3ZO4A

The synthesis and evaluation of diazaspirocyclic protein kinase inhibitors
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
337
structure length
335
Chain Sequence
SVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVMLVKHMETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFSEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CAMP-DEPENDENT PROTEIN KINASE CATALYTIC SUBUNIT ALPHA
publication title Synthesis and evaluation of heteroaryl substituted diazaspirocycles as scaffolds to probe the ATP-binding site of protein kinases.
pubmed doi rcsb
source organism Bos taurus
molecule tags Transferase/inhibitor
total genus 107
structure length 335
sequence length 337
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2013-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3zo4A01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3zo4A02
5JN2A 3FLWA 2RKUA 4X0MA 1OPKA 5CI7A 1M2QA 5HIBA 3GBZA 3F66A 2VO0A 2LAVA 4RZVA 5DPVA 5G6VA 3R8MA 5J8IA 4BDIA 4EYJA 5CEMA 4J98A 3S4QA 1T45A 2OF4A 3C7QA 3DNDA 1Q61A 3QX2A 4I21A 4O0YA 2UZTA 3TNHA 5M57A 1PJKA 4H05A 3BQRA 4V0GB 1OGUA 4UBAA 1Q8UA 3HDMA 2FVDA 4DINA 4Y5HA 4WSYA 2Y0AA 2YCQA 2G2IA 4RGJA 3LW0A 1NVQA 3VS3A 3SW4A 4ASXA 3KB7A 2XBJA 4JNWA 4AWIA 3E7OA 2QI8A 3QQUA 4EHGA 2GSFA 3AXWA 4WKQA 2Z60A 4B0GA 2OKRA 4UX9A 4JQEA 3UC3A 1PXOA 2EWAA 3ALOA 4FNXA 5ANEA 3DV3A 3R7YA 1H1QA 3ZLWA 3QFVA 2H6DA 3CQUA 3QAME 3FMMA 1W0XC 4M14A 1JSTA 1OKWA 2JITA 4KIOA 4WUNA 3EOCA 1Q4LA 3NUYA 1OECA 5K3YA 5BYLA 4IAKA 2ZAZA 4USFA 1LPUA 4BI1A 3BHTA 2XJ2A 1FMKA 3F5XA 4RLKA 4XG7A 5FD2A 3RVGA 2IZSA 3BLQA 3LXLA 4RIYB 4U40A 3UOHA 3UQCA 3QUEA 4QTBA 3TV7A 3ZFXA 1W84A 3FL5A 5HHWA 3C13A 4CZTA 3LIJA 5J5TA 4EQUA 3NYXA 3C51A 4USDA 1W83A 4PY1A 4U81A 3QQHA 4YURA 3ORNA 4BL1A 1GIIA 2GNFA 4C4GA 2QO7A 3DXNA 4C57A 3MY0A 4PUZA 3PSBA 4BDKA 4YTCA 3RPYA 4X2KA 1Z57A 4EJNA 4A9YA 3U55A 2FYSA 5KHXA 2ZYBA 5IA4A 1JOWB 2PE2A 4FE2A 4LGGA 2WKMA 1JKTA 1P4FA 2X2LA 3QF9A 3H30A 3ORXA 4O27B 4DFBA 1A48A 4UZDA 3POZA 2F4JA 3QTWA 3E7VA 3Q04A 3UG2A 3WZUA 3IGGA 1YWVA 2R3LA 2PVKA 2OICA 4G2FA 5ANDA 1KUTA 1L8TA 3FSFA 2HXQA 3QZFA 1GAGA 1AGWA 3CTQA 4JAIA 4KD1A 2ITPA 3FDNA 2WQBA 4MQ2A 4WSQA 4XG3A 5KZIA 4YJVA 4FT5A 3EWHA 3LOKA 3L8PA 3CPCA 3F9NA 1OIUA 2GU8A 2Y8OA 4KBKA 3ZXZA 3TZ9A 4CQEA 4G3CA 4F6WA 4O84A 2ZVAA 4IDTA 3A7JA 4FL1A 3A8XA 2J5EA 4M69A 4DGGA 2RF9A 1LR4A 1JKSA 2W06A 2WEIA 3FMKA 3A8WA 2C6EA 4V01A 3R9NA 4IE9A 5GJDA 4TWOA 1XJDA 4OUCA 5KMIA 3NMUF 3V8TA 2WAJA 5FP6A 2GFCA 1VEBA 2W05A 3HMPA 5CWZA 4FEUA 3PIXA 4ACCA 4KIKA 4EL9A 4CFMA 1QPJA 4LG4A 4G3GA 3CBLA 2ITWA 3QXPA 4FTRA 4AA4A 4E4NA 3COIA 3EN6A 5CU2A 4BYJA 1Y8YA 4IEBA 4ZIMA 4UMPA 4RWIA 4GVAA 1WMKA 4LM5A 5J87A 4PPCA 2EXCX 4OTGA 1OBDA 3VC4A 4YZNA 2UZNA 3R7EA 4QMMA 4J71A 3FSKA 4HVIA 2XIXA 2R4BA 3P1AA 4PF4A 4LUDA 5IG1A 5ANIA 5HLNA 5DBXA 3D5VA 4QPSA 5KHWA 3NVKI 3DU8A 3L9NA 3SHEA 3RK9A 1DAWA 3C4FA 2WTKC 2C0OA 2UW4A 4KIQA 3OZ6A 1V0OA 5LVLA 5GINE 1YXUA 2HENA 4BDEA 4IM2A 3RGFA 3FBVA 3HV5A 3C5IA 3D2KA 3QKMA 1KOAA 4NJ3A 1Q62A 5D11A 1QPDA 5HCXA 3PA4A 2EUFB 3DAJA 3FHIA 1YWNA 5AAFA 3HV7A 4JQ8A 4TWNA 4TYHB 1Q24A 4ZP5A 3PJ3A 5CEIA 2VX0A 4HVHA 3W10A 4A9UA 5IDPA 5J1WA 1SVGA 2HWPA 3UMWA 1I44A 1T46A 2JKKA 2XM8A 4K18A 2XNEA 4C3FA 3Q4CA 4RIXA 3NGAA 4F64A 3RI1A 1UA2A 3R30A 4GT4A 5JRSA 3V8SA 5CF5A 2OWBA 3LMIA 4AN3A 1QMZA 4DGMA 4LFIA 4OTQA 4QD6A 4C02A 2YAKA 4WRSA 1GY3A 2C6OA 3R00A 4J8MA 4F0GA 3NZ0A 3ULZA 4D4VA 4RLLA 4RIWB 3W18A 3UPXA 2WELA 3D14A 2C3IB 3B8RA 3PPKA 4I0TA 2VWWA 3CP9A 4FV7A 3SD0A 3UO6A 1NVSA 3DAKA 1E1VA 3ODZX 3DA6A 5L2QA 3D7ZA 3C4CA 4X2FA 3OS3A 2YWPA 5TE0A 2JD5A 3CS9A 3PRIA 2GTNA 2XK9A 3REPA 1LEWA 3UODA 2DWBA 3AC3A 4G34A 4IB1A 2Z8CA 3CEKA 4PMPA 4ASEA 2V55A 3R9DA 3PVBA 3QTZA 2UV2A 1ZLTA 5IA1A 4G6OA 5IQDA 1CSNA 4HYUA 4FYNA 4R8QA 3FQSA 2G01A 3MGYA 2QOFA 4FKQA 4PRJA 4EQCA 3LFSA 4FX3A 2XKFA 1ZARA 4L52A 3TXOA 5CI6A 4F9BA 5HOAA 4HGTA 4FSYA 4R3PA 3I6WA 1B39A 5L8LA 4DLJA 5JH6A 4IAFA 4MD8E 5J5SA 1CKJA 4NM5A 1GZNA 3KMUA 4GKIA 1YWRA 3PVGA 4D58A 4A9SA 4IDVA 3NVMB 5JZNA 2X8DA 3KA0A 4FKOA 2VWUA 3KXXA 2R5TA 3I0OA 3ROCA 5HO7A 3GU4A 5FWKK 4C8BA 4NJDA 3LLAA 1H25A 2IVUA 1J3HA 1J1BA 3CD3A 3PTGA 2PUPA 2W4JA 2BFXA 4TW9A 3ZS5A 3HAVA 4U79A 4Q9ZA 4C34A 3PYYA 4XG4A 5E90A 4W8EA 3MA6A 3Q3BA 3GU5A 4RC3A 5HICA 3ROYA 2XRUA 2C6IA 3FJQE 4BCOA 2WQNA 3F7WA 4GRBA 2C6TA 4O0SA 4CCUA 4E93A 2QHMA 4IVBA 1WBPA 3BX5A 4GIIA 2Z7QA 3HMMA 3UIBA 3ZDIA 3EHAA 1G3NA 2Z02A 4RX9A 2OSCA 3VN9A 2J0IA 4YTHA 5HVYA 2VUWA 2VWZA 3GU6A 4DTKA 5BYYA 5DG5A 3H10A 4OTIA 3BV2A 3PFQA 3AD4A 3FV8A 4K0YA 4X7QA 2YIYA 4ERKA 4FG9A 4RJ6A 4EZ5A 5HNGA 4U3YA 2OK1A 2X9FA 3KXZA 3O8PA 2A27A 3I6UA 3TDWA 4ITHA 4IWOA 4DC2A 5H8BA 4GSBA 5IQCA 2FO0A 4QRCA 2QLQA 1H1PA 2PVJA 2Y4IB 5EDRA 2B9FA 3HV6A 3R0TA 3UZRA 1XWSA 4RX5A 4ZTRA 3P7AA 2IW9A 1HOWA 4P5ZA 4XP0A 5HX6A 1PRYA 2WQMA 4EC8A 2EB2A 3LJ1A 3COMA 3RZFA 3TNPC 4ASZA 2CHLA 2PPQA 4ZMFA 3DCVA 3GI3A 4FSMA 3DXQA 3PP0A 4EOKA 5EYMA 4ZSGA 4TNDA 4O7LA 3QQLA 4GJ3A 4Q5HA 3IS5A 4I0RA 2JFMA 3MVJA 3H0ZA 1JKLA 3ULIA 3LXPA 4I93A 4C7TA 4D9TA 3UOKA 1UU3A 3NYOA 5CSVA 4MXXA 2CSNA 2Z2WA 2PMIA 3H0YA 1OI9A 4JBQA 2IJMA 