3ZO4A

The synthesis and evaluation of diazaspirocyclic protein kinase inhibitors
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
337
structure length
335
Chain Sequence
b'SVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVMLVKHMETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFSEF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CAMP-DEPENDENT PROTEIN KINASE CATALYTIC SUBUNIT ALPHA
publication title Synthesis and evaluation of heteroaryl substituted diazaspirocycles as scaffolds to probe the ATP-binding site of protein kinases.
pubmed doi rcsb
source organism Bos taurus
molecule tags Transferase/inhibitor
total genus 107
structure length 335
sequence length 337
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2013-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3zo4A01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3zo4A02
3CY2A 3O23A 2J4ZA 4RJ7A 4AA0A 4FF8A 3VULA 1XH7A 5F1ZA 5CVFA 4NM7A 3VUTA 4EL9A 2CGVA 3IKAA 2REIA 5CSVA 4F0IA 2WTWA 4IM2A 1H01A 1PYEA 2HK5A 2X4FA 4UZDA 2EXCX 1OPKA 4ITJA 5CS6A 3JY9A 4BVUA 4CXAA 2HXQA 2YCRA 3UOHA 4F1TA 3R8ZA 2PMIA 3BHVA 4HGTA 3ZYAA 4ASDA 4YLKA 4RWKA 4TN6A 3LCSA 2FSOX 3BCEA 3H0YA 3M11A 4YZCA 3PSBA 3PYYA 4L7SA 1W83A 3OW3A 3KL8A 4C36A 4P5QA 3R01A 4AT5A 4BIDA 5JQ5A 2WMTA 3IDPA 3IW8A 3PP1A 4J7BA 2PULA 4FV6A 5HHWA 2YHVA 5HO6A 3F3TA 4MWIA 3A7GA 2E9PA 4G3DA 1UWJA 4M68A 3UIBA 2OJ9A 3UZPA 4BC6A 5LOHA 4FKOA 2DQ7X 2QR8A 5JN2A 4G34A 4QYYA 3KREA 4U8ZA 3COKA 2XS0A 3FMDA 3PFQA 2F7ZE 4F6SA 3RK9A 3GC9A 2YA9A 5C9CA 2W99B 1Q8YA 5J7BA 3DB8A 2IW8A 1KOAA 3QZHA 2C0IA 1QPDA 2OJIA 3DDQA 4WNMA 5FQDC 3V5QA 2W1DA 4D2PA 1ZMUA 2YIXA 4JX7A 4E7WA 2W1IA 4AFJA 3C4XA 4ARKA 2J9MA 3RPSA 5L3AA 4NFMA 5EHYA 5JFWA 4YLLA 1WBPA 2ZMDA 3FZPA 4FTLA 2PVMA 2WHBA 4RWLA 2PZ5A 2C6TA 4R3CA 2R7IA 3ZO1A 3GXLA 3SW7A 2IJMA 4TRLA 1LEWA 1PY5A 3QGYA 4FT5A 5EI2A 1K3AA 2QHMA 4WHZA 5HBHA 2GNJA 3RZFA 3OBJA 4FT9A 4K9YA 4YZNA 3A2CA 4I0TA 4QMOA 3VW6A 1UU9A 1OGUA 4U79A 3EOCA 3CP9A 4EWQA 4HPUE 3BU3A 3HL7A 3PJ2A 4UEUA 4Y73A 5AP1A 3VHKA 2C4GA 4GFGA 3U6HA 1CMKE 1IASA 2BR1A 3D2IA 3IGOA 3TV4A 2BDJA 2ITNA 2YWVA 4EEVA 4QMWA 4ZY4A 1PKDA 3SRVA 4BTJA 4B8MA 4RGJA 5K9IA 3AD4A 4FV9A 3BZ3A 3BHUA 5AEPA 3OG7A 3ZZWA 3COIA 4ZY5A 3V8TA 2F4JA 5AP6A 1TQIA 4W8EA 3H9OA 1P2AA 4FTMA 1H1WA 4K0YA 5DEYA 3DBEA 4E5BA 2F7EE 1W84A 4GVJA 2UVXA 2YM4A 3OT3A 2OXYA 2GQSA 4MK0A 2YM3A 3ZDIA 2C68A 4RVTA 1XH4A 4DFYA 4FNWA 5A46A 5HGIA 1IRKA 3GCVA 3TM0A 5HO8A 4NT4A 2HZ4A 3ZC5A 3PRFA 4UALA 2B9HA 5GNKA 3V5PA 4O86A 1FMKA 1M52A 3MBLA 4G3EA 1YKRA 5T3QA 4B6LA 4PPBA 4QTBA 4WA9A 4BGQA 4EZ3A 1WVWA 1WBOA 2UZLA 2QOKA 3HZTA 