IA 3Q2MA 1V0OA 1YDSE 3IGGA 3U51A 3C4XA 2BIKB 3ENHA 4CYJA 1XQZA 5CAVA 3ZO3A 1G5SA 1CTPE 3G90X 4I23A 2JKMA 3MH2A 5AM6A 3WYXA 2PMIA 1DI8A 1Y8GA 5K9IA 2QVSE 4X3JA 3EN4A 3EYHA 4CFXA 4YSJA 2QU5A 4DFBA 4IWOA 4C33A 2RGPA 3UIXA 4BI1A 1OKWA 4N57A 3E3BX 5HG7A 3FYJX 2R3FA 4F09A 3HUCA 2VTQA 4JG8A 2IZUA 2OXYA 3VS6A 4JDJA 5HU3A 4O0RA 1J91A 4EUUA 4O7WA 3QL8A 4L9IA 2JAVA 1YOJA 2PZ5A 3F3ZA 2CKOA 4CKIA 3P23A 1Q4LA 1R78A 1VYZA 4JJRA 2C5YA 4C62A 3HX4A 4DEHA 5HU9A 5C27A 3UOKA 4XYFA 4C4JA 1P5EA 3VW6A 3U8WA 3QCQA 3SKCA 4DTBA 1OL2A 5EQPA 4FL2A 5I4NA 5KKRB 4KS8A 4ZJIA 2HCKA 2X7OA 4MD9E 4MNEA 5I3OA 1WBPA 4FNXA 1G8AA 2Z7QA 5HBHA 3VW8A 4CMOA 5C1QB 5I9UA 4A9UA 3ZRKA 4CGAA 5ETFA 1UNGA 4AFEA 4EH6A 1Q97A 5J9LA 3CCNA 2GDOA 3AQVA 4RIOA 2YM5A 5BYYA 4HYIA 3PLSA 5HNBA 5GIOE 1YXTA 3D7ZA 3EQRA 4DBNA 1XHAA 5D10A 2QR8A 5E8SA 3D5VA 5DVRA 2OKRA 3QQUA 3G51A 4XOZA 4WSQA 4LUEA 1FVRA 1OL6A 4IBMA 4BCGA 5IQEA 3AGMA 4FICA 3EL8A 2EVAA 1XO2B 5JFWA 4I5CA 2A19B 2RFEA 4AA4A 3KF7A 3KMMA 5LOHA 1TVOA 5CI7A 2PE2A 4R5YA 3VQHA 4BDKA 3U6JA 3LM0A 2ZM3A 4QQJA 2UW4A 3DY7A 4N0SA 4CFVA 5LCJA 4PV0A 1NVSA 2BAKA 4FTNA 4GV1A 1O9UA 5BVEA 2Y9QA 3LFEA 2LGCA 4HNIA 5C8KA 3FWQA 3UZRA 3HEGA 4ACGA 3N51A 5DWRA 3RPOA 5KUPA 2W1ZA 4BCQA 5HG9A 2ZVAA 3E3PA 4ZTRA 3GFWA 4I92A 2E9OA 2X7GA 1NVQA 2IPXA 3BLRA 5IF1A 3LKMA 2CPKE 2XYNA 3DKGA 3ZRMA 2ITZA 1PXKA 3V8SA 3R1SA 3Q5IA 1H01A 2G15A 3HYHA 4M69A 5ANEA 3TZ7A 3IDCA 5JSMA 4PQNA 4D28A 3G9LX 5KKRC 1AQ1A 3ZFMA 3QC4A 4CQEA 3UYSA 3A7JA 3R9RA 1JQHA 2QHMA 4DFNA 3L8XA 2PE1A 3MA3A 2FVDA 2WMXA 1ZARA 2IW6A 2QNJA 5LARA 1K9AA 5GIPE 1IRKA 2X4FA 2BRMA 3T8OA 4B8MA 4AN2A 5IQHA 4KABA 5A14A 4NIFB 3AD5A 3C4WA 5KMLA 3KXMA 4UMQA 4UMUA 4L43A 2B0QA 4FNZA 4NTTA 3FZTA 4MWHA 3CLYA 4P5QA 4D4YA 5I9XA 3QRJA 3BU5A 4DBXA 3Q4TA 4FUYA 2IZTA 1H1WA 4PDOA 4F65A 3BV3A 2XIRA 5DNRA 4IADA 4ZXTA 4GUBA 3PXZA 3VN9A 4MBIA 2C5VA 3BYMA 5DFPA 4CV8A 5DOSA 4UWBA 4RFZA 4PMMA 3OD6X 4WD5A 2BRGA 4WBBB 5HICA 4HW7A 5B2MA 5DEYA 4CTBA 4R77A 5M08A 4UBAA 1EH4A 4ZS0A 2OIBA 1H24A 4P90A 3GFEA 1WCCA 5HCXA 3ANQA 2QKRA 3T9IA 4YHFA 4B0GA 4C02A 3AT4A 5CF6A 4DEGA 4HYUA 5DGZA 1JNKA 4DINA 2Q83A 1H1RA 4FKVA 4CT1A 3A99A 4ERWA 3FXWA 1MQBA 3P5KA 5JMSA 3GI3A 3TKUA 5J7HA 3CGOA 3O50A 5ACBC 2XS0A 4PL4A 5TF9A 3MJ1A 3RNYA 4CCBA 3DK7A 2X6DA 1MRYA 5AUWA 1J3HA 4W4VA 2VX3A 5A4EA 3Q9XA 4LRKA 3TCPA 1XH9A 4PTEA 2P2HA 3CIKA 2C69A 1XKKA 2X8IA 5IDNA 5EK7A 3FHRA 4UN0C 3Q53A 3OXTA 1G8SA 2WU6A 4FT9A 4E5AX 5JT2A 4JAIA 2ZMDA 4W4YA 3TT0A 4GK3A 1E1XA 2C6IA 2WTKC 4ACCA 3OWKA 4JDHA 1PYEA 4RT7A 4XH6A 5L2IA 2XBJA 4D2PA 3NUYA 5J79A 3QTWA 4QRCA 2C47A 3EB0A 3MVHA 3EFJA 3RZBA 3P78A 4F64A 5CAUA 5JFVA 4F70A 4O0XA 2RFNA 3NYNA 5DT4A 4EK3A 4FEWA 3C51A 2R3GA 4WNMA 3ZLSA 4WRSA 3UQFA 3V5PA 3CBLA 5AEPA 4PMSA 3QTIA 5CSVA 4IC7A 5JGAA 3KREA 1YOMA 2R3PA 4BBFA 3R2BA 5JK3A 2JKKA 3SD0A 3ZRLA 3IONA 5AA8A 2BR1A 2CDZA 3GXLA 3QZHA 4IX6A 2VGOA 2BMCA 3P86A 3MY0A 4TW9A 3D4QA 4FEUA 3W2OA 4ARKA 3NS9A 2XNBA 1I09A 3KEXA 3PIZA 4GT4A 4F1MA 4XHKB 