4LOQA 5KKRB 4N57A 5EM8A 3HP2A 2HWOA 1FBNA 3E8NA 4ZJIA 3F3VA 4KAOA 1O6YA 2BAJA 3FYJX 5FEDA 4L9IA 2G1TA 4FL2A 4YJQA 2V7AA 4RX7A 3G15A 5D10A 5DGZA 2VD5A 2VZ6A 4XLVA 2CKEA 2IVVA 2C0IA 2J4ZA 4RVLA 1JLUE 4HCUA 4R3RA 2BDJA 4G16A 3DQXA 3K54A 5IQAA 4FKUA 3QBNA 3C50A 2PUNA 1FGIA 2B53A 2CMWA 3MA3A 4ITJA 3MY1A 1GZKA 4L68A 3R7OA 2HYYA 5DN3A 2CGVA 3PJ8A 4A7CA 5CAVA 4DE4A 2EU9A 5F9EA 5JEBA 4R6VA 5IUIA 4JG7A 3R63A 3TN8A 1BX6A 4UWYA 4EK4A 4OAVB 4AW5A 1UWHA 2BIKB 2I0EA 3GCPA 4OBOA 5AX9A 2XVDA 3DKCA 4U7ZA 2Z7LA 3KF4A 5FP5A 5AR5A 1P14A 2H9VA 4B8LA 2JIVA 3GUBA 5A6OA 3U6HA 2F7EE 1CM8A 3R1QA 4GYGA 4QMYA 3UQGA 3VAPA 5LXMA 4A4XA 4EHZA 3TT0A 4GMYA 4RSSA 4PP7A 3C1XA 2JDVA 3FAAA 5HE1A 5KBRA 5CT0A 2J5FA 3ZLSA 3LFFA 4CQGA 2VWIA 4M0YA 2NRUA 5I9XA 3Q2MA 5E8WA 5AUWA 5GHVA 3T3VA 2J7TA 4D2SA 1J7LA 4W4YA 3NYNA 3FZSA 1M52A 5HTBA 3R8PA 4E4MA 5C1QB 3R21A 4M8TA 3OCBA 2CNQA 4FTUA 4JS8A 4YLJA 3R9RA 2UW3A 3P23A 4ORKA 4AU8A 4MX9A 2Q0BA 4YZ9A 2CCHA 3FY0A 1IAJA 5HZNA 3MDYA 3AC2A 3RWPA 1WAKA 3FXZA 2EXEA 3G90X 4KABA 5IQBA 4GU9A 4GUBA 2FH9A 5JKGA 5CYIA 3KRWA 2WMBA 4IWDA 3ZEWA 5M51A 3UPZA 4XOZA 5BVWA 3V6SA 4F6SA 1BLXA 4ACMA 3THBA 4RFYA 5AR7A 3R8VA 4YO4A 3CD8A 3OFMA 1OL6A 1PXPA 4UEUA 4BWXA 4YSMA 3V8WA 4YMJA 5IH4A 4NU1A 3MH1A 2PL0A 4IX4A 3CJFA 4QYYA 4DITA 4Q5EA 4DH8A 1KV2A 2ZV9A 3LCSA 4XBRA 2QR7A 4WO5A 3W2PA 1YDTE 4GW8A 1M14A 4TY1A 4NFNA 2ERKA 4E4LA 3ACKA 4GK3A 3KKVA 3ZUUA 2WMSA 5HORA 4QP2A 4YO6A 5E8VA 5CNNA 4PWNA 4WHZA 5AP7A 2IZRA 3E3BX 5AM6A 4QQTA 4ZY5A 1APME 3CKXA 4F9WA 4C2VA 3QRIA 4GFGA 4I22A 4JOAA 1OIRA 2A0CX 4QYEA 2QOBA 4AUAA 2B54A 4DFUA 3A60A 4QQJA 1H28A 3DJ5A 1YXSA 4JG8A 1H4LA 4FV0A 4W4WA 5DEYA 4FTJA 4BZDA 1BI7A 4RFZA 1U5QA 4YJOA 1JSUA 3LQ3A 3EKKA 2WMQA 3D94A 2R3QA 3HRBA 4FIJA 4L01A 4MF0A 4RIOA 3WOWA 2Y4PA 3RALA 3BPRA 3W2CA 2Q0NA 4IAYA 2VTJA 2ZDTA 3GCSA 5IQEA 3Q9YA 2VWBA 4FC0A 5GZ9A 3VJNA 2ZMDA 4FI1A 3QGYA 2IVTA 3K3JA 3G6GA 2GNIA 3WF8A 5IKWA 4YZDA 4IJPA 1OZ1A 4WIHA 1DS5A 5J1VA 2C47A 5ACKA 4RC4A 3GC7A 4PMTA 4AT5A 3DOGA 3WF6A 4C3RA 3RNIA 3SW7A 5FRIA 5EYCA 3EYHA 1ZZ2A 2FB8A 3F3WA 4L3PA 1H0WA 4IACA 4IVDA 3MJ2A 4ACGA 5CANA 3ETAA 2H8HA 1OUYA 2W1HA 2XKCA 2FSTX 3WZDA 1ZY4A 4BDGA 2ZM4A 1QPCA 2BFYA 2YITA 3TL8A 1SVHA 4FKJA 2BALA 3WYXA 4Z3VA 1FQ1B 3Q9WA 5CENA 3RAKA 3FLQA 5FBOA 4FG8A 1U59A 3WE8A 4AZTA 4FIGA 1HCLA 4CFUA 3VUGA 5J9YA 2XIYA 3MYGA 3VW6A 4CFVA 3K2LA 1TQIA 4QP8A 4G3DA 5ANOA 3Q2JA 4BCJA 3A61A 4EZ3A 4F4PA 3FKLA 4PTEA 5HG7A 4EH8A 3R71A 2E9PA 4ERWA 2JEDA 2ITQA 4NUSA 1JPAA 4DFLA 5CVFA 4LRJA 2J0MB 1NVRA 1M7NA 4FK3A 2YABA 1YVJA 4YC8A 5JT2A 2JKOA 5HBEA 4H3BA 3G0FA 4XG2A 2WTJA 4NEUA 4AOIA 4EK3A 4XP3A 4OTFA 3Q5IA 4MXAA 5EW9A 4CMOA 3SXSA 3BGPA 5JGAA 2QOQA 4U9AA 3TTIA 1X8BA 4D0WA 3I4BA 4X3JA 1RW8A 1OBGA 3RHKA 3SOCA 2PYWA 4ONAA 2BZKB 4QP7A 2J9MA 3GU8A 1URCA 2HZIA 4CYJA 4M69B 4MNFA 5AP4A 1IR3A 1FVTA 1PW2A 1Y8GA 4ZOGA 5HNIX 1Y6BA 2JDRA 5ETCA 2CKPA 3KREA 4OTRA 3TNWA 3VBYA 5EQPA 2OH4A 4O7VA 3R22A 3LPBA 4FSZA 3JY0A 4KIKB 2C5OA 4LUEA 3GENA 1F5QA 5A46A 1UNLA 3GCUA 5CXHA 3RBWA 3LFBA 3E5AA 1K9AA 3IPHA 3Q6UA 5E1EA 2HOGA 4HCTA 1S9IA 3MPAA 5AUVA 3IW4A 1LEZA 2VO3A 1DI8A 2OFVA 3HA8A 5HE2A 5L4QA 1B6CB 4DLIA 3H9RA 3QKKA 3QRJA 5AX3A 3HL7A 4AT4A 2O64A 3O23A 4CD0A 2E2BA 3NDMA 4XCUA 5BUJA 5KMOA 1IASA 2NPQA 3FZTA 3DK3A 3QTIA 4P4CA 2RGPA 3QCSA 4X6QC 2CN8A 3I7CA 3FI8A 3UJGA 4O6EA 5ITAA 4I5MA 3ATTA 2B1PA 4FICA 2GQRA 3OMVA 4O7TA 3O8TA 4NM3A 5IU2A 4L42A 4FSRA 4ZZOA 2YM4A 4FKGA 3NYVA 4CMTA 4RWLA 5E8XA 2PVNA 2V22A 3G51A 2ZB0A 3L8VA 4BDAA 1VJYA 3DJ7A 3EFLA 3QCXA 4GUEA 4PX6A 2YFXA 4R7BA 2UZEA 4Z7HA 3DDPA 2YWVA 3TWJA 3UYTA 3ZC5A 5AA9A 4NSTA 5IMXA 3ZUVA 4AFJA 3IDBA 5JFSA 4RIXB 3VUIA 1AQ1A 4R1YA 1FMOE 1WVYA 5HIDA 4D28A 2J2IB 2OJIA 3QD2B 3LXNA 3E93A 3C4EA 4S32A 3N4VA 3R2BA 2OH0E 3DTCA 4O22A 2ITYA 3RAIA 4O96A 2C30A 5CVHA 4FVPA 5M09A 4RPVA 2XJ0A 3F2NA 4YJRA 4EBWA 2C5XA 4F99A 2X6DA 2IG7A 3NWWA 3KULA 1QPEA 2BAKA 4EOIA 3MVHA 3VW8A 1TVOA 4ZLYA 3H9FA 3TUCA 2UZUE 5CSWA 3HV4A 3FEGA 5M06A 5LJJA 5AADA 3UZPA 3F5GA 4BRXA 1KE6A 4OTPA 4H36A 1UVRA 2PMLX 3PLSA 2EVAA 2W1ZA 4L8MA 4LV5A 4BF2A 3QTRA 1BYGA 5FDXA 3HAMA 3SXFA 2PZRA 4YZMA 5L3AA 3DBCA 3NW5A 4G9CA 1YDRE 4KBAA 4N70A 4HYHA 2V62A 3JUHA 3BLRA 1XBBA 3L9LA 3Q32A 5DH3A 4O7ZA 3GCVA 2J6MA 4DEBA 1Q3DA 4MTAA 3VRZA 4DG2E 3VF8A 4WOVA 3ORKA 4TRLA 2XNBA 3FQHA 3W32A 3FC1X 3II5A 4JIKA 4FNZA 4QMUA 4CGAA 4CLIA 3P7BA 3FMDA 4JVGA 2WTKB 3LAUA 2OZAA 3PE1A 5CAQA 4NW6A 2F57A 1JNKA 1DAYA 3HP5A 1XKKA 4D4YA 4FNWA 4CG9A 3QA0A 4TYEA 4NTTA 2CJMA 4UMQA 4DA5A 5GIPE 2ZM3A 1I09A 5JFWA 1YW2A 4DGOA 3VUKA 2G2HA 2V0DA 3MVLA 3SC1A 4E8AA 4M7IA 5DNRA 1Z9XA 2R2PA 4MXYA 4C36A 4CFNA 4E20A 4O7WA 4RQVA 1OVEA 2ZM1A 5JSMA 2WPAA 2HIWA 1XH4A 4IZ5A 4B9DA 3VBVA 2WIPA 4I5PA 4BTKA 5AIKA 5FEQA 4DT8A 4HNIA 2X39A 2BUJA 3AD5A 3NS9A 2XK8A 2C6DA 1PXLA 4I4EA 4L53A 5AV4A 2P2HA 2FGIA 4MWIA 4DH3A 4E1ZA 3F3TA 2DS1A 3GC9A 3KRJA 2GQGA 2ITZA 2QLUA 2BAQA 3PSCA 4FF8A 4EK6A 4X3FC 1OKZA 3ID6C 4MXOA 5D7VA 4PPBA 4L45A 4KBCA 4P5QA 2F9GA 4NK9A 2J51A 3Q96A 3DBDA 4F7NA 4GFMA 4Z7GA 3V5LA 3PJ2A 4D2RA 4LOPA 3QLFA 3OCSA 5AP2A 2I7QA 4M12A 2W5BA 4I5CA 1OKYA 5AV0A 1J7IA 5EG3A 3PPZA 5DT4A 2GS7A 5CEQA 