3PE2A 3NYVA 4FKVA 4IWQA 3NW5A 2OGVA 4QO9A 4CD0A 4AA5A 5IUGA 2YITA 4DC2A 4J8MA 3LXLA 4GYIA 2LGCA 3OP5A 2EVAA 5CU2A 2X4ZA 4LUEA 4OTGA 5JRSA 1BMKA 4TXCA 3RWQA 4C3RA 1YWRA 2X8EA 4CMOA 4DFLA 2NNWB 2BFXA 3ID6C 5AUZA 3R9OA 2VTJA 2IVVA 3LXPA 3Q9ZA 4E4XA 3SG9A 2FYSA 3LM5A 4B4LA 2WMAA 3BKBA 4TKSA 5LQFA 3NS9A 5IQHA 3LM0A 3CJFA 2BZJA 3N4TA 5CNNA 4YHFA 4FL2A 4OGRA 2I0HA 2WQBA 5TT7A 1Y6BA 4EYMA 3PWYA 3WARA 4LOQA 4R1YA 4EK4A 4YJTA 1YOLA 2YIYA 4A9SA 2B4SB 2C5VA 1Z5MA 3CCNA 3UO6A 4YJNA 2PY3A 4QMQA 3PZEA 4NCTC 3RVGA 1U5RA 4IVDA 3DPKA 2R4BA 3CQWA 4FTNA 3HV5A 4MQ2A 5AP3A 1BKXA 1VR2A 3QZGA 4FKIA 3ALOA 3W16A 4D0WA 4EH2A 5LCJA 2ITPA 2UW5A 3JVSA 3QQKA 3K5VA 4NH1A 4QMYA 4NCTA 5C26A 5JK3A 1GZKA 3QX2A 3OOMA 4YNOA 3W18A 1JSTA 4PUZA 3IQ7A 4S34A 2WQMA 5FXRA 3RBWA 3AC2A 1QPCA 3K3IA 1PMNA 3CY3A 1KE9A 3NCGA 4RIWA 4TT7A 5IA5A 4BCGA 4ASEA 3HKOA 4YR8A 4E5WA 3LLTA 3QTUA 4M8TA 3R7UA 4CRLA 1XH9A 3VNTA 1XBBA 2QOCA 4ANLA 4I0RA 3ORIA 4U42A 2CGXA 1WBWA 4XH6A 3ZM9A 2XIZA 1HCLA 3PJ3A 4XV3A 3WYXA 3U8WA 4IWOA 2VWIA 2ZDTA 4PMSA 4A4LA 4BDKA 2ETRA 5EM5A 2FSMX 4ZTLA 3E8DA 4RPVA 3ZLSA 3LFDA 2WO6A 1R1WA 5I9YA 3QCYA 4J52A 4LMUA 4MD9E 4GIHA 2NRUA 4EH4A 2W5HA 3A4PA 4J8NA 3TNQB 5KMNA 4EJNA 5AUTA 5KZ0A 1Q8UA 4KD1A 3ORXA 1YI3A 2JDOA 1A06A 4FKGA 4X3FA 5EG3A 5AV1A 1OL6A 2XKEA 2BRNA 4L46A 4AN9A 1PXJA 4YTCA 3BEGA 5IG1A 3RAKA 4K77A 3KULA 3VBYA 3ZO2A 4AGDA 4IB3A 4UYNA 3KXXA 3HAMA 4AA4A 1TQPA 3GU5A 3IW6A 3NR9A 3I81A 5EH0A 2NO3A 1W8CA 3L8PA 4DFNA 3F2AA 3RMFA 2WMXA 2VV9A 4IC7A 5CXHA 4AGCA 4GCJA 4DEIA 3ZH8A 4EZ5A 4O0WA 4JAJA 5AIRA 4FV7A 4ERKA 1PXMA 2ITXA 4BTKA 3DY7A 5EW3A 4D9TA 2C3JA 4G1WA 2V7OA 4TYGA 3EQGA 4N6YA 4FOBA 2J0MB 3SQQA 3KMUA 4C59A 2WIHA 1V0BA 3U9NA 4Z3VA 4QNAA 4AUAA 4GG7A 1LUFA 4NW5A 3BLHA 4CYJA 3RM7A 3W32A 2QOIA 4MXCA 3KC3A 4KIOA 1PMUA 4G6LA 2O8YA 3I0OA 4G16A 3G15A 5F9EA 3HV7A 2EB2A 4O1OA 5E8WA 4UX9A 3L9LA 4LI5A 2CJMA 2X7OA 3G2FA 1PRYA 3UP7A 3DNEA 3P79A 5HG9A 4AW0A 4M67A 2XUUA 4K18A 1AD5A 2CNVA 4IWDA 4F64A 2QOFA 4DCEA 2Y4PA 1BYGA 3RPOA 2IW6A 4BB4A 4DGNA 5DT4A 5K4JA 3ZBFA 4D58A 4O7WA 2PE0A 4UMRA 1Y57A 3DKGA 3BWFA 4GIIA 3O17A 3QHWA 5CVGA 3G0EA 3EH9A 5HTCA 2XNMA 3MN3A 3A7IA 1GIIA 4M0ZA 5DA3A 4CZTA 1OKVA 3OCSA 5A4LA 2XK3A 3DZOA 4JBOA 1ND4A 3V6RA 3QX4A 4FKRA 5DN3A 5LMKA 1W98A 4YZMA 3QA0A 2V55A 3EQRA 2HZ0A 2XKCA 5DR9A 5C01A 2WQNA 3R8MA 4BCFA 4CZUA 2I40A 4DG3E 4LGHA 5EHOA 4J97A 3GOPA 4ZSGA 4F7NA 5L6OA 5M4FA 3C5UA 3O7LD 4AZFA 4BZOA 3WF8A 2Z2WA 2CKQA 3QL8A 2R2PA 5EYDA 3S1HA 4H1JA 5J9YA 4YO4A 4O7YA 3MWUA 1SMHA 2RF9A 4O7ZA 3QUPA 4RVLA 2R3NA 3W10A 5EDPA 4L8MA 2YERA 3QKKA 3QQFA 2WOTA 4TNBA 3Q4UA 4C62A 3SXRA 3N4UA 2HW7A 4BI0A 4IVCA 4U97A 4KAOA 