4EBVA 5CVHA 1T46A 3E8CA 3DBQA 2JIUA 1V0BA 3KRLA 4YSMA 5E91A 3RPSA 5I5ZA 2QOLA 2F7XE 3MVMA 1DI9A 2B52A 3POZA 1OKZA 2PZRA 1HCLA 1PMNA 4YBJA 3PG1A 4AN3A 3DJ6A 2C3IB 1QL6A 5D9HA 4GCJA 3VJOA 3FLQA 3UG2A 4OTDA 4BBEA 3D7TB 4RQVA 1JSVA 4IDTA 2YIYA 3UIMA 4TZRA 4YNOA 2ZB0A 4FIJA 3PXQA 4YJQA 4GJ2A 2E9VA 2F57A 3ETAA 4ENXA 2QONA 1P2AA 2QOIA 1BL6A 5HX8A 1OMWA 3OF0A 2CJMA 2F49A 4TN6A 4BDFA 3NYVA 4FC0A 1GJOA 3BE9A 4RLLA 4S32A 3VBQA 2WMSA 4Q5HA 4ZSJA 3VJNA 5KBRA 5E92A 3DBDA 5AIKA 2VTSA 4WUAA 3O7LB 4FTLA 3HRCA 4IVAA 1FPUA 2XKFA 1S9JA 3HZTA 4BGGA 3L9MA 4E20A 1NY3A 2E9NA 2GNIA 3EKKA 4FV7A 2BIYA 3L9PA 4MTAA 3ZM9A 4D58A 2EWAA 2QHNA 4AGUA 5FEQA 4RWLA 4EI4A 2YJRA 1GY3A 4OTIA 3MSSA 2BCJA 2XJ0A 3TNQB 3RNIA 3KXHA 4HYHA 5T6KA 3RM7A 2XA4A 2X9EA 3M11A 3QQHA 4D2SA 2JAMA 1JOWB 2OF2A 4YJVA 5JGBA 2YCSA 3MH0A 4KKHA 3LAUA 4YC3A 2ONLA 2ESMA 4FZ6A 4D1XA 1Q8WA 1PXMA 3OMVA 4NKAA 4XP2A 4DC2A 1OBGA 3C4ZA 5F4NA 5FD2A 4GU9A 4EH3A 2HW7A 3N4TA 3UGCA 2C6OA 3W33A 3BHYA 3NIEA 5IZFA 2IW9A 3UPXA 5AR7A 4MHAA 4RIWA 3ZXTA 3GVUA 3MPAA 5AR5A 3FZOA 2W96B 4KNBA 2RSVA 4D4VA 4AX8A 4EWQA 2VUWA 3OEZA 5E4HA 4H1JA 4YTFA 3Q4CA 3HKOA 3RI1A 3LXNA 1R3CA 3DV3A 4DG3E 4RG0A 4D4SA 5I9WA 4CMTA 3QQGA 3NAXA 5FDXA 2VX0A 1OVEA 2XYUA 3SRVA 4XS2A 3ALNA 3UOLA 1GOLA 3ID6C 3IDPA 5KHWA 4GMYA 4BGHA 5HOAA 3UVPA 3IO7A 3LZBA 5FDPA 4YZDA 2PZIA 5ICPA 3CGFA 4YGAA 3DXPA 2UZWE 3FDNA 5HX6A 2FH9A 3F9NA 4MQ1A 2ERKA 3HV6A 2GFCA 3KRRA 4C3FA 2OSCA 4CSVA 3PJ8A 4FOCA 4Y83A 3MH1A 4FT3A 3PG3A 3KB7A 4KD1A 2ZM1A 5E1EA 4AF3A 2PUPA 3EZVA 3GCQA 1MUOA 2B9JA 2UZBA 1WAKA 2UZTA 2QOCA 4YJTA 5H2UA 3ZFYA 4EC8A 4CT2A 4UMRA 3EIDA 1V1KA 3SXRA 3COMA 4CQGA 3MWUA 4R3RA 5EH0A 2W0JA 3WF7A 5AX3A 2R0UA 4M69B 4BC6A 1UV5A 3NYXA 1WBNA 2WD1A 3PXKA 3F3TA 2V0DA 3OWJA 3Q6WA 4G31A 4YC6A 2PU8A 1YVJA 3C0GA 3R0TA 3GT8A 2C0IA 2WMAA 3PSDA 2HY81 2BAJA 4PF4A 3E7VA 5KX8A 4L68A 4QMVA 3QKMA 4JOAA 5T68A 2W9ZB 1R0EA 2A1AB 3DDQA 3V5JA 2RFSA 4BDBA 2HZ0A 1NW1A 4FF8A 3WARA 3W32A 3K3IA 2OZAA 5IG1A 4MD7E 4R6VA 5TE0A 3E88A 1YHVA 1YI6A 3BCEA 5KZ0A 3UE4A 3EQPA 4L3PA 4IFGA 5DE2A 3ZSIA 2WB8A 4YP8A 4EOLA 4C4GA 4HJOA 3R02A 4HPTE 5CS6A 4JR3A 4C35A 3O23A 5KCVA 5T3QA 5CAOA 3U6IA 1CM8A 1U5QA 4BGQA 3JPVA 3ZSHA 4JRVA 2PVHA 2P55A 3BHHA 3T3VA 3KL8A 5L8JA 4QTAA 2OW3A 2IW8A 5L6PA 2GHLA 2W1DA 4WA9A 3UODA 5CSPA 3CE3A 2E9UA 4FI1A 2ERZE 2WMQA 4FV3A 2IVTA 3I79A 2I6LA 4XCUA 4AW5A 4HPUE 2A2AA 2XEZA 4BCIA 4E3CA 4FZDB 5AUZA 3IDBA 3PP0A 2YCQA 4ASDA 4CRSA 4R1YA 5L3AA 3PVWA 5HVJA 3BX5A 4A07A 4LYNA 4O0YA 5LVNA 5C8MA 3ZDIA 3R6XA 3GEQA 4FTTA 1JPAA 3COHA 3FY2A 1GZ8A 5CWZA 3REPA 3C0IA 4YUQA 4EZ5A 1RW8A 3LMHA 2F4JA 5AUXA 3FV8A 4L7FA 3QD0A 2P4IA 2JGZA 1OPKA 4FV8A 4GYIA 1FVVA 3PVGA 4CFFA 3NNVA 3BGQA 5DIAA 4M67A 1H8FA 1S9IA 3EZRA 3LLTA 3KXZA 3SA0A 3QCYA 4KRCA 5DYJA 3UNZA 4O7NA 4F6SA 5AWMA 4CLIA 2CGUA 2GQGA 3QQLA 4I6BA 4I22A 4JG6A 4U5JA 5HNIX 3JY0A 4S33A 3FLNC 5FEDA 3RWQA 1NVRA 5AM7A 1YWNA 2FSMX 3PYYA 5F94A 5AUVA 4QTEA 4J1RA 2YITA 5K0XA 5BQ0A 5C26A 1M2RA 