5HVJA 4O38A 2JKQA 1RQQA 1SYKA 3O2MA 4BBMA 2UVYA 3OUKA 2QKWB 4IMYA 4QTDA 4AE6A 1R0EA 3PJ1A 2HK5A 4FTQA 2GHLA 3CQWA 4IX5A 2JIIA 4E4XA 1YXTA 2O8YA 4CCBA 3Q53A 5C9CA 2WOTA 3OWKA 4MYGA 5T68A 5JQ8A 3SGCA 3RAWA 4XG9A 3BWJA 2W7XA 4QMVA 2O5KA 3FPQA 1A06A 5L6WL 1G8AA 3FLNC 4RVTA 3FXXA 3ZO1A 4HPTE 4AA5A 4D4RA 3FYKX 2I0HA 2AUHA 4S34A 5CSHA 2F7ZE 5EDQA 2IVSA 5EDPA 5E8UA 4BZOA 2XMYA 3IGOA 4KS8A 4QP6A 3Q6WA 2O2UA 4F9YA 5M08A 4YNEA 2PMNX 5FDPA 3R1YA 3OTVA 3P5KA 4MXCA 3A2CA 4JR7A 3UGCA 3GOPA 5BVNA 3Q60A 4GG5A 5EQYA 4L44A 3WF5A 3I7BA 5DHJA 3AT4A 1L3RE 5CS6A 3KXHA 4G5PA 4C61A 4WNPA 4FL3A 2Q83A 2R64A 3ZRLA 4ALWA 1XQZA 4BKYA 4ZLOA 4QMWA 2RL5A 3RHXA 4AN2A 5KMMA 5M44A 3L9PA 3DTWA 3BLHA 1XH9A 4RFMA 2YM6A 4AZSA 3V3VA 2RG5A 3UP7A 1H0VA 4X3FA 3NUSA 2A1AB 2BTRA 3LM0A 4GEOA 4I41A 2YIWA 1SVEA 2WMAA 4B99A 1J7UA 4EI4A 5EK7A 3V5PA 5DT3A 3ZH8A 5FTOA 4EUUA 4QMNA 4O7YA 1J91A 1ZWSA 2OJ9A 4O0XA 5CEPA 4EJ7A 3BELA 3S3IA 3OOMA 2WZJA 4DEAA 4FIIA 5F4NA 3QL8A 5HU9A 1CDKA 3ET7A 2VTIA 3MI9A 4YJUA 2YLEA 3C0GA 5AP3A 3QYWA 4CT1A 4CZYB 3R6XA 4PNIA 5CLPA 4GS6A 3OF0A 2ITOA 2OIBA 4ID7A 3K3IA 4WA9A 3O50A 3UNKA 4QMOA 3CIKA 5E92A 4G17A 2XYNA 3ZONA 4WD5A 4YJPA 5CTPA 4AG8A 1ZOEA 1IG1A 1V0BA 5HD4A 2B0QA 1U4DA 3MPMA 4FV4A 4PTCA 4QPMA 4F1MA 2BHEA 3HUBA 4XEYA 4AW2A 4YU2A 3TM0A 2YM7A 1IRKA 3OHTA 2B9HA 4O82A 3QTUA 4E5BA 4C38A 3OY3A 4FTKA 4XRLA 2YJSA 3BWFA 2HZ0A 2YAAA 3U8WA 5I9YA 4DH5A 2XK6A 4JAJA 1UKHA 3BGQA 4EONA 2O0UA 2XA4A 2YN8A 2YM8A 4AZWA 2UW5A 2DUVA 5HBHA 3LXKA 4AACA 2QD9A 4C4IA 5LWNA 4V04A 3RPRA 1ZRZA 3MFUA 2FUMA 2WD1A 4WT6A 2E9UA 2Y9QA 3EH9A 3EZVA 4FSNA 5CY3A 3DQWA 3RTPA 3UO4A 3ZOSA 5CEOA 5C4KA 4K77A 4IAAA 5BX0A 4CV8A 3R8UA 4DG3E 4EBVA 3LFDA 5D7AA 4UWCA 4FT0A 5AUZA 1H01A 4KA3A 1Z5MA 2GPHA 3PXYA 3R2YA 3VS0A 2Y7JA 4IFCA 3GFWA 4BCGA 4F9AA 5B2MA 5LQFA 3HZTA 3FL4A 1NXKA 3IW8A 4TWPA 3F88A 4U97A 4WG5A 5FM2A 3RM7A 3RWQA 1UNHA 4NKAA 5IUHA 4GIHA 2WMUA 1M17A 4IZYA 3MV5A 4L46A 4M0ZA 4AW0A 1URWA 4JRVA 4PDOA 2OLCA 4BTJA 4XUFA 2ZDUA 2PK9A 4Y46A 3MSSA 3V5JA 2PZYA 4U5JA 3OWJA 4AX8A 4JL9A 1RJBA 3G9LX 4RZWA 2F2UA 4DCEA 3TDVA 4O7NA 2X9EA 2BHHA 1ZOGA 3PY1A 4MVFA 5F20A 1YDSE 4F09A 1K2PA 5EFQA 4GT3A 4R5YA 4ZK5A 4P7EA 2OZOA 5ANJA 1WBWA 2OU7A 5C03A 4OT6A 4FSUA 4FSWA 4RQKA 5AR8A 2YCFA 2CGWA 3FLSA 4QYGA 4LOOA 4PMSA 3NLBA 4FEXA 1KSWA 4G6LA 5E8TA 5FLFA 2PY3A 3FMHA 1GZOA 1PMNA 5E4HA 2VO7A 5HCYA 5TKDA 2GS6A 5IMEA 4NYEA 5C8KA 2G9XA 5BVDA 3P78A 3TUDA 4WNMA 3EB0A 4APPA 4UYNA 4L00A 2GS2A 3N4TA 2V7OA 3R28A 4H3QA 5C27A 1VYZA 2XIKA 3C0HA 3TZMA 1KE7A 4CSVA 3IW6A 3F2RA 3L1SA 5AV1A 4MBLA 4NL0A 3UQFA 5KMLA 1KE8A 4X2JA 2VTRA 5EYDA 1MUOA 3ORZA 2OGVA 4AF3A 2IPXA 5IA0A 1CKPA 5LCKA 4CMUA 3BEGA 5CXZA 5KCVA 5IA3A 1FVRA 1PXKA 3ZFYA 5K0XA 3RM6A 3OTUA 3DZQA 4NIFA 2W1CA 3SRVA 4OR5A 1KE9A 5DR2A 3ORPA 3R7GA 4EOLA 1UKIA 4IANA 1J1CA 3VF9A 3BYSA 4HOKA 5TR6A 5EM7A 4CV9A 1S9JA 2VNWA 3EFWA 3KN5A 3LLTA 4IQ6A 4WBOA 4XRJA 2UVZA 4Q9SA 4J7BA 3TV6A 4TT7A 4YLKA 4DG0E 4QMSA 2XNOA 2WQOA 2PE0A 5L2SA 3MJ1A 2R3HA 5KMJA 3ACJA 3GGFA 2O65A 2XIRA 3UMXA 3LCKA 2IWIA 2RIOA 3ZSIA 2X0GA 2PUUA 4QO9A 2C6LA 3GC0A 3HVCA 4L6QA 3RZBA 4F0FA 5DIAA 1QL6A 4B7TA 3G5DA 4FTAA 5D9HA 4XP2A 3D5UA 5LVOA 3K5UA 3VBXA 4F7SA 3UOLA 4I6QA 3VNTA 3AT2A 4CTBA 4BY9E 2W5HA 4ZTMA 3P7CA 4FGBA 4BGQA 2PVLA 3GU7A 4OAUC 3U4WA 4EH6A 1CKIA 2ONLC 3C4ZA 3AMBA 4EH2A 4IXPA 4JR3A 2C6KA 4C37A 2O63A 1STCE 3GT8A 1FPUA 3HEGA 3QTSA 4EOPA 4Z9LA 3JVSA 4Y72A 2ZMCA 1P4OA 1XBAA 4CTCA 2I0YA 3A7IA 3EZRA 5HG5A 5IQIA 3AC4A 4TYGA 5CT7A 5EW8A 2R7IA 3C4WA 3F69A 3LQ8A 3O96A 3NCGA 4BDDA 5TOZA 2QURA 4XHKB 4R5SA 2GQSA 4WBBB 4ALUA 2YM5A 3ZDUA 5HBJA 2WTDA 4XOYA 4J99A 5HD7A 3L8SA 2W1DA 3U51A 1O6LA 3P0MA 3D0EA 2PZIA 4HZRA 4FV3A 4FGRA 4AT3A 4LGHA 2LGCA 4AXAA 5E9EA 5DOSA 5EOLA 1CMKE 4KNBA 4B6LA 4BCKA 1YQJA 5J79A 2QKRA 4K9YA 2B9IA 4FKRA 2QG5A 2J90A 5DE2A 2C3KA 2J0LA 4HVDA 1YXVA 1YKRA 4XBUA 3DBFA 4J53A 1MQBA 4S30A 3KXMA 4P2KA 1KV1A 3Q5ZA 3SQQA 3BZ3A 5BVOA 3IK3A 4FT3A 4FV5A 3EQHA 4TXCA 5HKMA 5LOHA 3E64A 4JX3A 2HY0A 2X7OA 5HLPA 3UTOA 4HCVA 1A9UA 1XH5A 2FSMX 3RP9A 5HTCA 3MVMA 3E3PA 4DT9A 2HW7A 3NUXA 4C4EA 1ZMWA 1Y6AA 1YHVA 3PP1A 1LP4A 4IAZA 5HI2A 5CAUA 3I5ZA 4W8DA 2ZV7A 5GNKA 4O1PA 1EH4A 2XRWA 2VTNA 4M68A 4FKIA 4JQ7A 3P79A 4FTOA 4DGNA 3CPBA 1XH6A 2J0KA 3ZO2A 2E9NA 1WBNA 3O17A 5I5ZA 5JMSA 3FLZA 2ONLA 3HNGA 2XF0A 3DZOA 1O9UA 2VAGA 3M1SA 5EYKA 5JK3A 1ZZLA 3JPVA 3EN9A 2R3RA 4UMTA 4EKLA 4QMLA 4PPAA 4G31A 4GKHA 3W33A 4KWPA 3FZRA 4NM0A 4OTHA 4BGHA 2YZLA 4FKPA 3KGAA 4OTWA 4DBNA 3V5WA 4DFYA 3IOPA 1DI9A 1SNUA 5HG8A 3ZLYA 4RJ3A 2CLXA 3CXWA 1NY3A 1H1SA 5I9UA 3HUCA 4XG6A 3I1AA 3RCDA 3FKNA 4DEEA 3HMIA 4C58A 5AP1A 1ND4A 4DCAA 4I94A 4TYIA 1IAHA 5I9VA 3COHA 4UMRA 1VR2A 4I6HA 3BRBA 3KULB 3W8LA 3PSDA 4JIAA 3KMWA 2ITTA 3ZC6A 3RK5A 1Q97A 2W5AA 3MW1A 1Q8WA 1YHSA 3SV0A 3O8UA 1CTPE 3P9JA 4DGLC 3IECA 4UALA 4I3ZA 4O0WA 4ANNA 3JS2A 4E7WA 1PYXA 1TQPA 1WBVA 2C1AA 3BHUA 4K11A 2YCRA 3T9IA 4CKIA 5IQFA 3BHVA 3NRMA 4RJ5A 3ZUTA 1UNGA 4FODA 5L8KA 4QQCA 4N4SA 2GTMA 4IVCA 4BVUA 3GB2A 1PMUA 5AUYA 2FSLX 3W2OA 3HKOA 3HV3A 3BGZA 4CLJA 4FK6A 5IEYA 3KY2A 3RKBA 3MY5A 5KMNA 1AD5A 4JDKA 4C59A 1PY5A 5M53A 2OZAB 3R8LA 