4KS8A 3FKNA 3QCXA 2XNPA 4C2VA 5KX8A 1M14A 3NUAA 2PHKA 2SRCA 1Q62A 2ACXA 4E5AX 4XG6A 1OUYA 2JDSA 4DTAA 3QC4A 3H9FA 4NIFB 1J7UA 3H4JA 4BDFA 3ZLWA 4EWHA 1FPUA 2X9EA 3PG1A 4AFEA 3I5NA 3U6JA 4AS0A 4O22A 4ZLZA 1PXOA 2CKPA 2YM7A 4JG8A 3QALE 3EN6A 4X2GA 4AOJA 1U54B 2C6DA 4AQCA 2I6LA 5FXSA 3TUCA 2XMYA 4J95A 4C4FA 3W55A 4UXQA 4C02A 5IEYA 5M51A 2O3PA 5FEDA 4PPAA 4X2KA 4YUQA 3FJQE 1OB3A 5BYYA 4B0GA 4NL0A 5M08A 5CSHA 3RHKA 5DWRA 4FGRA 4BCNA 5BVDA 2X1NA 3HGKA 2X8IA 4FSWA 3UNKA 1APME 1BLXA 4W4YA 5DMZA 4M14A 4ASZA 2G2HA 4FICA 4CVAA 2OZOA 4FV5A 3ZFXA 3OY1A 1YOMA 4IM0A 2XB7A 4MBJA 4YGAA 3FLSA 5FTQA 3IDBA 2C5NA 3GQLA 3BE2A 2OICA 5IQIA 2WTIA 2Y9QA 3VS1A 4GUBA 4C37A 2JIVA 3TNWA 4IW0A 4ACDA 3Q2MA 4O7RA 3P0MA 4BZNA 4I6HA 1LPUA 2GDOA 4UBAA 4CV9A 4RWJA 4XP0A 4C8BA 4Z7GA 1V0OA 3QTXA 4AP7A 1YI4A 1WAKA 2BRGA 4FNXA 4IFGA 4C57A 5AP4A 1U59A 3KA0A 3HP5A 3PXFA 3LFCA 2Y0AA 5ANDA 3LMIA 1XKKA 3W2OA 2QLQA 2V22A 3AC4A 3UGCA 4FTOA 2XNOA 5AP7A 3V6SA 4YTHA 1ZRZA 5D7AA 3ZUVA 3QD4A 5G6VA 3ZUUA 5CSPA 5K5XA 4YJSA 3CSVA 3OWPA 3RALA 5BYZA 4D2TA 5EDRA 3O8PA 3POZA 4EOSA 2YLEA 4KKGA 4O0UA 4RLKA 3EQDA 4FTJA 3QCQA 4AW5A 4F7JA 4DEBA 1PF8A 4JDKA 3TL8A 2JDTA 4L01A 4B7TA 5M44A 3ZLXA 1Q61A 2YAAA 3O8UA 4QMSA 2BZHB 3KVXA 4F9WA 4HCVA 5AR3A 1CTPE 4RC3A 3GT8A 3AMBA 3DFCB 4A4XA 4X2JA 1DI8A 4R1VA 2ZOQA 3HECA 3OTVA 4LL0A 4F0GA 3ZO4A 1CKJA 2RFEA 4WUAA 5E9EA 3EMGA 3PTGA 3R00A 3UYTA 4DYMA 3OUKA 2XK8A 2BRBA 1PXIA 4S2ZA 3FKLA 4GRBA 2R3HA 3F5XA 1UKHA 1WCCA 4QTAA 4KBAA 4QMXA 5F20A 5HBEA 3TJCA 4AX8A 2YN8A 3FY0A 1OPLA 4F08A 2WQEA 2OIQA 4YJUA 3EFKA 5TF9A 3C1XA 3KQ7A 5HE1A 5CEPA 5IQCA 1M17A 4BICA 3RKBA 4EI4A 4FR4A 5AM7A 3MA6A 4D5KA 4RRVA 3GU8A 3QZIA 2W4JA 2ZMCA 3U9CA 4GKIA 1OBGA 2JKOA 2F9GA 2JDRA 3F88A 1UNHA 3NPCA 4HGSA 3UIXA 4ALWA 5CT7A 3HEGA 3QTRA 2W96B 4BYIA 4GK3A 3LMGA 1H1PA 3RCDA 5IQDA 3DK6A 2PMLX 4FV0A 4AW2A 3R71A 4A07A 4JI9A 5DIAA 4QMMA 2C1BA 4ZMFA 3DBDA 4L67A 5H9BA 2QODA 3IOPA 3PJ1A 4IZ5A 3E88A 2BVAA 4I92A 4J99A 4WRGA 5CF8A 3BYOA 3QTZA 5ANGA 4CGAA 3FI4A 4FVPA 4N0SA 2JEDA 1SYKA 5HE0A 4UZHA 2VGOA 3NVKI 3PDTA 3LQ5A 4FV2A 5E4HA 3EKKA 4ZZNA 2OXXA 1E1XA 3CJGA 4DFBA 3COMA 3QXOA 3MIYA 3Q53A 5DG5A 5CALA 1VEBA 5EQYA 5HI2A 1SNUA 2ETMA 1H08A 3QTSA 2J6MA 1KWPA 4ZTSA 5M4UA 3QLGA 4RT7A 4TW9A 3D15A 4C3PA 4G6NA 3WILA 2JC6A 4FV1A 4I94A 2HWOA 4RIYA 5DR6A 2XK4A 4G3CA 2XRWA 4YSMA 4CLIA 4EYJA 4I6QA 5AA8A 4QMUA 1QMZA 1JSUA 4BRXA 3LJ2A 4FSUA 3OROA 3DDPA 1PMEA 4BY9E 2VTSA 3UODA 4JVGA 3CLYA 3V51A 5IQAA 4EHVA 3BGZA 4IE9A 4BBMA 2UW6A 5EKNA 3AG9A 4C3FA 3MPAA 5GJGA 1A9UA 1KSWA 3Q52A 5AX3A 4AT4A 1MUOA 4MCVA 1L8TA 4MXXA 3D2KA 4XRJA 2G15A 4W4VA 1M2RA 5L8LA 2CNQA 5EDQA 