3EN7A 2W1GA 4DEAA 4LL5A 3CR0A 2ZV8A 3DAKA 3NW6A 4JBPA 1JBPE 1IG1A 3FKOA 4MK0A 5AP7A 2P3GX 3D0EA 3EKNA 3UBDA 3NUAA 4KSPA 3FQHA 4HVDA 5KO1A 4KIKA 3IW5A 4TWOA 5EG3A 2WMWA 5IQIA 1U59A 2X2KA 2UZNA 3H3CA 3ORIA 3PE1A 2VTHA 2Y0AA 2XKCA 3TWJA 1M7QA 4I21A 5FXRA 2GS2A 3W16A 1FBNA 3EYGA 4AU8A 4CD0A 3BI6A 2J7TA 2YCFA 4QPAA 4RJ8A 4ZEGA 1OIRA 3VF9A 2BDWA 5DT0A 3VUIA 5LWMA 3GCSA 4FSTA 4DGGA 4YPSA 5FBOA 4DFUA 3VUTA 4MXOA 3VUDA 2VTIA 4KKEA 1H1PA 2OI4X 5EW3A 2E2BA 3DU8A 3Q9ZA 3CTQA 4YJUA 5F20A 4YJSA 1WFCA 4XLIA 5GJFA 2O64A 4AFJA 5KBQA 3CPCA 1M17A 2BAQA 3FMDA 4Z7HA 3I0QA 4OAUC 5E9EA 4MH7A 2BHEA 3AMAA 4AOJA 5GJDA 4U44A 3GP0A 4BTMA 5D7AA 4DHFA 2C0OA 1PXIA 3AC4A 4GW8A 2P2IA 1XR1A 4ZLYA 4QMXA 4XG3A 4M15A 4MXCA 4J8MA 1PYXA 1SM2A 3ITZA 2XIXA 5AAGA 3TUDA 4W8EA 2G2FA 2R4BA 5FXSA 4EHGA 3NR9A 4M97A 5EYCA 2OIDA 2WHBA 4AZEA 3FI2A 5LQFA 4NU1A 1ZLTA 3I6WA 3PIYA 3QA8A 4FT5A 1UU7A 5H8BA 2G2IA 3IOPA 4DH3A 5F95A 2QU6A 4O96A 1V0PA 4U8ZA 3R7UA 5IA1A 1U4DA 1H4LA 5HHWA 3GU6A 4FSZA 3VS5A 3MB6A 4W4WA 4Y95A 5FXQA 1XH7A 2VNWA 4PNKA 1WBSA 2CMWA 3GC8A 3FPQA 1ZYDA 3ACKA 4CFWA 1DAWA 4JXFA 4F08A 5CF5A 4GG7A 1WMKA 5EM7A 1PXJA 2C3JA 3HV4A 4QTDA 2O5KA 4FR4A 4IM2A 1ERKA 3F3UA 4QTBA 4EOPA 2V7AA 1ZWSA 4W9WA 3OY3A 5E1SA 5HCZA 2ITQA 4TYGA 4AGCA 5J1WA 3RGFA 2VZ6A 4FSUA 5IH4A 4PUZA 3NNWA 5C4LA 4EOQA 4JIKA 4BDIA 2GU8A 4BL1A 2X7FA 4CFNA 2CCHA 5HTIA 5ETAA 4LGHA 4OR5A 2ITNA 1KE9A 1UU9A 1R0PA 5CAPA 4JBVA 4BR3A 2Q0BA 3GU4A 3TJCA 4PTGA 5TT7A 4RIWB 3E5AA 3HDNA 3QTXA 3VS7A 2JD5A 3DK3A 2YEXA 1LPUA 4IB0A 4FMQA 5BVDA 4IFCA 4OAVB 4JVGA 4AP7A 5M4UA 1Q3DA 4F4PA 5L4QA 2ZV2A 3WI6A 2YACA 5CU3A 2WTCA 5E8UA 4PTCA 4AGDA 2ZJWA 3FMKA 5F9EA 2WOUA 5EM6A 2OICA 3D94A 1XBCA 3ORLA 5DEWA 3SOAA 3SRVB 4B8LA 3II5A 1JKKA 1BL7A 3FE3A 1K2PA 3IW6A 1IA8A 4UMTA 4E1ZA 1UU3A 2OO8X 3JVRA 2GHGA 1KOAA 3AXWA 3EHAA 4IXPA 5E8XA 4DT8A 4U43A 4BCPA 4TNDA 5EYMA 2YA9A 2HWPA 3A7GA 1GIIA 4G3DA 3BLHA 3R1NA 2CLQA 4HVSA 3LXLA 5AP5A 3G0FA 1BI7A 5E8VA 3QRKA 1Q24A 3DDPA 2XUUA 4FTAA 1H0WA 4DGMA 3BQCA 3CS9A 4OTHA 4IVBA 2ONLC 5TKDA 5JH6A 4BWKA 5A9UA 2QG5A 4V05A 1YI4A 1I44A 4EQCA 1PY5A 4J52A 4EZ7A 1ZYLA 3EN5A 3FLYA 3DS6A 5ANDA 4EK5A 1LUFA 2QR7A 2XEYA 3IQ7A 2O0UA 4OLIA 2UW3A 5J87A 3MGYA 2JDSA 3FZSA 2R3HA 2PK9A 4G3CA 4B4LA 4L45A 2GNGA 1TQMA 3QWKA 4YU2A 1PHKA 3QLFA 4HGLA 4FSWA 4RBLA 1PXOA 3UOHA 3V51A 4AZVA 1OL5A 3FHIA 5KMNA 4H3PA 4L00A 3KMWA 3G15A 4K6ZA 2W5HA 5J95A 3ACJA 4FL1A 4ERKA 3PSBA 2PVLA 4UY9A 2YCRA 3QTRA 1XBAA 3R9DA 2OZAB 2AC5A 1WVXA 4J53A 2XH5A 2BRNA 4MQ2A 5HLWA 3TUBA 1OIUA 2IO6A 2XK7A 4FT7A 4LV5A 3CSVA 2R7BA 2ITOA 3NYOA 3C4FA 3LW0A 1JKLA 2FYSA 3W2CA 4BZOA 2OG8A 4H58A 1ND4A 5IEYA 3Q5ZA 3T9TA 3QHRA 3D2IA 3HMIA 3KCFA 2PPQA 4I94A 4F0FA 1KE5A 1WBVA 3FI4A 3OXIA 4ANLA 1OKVA 3BYSA 2ZDUA 4PY1A 4RVTA 4EOKA 3G0EA 4TL0A 5IA0A 5AV3A 3U87A 4ZZOA 1Q61A 2VX1A 4FSQA 1Q8UA 4FUXA 4N70A 3KRJA 3LCDA 4NFMA 2ZDTA 1J1BA 2AUHA 4NW6A 4GS6A 3QQKA 2QOKA 4CRLA 2B9IA 4EOJA 3ZTXA 5L8KA 2X39A 4DCAA 2FSOX 3GOKA 3IGOA 