3VQUA 3CSVA 2W4KA 1OL7A 2UW8A 3DK7A 2W0JA 3OOGA 2GHGA 4QNYA 4XV9A 2PE1A 3RINA 4IB0A 5AAGA 3E8DA 3IONA 4A4OA 5E1SA 2DYLA 4ZAUA 2JBOA 3SAYA 5BMSA 3D9VA 4KKHA 1KWPA 3KXNA 5C01A 4I24A 3BQCA 4HGLA 4IM0A 2VTAA 2X8EA 3I60A 2F2CB 2JDOA 2WU6A 4YC6A 4AZVA 2B52A 3SA0A 4ACHA 4C4HA 4BCIA 1U54A 3ZYAA 5CAOA 5M55A 4JG6A 5H8GA 3UVPA 4RX8A 3MBLA 3R7VA 4CKRA 4XH6A 1TKIA 1E1XA 2RFDA 3OXZA 2QOOA 3FMJA 4BDHA 1Q41A 4QYHA 4JBPA 4ANQA 4MD9E 1BMKA 4DEIA 5CF4A 3KRLA 5M4CA 4EK5A 3IO7A 1HCKA 2JKMA 2WNTA 2ZV8A 2UZWE 4EOJA 4GV1A 5KMKA 4MF1A 2VX3A 4QYFA 2VTPA 3CY3A 2W1FA 3NIZA 4GG7A 2JFLA 3NUAA 4FTNA 1W8CA 3BYUA 1E9HA 2YISA 3A7GA 3BYOA 3FE3A 2X4FA 2OI4X 3DK6A 1SM2A 3HMOA 3R73A 4FSTA 4GU6A 4JX7A 4BN1A 4DEHA 4OTDA 5CAPA 4X6RA 2VX1A 3OWLA 5CEKA 3LZBA 1OB3A 3MFRA 4Y8DA 3FI4A 1BI8A 3MH0A 5HCZA 2RFEA 1QCFA 2R3NA 3G6HA 3PXZA 4ZZNA 3Q9ZA 1YOJA 3QALE 4ENXA 1JQHA 2VV9A 4YJNA 2QONA 3KRRA 4BC6A 5A4CA 2BRBA 2WB8A 4CVAA 2ETKA 4ACDA 3GFEA 5HE0A 3UP2A 3DLZA 5KX8A 4FIFA 1P2AA 1OPLA 4BGGA 4BWPA 2ERZE 4O2PA 4J97A 4BWKA 2GFSA 4DN5A 4XV1A 2KTYA 2C6MA 2JDTA 4FEWA 5DR6A 3QWKA 3VQHA 2VTQA 4UN0C 3DKFA 4FV2A 1RE8A 4IZ7A 2R3KA 4ZTNA 3VO3A 3TIYA 3C0IA 3UIUA 3JVRA 2XCHA 2VRXA 3TKHA 3O7LB 3KRXA 2OFUA 2P33A 4FSQA 2JAVA 4X3FB 4AAAA 3MFTA 5I3OA 4ZS4A 1Y57A 4MCVA 4O6LA 3QUDA 5EM5A 3NIEA 4M13A 4BHNA 4DHFA 4I5HA 1WVWA 3RCJA 5A54A 5BUEA 4BI0A 3TJDA 4J1RA 4F08A 3ZBXA 5HESA 2BZJA 2IN6A 3MTLA 3QX4A 3FY2A 1MRUA 3MESA 4RJ7A 1IA8A 1M2RA 3ENHA 2I6LA 3BHHA 3WZEA 3BKBA 2QNJA 5EM6A 3LFQA 4O0UA 5CSPA 3NUPA 4ZMEA 4ZSJA 1YI6A 1W7HA 2XK4A 1GOLA 4FVRA 3VHEA 4O81A 4D1ZA 4G3FA 4FTMA 3MB7A 4M3QA 1H08A 2DQ7X 2P2IA 3GVUA 3OBJA 5HIEA 4M67A 4RG0A 2VNYA 4KUJA 1Q99A 5GZ8A 3FKOA 4II5A 2XNGA 3LQ5A 3FUPA 3WILA 4MEDA 3BE2A 3OUNB 3CC6A 4TN6A 3LFEA 5AUTA 4GVJA 3P86A 2X4ZA 3BCEA 3QQJA 3OBGA 4W9XA 3FZPA 3SG9A 1FOTA 2JC6A 3A4OX 4PV0A 3E88A 3LFNA 2PTKA 3MFSA 3SOAA 2J50A 4Y95A 2OJJA 3LMGA 5F1ZA 4BDBA 5FQDC 2YCSA 4KINA 1GJOA 3S0OA 3SLSA 3PY3A 4FVQA 5EKNA 1OITA 2C5YA 3P08A 4QP9A 4RJ8A 2XB7A 5IDNA 2PULA 4IB5A 2C4GA 5B0XA 3ZRMA 2X1NA 3FMNA 3ZSHA 2W17A 1WBTA 4F63A 3RNYA 5L2TA 3GQIA 3PVUA 4F6UA 4ZSAA 2QHNA 4JT3A 2PVMA 2R9SA 4QTAA 5ETFA 1R39A 4Z16A 5M4UA 4JBVA 2W96B 2VWYA 4GCJA 3VBWA 4M84A 5FBNC 4HVGA 5BVFA 3AMAA 3R04A 2XM9A 3UIMA 2YJRA 2HZNA 3A99A 2XK7A 3OEFX 4M15A 4Y85A 3QZHA 2OBJA 4W9WA 5I3RA 3LCOA 3FLYA 3NAYA 3FWQA 4M97A 4R7IA 4F1TA 4O0VA 5J7BA 1FVVA 5HLWA 3N9XA 3RPVA 1REKA 1YI3A 4O21A 2OXXA 3L8XA 3ZO3A 4ANOA 4FOBA 4EUTA 4UXQA 4GJ2A 2NO3A 4FEVA 3U4UA 1GZ8A 3JY9A 2CCIA 1LUFA 4NFMA 4W4VA 2F49A 5B2LA 1JBPE 1XR1A 3GQLA 4LRMA 2HW6A 5BYZA 4FG7A 1Q8ZA 4L43A 2FSOX 2YLFA 4JXFA 3LFAA 4ZSLA 3ZTXA 5EOBA 4IX6A 4DTBA 2VTTA 4FKTA 2HELA 3RAHA 3DXPA 5IH5A 3KK8A 5FM3A 2OIQA 4JDJA 4RA5A 4E26A 4LMNA 4XV2A 3KF7A 3PE2A 2QOLA 4ANBA 1OL2A 4CZUA 3QHRA 1PMVA 2UVXA 3EQPA 3EQDA 4NIFB 3CGOA 4QT1A 2QU5A 1Y91A 1OPJA 3Q4ZA 4K33A 4TWCA 4XX9A 3SRVB 5H3QA 4ZJVA 3R9HA 3UBDA 5HGIA 2ESMA 2BRHA 3DNEA 3QTQA 3ANRA 1JVPP 4TL0A 4U80A 5DWRA 3TUBA 3O0GA 3F5UA 4E73A 3EIDA 1R78A 3ZXTA 1BKXA 5DI1A 2KULA 2WU7A 2A4LA 2GNHA 3OG7A 4R3CA 2BIYA 5AR4A 3SKCA 3D2IA 4RT7A 4EH3A 3L9MA 2W1IA 3Q9XA 5CX9A 3CJGA 5AV3A 4HYSA 2VN9A 3ATSA 5GZAA 3RPOA 3D5XA 5L6PA 5I9WA 2UZOA 3AMYA 4L67A 3VS5A 1H26A 4ZTHA 5EQEA 3DKOA 5B7VA 5BVEA 4O83A 4NCTC 4TPTA 3BEAA 4EWQA 1OMWA 3PJCA 2BRMA 4EKKA 3TI1A 2RSVA 2X2MA 3S1HA 1IA9A 3CY2A 3QYZA 3A62A 3NX8A 2YERA 4F0IA 3BIZA 5TO8A 4EH4A 3E63A 3H9OA 4H39A 4QMXA 3QU0A 2QO9A 3ODYX 5K9IA 5KUPA 4NZWB 5EHYA 3PA5A 1XO2B 4RVMA 3G33A 4RRVA 4NT4A 4D2VA 2VTMA 2BVAA 1W98A 2PVHA 2R3PA 3BYVA 4FTTA 3NW6A 3QUPA 4DBXA 3D7TA 3F5PA 4AGUA 5A4QA 4L7FA 4CT2A 3NW7A 4FIEA 2J0JA 3DGKA 1ZYLA 4KKGA 4RMZA 4X2NA 3S2PA 4AW1A 1H27A 4XS2A 4NW5A 3FZ1A 5E91A 3PUPA 4IZAA 4WNKA 2WMWA 1MRYA 3OWPA 4YGAA 4DFZE 3UYSA 3OVVA 2QR8A 1MRVA 3KCFA 3MPTA 1UU7A 4IVAA 4G6NA 3O7LD 4PDSA 2HXLA 4YZCA 3ZMMA 2ITXA 4GYIA 3UNZA 4AS0A 3A7HA 2R0UA 5A4LA 5JGBA 3UDBA 4O7SA 2PHKA 3NUNA 4FR4A 4N0SA 5CZIA 3Q52A 4D55A 3KK9A 4YP8A 4ZY6A 5AMNA 2B55A 4ZTQA 4GK4A 4H58A 5JFVA 1GNGA 3NNXA 3NNWA 1REJA 2BROA 3G2FA 3ZHPC 3OW4A 4F70A 3WI6A 5BNJA 5DVRA 3W2QA 4O2ZA 5DR9A 2WHBA 3IKAA 3DFCB 4IH8A 3EQRA 3PG1A 3UE4A 2QCSA 4FZ6A 3CCNA 5CU0A 2WMTA 5LMBA 3IW7A 4FZ7A 1UWJA 4EHVA 4QMPA 4FTIA 2VGOA 3DLSA 3NAXA 4TNBA 3VBTA 3VS7A 4BKZA 4NCTA 4DEGA 3PXQA 3DKGA 3LJ0A 1PXJA 1M7QA 4FOCA 3VIDA 2WTIA 3DS6A 5IEVA 3MS9A 3GEQA 4HZSA 5AR3A 3V5TA 5F95A 1NW1A 3QD3A 2O3PA 5DYJA 4FZDB 5TT7A 4AOJA 2F7XE 5A14A 4NWMA 4AGWA 3E87A 4YLLA 4H1JA 1YOMA 3OEZA 3QQGA 2QOKA 3NR9A 3U6JA 4A9TA 3VS6A 5K5NA 4YHFA 3OT3A 1R3CA 2Y6OA 5DEWA 3RJCA 3WF9A 2X7FA 1PF8A 4E6QA 4KRDA 1FINA 4IM3A 4FUXA 4I20A 4BCNA 2CNUA 2XBAA 4GK2A 3F3UA 4CKJA 1ZYJA 3BV3A 4QPAA 4I0SA 3EJ1A 4RA4A 3M42A 3PZEA 4U0IA 2VU3A 4YBKA 2AC5A 3JYAA 4IB3A 4L3LA 5CVGA 4E6AA 1XH8A 3DBQA 5FGKA 3HDNA 3DT1A 3LCDA 4HPUE 4ZXTA 3LKMA 4D5HA 3DBEA 5I0BA 4WG4A 3EQCA 3ORMA 3NPCA 3KL8A 1ZOHA 4LYNA 3NNUA 3RPSA 2IZUA 4TTHB 3PVWA 5EH0A 5C4LA 5BUIA 1W82A 2HZ4A 4WG3A 3B2WA 1YI4A 2BILB 5A6NA 5CF8A 5FXSA 4E6DA 2H96A 4E5WA 2WXVA 5AR2A 4BI2A 4EH5A 1BL6A 4F7LA 4B8MA 2NP8A 4APCA 4R7HA 4AZFA 