1MQBA 2CN5A 1ERKA 3DAJA 4XG8A 4YZ9A 4YJOA 2IN6A 5CEQA 5FD2A 4X3JA 3QQHA 2EWAA 3DNDA 2PPQA 4AE6A 5BMMA 3GNIB 1PXKA 4O6EA 4XHKB 4L7FA 4DFXE 3ORTA 2XCHA 4MX9A 5DEWA 2WMVA 3KCKA 1CDKA 4UMPA 4HJOA 5AV3A 3R04A 3W8LA 4XV9A 2Y7JA 2HZNA 2UZUE 3Q9YA 3F9NA 5CY3A 4C4HA 2EXMA 1XH6A 3O96A 2WFYA 1ZY4A 4BI2A 1XR1A 4I4FA 5IUHA 2JAMA 2EB3A 4L52A 4FEVA 4C33A 4O7VA 3NNUA 4M15A 3V01A 1PXLA 5EM7A 1R0PA 4FKQA 1O6KA 5I9UA 5F95A 1V1KA 3PZHA 3G90X 2CPKE 3NVMB 3HMIA 3D9VA 3GOKA 5T68A 3PA3A 1YQJA 1JAMA 5C8NA 4RJ8A 4ACMA 4F6UA 5FM3A 4BCHA 1PHKA 2QO2A 2P2HA 5HNIX 5DPVA 3MB7A 4EHZA 1TKIA 4ZSLA 3FPQA 2V0DA 4HVDA 1J1BA 2VTQA 3R9RA 3MFUA 4OBPA 4D28A 2BAJA 4IH8A 4XG9A 4FVQA 3QQGA 4FKLA 4RQKA 5D10A 4HYIA 3R9NA 1PXPA 2YIRA 3IG7A 3W33A 2VTOA 4QQ5A 3ZCLA 4PMPA 3ODZX 4O0TA 3NWWA 3FZOA 4GSBA 3T3VA 2W1ZA 3L9NA 4PDPA 5EYKA 1WBNA 1UU3A 3A7FA 3VUMA 5HTIA 3ORNA 1NVQA 4IZYA 3VQUA 1M7NA 2OJJA 4EQMA 5B7VA 4X2NA 4MXAA 3A8WA 2QOOA 4DEHA 4WG4A 3ZBXA 1OPJA 2IG7A 1NVRA 4RFYA 1YVJA 3MI9A 1ZYJA 1STCE 4I23A 1BI7A 4K33A 2OO8X 1ZARA 2RKUA 4NM3A 4QYHA 1QPEA 3RZBA 4EK5A 2XYNA 3WZEA 5FWKK 3FLQA 4UWYA 3SAYA 4TWCA 4AZTA 4C0TA 2W9ZB 4U7ZA 2A19B 3LCKA 2HWPA 5A3XA 4A9TA 3GC0A 2PU8A 3Q96A 5BPYA 3LE6A 3H0ZA 3KF4A 4QQTA 2ZAZA 2IZRA 4FTAA 3FLNC 5DRBA 2C3KA 2Q0NA 5D11A 4EHEA 2XIXA 4XLIA 4EUTA 3AC8A 4I24A 3SXFA 2YISA 4FIGA 3FLYA 2CKEA 1MRYA 4R7BA 3BU6A 5DYJA 1OL5A 3MH2A 2A27A 2W0JA 1O9UA 5E1EA 3C50A 4MF0A 4CKJA 5J1WA 2FH9A 4JG6A 4PTCA 4OTPA 4M0YA 4MXZA 4ZXTA 5IDPA 5DVRA 5CEOA 1KUTA 4CFMA 2IO6A 4DE4A 3D7TA 3OVVA 3A8XA 2Y4IC 1AQ1A 2H96A 4L3PA 5IPJA 3DLSA 5AR4A 3ACKA 4II5A 2F49A 3ZHPC 4RC2A 2QKRA 4J1RA 4MHAA 4Y95A 1YXXA 5IA1A 5JRQA 4DEEA 2BHEA 1TVOA 3DXPA 3QRIA 4PTEA 3VS5A 3AT2A 3PVBA 3WZJA 1YWVA 2YAKA 5FP5A 3ZS5A 2J50A 4JT3A 4CEGA 2C6MA 4EORA 3G9NA 4O7LA 3ORMA 4GK4A 3G5DA 3R7EA 3SGCA 3EZVA 4RZVA 2C5XA 3RCJA 2VRXA 3VS0A 3HUCA 5LCKA 1G8SA 4GK2A 3QU0A 5E8VA 2ITVA 4KIKB 4WSYA 4JOAA 2GCDA 5EM6A 1KE7A 2RG5A 3BE9A 3LFQA 5HNBA 4E6AA 5BVNA 3Q6WA 3RPVA 4G9RA 1XBAA 2X9FA 3PVUA 3UC4A 4BDJA 5HLNA 3OCTA 2BDWA 3ZOSA 4JBQA 1R3CA 2F2CB 1O6YA 2WTCA 4BDHA 2JFMA 3FXXA 2B1PA 2XEYA 3LLAA 2H6DA 3CTQA 3P78A 5GJDA 1RDQE 1UU7A 5AAFA 5AP5A 4A9RA 2O65A 4CLJA 5M57A 3QF9A 4YHTA 3E87A 4HNFA 3WZDA 4IBMA 5HNGA 3LXNA 4IX4A 2WOUA 5BVWA 4CTCA 5CF4A 2YZLA 4YP8A 2XM8A 4GW8A 3WF9A 3C5IA 5KCVA 2CGUA 3FZTA 3DJ6A 3QGWA 2AYPA 3QRUA 2B9JA 2C1AA 4BCKA 1URCA 3KU2A 4IAFA 4ZSEA 3FAAA 3KMMA 4OUCA 4RZWA 4U80A 3DJ7A 2RFDA 2YABA 3H9RA 4KKHA 2I1MA 3NW7A 3A61A 5CAUA 4LRMA 3VS3A 5EQEA 2ESMA 3PLSA 2ZV2A 5E8ZA 2PVRA 4IX5A 2OI4X 2VTPA 1FBNA 5E91A 2WU6A 3JXWA 4OLIA 2OWBA 3LCOA 4K2RA 1NT2A 3OWJA 3DQWA 