1OUYA 3MFSA 5LVPA 4FKTA 3QKLA 4LQMA 3QQFA 4E4MA 5IQGA 2H34A 2GS6A 2PTKA 2G9XA 3QRTA 1O6KA 3DFCB 2OFUA 4FIHA 5TOZA 3ULZA 5KNJA 3JVSA 4D4RA 4IZAA 4BZDA 1DAYA 2EXMA 4JX7A 3RHKA 3V8TA 3ORTA 2IJMA 4EL9A 3C5IA 5HTCA 2YDIA 4S2ZA 3FLSA 4AT3A 3ZYAA 2B55A 3NX8A 2W1IA 3R8VA 3NW7A 5FRIA 3SHEA 4DFZE 2J9MA 1W83A 2XNOA 5M07A 4HZSA 4IJ9A 5JFXA 4RJ4A 4M14A 1ZY4A 4IX4A 5ANKA 4J98A 4PP7A 4UWYA 5LMKA 4D1SA 4KIKB 4Q9SA 4BIEA 3S95A 4CV9A 2WAJA 3W8LA 3OCGA 4FK3A 4DE4A 4FSYA 2WTJA 3R9OA 4GEOA 3OTUA 5A4CA 4KS7A 4EHEA 1DM2A 1YQJA 4DAWA 5EKNA 3V6RA 4WBOA 2R3KA 3GB2A 4I0SA 5ACKA 2GTNA 3LVPA 3WIKA 5EM5A 3QKKA 4Q2AA 5FQDC 4ENYA 3CKXA 2XK6A 5EYKA 4CYIA 3BBWA 4IB5A 4RWIA 2J5EA 3HP5A 4UXQA 3ET7A 3K54A 4U9AA 4WG4A 2VWIA 3UP2A 4EHZA 5IA4A 3TI1A 5EDQA 4AOTA 1QPCA 3P0MA 2WELA 5AV2A 3SV0A 4C59A 1PXPA 2RIOA 4JL9A 3V3VA 2W1EA 3CPBA 4AG8A 2QOFA 2Y6OA 3VIDA 1QMZA 3QYWA 3R1YA 4RJ3A 3UQCA 3LFBA 4IAYA 3BWJA 2RG6A 3N4UA 5EDRA 3DKFA 4PDSA 4HGSA 4ANMA 2R3OA 5DRBA 2OZOA 3OOGA 4BF2A 3RALA 4ZOGA 2Y6MA 4BDDA 4BDGA 2NNWB 2OFVA 4I6HA 4OTWA 3UNKA 5A54A 3NIZA 4AS0A 3MH3A 3BLQA 4GYGA 3UIUA 2UW6A 2ZAZA 1PJKA 2BROA 3BBTB 1OL1A
chains in the Genus database with same CATH superfamily
2WEIA 4JBOA 4DH8A 3HV5A 4FGRA 4ZSLA 3DLSA 2VTLA 3RAHA 1JLUE 5AX9A 5HBJA 5HQ0A 3MTLA 3NNUA 5K4JA 2JKQA 3DBFA 3QD2B 4EH2A 3OEFX 4HZRA 1Y8YA 2UVYA 3BYVA 5IKWA 3TJDA 1TQPA 3UC4A 1Z9XA 4GK2A 4Y5HA 5I9VA 3R71A 4GKHA 2R9SA 4TWPA 3TDWA 2WFYA 3A2CA 5L6WL 4FKIA 3AG9A 1YRPA 2DWBA 3HGKA 3PXYA 2CKEA 2JITA 3MW1A 5FEEA 2PYWA 4IZ5A 4ZJJA 3Q32A 2ITUA 3S0OA 5I9YA 4O84A 4YLLA 2JFMA 2OJ9A 1M7NA 2I0VA 1GZKA 2HZNA 4Y46A 4RFMA 5EDPA 5KHXA 4L46A 3ZSGA 4FSMA 1J1CA 5CEOA 3F5PA 2FSTX 3PWDA 1Z57A 5HTBA 1OECA 2WTKB 3TZ8A 3TTJA 1H25A 4QNYA 5EYDA 3VBXA 5FP5A 1J7UA 4DHZA 2HIWA 5DN3A 3FZ1A 3U9NA 3PUFC 1JWHA 2W05A 2YWPA 4O0TA 3UDSA 1OGUA 4ANSA 4TNBA 5IMEA 2QODA 4A9TA 3NCGA 3R2YA 2ZOQA 3QF9A 4D2RA 3JUHA 1U54A 2V5QA 2VTTA 3DJ5A 3DA6A 3G2FA 3IECA 3PPKA 4K0YA 1VLRA 5DMZA 4X2NA 3ZC6A 4IAFA 2DYLA 4C3RA 2WQNA 3F88A 4JQEA 4J99A 3WF6A 2BHHA 3ORPA 1A9UA 4LGDA 4XG9A 4FG7A 1PXLA 3AC8A 4FTOA 4FV6A 3KF4A 3TKHA 4X0MA 3VNTA 5HVKA 1NA7A 3VS4A 4JX3A 4AZSA 3MESA 3W18A 3VRZA 4MUQA 1XWSA 4BHZA 4KA3A 4QPSA 4R3PA 2WQMA 4X3FA 4MD8E 3FMLA 3NUUA 3UZPA 2VO7A 3PFQA 3R8PA 4WNOA 3FKNA 3B8QA 4I93A 3KULB 4L44A 2WU7A 4GFMA 3MIYA 4DT9A 4DGOA 4F1OA 4P4CA 2YWVA 4CZTA 3LFCA 1W2FA 4XOYA 4LM5A 3FI8A 2PWLA 3R83A 3QRIA 3RM6A 4F7SA 3MN3A 4RQKA 3WZDA 2B54A 4QMNA 3C0HA 3GGFA 1GZOA 2XNNA 4IACA 5BVKA 2GS7A 4BVUA 3QU0A 4P7EA 4EEVA 1G8KA 4ALWA 5BVWA 3C5UA 2W9FB 3BPRA 3GC9A 4FK6A 4GFGA 4GRBA 4HGTA 1PMVA 4O0UA 4FKRA 4AQCA 2W1CA 1QPDA 5C8NA 5H3QA 4CLJA 1VJYA 4FRFA 2UZEA 3PY3A 3QA0A 2WMVA 3V8WA 2FSLX 3ZCLA 4K33A 2VGPA 4LUDA 2YIXA 3UOJA 3KCKA 3UTOA 3W55A 3OHTA 4GJ3A 3OUKA 5FLFA 5AA9A 1UWHA 4U6RA 4YZNA 4U7ZA 3PVBA 1T45A 4AOIA 1IA9A 4FKWA 2PULA 4C2VA 2QOBA 2I7QA 4BCNA 2XIKA 4D2VA 2GCDA 4O21A 5HBEA 5HG5A 3HVCA 1Q8ZA 2ZFYA 4RWKA 4FVQA 