4USEA 5JGDA 1OL5A 2GMXA 5KE0A 1XBCA 2WTWA 5FXQA 1R0PA 4I6BA 5FG8A 5HG9A 1V0PA 2RG6A 4EOMA 5EW3A 3OW3A 2UW7A 2YHVA 3ALNA 2GCDA 4D0XA 3S00A 4O0RA 3U6IA 1R1WA 3EN4A 2XIZA 3GOKA 5ETAA 3V01A 3VUDA 3AGLA 3F61A 4NH1A 1B38A 3DB8A 4MWHA 2ETMA 2P0CA 4MHAA 5H8EA 3ITZA 4LL0A 3UVQA 2ITNA 3KQ7A 1VYWA 4XLIA 4IADA 3BU5A 5ACBC 2XYUA 3TV4A 1H07A 2PZPA 4U44A 2I0VA 2IW8A 4G3EA 4D5KA 4I1ZA 1WFCA 4WRGA 2QO2A 2B7AA 4ZJJA 3AGMA 3SX9A 3CTJA 4FZFB 4O86A 5DT0A 4BCMA 5CU4A 4RWKA 3VVHA 2HCKA 4I4FA 2R0IA 3EQFA 2C3JA 5KZ0A 3SXRA 2R3OA 2Y6MA 4AGDA 5A4EA 3LFCA 2PVRA 4QMZA 4LI5A 1GIJA 4FV9A 4K1BA 4LMUA 4PTGA 3WZJA 1DM2A 2ZJWA 3EQGA 4NTSA 1U54B 4PP9A 3VWAA 1ATPE 5GJGA 4YHTA 4O1OA 4GT5A 4D1XA 2R7BA 5M4IA 4KIPA 1SNXA 4OBQA 1K3AA 3WZKA 4ANLA 2Z7SA 4MNEA 4FKSA 2VGPA 5AWMA 5K5XA 2QOCA 4G1WA 4CYIA 3T3UA 3ENMA 4RC2A 4N6ZA 5LCJA 4IW0A 1VZOA 2QU6A 2R3JA 3ZM4A 2XJ1A 3QTXA 3U9CA 3PZHA 2VTSA 3FPMA 4YTFA 2XNMA 3BU3A 1V1KA 4BTFA 3QKLA 2YDJA 2YIRA 3QC9A 4PL4A 4FV8A 4PL5A 3TKUA 4BDFA 4EORA 3VUTA 4AQCA 3EYGA 1U5RA 3R01A 2PVFA 4YBJA 4F9CA 4ZY4A 2PUIA 3JR1A 3UNJA 2G2FA 3QGWA 3EN5A 4C3PA 5AM7A 2IO6A 3OT8A 4EQMA 2BZHB 3F82A 3FI2A 4PQNA 5M4FA 2RFSA 4UZHA 3ZZWA 3BYMA 5B2KA 3KC3A 4FKWA 2R3IA 4K6ZA 2XKEA 3E92A 2XZSA 3UC4A 4N6YA 2BDWA 2R3MA 3WIGA 4S31A 3BI6A 5JZJA 3AOXA 2C68A 2CLQA 3SDJA 3W2SA 5IA2A 5LMKC 2AYPA 3TNQB 2X7GA 4D2PA 3EL8A 3KN6A 4FTLA 4EK8A 3TJCA 1PKGA 3G0EA 3TNIA 4ZTLA 3M2WA 2REIA 2BDFA 3AC1A 3DDQA 1ZMVA 4JRNA 4MK0A 1UV5A 4UWBA 1ZXEA 3OROA 4BYIA 3U87A 4I92A 1ZMUA 4MBIA 5AP0A 3OXIA 4YR8A 5FXRA 4BBFA 5HO8A 3PA3A 3HGKA 5IEXA 2H34A 4NKSA 4V0GA 3U9NA 3EQBA 1G5SA 2EXMA 4EOSA 2UW0A 2I40A 5AIRA 4H1MA 5AFVA 3SG8A 2R3GA 1U46A 2XH5A 5D1JA 2ZV2A 2C69A 4TYJA 4ZZMA 3RMFA 3VHKA 3R8ZA 3VULA 5GIOE 3H3CA 3LMHA 5DRBA 3D83A 3V6RA 3ZEPA 5CZHA 4CNHA 4PNKA 2WIHA 3R1SA 3I5NA 5HO6A 4L3JA 4EZ7A 2GHMA 4QNAA 4ANSA 5DFPA 3UOJA 3PRFA 2YACA 3JXWA 5AP6A 5E8YA 3HLLA 3HMNA 2JDSA 2QVSE 5LMAA 5AEPA 3ORLA 1XH7A 4YNOA 4F65A 2YEXA 3BE9A 3ORTA 4Y73A 4ANMA 2PSQA 3QXOA 3R02A 3TIZA 3T8OA 1YOLA 3ERKA 2XS0A 4FNYA 3QLGA 4O0TA 4U6RA 3TEIA 4A9RA 4CEGA 1H8FA 3AD6A 3C4XA 3QCQA 1M2PA 3F3ZA 3FC2A 3PXRA 3I81A 4HGEA 4HGSA 4RIYA 1H24A 3UO5A 4HJOA 5I4NA 4AE9A 4BCQA 1BUHA 4ALVA 2VTOA 2IW6A 3CE3A 4IAIA 4ZTSA 4C4JA 1H00A 3HRFA 3BU6A 3MH3A 3G9NA 4CRSA 1PXMA 1H1WA 3ZZEA 4AP7A 4CFFA 4HNFA 4B4LA 1F3MC 4DH1A 5E8ZA 3D5WA 4P90A 2OJFE 1PMEA 5LMKA 5FEEA 3KEXA 4FT7A 5EI2A 2WTCA 2X81A 3TACA 4WUAA 4QOXA 2R3FA 4RVKA 3VS1A 4BCHA 4CFWA 2BRGA 2YM3A 2BZIB 4O7RA 3MH2A 5CQWA 3EQIA 4BIBA 1O6KA 3TZ7A 3ZM9A 3DAEA 2OJGA 1WVXA 4BZNA 5E7RA 2CGUA 4EH7A 4RJ4A 3BBTB 4KSPA 4D4SA 1ZY5A 4IBMA 2W9ZB 3DPKA 2XK3A 3QZGA 4J96A 4EYMA 3WYYA 2YZAA 4I6FA 4J52A 3QRUA 5AUUA 3A7FA 1OIQA 3PDTA 5FTGA 4U8ZA 3UIXA 4X21A 2BRNA 3QD0A 1OL1A 3V04A 1TQMA 4DEDA 3QD4A 1NA7A 2XCKA 4HW7A 2QOHA 3VS2A 2JAMA 4QP1A 3DFAA 1P5EA 4DH7A 2HAKA 2WMRA 3OP5A 1PXNA 2C3LA 3POOA 3GXLA 3VJOA 2QOIA 3KCKA 5EI6A 3WBLA 3U54A 3AC5A 3NCZA 5IZFA 4DF3A 2GDOA 3EFKA 2XUUA 4K8AA 4XJ0A 2CKOA 5L2IA 2NRYA 2P55A 3EFJA 2QG7A 5AAEA 2XNNA 4IX3A 5BPYA 2PMOX 3FI3A 3M11A 5IQHA 4MD7E 5G1XA 2AC3A 3EKNA 5FUTA 2VWVA 4KKEA 4YHJA 1ZYCA 3PWDA 3CTHA 2HY81 4FV1A 4BCFA 4C0TA 4QMQA 3PIZA 3LJ2A 4LQMA 2NNWB 2JBPA 4CG8A 3ANQA 3Q4TA 4MH7A 2W99B 1Q8TA 3EL7A 4GL9A 3TCPA 5JFXA 5LWMA 3OC1A 2Z7RA 5DLSA 1YXXA 3ORIA 3GNIB 2WOUA 3AG9A 2B9JA 4TYHA 3HRCA 3LE6A 4BDCA 2YDKA 3QQKA 4TZRA 2C5VA 4F7JA 5K4IA 3QQFA 4R77A 2E9VA 2BPMA 4W4XA 4J95A 4AA0A 4BB4A 4Q2AA 5J95A 2UZLA 2UZDA 5CU3A 4EWHA 2A2AA 3PIYA 1KE5A 2BR1A 1SZMA 4OT5A 3OXTA 1ZAOA 4KSQA 4UV0A 4DTAA 2OIDA 4V05A 5AA8A 2GNLA 4U43A 5GJFA 2B4SB 3E8EA 3PG3A 4RIWA 2V5QA 4BHZA 5HNBA 4C4FA 2XP2A 3EN7A 4FV6A 4MQ1A 2JGZA 2WMXA 4AGCA 4DFXE 3LCTA 3ZRKA 4L7SA 4HVSA 1WBOA 4ZEGA 2ETRA 1UU8A 3KXGA 3OD6X 1Q3WA 4J8NA 5CU6A 5AP5A 4MKCA 3Q4UA 4BFMA 3W2RA 4PL3A 4I23A 2X2KA 4NM7A 5EHLA 2YDIA 4YJSA 5K4JA 3NUUA 4FYOA 5BQ0A 5L2WA 1BL7A 1ZYDA 2RFNA 3AC8A 5T3QA 4K2RA 3D4QA 2W9FB 2Y4IC 3D7TB 5AV2A 2UW9A 3R1NA 4FTCA 4KS7A 3AQVA 4R78A 5LVMA 3GP0A 4S2ZA 1OKVA 4FBXA 3R7UA 2X8IA 5ICPA 3HA6A 2X6EA 2OXDA 5E8SA 2OF2A 4XNEA 4LL5A 2WMVA 3IDPA 2ACXA 2IZTA 5CALA 4IC7A 4DAWA 2CN5A 4ZS0A 2WO6A 3HECA 3PWYA 4EEVA 2UZBA 2CNVA 2YA9A 2VTLA 4RWJA 4BTMA 2JIUA 2VWXA 3C5UA 1JAMA 4S33A 3ZCLA 4EOOA 2YIXA 3I79A 4QP3A 4C33A 4CXAA 2XEYA 2CPKE 2I1MA 1WZYA 4PDPA 4H3PA 3WF7A 1H1RA 3QHWA 3QRTA 5HU3A 5KKRC 2BMCA 4OLIA 4QMTA 5K0KA 2OO8X 1Q8YA 4GH2A 3VRYA 1OIYA 4AZEA 3MB6A 1OUKA 1NT2A 1RDQE 4JBOA 4U42A 4IWQA 3F2AA 4BIDA 4C35A 2G15A 4JI9A 5ANGA 5IPJA 5D41A 3HYHA 5DMZA 1MQ4A 4FUYA 2VTHA 4FZAB 3MIAA 4MXZA 2OXYA 2W1GA 3FMEA 2PU8A 4D2WA 4UY9A 3GCQA 2BTSA 3IDCA 4BICA 2VO6A 2SRCA 5EKOA 4UYAA 4UMUA 2PWLA 4AOTA 3MWUA 4E6CA 5J9ZA 4ITIA 1PHKA 3TG1A 4YUQA 3FMLA 1FGKA 4PDYA 5IQGA 5CSXA 3W16A 5AJQA 2FA2A 5ETIA 3FXWA 5IA5A 3ZSGA 4ARKA 2ZB1A 5IUGA 4KRCA 3AT3A 4LV8A 4YPSA 3F7ZA 3UG1A 4D9UA 4YSJA 4G5JA 2CDZA 3WARA 2QQ7A 4JDIA 2YIQA 1PKDA 5T6KA 3R83A 4UB7A 3W8QA 2CGXA 2CKQA 4OBPA 4FMQA 4JDHA 5A9UA 5CNOA 1WBSA 3KU2A 4C2WA 1OM1A 1ZYSA 3T9TA 4TKSA 1PXIA 4YPDA 4HYIA 1KOBA 5A3XA 3IW5A 4MAOA 4R1VA 4LGDA 3A4PA 1JWHA 3IG7A 3ZO4A 