5AR8A 5A6NA 4MQ1A 1NY3A 2GS6A 3ZONA 2C5OA 3E8NA 4QT1A 5H2UA 4FVRA 1PJKA 2GTNA 1ZOGA 3EQCA 4U9AA 3BYMA 3FMHA 3NX8A 2F7XE 5J8IA 5KMMA 3UO5A 3UE4A 3ZDUA 4EQUA 2GNLA 4GVAA 5K3YA 3UQFA 2IZSA 5GJFA 3VUKA 4G5PA 5HD4A 4BCOA 2IPXA 3HVCA 4BZDA 4CFXA 3AC1A 3OXZA 4FKPA 1FVVA 2HZIA 3BBWA 5EK7A 3FI2A 2UZOA 4IX3A 4ACCA 3I0QA 3OT8A 2QR7A 4KNBA 3AMYA 3RK7A 3RP9A 2X2LA 5LMAA 2QKWB 3JPVA 4L3LA 4JBPA 5L2TA 1GAGA 4FSYA 5I3RA 3FY2A 3PA5A 4YHJA 3DA6A 5CU4A 2PYWA 4U81A 2XIYA 3CPBA 3ZRKA 3LCTA 4DGOA 3C0GA 5FTOA 3MS9A 2P3GX 3TDVA 4ZMEA 3PE1A 4A9YA 3ORPA 1E9HA 4EHGA 3DKFA 3QWKA 4FG9A 2BTSA 5LVPA 2ERKA 3NLBA 3NYOA 2Y6MA 3F2NA 4DT8A 5A9UA 1ZWSA 4F65A 3HV4A 2OIBA 2ITTA 1OL7A 3BLRA 1OVEA 3F3WA 3FMLA 4ONAA 3F7ZA 2QG5A 1MRVA 2QOQA 5JT2A 3A7JA 1J1CA 2BALA 4YU2A 3FZ1A 2RFSA 3QD3A 3LIJA 3HNGA 1R78A 1RQQA 2G1TA 4MAOA 4CFVA 2HXLA 3LFNA 1YXSA 2HOGA 2UUEA 2A2AA 3MYGA 5FM2A 5KMIA 1ZYSA 3O8TA 2WMRA 3U55A 2RIOA 4G3FA 4ENXA 4FTIA 4O7TA 3NMUF 2GS7A 2PZYA 5HX8A 1Q4LA 3CTJA 2P55A 5IQBA 5F94A 2XBAA 3T3UA 4KSQA 2XH5A 5EKOA 2W05A 5LVOA 4DTBA 3P23A 4I5HA 1BL7A 4MD7E 3BEAA 2XNGA 3R63A 4O2PA 4V01A 2J0JA 4TYJA 2CSNA 3VVHA 1IEPA 2GFSA 2W1GA 4AOTA 4D0XA 2WU7A 2QO9A 2R3JA 2XA4A 3TKIA 3TT0A 3DT1A 4W4XA 4F9CA 2WNTA 2ZDUA 3EN5A 3AQVA 5TO8A 1XBCA 5HIDA 4AT3A 3FBVA 3BGPA 2Y8OA 1JKSA 1JPAA 4KB8A 1E1VA 4ANSA 4YPDA 3UOLA 5DGZA 4EOJA 3QLFA 3TIYA 4F4PA 1FGKA 2HIWA 2BAKA 3RI1A 4Z16A 1QL6A 4HW7A 5A4CA 5BNJA 3B8QA 4FKUA 3EFJA 4HVGA 4H39A 3BWJA 2BZKB 3FQHA 4XP2A 4OBQA 5HE3A 5CT0A 4RFZA 3MSSA 3GFEA 3OY3A 4GT3A 4H36A 4LGDA 5AUXA 5HVKA 5IMEA 5CQUA 4QQJA 4R7IA 1HOWA 2XCKA 2VX0A 3DLZA 2PVHA 3UC3A 4DF3A 2I7QA 4K1BA 3UP2A 4GV1A 5I5ZA 4BN1A 3MVJA 3UDBA 4FIFA 4RX9A 4RX5A 4UB7A 1W7HA 4LM5A 3VJNA 3MFTA 4FA2A 3VC4A 4JS8A 3KRXA 2O63A 4YC6A 3F5PA 4WNPA 2XNBA 3RK5A 2BRMA 4ZK5A 2JKQA 2OF4A 4I41A 1U46A 5L8JA 4IX6A 5HCYA 5J7HA 2GNGA 5JMSA 4E20A 3DJ5A 2QO7A 3UIMA 4FMQA 2E2BA 3DAKA 3FC1X 4EKLA 2C6KA 4O6LA 2X8DA 5CI6A 3CQUA 4L9IA 4EOMA 4RQVA 4FIHA 4I6FA 4QYFA 4Y72A 3GFWA 3WI6A 1WZYA 3BHHA 1S9JA 3NIEA 4RWIA 3B2WA 4WOVA 2WEVA 4OTHA 2WGJA 4PMTA 2BPMA 2OXDA 3WF6A 4ALUA 4E26A 3SV0A 3EL8A 5ACKA 1Q3WA 4X0MA 2ZV8A 4FL1A 5A54A 4W9XA 4IZAA 4M12A 5KMJA 2B54A 2X2KA 3ITZA 2B9FA 5H8GA 2P0CA 5EM8A 5AA9A 5AP0A 4M84A 5FEEA 2IVTA 1KV2A 1YDTE 4FV4A 3FLWA 1WBTA 3AD6A 5KUPA 2YLFA 3HMPA 4RLLA 4N70A 4G6OA 2PMOX 4ZZMA 4AOIA 3MTLA 4RA5A 3EB0A 4F7LA 3P7CA 2RFNA 4KRDA 4BHZA 3BQCA 3FLZA 4V0GB 4AGUA 4QP3A 4IANA 3ULIA 3NAXA 4V04A 3ORZA 3DU8A 4D2WA 4CMUA 2GNHA 5M53A 3V5WA 4DAWA 2WQOA 2CCIA 1OI9A 3FPMA 3RHXA 3CKWA 3HV3A 2UW3A 3R8UA 4AG8A 1OIUA 2ZM4A 2BDFA 3GVUA 3W2QA 4JQEA 4BGHA 4FSMA 3Q32A 4EBVA 