5IQDA 4G34A 2Y4PA 3TZMA 5IQAA 3BEAA 4K11A 4GL9A 4PDPA 2C0TA 3BIZA 3A4OX 4OTRA 4C61A 2CGVA 3PTGA 3UG1A 4G2FA 4C3PA 4USFA 4YZCA 3O0GA 2VTJA 4E8AA 4Z3VA 3QYZA 3AC5A 5FTOA 3DOGA 5H8GA 1GIJA 4O0SA 4O22A 1Q8YA 4M0ZA 4M7IA 2CN8A 4R7HA 2VWXA 5GZAA 3QGWA 2IVSA 4KWPA 2X1NA 3IW7A 5KMJA 4IB3A 3LIJA 1UNLA 4BICA 4RRVA 4MAOA 1YOLA 3DZOA 3AT3A 1H1QA 2J90A 2WOTA 3GC0A 4OBOA 5DR6A 3ML1A 2DS1A 3O8PA 3VO3A 4IMYA 4NFNA 3TTIA 4BCMA 1H0VA 5AAEA 3ZC5A 4M66A 3PXRA 3UPZA 2W17A 2J51A 3GQLA 5K3YA 1G8JA 2UW7A 3THBA 3AT2A 5D1JA 2IVUA 3RK7A 3TDVA 3VUHA 4CFUA 3FQEA 3SOCA 4NH1A 4RVMA 3NLBA 3F3WA 4IJPA 5CU2A 2WMTA 1FINA 3NUNA 4DFXE 2J0IA 3BKBA 2R3JA 3EQBA 4F0IA 2XIYA 4LGGA 3TG1A 2HOGA 3S1HA 1L8TA 3RJCA 2BDFA 3DNEA 4WSYA 4M0YA 1SVHA 5CZIA 3SLSA 5GNKA 4LRJA 4EOOA 2VTMA 4FVRA 4CEGA 4C58A 4G9CA 2ETRA 4GH2A 2JIVA 3R8LA 4PDYA 4EQUA 2YJSA 3NDMA 4LMNA 2JDVA 3OT3A 3DLZA 5M44A 5HIEA 4IM3A 1KE8A 4O0VA 2PL0A 3G6HA 1PW2A 3BHTA 4O7YA 4Y5QA 3W2RA 2X4ZA 4H05A 1Z5MA 2VTAA 3D15A 3G6GA 4U42A 2JLDA 4HVHA 3EL7A 2XALA 1Q8TA 3D83A 3E87A 2PE0A 2X81A 1BUHA 4WRGA 4D0XA 4D9TA 4MNEB 2YISA 4DCEA 3UMWA 3WZJA 3OWLA 2XF0A 2AC3A 1URCA 4GT3A 3W2QA 3TV4A 2QKWB 4PMTA 4O6EA 3R7GA 1H08A 1KV1A 4ZTNA 4BJJB 4FKLA 2V22A 3ELJA 1Q99A 4N4SA 3KRWA 4DDGA 3PA4A 1ZOEA 4G3EA 4H36A 4JRNA 4JR7A 5LVOA 3AD4A 4QP3A 3H0ZA 3IW8A 4FV1A 5HIDA 4Y72A 2F7EE 1XH6A 3OC1A 4DTKA 3BGPA 2NRYA 4U40A 5HNGA 3KY2A 3ORXA 2IG7A 4R1VA 3PSCA 4E73A 5CU4A 2Z2WA 3ZLYA 2PVJA 1M2QA 3QCSA 2PMNX 2O3PA 2UZVA 3CD8A 5KZIA 2ZB1A 2WPAA 2PVMA 1AD5A 4BYJA 4FKOA 4QP2A 4ANNA 5CT7A 4D2WA 3WBLA 4O91A 2W06A 4H3BA 4MF1A 4I24A 2UVZA 3PJ1A 3Q3BA 4K9YA 3E8EA 4J7BA 2C1AA 5LVLA 1U46A 2XRWA 3ROYA 4YZBA 3RTPA 4AW1A 4U80A 4BHNA 3NUPA 4MBLA 4Z55A 3QAME 4QQCA 4R8QA 1OPLA 4WHZA 3ZLXA 2BFYA 1H00A 5HCYA 4IC8A 3AMYA 2HYYA 4YJRA 5LMKC 3TNHA 4G6LA 4OBQA 4G3GA 1H07A 4A4OA 3WZEA 4EH9A 5KMKA 1CKJA 5DBXA 3HDMA 3N9XA 4FEQA 5CSHA 5FWKK 3TNWA 4NSTA 2V62A 3EQDA 3FL5A 3VWAA 3L8PA 2XKDA 3OXZA 4UWCA 3L1SA 2XK8A 3V5QA 5AUTA 5IQBA 2UW8A 5BUEA 2REIA 5AR4A 5CALA 2WTDA 3LXPA 3WF9A 4HNFA 2VU3A 3ZEWA 2OK1A 3ZUVA 4FZAB 1UWJA 4C4EA 5BVOA 4QPMA 3ZOSA 3I5NA 4BRXA 3KXNA 2OJGA 4NK9A 1SYKA 4C4FA 2HENA 4AW0A 4YMJA 3NFFB 4QDEA 4C8BA 3VVHA 4WNPA 3A7IA 3LOKA 3PZEA 3VUGA 4WIHA 2X0GA 3UO6A 3R8ZA 4GFOA 3KVWA 3WF5A 4DLIA 3IW4A 3RK9A 2PZYA 4AXAA 5J5SA 2IZSA 2YZAA 4NWMA 4QMZA 4MXAA 3QFVA 5CT0A 5HLPA 4BDEA 4D1ZA 4DH7A 4PRJA 4O4DA 3OFMA 4DG0E 5M51A 4O2ZA 1OZ1A 2CKPA 4TYIA 3HNGA 2JBPA 2GNHA 5HI2A 4AXCA 1Y57A 3O8TA 4EOMA 2QO7A 2B4SB 3PIXA 3QHWA 4L8MA 4YPDA 1M52A 5C01A 5LMAA 4FV5A 5FTGA 3NFGB 5J9ZA 4YR8A 3I7CA 3RAIA 4X3FB 1RQQA 4FV4A 5JZNA 3FAAA 2WO6A 1P4OA 5E8ZA 2ZV7A 4XLVA 3BL9A 2BILB 1UA2A 1YWVA 1FGIA 3HA6A 3CD3A 4G6NA 2ITXA 4M68A 2WQBA 2JIIA 4L3JA 4ZTLA 4PL3A 4G1WA 4ZSEA 2RF9A 4KRDA 1VR2A 5AP3A 2WQOA 2YABA 4OT6A 4P2KA 4R7IA 5CSXA 5EQYA 3FI3A 4CXAA 3Q04A 3S3IA 3LPBA 5LMBA 4EK4A 3QCXA 5AP1A 3QZIA 4XJ0A 2XCHA 4FA2A 1KV2A 4FTRA 4OTGA 5A4TA 1REKA 4C34A 4OUCA 