3UZTA 1IEPA 4BR3A 5LVNA 2UZVA 3BBWA 1Q5KA 5KO1A 2ITUA 1WCCA 3KFAA 4G9RA 2JLDA 3FHRA 3P4KA 5HTIA 2OG8A 3OCTA 3ZFMA 3O71A 3NNVA 4E3CA 2PVYA 3QWJA 4FA2A 4PMMA 3COKA 3K5VA 3PXFA 4EH9A 4FKVA 4U3ZA 2C1BA 4U41A 4EC9A 3IQ7A 5AUXA 3CLYA 2BKZA 5BMMA 4FT9A 4YTIA 3OY1A 2C0TA 3TTJA 5CASA 2P3GX 3PXKA 4FIHA 4ZLZA 2ZOQA 3QC4A 3GC8A 3DB6A 2WTVA 4BBEA 4MBJA 1JSVA 5ANKA 3ZU7A 4QTEA 5A4TA 3LHJA 4YJTA 5DA3A 3OCGA 4ZSEA 1YRPA 2A19B 2GNGA 4DYMA 5H2UA 3MN3A 3MIYA 3R9OA 4IFGA 3TZ8A 3NEWA 3IOKA 4QP4A 3V51A 3KMMA 4O91A 4E5AX 4ENYA 3ELJA 5JQ5A 3PLAE 3PPJA 3HX4A 4QQ5A 4EOQA 3BHYA 5L6OA 4A07A 2GNJA 2XEZA 3MTFA 3LM5A 4OGRA 4IC8A 5HEZA 4WNOA 4LRKA 3C9WA 4CFXA 4JJRA 2E9OA 2C5NA 3F6XA 2WEVA 1MP8A 3FQEA 5CQUA 4IWPA 4XG8A 5LARA 2P4IA 1G8SA 3N51A 3FZOA 5IH6A 3W1FA 3SVVA 3WIKA 2WFYA 4A06A 4GFOA 4XV3A 3QA8A 3VBQA 2XNPA 3TKIA 5M56A 3NSZA 1F0QA 3E8CA 3KVXA 4A4LA 2W1EA 4MNEB 4CRLA 4AFEA 4KB8A 5EHOA 2EB3A 2BCJA 5DRDA 5HE3A 5HQ0A 4Y5QA 4JLCA 3CKWA 1PYEA 4X2GA 2WQEA 4BIEA 3EMGA 4ASDA 4Z55A 5C8NA 5L8JA 3RK7A 3N4UA 4BDJA 5CF6A 2PZ5A 3S95A 4IHPA 3UVRA 5LVPA 2BKKA 4FKLA 4C62A 3V5QA 4F1OA 4AN9A 5M07A 3DY7A 5TF9A 5F94A 5C8MA 2QC6A 3VUHA 3B2TA 3CGFA 3B8QA 5KBQA 5H9BA 3R7IA 5D12A 5HVKA 3CR0A 5FTQA 4Y83A 5EI8A 3ZLXA 4D2TA 5I9ZA 5J9LA 3VUMA 3ZBFA 1JKKA 1YHWA 3H4JA 4XMOA 3WE4A 5IISA 5KNJA 4BCPA 4U45A 2UW6A 1UU9A 2W4OA 1ERKA 3W55A 3QZIA 2QODA 3I0QA 2UUEA 3E62A 5BVKA 5J7HA 3O51A 4D1SA 3CQEA 5JRQA 4EHEA 4UXLA 1SMHA 4DFNA 4XYFA 1GIHA 5C26A 2ITVA 4QTCA 3QCYA 5IF1A 4RBLA 3QRKA 3D15A 3KVWA 3LVPA 4YC3A 4BKJA 3DJ6A 2XKDA 5HX8A 1XHAA 4FEQA 4IJ9A 4IIRA 2WGJA 4OW8A 3PY0A 2OW3A 3VS4A 4M66A 4YZBA
chains in the Genus database with same CATH superfamily
5JN2A 3FLWA 2RKUA 4X0MA 1OPKA 5CI7A 1M2QA 5HIBA 3GBZA 3F66A 2VO0A 2LAVA 4RZVA 5DPVA 5G6VA 3R8MA 5J8IA 4BDIA 4EYJA 5CEMA 4J98A 3S4QA 1T45A 2OF4A 3C7QA 3DNDA 1Q61A 3QX2A 4I21A 4O0YA 2UZTA 3TNHA 5M57A 1PJKA 4H05A 3BQRA 4V0GB 1OGUA 4UBAA 1Q8UA 3HDMA 2FVDA 4DINA 4Y5HA 4WSYA 2Y0AA 2YCQA 2G2IA 4RGJA 3LW0A 1NVQA 3VS3A 3SW4A 4ASXA 3KB7A 2XBJA 4JNWA 4AWIA 3E7OA 2QI8A 3QQUA 4EHGA 2GSFA 3AXWA 4WKQA 2Z60A 4B0GA 2OKRA 4UX9A 4JQEA 3UC3A 1PXOA 2EWAA 3ALOA 4FNXA 5ANEA 3DV3A 3R7YA 1H1QA 3ZLWA 3QFVA 2H6DA 3CQUA 3QAME 3FMMA 1W0XC 4M14A 1JSTA 1OKWA 2JITA 4KIOA 4WUNA 3EOCA 3PFYA 1Q4LA 3NUYA 1OECA 5K3YA 5BYLA 4IAKA 2ZAZA 4USFA 1LPUA 4BI1A 3BHTA 2XJ2A 1FMKA 3F5XA 4RLKA 4XG7A 5FD2A 3RVGA 2IZSA 3BLQA 3LXLA 4RIYB 4U40A 3UOHA 3UQCA 3QUEA 4QTBA 3TV7A 3ZFXA 1W84A 3FL5A 5HHWA 3C13A 4CZTA 3LIJA 5J5TA 4EQUA 3NYXA 3C51A 4USDA 1W83A 4PY1A 4U81A 3QQHA 4YURA 3ORNA 4BL1A 1GIIA 2GNFA 4C4GA 2QO7A 3DXNA 4C57A 3MY0A 4PUZA 3W0QA 3PSBA 4BDKA 4YTCA 3RPYA 4X2KA 1Z57A 4EJNA 4A9YA 3U55A 2FYSA 5KHXA 2ZYBA 5IA4A 1JOWB 2PE2A 2XANA 4FE2A 4LGGA 2WKMA 1JKTA 1P4FA 2X2LA 3QF9A 3H30A 3ORXA 4O27B 4DFBA 1A48A 4UZDA 3POZA 2F4JA 3QTWA 3E7VA 3Q04A 3UG2A 3WZUA 3IGGA 1YWVA 2R3LA 2PVKA 2OICA 4G2FA 5ANDA 1KUTA 1L8TA 3FSFA 2HXQA 3QZFA 1GAGA 1AGWA 3CTQA 4JAIA 4KD1A 2ITPA 3FDNA 2WQBA 4MQ2A 4WSQA 4XG3A 5KZIA 4YJVA 4FT5A 3EWHA 3LOKA 3L8PA 1ST0A 3CPCA 3F9NA 1OIUA 2GU8A 2Y8OA 4KBKA 3ZXZA 3TZ9A 4CQEA 4G3CA 4F6WA 4O84A 2ZVAA 4IDTA 3A7JA 4FL1A 3A8XA 2J5EA 4M69A 4DGGA 3TMOA 2RF9A 1LR4A 1JKSA 2W06A 2WEIA 3FMKA 3A8WA 2C6EA 4V01A 3R9NA 4IE9A 5GJDA 4TWOA 1XJDA 4OUCA 5KMIA 3NMUF 3V8TA 2WAJA 5FP6A 2GFCA 1VEBA 2W05A 3HMPA 5CWZA 4FEUA 3PIXA 4ACCA 4KIKA 4EL9A 4CFMA 1QPJA 4LG4A 4G3GA 3CBLA 2ITWA 3QXPA 4FTRA 4AA4A 4E4NA 3COIA 3EN6A 5CU2A 4BYJA 1Y8YA 4IEBA 4ZIMA 4UMPA 4RWIA 4GVAA 1WMKA 4LM5A 5J87A 4PPCA 2EXCX 4OTGA 1OBDA 3VC4A 4YZNA 2UZNA 3R7EA 4QMMA 4J71A 3FSKA 4HVIA 2XIXA 2R4BA 3P1AA 4PF4A 4LUDA 5IG1A 5ANIA 5HLNA 5DBXA 3D5VA 4QPSA 5KHWA 3NVKI 3DU8A 3L9NA 3SHEA 3RK9A 1DAWA 3C4FA 2WTKC 2C0OA 2UW4A 4KIQA 3OZ6A 1V0OA 5LVLA 5GINE 1YXUA 2HENA 4BDEA 4IM2A 3RGFA 3FBVA 3HV5A 3C5IA 3D2KA 3QKMA 1KOAA 4NJ3A 1Q62A 5D11A 1QPDA 5HCXA 3PA4A 2EUFB 3DAJA 3FHIA 1YWNA 5AAFA 3HV7A 4JQ8A 4TWNA 4TYHB 1Q24A 4ZP5A 3PJ3A 5CEIA 2VX0A 4HVHA 3W10A 4A9UA 5IDPA 5J1WA 1SVGA 2HWPA 3UMWA 1I44A 1T46A 2JKKA 2XM8A 4K18A 2XNEA 4C3FA 3Q4CA 4RIXA 3NGAA 4F64A 3RI1A 1UA2A 3R30A 4GT4A 5JRSA 3V8SA 5CF5A 2OWBA 3LMIA 4AN3A 1QMZA 4DGMA 4LFIA 4OTQA 4QD6A 4C02A 2YAKA 4WRSA 1GY3A 2C6OA 3R00A 4J8MA 4F0GA 3NZ0A 3ULZA 4D4VA 4RLLA 4RIWB 3W18A 3UPXA 2WELA 3D14A 2C3IB 3B8RA 3PPKA 4I0TA 2VWWA 3CP9A 4FV7A 3SD0A 3UO6A 1NVSA 3DAKA 1E1VA 3ODZX 3DA6A 5L2QA 3D7ZA 3C4CA 4X2FA 3OS3A 2YWPA 5TE0A 2JD5A 3CS9A 3PRIA 2GTNA 2XK9A 3REPA 1LEWA 3UODA 2DWBA 3AC3A 4G34A 4IB1A 2Z8CA 3CEKA 4PMPA 4ASEA 2V55A 3R9DA 3PVBA 3QTZA 2UV2A 1ZLTA 5IA1A 4G6OA 5IQDA 1CSNA 4HYUA 4FYNA 4R8QA 3FQSA 2G01A 3MGYA 2QOFA 4FKQA 4PRJA 4EQCA 3LFSA 4FX3A 2XKFA 1ZARA 4L52A 3TXOA 5CI6A 4F9BA 5HOAA 4HGTA 4FSYA 4R3PA 3I6WA 1B39A 5L8LA 4DLJA 5JH6A 4IAFA 4MD8E 5J5SA 1CKJA 4NM5A 1GZNA 3KMUA 4GKIA 1YWRA 3PVGA 4D58A 4A9SA 4IDVA 3NVMB 5JZNA 2X8DA 3KA0A 4FKOA 2VWUA 3KXXA 2R5TA 3I0OA 3ROCA 5HO7A 3GU4A 5FWKK 4C8BA 4NJDA 3LLAA 1H25A 2IVUA 1J3HA 1J1BA 3CD3A 3PTGA 2PUPA 2W4JA 2BFXA 4TW9A 3ZS5A 3HAVA 4U79A 4Q9ZA 4C34A 3PYYA 4XG4A 5E90A 4W8EA 3MA6A 3Q3BA 3GU5A 4RC3A 5HICA 3ROYA 2XRUA 