2QOBA 3QYWA 3FYKX 3KRWA 4NSTA 5LVNA 4GMYA 2YDKA 2EXEA 3C9WA 4EH3A 2JKKA 3UNJA 3MIAA 2JLDA 4OT5A 3F5GA 4BDBA 4N4SA 2QNJA 3ZSHA 4XG4A 5AAGA 2HELA 4QNYA 2FUMA 4I3ZA 5HO7A 4FE2A 4F0FA 2PVKA 3WOWA 4PV0A 5K5NA 3I79A 3R7OA 5ANEA 4A06A 4QYEA 4RX7A 4U3YA 3MJ2A 4IJ9A 4BIEA 4GFMA 4EOOA 3E62A 2WMBA 1GZOA 3EQBA 5HU9A 5M09A 3V3VA 4IAAA 1IA9A 4PRJA 2UZDA 3RTPA 3VUGA 4TYIA 3WYYA 5FP6A 3VRZA 1M2QA 4KIQA 5DOSA 1WBSA 4PWNA 3VBWA 3NNWA 4I93A 3TIZA 2WMUA 5AADA 2YDJA 5EW8A 5JKGA 4N57A 4TYEA 5AX9A 3PPKA 4FV8A 4R3RA 1O6LA 4H3QA 4JDJA 3WBLA 4APCA 4U5JA 2CLQA 4I4EA 3NGAA 3PY3A 4CMTA 4EJ7A 3FZRA 4P5ZA 4JRNA 4TPTA 5HG8A 3R7YA 4Q9SA 3P9JA 4BKYA 4FTKA 2XK9A 3DFAA 5EOLA 3G9LX 5CF6A 5L2QA 4D4YA 3R0TA 4YTFA 3B8RA 3BV2A 3QFVA 4EOPA 5EI8A 2GU8A 1P4OA 4K6ZA 4EH5A 2W5BA 4UXLA 3PP0A 3A4OX 3FHIA 4QTEA 5LVMA 5F4NA 2B52A 4ASXA 1Q5KA 2QC6A 2W1FA 2X7GA 2GNFA 3G51A 2ZM3A 3L8XA 4LRKA 4Y5QA 4F9YA 4MXOA 1WBVA 4G3GA 4IB0A 4XLVA 2VO0A 1B39A 2QVSE 1R39A 5L2IA 3AOXA 3QD0A 4DEDA 3EIDA 3RPRA 4USEA 5CU0A 4PQNA 4NIFA 2W06A 3POOA 3ULZA 3VJOA 3ZFMA 4KABA 4O82A 4BCJA 4WBOA 5HCZA 3Q9WA 4G5JA 1NA7A 4X2FA 4L68A 1U54A 1YXUA 2Q83A 5IA0A 4APPA 5BQ0A 5T6KA 4PL3A 2GMXA 2CGWA 2Z60A 2XVDA 2GQGA 3P5KA 4QP2A 3BYVA 4JQ7A 2B7AA 5C27A 2VNWA 3CGOA 2UW0A 1BL6A 2J51A 3LCDA 4ZTNA 5M4IA 5L8KA 2X81A 4HYSA 5EQPA 4L3JA 4KS7A 3OXTA 2CKOA 4LYNA 4JR3A 3JYAA 1DM2A 4RVMA 2UZBA 3IGGA 2DS1A 4NTSA 4CNHA 4DN5A 1BUHA 4NJDA 3NUPA 4X6RA 5CLPA 2C0TA 3A99A 4RIOA 3TV7A 2R5TA 5AMNA 3Q4TA 4Y83A 3ET7A 5CAOA 2CCHA 5HKMA 4IJPA 3II5A 5HICA 3GQIA 4FODA 4HCUA 1F5QA 1EH4A 4BI1A 3R8VA 3P86A 2PVJA 3I1AA 1H1RA 2C5YA 4XRLA 4E4NA 4F6WA 3KXHA 4MH7A 4FKTA 4TWPA 3I6WA 3V5LA 3U54A 3TZ8A 5CEMA 3GUBA 2UW7A 2QURA 4N6ZA 2J0LA 2HYYA 2W1CA 4IAIA 4FL3A 4IM3A 4KINA 4C4EA 4DGLC 2QQ7A 2RGPA 3DQXA 5CI7A 3BI6A 4RG0A 3S00A 4FIIA 3ANQA 3R8PA 4DLJA 4UMUA 3FV8A 3GU4A 3F3UA 4ZTHA 1SVGA 4BCMA 4CT1A 2R3MA 1UNGA 4NKSA 3R28A 2YDIA 4AN3A 4EOLA 4ID7A 3IDCA 2QU5A 5DT3A 3ORLA 3D5UA 4ZSAA 1NXKA 4JL9A 2HAKA 1W0XC 2C69A 4WKQA 4YZDA 5FRIA 5CENA 1Q3DA 3GC8A 4BWKA 3G33A 5BUEA 4TL0A 2VTHA 3T8OA 4UYAA 3FQSA 3UMXA 1VYZA 4GJ3A 1PYXA 3DXNA 4DINA 3KMWA 4FZFB 3PRIA 5DH3A 5AR2A 2WEIA 4BKZA 1IR3A 2XK7A 3E63A 4EONA 4E6DA 1CKPA 3SG8A 3ZZEA 2R0UA 4B9DA 1J7LA 3HX4A 3TUDA 1YHSA 3PPJA 4JAIA 4LOPA 3UVQA 1Q8TA 2XZSA 3ZLYA 3NCZA 3M1SA 3QCSA 1WVYA 3KEXA 3RNIA 2XNEA 1UVRA 3QUDA 2W4KA 4OR5A 4Q5EA 1P4FA 4A7CA 3OTUA 3QRJA 4R3PA 4YTIA 3DTCA 5KMOA 1R0EA 4YJVA 1JOWB 3GGFA 3TCPA 5EOBA 4TTHB 5CAPA 4QMPA 2OZAB 4IHPA 3E7OA 2YEXA 2CHLA 4A4OA 3BIZA 4JDHA 4MBLA 4QRCA 4NM5A 4ZEGA 4CKIA 3WZUA 4ZP5A 4FIEA 2PMNX 4PF4A 3AGLA 3WIKA 2Z7SA 2WTJA 3A7HA 