4OW8A 4F6UA 3GU8A 5GZ8A 3ENMA 3L9NA 1UVRA 3AD6A 4FIEA 1A06A 1YKRA 3DQWA 2X6EA 1W98A 3FQSA 2QURA 1LEWA 2B53A 4RZWA 4F63A 4A7CA 4K8AA 3F82A 4RVKA 5M56A 3NMUF 2YM3A 3S00A 5BUIA 4XG6A 4W4XA 3OUNB 3CY3A 3EFWA 4X6QC 1SNXA 4LV8A 3QUDA 2BFXA 1E1VA 1ZRZA 3GU5A 4E4NA 3R73A 5D41A 1JKSA 2V55A 3DZQA 4QP9A 3SW4A 1YDTE 1URWA 4E6QA 4FZFB 5BYZA 3RINA 4X3FC 4R3CA 5H9BA 4CKRA 3ALOA 3CEKA 3ORKA 2VTNA 5EFQA 4ZZMA 3SG9A 4F1TA 4FTJA 4IB1A 4DEDA 4C37A 4RSSA 1VZOA 4U3YA 5DPVA 3HMMA 3ZXZA 5BVFA 5LXMA 3PJ3A 4FYOA 3RAKA 1XH5A 4MF0A 4TTHB 2Z7SA 2QD9A 3MDYA 3QWJA 3M1SA 3CTHA 3RZFA 4CKJA 3SVVA 3I81A 4RX5A 2EXCX 4RPVA 3P7AA 1FGKA 4I5HA 2C68A 4APPA 2C6LA 2VV9A 3ZMMA 4ZMEA 2QOQA 3NZ0A 4DH5A 2BDJA 4QMOA 3TEIA 3CC6A 4GVAA 2BTRA 2VWBA 5FTQA 1K3AA 2QLQA 5CTPA 3SXSA 4LOQA 5KMOA 4BDAA 3VUMA 4ORKA 3FZRA 3F2AA 4V04A 2EB3A 2P0CA 2W99B 3F6XA 3OW3A 4NT4A 4FGBA 3OTVA 3HECA 3O51A 2OJIA 2GNFA 3MV5A 3V04A 4ITIA 2PMOX 3G9NA 4OTFA 3WIGA 3QXPA 3LMGA 4R7BA 4YHTA 3QALE 5KMIA 3R21A 5E8TA 1OIYA 2C6DA 1CKIA 2C5OA 4MCVA 4ITJA 2YAKA 4V0GA 4O6LA 3PJ2A 4ACHA 3ZO4A 3GNIB 1NT2A 4KIPA 1H28A 1SNUA 4F7JA 3DCVA 3R8MA 2C4GA 4LOOA 2WQEA 4DGLC 1H26A 2WTIA 4DEBA 1W82A 2PVRA 4X7QA 3CJFA 3EWHA 3P7BA 1YI3A 5J1VA 3NEWA 4IWPA 5IDPA 2BZKB 5CI6A 3ODYX 4S31A 1MRUA 4BCOA 4O27B 3BRBA 1BLXA 5L2SA 3H10A 4NCTA 2J0MB 2YLFA 3LHJA 5IH5A 5JRSA 5JFSA 2HWOA 3W8QA 4ZK5A 3FLZA 3KFAA 2QC6A 4TYEA 5ANOA 1TZDA 3MTFA 2H6DA 4H3QA 5DHJA 4AZTA 2A98A 3F2NA 3MBLA 3MPTA 5HORA 4ZLZA 1PKDA 4QP8A 3NAYA 4BCKA 5HO6A 2W4JA 3R9HA 1BX6A 1ZMWA 3UVQA 3E62A 3QLGA 4QDVA 5H8EA 4N6YA 1U5RA 3KN6A 1REJA 4JNWA 4PNIA 3L8VA 4QTCA 4FV2A 4DEIA 5JZJA 2I0YA 4AUAA 1CSNA 1OIQA 3DB8A 3TNPC 4ZSAA 5HLNA 3LM5A 4K77A 5L6OA 2ITYA 3R04A 1XMMA 3KU2A 4FE2A 1ST0A 1FMKA 4J95A 3OROA 3VUKA 3EJ1A 4RWJA 3QGYA 3HMPA 3A7FA 4BI2A 5ITAA 3BWFA 2NO3A 4RVLA 5CEPA 4FSRA 3AC2A 5IH6A 4MXZA 1CMKE 2FGIA 4RC4A 3P7CA 3LFSA 2JDOA 2XJ2A 1ZOHA 1M14A 4RA4A 2XKEA 2JC6A 3OY1A 2ZYBA 4AWIA 4EH5A 3TUCA 4F9YA 4F9CA 4M3QA 4F99A 2IZRA 3F5XA 3F66A 4BKYA 2GQSA 3FKLA 4I6QA 4ALUA 4XV3A 2BRHA 4G5PA 2VWVA 4NTSA 5CSWA 4D0WA 4UX9A 2XIZA 5AR2A 4I0RA 4QNAA 3MFTA 3UDBA 3ZS5A 5CU0A 3CTJA 4ANBA 5J9YA 3OCBA 4AZFA 4YNEA 1B39A 4LL0A 3AOXA 2QI8A 5HE3A 4B9DA 3FC2A 1IAHA 4GIIA 5K4IA 1M2PA 2A4LA 2BVAA 3MI9A 4FX3A 4ZP5A 4DF3A 2YM4A 3L9LA 4IW0A 1OPJA 4IH8A 3L8SA 4XV1A 2LAVA 4USEA 1IAJA 4C7TA 3A8WA 1PF8A 4XV9A 4ZZNA 4USDA 5JEBA 3B2WA 3SG8A 3IS5A 3R22A 4RIXA 4F9BA 1OI9A 3PZHA 1W84A 1X8BA 4FL3A 1PRYA 4L3LA 4KSQA 3NW5A 3HV7A 3VS1A 3OT8A 3EQHA 1UKHA 4IHPA 4TYJA 1TFFA 3FUPA 1Y6BA 2QO2A 3E8NA 3C50A 4IX5A 3VS2A 2YM6A 5A6OA 4EZ3A 1AGWA 3FXZA 4RJ7A 4O82A 4S34A 4XG8A 4YURA 2WTVA 4YLJA 4O38A 4U97A 2VWYA 4FV0A 2VWUA 4BBMA 1LP4A 3R01A 2YN8A 3K5UA 4NW5A 5LJJA 3HL7A 3HP2A 4EQMA 3ZHPC 2X8DA 4J8NA 3PXFA 3UQGA 4EBWA 2VO6A 2DQ7X 4CVAA 4YLKA 3QTUA 4AT4A 3TV7A 3BYUA 2FUMA 3GCUA 4I4EA 4AGWA 3NVKI 5FUTA 4ZJVA 3E7OA 4W9XA 2J0LA 3CJGA 5EM8A 3LCSA 4B6LA 5AP2A 2FA2A 3VHEA 2X9FA 2GNLA 