2C6IA 3FJQE 4BCOA 2WQNA 3F7WA 4GRBA 2C6TA 4O0SA 4CCUA 4E93A 2QHMA 4IVBA 1WBPA 3BX5A 4GIIA 2Z7QA 3HMMA 3UIBA 3ZDIA 3EHAA 1G3NA 2Z02A 4RX9A 2OSCA 3VN9A 2J0IA 4YTHA 5HVYA 2VUWA 2VWZA 3GU6A 4DTKA 5BYYA 5DG5A 3H10A 4OTIA 3BV2A 3PFQA 3AD4A 3FV8A 4K0YA 4X7QA 2YIYA 4ERKA 4FG9A 4RJ6A 4EZ5A 5HNGA 4U3YA 2OK1A 2X9FA 3KXZA 2IEWA 3O8PA 2A27A 3I6UA 3TDWA 4ITHA 4IWOA 4DC2A 5H8BA 4GSBA 5IQCA 2FO0A 4QRCA 2QLQA 1H1PA 2PVJA 2Y4IB 5EDRA 2B9FA 3HV6A 3R0TA 3UZRA 1XWSA 4RX5A 4ZTRA 3P7AA 2IW9A 1HOWA 4P5ZA 4XP0A 5HX6A 1PRYA 2WQMA 4EC8A 2EB2A 3LJ1A 3COMA 3RZFA 3TNPC 4ASZA 2CHLA 2PPQA 4ZMFA 3DCVA 3GI3A 4FSMA 3DXQA 3PP0A 4EOKA 5EYMA 4ZSGA 4TNDA 4O7LA 3QQLA 4GJ3A 4Q5HA 3IS5A 4I0RA 2JFMA 3MVJA 3H0ZA 1JKLA 3ULIA 3LXPA 4I93A 4C7TA 4D9TA 3UOKA 1UU3A 3NYOA 5CSVA 4MXXA 2CSNA 2Z2WA 2PMIA 3H0YA 1OI9A 4JBQA 2IJMA 4LOQA 5KKRB 4N57A 5EM8A 3HP2A 2HWOA 1FBNA 3E8NA 4ZJIA 3F3VA 4KAOA 1O6YA 2BAJA 3FYJX 5FEDA 4L9IA 2G1TA 4FL2A 4YJQA 2V7AA 4RX7A 3G15A 5D10A 5DGZA 2VD5A 2A98A 2VZ6A 4XLVA 2CKEA 2IVVA 2NYAA 2C0IA 2J4ZA 4RVLA 1JLUE 4HCUA 4R3RA 2BDJA 4G16A 3DQXA 3K54A 5IQAA 4FKUA 3QBNA 3C50A 2PUNA 1FGIA 2B53A 2CMWA 3MA3A 4ITJA 3MY1A 1GZKA 4L68A 3R7OA 2HYYA 5DN3A 2CGVA 3PJ8A 4A7CA 5CAVA 4DE4A 2EU9A 5F9EA 5JEBA 4R6VA 5IUIA 4JG7A 3R63A 3TN8A 1BX6A 4UWYA 4EK4A 4OAVB 4AW5A 1UWHA 2BIKB 2I0EA 3GCPA 4OBOA 5AX9A 2XVDA 3DKCA 4U7ZA 2Z7LA 3KF4A 5FP5A 5AR5A 1P14A 2H9VA 4B8LA 2JIVA 3GUBA 5A6OA 3U6HA 2F7EE 1CM8A 3R1QA 4GYGA 4QMYA 3UQGA 3VAPA 5LXMA 4A4XA 4EHZA 3TT0A 4GMYA 4RSSA 4PP7A 3C1XA 2JDVA 3FAAA 5HE1A 5KBRA 2AEGA 5CT0A 2J5FA 3ZLSA 3LFFA 4CQGA 2VWIA 4M0YA 2NRUA 5I9XA 3Q2MA 5E8WA 5AUWA 5GHVA 3T3VA 2J7TA 4D2SA 1J7LA 4W4YA 3NYNA 3FZSA 1M52A 5HTBA 3R8PA 4E4MA 5C1QB 3R21A 4M8TA 3OCBA 2CNQA 4FTUA 4JS8A 4YLJA 3R9RA 2UW3A 3P23A 4ORKA 4AU8A 4MX9A 2Q0BA 4YZ9A 2CCHA 3FY0A 1IAJA 5HZNA 3MDYA 3AC2A 3RWPA 1WAKA 3FXZA 2EXEA 3G90X 4KABA 5IQBA 4GU9A 4GUBA 2FH9A 5JKGA 5CYIA 3KRWA 2WMBA 4IWDA 3ZEWA 5M51A 3UPZA 4XOZA 5BVWA 3V6SA 4F6SA 1BLXA 4ACMA 3THBA 4RFYA 5AR7A 3R8VA 4YO4A 3CD8A 3OFMA 1OL6A 1PXPA 4UEUA 4BWXA 4YSMA 3V8WA 4YMJA 5IH4A 4NU1A 3MH1A 2PL0A 4IX4A 3CJFA 4QYYA 4DITA 4Q5EA 4DH8A 1KV2A 2ZV9A 3LCSA 4XBRA 2QR7A 4WO5A 3W2PA 1YDTE 4GW8A 1M14A 4TY1A 4NFNA 2ERKA 4E4LA 3ACKA 4GK3A 3KKVA 3ZUUA 2WMSA 5HORA 4QP2A 4YO6A 5E8VA 2XARA 5CNNA 4PWNA 4WHZA 5AP7A 2IZRA 3E3BX 5AM6A 4QQTA 4ZY5A 1APME 3CKXA 4F9WA 4C2VA 3QRIA 4GFGA 4I22A 4JOAA 1OIRA 2A0CX 4QYEA 2QOBA 4AUAA 2B54A 4DFUA 3A60A 4QQJA 1H28A 3DJ5A 1YXSA 4JG8A 1H4LA 4FV0A 4W4WA 5DEYA 4FTJA 4BZDA 1BI7A 4RFZA 3W0PA 1U5QA 4YJOA 1JSUA 3LQ3A 3EKKA 2WMQA 3D94A 2R3QA 3HRBA 4FIJA 4L01A 4MF0A 4RIOA 3WOWA 2Y4PA 3RALA 3BPRA 3W2CA 2Q0NA 4IAYA 2VTJA 2ZDTA 3GCSA 5IQEA 3Q9YA 2VWBA 4FC0A 5GZ9A 3VJNA 2ZMDA 4FI1A 3QGYA 2IVTA 3K3JA 3G6GA 2GNIA 3WF8A 4I6LA 5IKWA 4YZDA 4IJPA 4O4FA 1OZ1A 4WIHA 1DS5A 5J1VA 2C47A 5ACKA 4RC4A 3GC7A 4PMTA 4AT5A 3DOGA 3WF6A 4C3RA 3RNIA 3SW7A 5FRIA 5EYCA 3NFGB 3EYHA 1ZZ2A 2FB8A 3F3WA 4L3PA 1H0WA 4IACA 4IVDA 3MJ2A 4ACGA 5CANA 3ETAA 2H8HA 1OUYA 2W1HA 2XKCA 2FSTX 3WZDA 1ZY4A 4BDGA 2ZM4A 1QPCA 2BFYA 2YITA 3TL8A 1SVHA 4FKJA 2BALA 3WYXA 4Z3VA 1FQ1B 3Q9WA 5CENA 3RAKA 3FLQA 5FBOA 4FG8A 1U59A 3WE8A 4AZTA 4FIGA 1HCLA 4CFUA 3VUGA 5J9YA 2XIYA 3MYGA 3VW6A 4CFVA 3K2LA 1TQIA 4QP8A 4G3DA 5ANOA 3Q2JA 4BCJA 3A61A 4EZ3A 4F4PA 3FKLA 4PTEA 5HG7A 4EH8A 3R71A 2E9PA 4ERWA 2JEDA 2ITQA 4NUSA 1JPAA 4DFLA 5CVFA 4LRJA 2J0MB 1NVRA 1M7NA 4FK3A 2YABA 1YVJA 4YC8A 5JT2A 2JKOA 5HBEA 4H3BA 3G0FA 4XG2A 2WTJA 4NEUA 4AOIA 4EK3A 4XP3A 4OTFA 3Q5IA 4MXAA 5EW9A 4CMOA 3SXSA 3BGPA 5JGAA 2QOQA 4U9AA 3TTIA 1X8BA 4D0WA 3I4BA 4X3JA 1RW8A 3UDSA 1OBGA 3RHKA 3SOCA 2PYWA 4ONAA 2BZKB 4QP7A 2J9MA 3GU8A 1URCA 2HZIA 4CYJA 4M69B 4MNFA 5AP4A 1IR3A 1FVTA 1PW2A 1Y8GA 4ZOGA 5HNIX 1Y6BA 2JDRA 5ETCA 2CKPA 4O4EA 3KREA 4OTRA 3TNWA 3VBYA 5EQPA 2OH4A 4O7VA 3R22A 3LPBA 4FSZA 3JY0A 4KIKB 2C5OA 4LUEA 3GENA 1F5QA 5A46A 1UNLA 3GCUA 5CXHA 3RBWA 3LFBA 3E5AA 1K9AA 3IPHA 3Q6UA 5E1EA 2HOGA 4HCTA 1S9IA 3MPAA 5AUVA 3IW4A 1LEZA 2VO3A 1DI8A 2OFVA 3HA8A 5HE2A 5L4QA 1B6CB 4DLIA 3H9RA 3QKKA 3QRJA 5AX3A 3HL7A 4AT4A 2O64A 3O23A 4CD0A 2E2BA 3NDMA 4XCUA 5BUJA 5KMOA 1IASA 2NPQA 3FZTA 3DK3A 3QTIA 4P4CA 2RGPA 3QCSA 4X6QC 2CN8A 3I7CA 3FI8A 3UJGA 4O6EA 5ITAA 4I5MA 3ATTA 2B1PA 4FICA 2GQRA 3OMVA 4O7TA 3O8TA 4NM3A 5IU2A 4L42A 4FSRA 4ZZOA 2YM4A 4FKGA 3NYVA 4CMTA 4RWLA 5E8XA 2PVNA 2V22A 3G51A 2ZB0A 3L8VA 4BDAA 1VJYA 3DJ7A 3EFLA 3QCXA 4GUEA 4PX6A 2YFXA 4R7BA 2UZEA 4Z7HA 3DDPA 2YWVA 3TWJA 3UYTA 3ZC5A 5AA9A 4AXDA 4NSTA 5IMXA 5BV3A 3ZUVA 4AFJA 3IDBA 5JFSA 4RIXB 3VUIA 1AQ1A 4R1YA 1FMOE 1WVYA 5HIDA 4D28A 2J2IB 2OJIA 3QD2B 3LXNA 3E93A 3C4EA 4S32A 3N4VA 3R2BA 2OH0E 3DTCA 4O22A 2ITYA 3RAIA 4O96A 2C30A 5CVHA 4FVPA 5M09A 4RPVA 2XJ0A 3F2NA 4YJRA 4EBWA 2C5XA 4F99A 2X6DA 3W0RA 2IG7A 3NWWA 3KULA 1QPEA 2BAKA 4EOIA 3MVHA 3VW8A 1TVOA 4ZLYA 3H9FA 3TUCA 2UZUE 5CSWA 3HV4A 3FEGA 5M06A 5LJJA 5AADA 3UZPA 3F5GA 4BRXA 1KE6A 4OTPA 4H36A 1UVRA 2PMLX 3PLSA 2EVAA 2W1ZA 4L8MA 4LV5A 4BF2A 3QTRA 1BYGA 5FDXA 3HAMA 3SXFA 2PZRA 4YZMA 5L3AA 3DBCA 3NW5A 4G9CA 1YDRE 4KBAA 4N70A 4HYHA 2V62A 3JUHA 3BLRA 1XBBA 3L9LA 3Q32A 5DH3A 4O7ZA 3GCVA 