4R5SA 5KHXA 4FZ7A 4IADA 4FX3A 4O91A 3UZRA 2OLCA 3LQ3A 2W4OA 3HRCA 3BHTA 3O51A 3GU6A 3WIGA 4BTMA 5I4NA 2BMCA 2F57A 1HCKA 3BU5A 4K11A 5CQWA 4LL5A 1YDRE 2ZVAA 3P7AA 3LHJA 2R3PA 4MNEB 3F66A 2XKDA 2JGZA 3LFFA 3LOKA 3MPMA 3QQUA 5HIEA 2Z02A 3CS9A 3VS6A 2QCSA 4BDAA 5H8EA 5J5SA 3QXPA 2VAGA 4XBRA 2JIUA 5HD7A 3DAEA 3KFAA 4U45A 2OG8A 3SD0A 1DI9A 2GHGA 4C7TA 3EN9A 1OIQA 1OM1A 3SLSA 4D4SA 4O21A 5FBNC 4EK3A 1WVXA 5IA3A 1REJA 3UOKA 3ZEWA 2X2MA 4ZZOA 3QTWA 4NFNA 2J2IB 2X0GA 3KXGA 3LFEA 1RJBA 3KY2A 4OAUC 4R77A 2GFCA 3KRRA 4F1MA 1UU8A 3VBTA 2PVFA 2C3IB 3CXWA 5CANA 2VU3A 2VO7A 3NUXA 3KKVA 4CCUA 3UJGA 3EFLA 4M69B 3SC1A 2QONA 5ETFA 5CX9A 1G3NA 2ITYA 3MY5A 3KRLA 2HW6A 2ONLC 4OTFA 2YCFA 2CNUA 5BUIA 5E8XA 3FL5A 4FSNA 4Q9ZA 5GZ9A 4R78A 1OKZA 4O84A 2Z8CA 4XX9A 2J0KA 4EH9A 2AUHA 1WMKA 4EQCA 2BFYA 2C3LA 1GZ8A 2PZRA 3MVLA 2VUWA 1L3RE 3UNZA 5HLWA 3RWPA 4FYOA 3E8EA 5IA2A 1MQ4A 5DT0A 2ZYBA 4ACHA 2E9VA 4PMMA 4AZWA 5JFVA 4I5PA 3E93A 3ETAA 2GHMA 2R3RA 5D7VA 4PP7A 1X8BA 1AGWA 3PXQA 3R30A 4FTQA 3E92A 4FTCA 3NYXA 1U4DA 3NAYA 2W17A 4LG4A 1LEZA 3DGKA 3F3VA 3OMVA 2FO0A 3OXIA 3EJ1A 5HLPA 3R83A 5K4IA 3OS3A 1YDSE 4D2SA 3RAIA 3Q3BA 5M06A 2I0EA 4RIXB 4H1MA 4C61A 1KE5A 1ZYLA 3VS2A 3WF5A 3DK3A 4FBXA 4GYGA 4FK3A 4GEOA 4TYHB 4DCAA 2UZTA 3MVHA 3QBNA 4EK6A 4GJ2A 2E9UA 4USDA 3E7VA 3P7BA 4FOCA 3IW5A 1H1QA 3EYGA 1QPJA 4ITIA 4O7SA 4GU9A 5CWZA 4A9UA 3N51A 3RJCA 3C13A 4JNWA 5IUIA 2VTAA 5B2MA 4PNIA 4F99A 4FT0A 3ZFYA 4C34A 2C47A 4F7SA 1RE8A 2HCKA 4YMJA 2WB8A 3D7ZA 3Q4CA 2PTKA 2XP2A 3HV6A 4ZIMA 3SA0A 3OD6X 3PY1A 4W8DA 3C4FA 3TWJA 4BDIA 3C4ZA 4FG7A 2XIRA 4BHNA 2C6EA 1K9AA 5DNRA 4ZSJA 3IW4A 4L45A 5K0KA 4RC4A 3CD8A 3E3BX 1DAWA 4USFA 1H00A 4YLJA 2UZEA 4BCIA 2WTKB 3AD5A 4KRCA 1GOLA 5HBJA 5KMLA 5C4KA 4QP8A 4WNOA 5BUJA 3Q6UA 4JDIA 2PUUA 3QYZA 4NM0A 3HA8A 4D4RA 4QQCA 4GL9A 3E8CA 3U6IA 3ODYX 5KMKA 5A14A 3PPZA 4NEUA 4JX3A 2ITZA 5J9ZA 3O0GA 5DE2A 4D1SA 3GENA 4ZAUA 2VTLA 3HDMA 3JS2A 4DH5A 3EQFA 3VUIA 3C0HA 5L4QA 1IAJA 3FYJX 4MKCA 1Q24A 2R64A 4DG2E 2WIPA 2UV2A 2YIWA 2YM8A 5I3OA 3OUNB 1JVPP 3KK8A 2PE1A 5CAQA 5AUUA 4J53A 4EOQA 3ENMA 5CAVA 1ZLTA 2C6LA 3MDYA 5IQFA 5JGDA 1Y8GA 2O64A 2WMWA 3CD3A 4P2KA 2ITQA 4AZVA 5FGKA 2JBOA 3TNIA 1JWHA 4QPAA 3R8LA 1URWA 4XJ0A 3IW7A 2BZIB 3FL4A 3ENHA 3MH3A 3TUBA 3COHA 3HMOA 4DFUA 1ATPE 5IQEA 1IA8A 4ZY6A 4EOKA 3FMKA 1Q8WA 2X7FA 3FI3A 4DG0E 3WF7A 2BKKA 3CC6A 4FTUA 4FKWA 4UN0C 4W4WA 3K54A 3A60A 3AT4A 4D2RA 4O1PA 5AUYA 4IEBA 4CFNA 1CKIA 4F9AA 3ZEPA 2XJ2A 3TZ9A 5CXZA 1M2PA 2RL5A 1Q8ZA 4QOXA 3EQPA 2ITWA 3MY0A 5CU3A 5TOZA 4DA5A 3G0FA 4QP4A 2VN9A 4O38A 2OSCA 1OUKA 3H3CA 3UOJA 2UZWE 3ZM4A 3TJDA 4O27B 3OBGA 3D5XA 5IH4A 3VUHA 