3DXQA 3S4QA 1YHWA 4F9AA 2OJFE 2R3LA 4JDIA 4EHVA 2A27A 2PVNA 4O4FA 4DFYA 2UW0A 5BYLA 4BCJA 1JAMA 2BPMA 3BLAA 5G6VA 5JQ5A 2HZIA 3Q9YA 3QTQA 1YXXA 4MKCA 2OXDA 3QUEA 4JDKA 3V5TA 4F9WA 5BV3A 4NUSA 4TYHA 5AMNA 2Y7JA 4FKJA 4ANOA 1P4FA 3LFQA 4ZIMA 5FG8A 1JVPP 3KVXA 4NJ3A 4I1ZA 2OJJA 5HGIA 4ZSGA 5CEIA 2ETKA 1B38A 4WNKA 3RK5A 2WIHA 3R9NA 3F2RA 3RVGA 4ZLOA 4EH4A 2R3MA 4BCHA 4IWQA 2EXEA 2C1BA 2XNMA 5M53A 3HAMA 2J5FA 3GU7A 4FTMA 1ST4A 2OU7A 2RL5A 4A9YA 3EOCA 3PDTA 4XEYA 2HZ4A 3C1XA 4TKSA 4UALA 3SQQA 1ATPE 4V01A 2Y8OA 2O65A 3BU6A 5CNNA 5I9ZA 4E5BA 2C5XA 5G1XA 3JYAA 3TKIA 2W4KA 3QX2A 4E7WA 4LRMA 4WOVA 1BKXA 3WOWA 4DH1A 1SZMA 4W8DA 5CYIA 4DEEA 3MFUA 4GG5A 4L52A 4AN9A 2B9HA 4WG3A 5ANGA 3UMXA 5CXZA 4FTUA 3HMNA 2X0QA 1LR4A 4YO4A 4QYGA 3CXWA 4M12A 3W0RA 3LCTA 2HXLA 3GQIA 4L67A 1A48A 2UZDA 3R1QA 4I6FA 3POOA 4BTFA 4E4LA 2GHMA 2KULA 2J6MA 4BKJA 4I20A 4EOIA 3LQ5A 3LQ8A 4HCUA 4Z16A 3KXGA 1MQ4A 4XBUA 4O86A 2ZM4A 5FM3A 5LWNA 3WF8A 3BZ3A 1WVWA 2GPHA 2GMXA 3RWPA 4G17A 4QOXA 3VC4A 3V5WA 3E92A 3R7EA 5JGDA 1RJBA 2WNTA 5EQEA 4JT3A 3MVLA 4EK8A 5J8IA 4ACDA 4BN1A 3QTZA 3QZFA 3LQ3A 4QMPA 3GBZA 1KUTA 1GIHA 3KA0A 3QXOA 3CKWA 3RHXA 4O4CA 4FG8A 5AV1A 4E6CA 4QYHA 3F5GA 4J96A 4A9SA 4RIYA 1F0QA 2WKMA 3LXKA 2XVDA 3W2SA 3TIYA 4QMMA 4HCVA 4OT5A 4XP3A 5HO7A 3IK3A 4G3FA 3ATSA 3WZKA 4FT0A 4V0GB 3CQEA 3RBWA 4PX6A 5CENA 2JFLA 3B8RA 1H1SA 3MA6A 1Y6AA 3PP1A 4C4HA 5AP0A 3BGZA 1DS5A 4R5SA 3QD3A 2Q0NA 3DGKA 4M84A 3CP9A 4YJPA 4K2RA 3H0YA 4NJDA 5BMMA 3FXXA 3TL8A 4DITA 4D9UA 4E26A 3TM0A 4B7TA 2HK5A 2WMUA 3IOKA 2BZJA 4UZHA 4YTIA 2XNPA 3EN9A 4IDVA 5M09A 5GZ9A 5D11A 2BKKA 2IN6A 4ZTQA 1TQIA 5IISA 3CQWA 5HESA 5GJGA 2G01A 2AEGA 3OBJA 2Y4IB 3SX9A 5AUUA 2UZLA 3COIA 3DBCA 4MVFA 4FTKA 4IAZA 2XNGA 3ULIA 2R3QA 3JXWA 4BDCA 2YIQA 3KGAA 1J7IA 2KTYA 4BY9E 4I3ZA 1LEZA 5HD4A 4XG4A 3LFAA 3R63A 2DUVA 4TRLA 5HKMA 2OIQA 3NVMB 1JSTA 2PUNA 4ASZA 4NL0A 4QT1A 1ZMVA 3ANRA 3HA8A 5C03A 1OKYA 3A4PA 4C36A 4UMPA 4BYIA 3QBNA 2QQ7A 4L53A 4M8TA 4KIQA 4IVCA 3EQGA 4E6AA 3EFKA 4ZAUA 5K5XA 5ANIA 2PMLX 4FSNA 3NUXA 2X2MA 3UO4A 3WYYA 4QQTA 5J5TA 2BZIB 3A61A 4FEXA 2VN9A 3SW7A 2OXXA 2YFXA 3QTSA 4RX9A 4KBCA 5A3XA 3C9WA 4DG2E 3MFRA 4ITHA 3OZ6A 4IZYA 5AP6A 4EWHA 4C2WA 2R64A 3VBYA 4Y73A 3LJ1A 2CNUA 2NRUA 2H96A 3CY2A 3E93A 4NM0A 2UV2A 4NKSA 3ZO2A 4A9RA 4BIBA 1Y91A 5HZNA 2IF8A 2E9PA 4ANQA 4LDTA 3WZUA 4F7NA 3ZUUA 2GSFA 4NCTC 2GQRA 4XG7A 4O2PA 3VHKA 3JR1A 1YXVA 2HXQA 5D7VA 4AA5A 2Y4IC 3TZ9A 4LV7A 3FPMA 5DR9A 3I4BA 2BKZA 4QMYA 4BKZA 1W7HA 1CDKA 2JDTA 4HYSA 1GAGA 2J0KA 3I0OA 5A6NA 4K18A 3F7ZA 2SRCA 5AIRA 5IA3A 4X2JA 4QD6A 2XZSA 4O4EA 5ETCA 2Z8CA 4UEUA 5FBNC 2CGXA 2WZJA 3DAEA 1W0XC 3FYKX 3NGAA 3K2LA 2FB8A 2PUUA 4YHJA 2PY3A 4ID7A 4QP4A 4KAOA 5BVNA 3BQRA 4QMLA 2GNJA 2XCKA 4J97A 4MXXA 1JKTA 4RIXB 5L2WA 4AW2A 2QLUA 1BYGA 4UYAA 4CCUA 4ZTMA 3A62A 5CLPA 2H8HA 3G33A 3JS2A 4RGJA 3MS9A 4AA0A 4ASXA 4L6QA 4E6DA 5B2LA 5DT3A 4FEVA 5CEMA 4E5WA 4RLKA 2YIWA 3G5DA 2PVKA 2IVVA 3OS3A 3ZUTA 3D5WA 3UVRA 