2J6MA 4DEBA 1Q3DA 4MTAA 3VRZA 4DG2E 3VF8A 4WOVA 3ORKA 4TRLA 2XNBA 3FQHA 3W32A 3FC1X 3II5A 4JIKA 4FNZA 4QMUA 4CGAA 4CLIA 3P7BA 3FMDA 4JVGA 2WTKB 3LAUA 2OZAA 3PE1A 5CAQA 4NW6A 2F57A 1JNKA 1DAYA 3HP5A 1XKKA 4D4YA 4FNWA 4CG9A 3QA0A 4TYEA 4NTTA 2CJMA 4UMQA 4DA5A 5GIPE 2ZM3A 1I09A 5JFWA 1YW2A 4DGOA 3VUKA 2G2HA 2V0DA 3MVLA 3SC1A 4E8AA 4M7IA 5DNRA 1Z9XA 2R2PA 4MXYA 4C36A 4CFNA 4E20A 4O7WA 4RQVA 1OVEA 2ZM1A 5JSMA 2WPAA 2HIWA 1XH4A 4IZ5A 4B9DA 3VBVA 2WIPA 4I5PA 4BTKA 5AIKA 5FEQA 4DT8A 4HNIA 2X39A 2BUJA 3AD5A 3NS9A 2XK8A 2C6DA 1PXLA 4BJJA 4I4EA 4L53A 5AV4A 2P2HA 2FGIA 4MWIA 4DH3A 4E1ZA 3F3TA 2DS1A 3GC9A 3KRJA 2GQGA 2ITZA 2QLUA 2BAQA 3PSCA 4FF8A 4EK6A 4X3FC 1OKZA 3BL9A 3ID6C 4MXOA 5D7VA 4PPBA 4L45A 4KBCA 4P5QA 2F9GA 4NK9A 2J51A 3Q96A 3DBDA 4F7NA 4GFMA 4Z7GA 3V5LA 3PJ2A 4D2RA 4LOPA 3QLFA 3OCSA 5AP2A 2I7QA 4M12A 2W5BA 4I5CA 1OKYA 5AV0A 1J7IA 5EG3A 3PPZA 5DT4A 2GS7A 5CEQA 5HVJA 4O38A 2JKQA 1RQQA 1SYKA 3O2MA 4BBMA 2UVYA 3OUKA 2QKWB 4IMYA 4QTDA 4AE6A 1R0EA 3PJ1A 2HK5A 4FTQA 2GHLA 3CQWA 4IX5A 2JIIA 4E4XA 1YXTA 2O8YA 4CCBA 3Q53A 5C9CA 2WOTA 3OWKA 4MYGA 5T68A 5JQ8A 3SGCA 3RAWA 4XG9A 3BWJA 2W7XA 4QMVA 2O5KA 3FPQA 1A06A 5L6WL 1G8AA 3FLNC 4RVTA 3FXXA 3ZO1A 4HPTE 4AA5A 4D4RA 3FYKX 2I0HA 2AUHA 4S34A 5CSHA 2F7ZE 5EDQA 2IVSA 5EDPA 5E8UA 4BZOA 2XMYA 3IGOA 4KS8A 4QP6A 3Q6WA 2O2UA 4F9YA 3ML1A 5M08A 4YNEA 2PMNX 5FDPA 3R1YA 3OTVA 3P5KA 4MXCA 3A2CA 4JR7A 3UGCA 3GOPA 5BVNA 3Q60A 4GG5A 5EQYA 4L44A 3WF5A 3UDTA 3I7BA 5DHJA 3AT4A 1L3RE 5CS6A 3KXHA 4G5PA 4C61A 4WNPA 4FL3A 2Q83A 2R64A 3ZRLA 4ALWA 1XQZA 4BKYA 4ZLOA 4QMWA 2RL5A 3RHXA 4AN2A 5KMMA 5M44A 3L9PA 3DTWA 3BLHA 1XH9A 4RFMA 2YM6A 4AZSA 3V3VA 2RG5A 3UP7A 1H0VA 4X3FA 3NUSA 2A1AB 2BTRA 3LM0A 4GEOA 4I41A 2YIWA 1SVEA 2WMAA 4B99A 1J7UA 4EI4A 2IF8A 5EK7A 3V5PA 5DT3A 3ZH8A 5FTOA 4EUUA 4QMNA 4O7YA 1J91A 1ZWSA 2OJ9A 4O0XA 5CEPA 4EJ7A 3BELA 3S3IA 3OOMA 2WZJA 4DEAA 4FIIA 5F4NA 3QL8A 5HU9A 1CDKA 3ET7A 2VTIA 3MI9A 4YJUA 2YLEA 3C0GA 5AP3A 3QYWA 4CT1A 4CZYB 3R6XA 4PNIA 5CLPA 4GS6A 3OF0A 2ITOA 2OIBA 4ID7A 3K3IA 4WA9A 3O50A 3UNKA 4QMOA 3CIKA 5E92A 4G17A 2XYNA 3ZONA 4WD5A 4YJPA 5CTPA 4AG8A 4DDGA 1ZOEA 1IG1A 1V0BA 5HD4A 2B0QA 1U4DA 3MPMA 4FV4A 4PTCA 4QPMA 4F1MA 2BHEA 3HUBA 4XEYA 4AW2A 4YU2A 3TM0A 2YM7A 1IRKA 3OHTA 2B9HA 4O82A 3QTUA 4E5BA 4C38A 3OY3A 4FTKA 4XRLA 2YJSA 3BWFA 2HZ0A 2YAAA 3U8WA 5I9YA 4DH5A 2XK6A 4JAJA 1UKHA 3BGQA 4EONA 2O0UA 2XA4A 2YN8A 2YM8A 4AZWA 2UW5A 2DUVA 5HBHA 2ZFYA 3LXKA 4AACA 2QD9A 4C4IA 5LWNA 4LV7A 4V04A 3RPRA 1ZRZA 3MFUA 2FUMA 2WD1A 4WT6A 2E9UA 2Y9QA 3EH9A 3EZVA 4FSNA 5CY3A 3DQWA 3RTPA 3UO4A 3ZOSA 5CEOA 5C4KA 4K77A 4IAAA 5BX0A 4CV8A 3R8UA 4DG3E 4EBVA 3LFDA 5D7AA 4UWCA 4FT0A 5AUZA 1H01A 4KA3A 1Z5MA 2GPHA 3PXYA 3R2YA 3VS0A 2Y7JA 4IFCA 3GFWA 4BCGA 4F9AA 5B2MA 5LQFA 3HZTA 3FL4A 1NXKA 3IW8A 4TWPA 3F88A 4U97A 4WG5A 5FM2A 3RM7A 3RWQA 1UNHA 4NKAA 5IUHA 4GIHA 2WMUA 1M17A 4IZYA 3MV5A 4L46A 4M0ZA 4AW0A 1URWA 4JRVA 4PDOA 2OLCA 4BTJA 4XUFA 2ZDUA 2PK9A 4Y46A 3MSSA 3V5JA 2PZYA 4U5JA 3OWJA 4AX8A 4JL9A 1RJBA 3G9LX 4RZWA 2F2UA 4DCEA 3TDVA 4O7NA 2X9EA 2BHHA 1ZOGA 3PY1A 4MVFA 5F20A 1YDSE 4F09A 1K2PA 5EFQA 4GT3A 4R5YA 4ZK5A 4P7EA 2OZOA 5ANJA 1WBWA 2OU7A 5C03A 4OT6A 4FSUA 4FSWA 4RQKA 5AR8A 2YCFA 2CGWA 3FLSA 4QYGA 4LOOA 4PMSA 3NLBA 4FEXA 1KSWA 4G6LA 5E8TA 5FLFA 2PY3A 3FMHA 1GZOA 1PMNA 5E4HA 2VO7A 3W0MA 5HCYA 5TKDA 2GS6A 5IMEA 4NYEA 5C8KA 4QDVA 2G9XA 5BVDA 3P78A 3TUDA 4WNMA 3EB0A 4APPA 4UYNA 4L00A 2GS2A 3N4TA 2V7OA 3R28A 4H3QA 5C27A 1VYZA 2XIKA 3C0HA 3TZMA 1KE7A 4CSVA 3IW6A 3F2RA 3L1SA 5AV1A 4MBLA 4NL0A 3UQFA 5KMLA 1KE8A 4X2JA 2VTRA 5EYDA 1MUOA 3ORZA 2OGVA 4AF3A 2IPXA 5IA0A 1CKPA 5LCKA 4CMUA 3BEGA 5CXZA 5KCVA 5IA3A 1FVRA 1PXKA 3ZFYA 5K0XA 3RM6A 3OTUA 3DZQA 4NIFA 2W1CA 3SRVA 4OR5A 1KE9A 5DR2A 3ORPA 3R7GA 4EOLA 1UKIA 4IANA 1J1CA 3VF9A 3BYSA 4HOKA 5TR6A 5EM7A 4CV9A 1S9JA 2VNWA 3EFWA 3KN5A 3LLTA 4IQ6A 4WBOA 4XRJA 2UVZA 4Q9SA 4J7BA 3TV6A 4TT7A 4YLKA 4DG0E 4QMSA 2XNOA 2WQOA 2PE0A 5L2SA 3MJ1A 2R3HA 5KMJA 3ACJA 3GGFA 2O65A 2XIRA 3UMXA 3LCKA 2IWIA 2RIOA 3ZSIA 2X0GA 2PUUA 4QO9A 2C6LA 3GC0A 3HVCA 4L6QA 3RZBA 4F0FA 5DIAA 1QL6A 4B7TA 3G5DA 4FTAA 5D9HA 4XP2A 3D5UA 5LVOA 3K5UA 3VBXA 4F7SA 3UOLA 4I6QA 3VNTA 3AT2A 4CTBA 4BY9E 2W5HA 4ZTMA 3P7CA 4FGBA 4BGQA 2PVLA 3GU7A 4OAUC 3U4WA 4EH6A 1CKIA 2ONLC 3C4ZA 3AMBA 4EH2A 4IXPA 4JR3A 2C6KA 4C37A 2O63A 1STCE 3GT8A 1FPUA 3HEGA 3QTSA 4EOPA 4Z9LA 3JVSA 4Y72A 2ZMCA 1P4OA 1XBAA 4CTCA 2I0YA 3A7IA 3EZRA 5HG5A 5IQIA 3AC4A 4TYGA 5CT7A 5EW8A 2R7IA 3C4WA 3F69A 3LQ8A 3O96A 3NCGA 4BDDA 5TOZA 2QURA 4XHKB 4R5SA 2GQSA 4WBBB 4ALUA 2YM5A 3ZDUA 5HBJA 2WTDA 4XOYA 4J99A 5HD7A 3L8SA 2W1DA 3U51A 1O6LA 3P0MA 3D0EA 2PZIA 4HZRA 4FV3A 4FGRA 4AT3A 4LGHA 2LGCA 4AXAA 5E9EA 5DOSA 5EOLA 1CMKE 4KNBA 4B6LA 4BCKA 1YQJA 5J79A 2QKRA 4K9YA 2B9IA 4FKRA 2QG5A 2J90A 5DE2A 2C3KA 2J0LA 4HVDA 1YXVA 1YKRA 4XBUA 3DBFA 4J53A 1MQBA 4S30A 3KXMA 4P2KA 1KV1A 3Q5ZA 3SQQA 3BZ3A 5BVOA 3IK3A 4FT3A 1TFFA 4FV5A 3EQHA 4TXCA 5HKMA 5LOHA 3E64A 4JX3A 2HY0A 2X7OA 5HLPA 3UTOA 4HCVA 1A9UA 1XH5A 2FSMX 3RP9A 5HTCA 3MVMA 3E3PA 4DT9A 2HW7A 3NUXA 4C4EA 1ZMWA 1Y6AA 1YHVA 3PP1A 1LP4A 4IAZA 5HI2A 5CAUA 3I5ZA 4W8DA