4DA5A 3VQUA 4DGNA 3EQCA 3Q60A 4FKQA 5E90A 4JQ8A 3UJGA 2WXVA 4YJOA 2OH0E 4HOKA 1FOTA 2VTOA 3HV3A 3O17A 4FTCA 3W1FA 1PXNA 1WBOA 4UV0A 3D5XA 3ZBFA 2R3IA 5CEQA 3QD4A 4XP0A 4F6WA 4U79A 4QP1A 2PUIA 3PY1A 2O2UA 1NXKA 2O8YA 4FTQA 1XH8A 3AC1A 3W2PA 2VRXA 4XV2A 4ZY4A 4X21A 3SAYA 3KKVA 3SGCA 3MIAA 2WMRA 3ZFXA 4IAAA 4ZY6A 3ZM4A 3O8UA 5A4QA 4DTAA 4I4FA 2R5TA 2W4OA 2Z7LA 3ZZEA 4C57A 3DXNA 4QQ5A 2J50A 1KOBA 4UXLA 5AR8A 4PP9A 4BIDA 5F1ZA 2VO0A 2XBAA 1J7LA 3FC1X 2XB7A 3PFYA 3LFNA 2JEDA 1QPJA 5CU6A 2XMYA 5EW8A 2EB2A 4PL5A 4TWCA 1APME 4FYNA 1W2DA 2F7ZE 2J0JA 3MY1A 4NM3A 4TYHB 5DRDA 3PRIA 3DTCA 3OBGA 4QP7A 3KXXA 5HG8A 1IEPA 4LOPA 2WTWA 4AE6A 5DI1A 3DBEA 3PVUA 4Y8DA 3ZBXA 4IVDA 4DN5A 3P1AA 3LLAA 4FNYA 1E9HA 3C4EA 3P08A 5L2QA 4LG4A 4BTKA 4G5JA 3VBVA 4MWIA 4MX9A 5CXHA 4YJNA 4O1PA 3RPVA 4QMQA 5BNJA 2VD5A 3FL4A 2W1FA 4CZUA 2W5AA 3MY5A 1W8CA 3PPZA 1KE6A 4JI9A 4U45A 2PZPA 4JLCA 3U4UA 2OF4A 4BFMA 1JSUA 3BHVA 1R1WA 1Q62A 3BEGA 3I1AA 5M55A 5IUGA 3ZO1A 3NCZA 3UP7A 3ORZA 2BUJA 4DFLA 2C3LA 3Q52A 3Q9WA 5IPJA 4KKGA 4MXYA 2O63A 4TWNA 2W7XA 1SVEA 5E8YA 3RAWA 4XRJA 4AZWA 5BMSA 2G1TA 4NM5A 3CQUA 2R2PA 4FVPA 4MEDA 4U41A 3RPRA 5B7VA 5CASA 4FKGA 3TNIA 1HOWA 3F3VA 5FM2A 4F0GA 2I0HA 5LVMA 3QX4A 2QO9A 3RCDA 3OP5A 3ORNA 3QZGA 5BPYA 1Q41A 3EQIA 4LFIA 5EHOA 5AFVA 1KE7A 1WZYA 5AR3A 3ZH8A 2BRBA 4PPAA 1Q3WA 4GK4A 5HVYA 4EJ7A 4PWNA 3QC9A 4FODA 3FMMA 3PE2A 2XJ1A 3UO5A 4FTIA 3PWYA 3RP9A 3U55A 4RC3A 3W0MA 3UIBA 4O7LA 3HMOA 2QOHA 5KMMA 2EU9A 5J7BA 4FZ7A 2B1PA 1OL7A 4ZY5A 4A4XA 2ITWA 2CN5A 2F9GA 2R3NA 1SMHA 3P79A 3F69A 1H27A 3LJ0A 2VWZA 2HW6A 3BYOA 4QYFA 3LFDA 2P33A 5CZHA 3NPCA 4XRLA 2XM9A 4UB7A 2CNQA 4RIYB 1MRVA 2Z60A 5HE2A 1HCKA 3A60A 3KRXA 4ZTSA 3NNXA 4FV9A 4KB8A 3LJ2A 2YLEA 5EI6A 5K0KA 5HO8A 2JBOA 2W1HA 3EH9A 3U4WA 1ZXEA 2CSNA 2OBJA 3OG7A 4HCTA 4OTPA 2XRUA 4RJ6A 1BMKA 3OCTA 4IX3A 2VTRA 3UZTA 2YDKA 1OGYA 3HLLA 4UZDA 4XBRA 4E4XA 3NRMA 2BTSA 5HIBA 3TV6A 3IPHA 3AMBA 4MYGA 4OTQA 4FKUA 3IG7A 3DFAA 2C6MA 3E64A 4Q9ZA 3HRBA 4GIHA 5M57A 3I60A 4NM7A 1P14A 1WBWA 4RMZA 3TIZA 3E63A 3R7VA 4YTHA 1U54B 1L3RE 3FZPA 4QMSA 1O6LA 3V6SA 2GTMA 2YM7A 4O0WA 5IEXA 3Q2JA 3H9OA 4XX9A 5E8WA 1YHSA 3Q4ZA 2NP8A 3F61A 5IA5A 4AAAA 2OGVA 4X2FA 2ITVA 4BZNA 4D55A 4QYEA 5IMXA 1UKIA 4BB4A 3NWWA 3TN8A 3UDZA 2BALA 2QOOA 5GINE 3Q4UA 2HELA 3B2TA 4O7VA 4OGRA 4I5PA 3GCVA 4C38A 4CTCA 4FIFA 2RFDA 5HE1A 3ERKA 3SDJA 4EH8A 2NYAA 3O2MA 2F2CB 3QRUA 4RC2A 4YBKA 1F3MC 3LCKA 5DH3A 5AAFA 4J71A 5A46A 3O96A 4MNFA 4Z7GA 3QUPA 3M42A 1ZZ2A 2XANA 5HEZA 4GVJA 5M4FA 4O81A 4IE9A 4IIRA 3FMJA 3NUSA 5ETIA 2EUFB 2QCSA 4BDHA 3LE6A 1QCFA 2C6KA 5EHYA 4ASEA 5CQUA 4DYMA 2WIPA 5IEVA 1UU8A 3K3JA 1ZAOA 3FLWA 4ALVA 4RZVA 3GUBA 3UC3A 2ZV9A 1OM1A 1ZOGA 3ZEPA 3EMGA 4EKLA 5JQ8A 1MP8A 2XK3A 3BV2A 2UZOA 4TT7A 2CKQA 1RE8A 3D14A 1O6YA 5CNOA 4Q5EA 2Z02A 3ATTA 2YDJA 5L8LA 2OH4A 3LCOA 3W0NA 2IWIA 4FNWA 3FBVA 3ORMA 5HD7A 4R78A 2OWBA 3VBWA 3U6HA 4JAJA 5M4CA 3QQJA 5IQCA 4BWXA 3FMNA 4PPCA 3D9VA 5CX9A 2JKOA 5TR6A