4IQ6A 4I22A 2C0OA 1NVSA 1MRUA 2I0YA 3FHRA 3OFMA 3P4KA 4IC8A 5EI6A 3MVMA 3VBXA 3TNHA 2XIKA 1YOJA 3OOGA 2OBJA 5LXMA 5IEXA 4WRSA 4KIKA 5JGAA 2VWUA 5BVKA 4FYNA 4I6BA 2VTIA 5GINE 3DV3A 5JZNA 4BDCA 4ZLOA 3ORKA 4QTCA 4HNIA 4QP7A 3VBQA 1G8AA 4AE9A 2BAQA 4D5HA 2XBJA 3MESA 5AR7A 3PWDA 3UQCA 3ZSIA 3K3JA 3TN8A 3ZXTA 2CDZA 4YC3A 1LP4A 4H3BA 3ZSGA 4WT6A 4XG7A 3EWHA 3IS5A 4CQGA 1NW1A 4FEQA 1A48A 2J5EA 3CPCA 3DOGA 3O7LB 3HP2A 3EQHA 5FG8A 2JFLA 5A6OA 2A4LA 4JJRA 3WE4A 5A4EA 1CSNA 1IG1A 4H05A 2HENA 5CF5A 1BI8A 1KE6A 1H26A 2FSTX 3DZQA 2PVLA 3GP0A 2QHNA 4DH1A 4NU1A 5CASA 3PXKA 5CSWA 3CR0A 4HVSA 4BL1A 5HU3A 2QU6A 3AC3A 2BIYA 4QYGA 4QMLA 5AV2A 5FTGA 4Q2AA 3CBLA 3C4EA 2CLXA 4B99A 1OITA 3GCQA 2W1HA 2ZJWA 5CEIA 4RVKA 3FZSA 3Q60A 5DHJA 1OKWA 2VD5A 4PPCA 4M97A 4OTDA 2XM9A 3NUUA 5JH6A 2X6EA 3SRVB 1Y6AA 4ANNA 5J1VA 3UZTA 3AC5A 2Q0BA 3F61A 4U40A 3AMAA 5ICPA 4AF3A 1ZYCA 5BVEA 3BPRA 4HCTA 4ANMA 4ERWA 1YW2A 1JKLA 1ZOEA 5HVYA 2OH0E 3TACA 2EUFB 3MH1A 5CU6A 5E8SA 3NIZA 2VX3A 5IU2A 4PL4A 2VTMA 4BBFA 1ZY5A 4RSSA 4FSRA 3OF0A 4QMZA 3F6XA 4OTQA 4EH8A 3CGFA 2ZV7A 5AIKA 5ITAA 3PJ8A 2FGIA 3FE3A 2XRUA 2XJ0A 4AACA 5M56A 3BELA 3DBCA 1Z9XA 2HY0A 5JSMA 3I6UA 4QPMA 2PSQA 3SW4A 4PDOA 4RJ4A 3PXZA 3BX5A 4XEYA 5BMSA 5BVFA 3DBFA 4D1ZA 4O2ZA 2R3IA 4GUEA 3VIDA 4DGGA 4CG9A 3OEFX 4PY1A 4C2WA 3TKHA 2B55A 5AR5A 4LGGA 5BX0A 5ANOA 2YJRA 5E1SA 2QD9A 4S31A 3R22A 1XWSA 4ZTQA 3SOCA 1GJOA 4UWCA 2W5AA 4DH7A 4FSZA 1FQ1B 4QTDA 3TDWA 3CKXA 3TG1A 3BQRA 4GU6A 4U43A 3R9DA 1SVEA 4YJPA 5J87A 3UBDA 5IH5A 3FSFA 5D1JA 4Z55A 5FEQA 3L8VA 1PW2A 2OFVA 3Q5ZA 2GTMA 3VAPA 3ZC6A 2AC3A 2W1EA 4MTAA 1H25A 4CV8A 3S0OA 3LW0A 3KXNA 1JNKA 3FEGA 4KA3A 3MJ1A 4XV1A 4TNDA 2F2UA 3BV3A 3KN5A 3LAUA 4L00A 4EK8A 4QMNA 5HORA 5D41A 4OTWA 4QPSA 5C8MA 3LFAA 4P4CA 3FMEA 2JKMA 3QTIA 5BVOA 4FZ6A 2VTRA 2IVUA 3D0EA 5DBXA 5IH6A 3LVPA 1UA2A 5IMXA 1Q41A 5B2KA 1JKKA 2CN8A 3NNXA 1JSVA 4EH6A 1FGIA 5IZFA 4HZRA 1OECA 4GH2A 4PTGA 5I9VA 1QCFA 1KV1A 5L2WA 3EN7A 4GT5A 1FINA 2CMWA 4ZS4A 1H4LA 2R7BA 2RSVA 2XEZA 4KBKA 2J5FA 2Z7LA 3ALNA 4RIWB 4CCBA 5KHWA 2VWYA 1SZMA 3PY0A 3TV6A 4BGGA 2VX1A 4H3PA 5AUWA 3NEWA 4GT4A 5KNJA 1YHWA 4U6RA 3R1NA 3L8SA 2NRYA 5IKWA 5FDXA 1VYWA 1YWNA 2BILB 2QI8A 4TY1A 2VZ6A 2XNNA 5KBQA 1XJDA 2YCQA 3D5VA 3PG3A 4TWNA 2VNYA 2DYLA 3KVWA 3CIKA 5HX6A 2QLUA 2UW4A 5E7RA 4IFCA 1ZOHA 4MXYA 4LUDA 3F7WA 1H24A 3LQ8A 4F63A 4JIAA 5CVHA 5HIBA 3F3ZA 4EBWA 4F9BA 4IMYA 4CQEA 4ZTMA 2JIIA 5BYLA 3P08A 2YZAA 5H8BA 3KXZA 5J9LA 4FK6A 4NKAA 1Q97A 2BCJA 4MYGA 5IA4A 3W1FA 5HTBA 3UO4A 1YXVA 4X3FB 4C4JA 4FEXA 2YWPA 3ROCA 4OBOA 1ZMVA 3QUEA 3KXMA 3RINA 3ZUTA 3KULB 4FNZA 1J91A 5HESA 3RAHA 4X3FC 4RMZA 3R1YA 4BCPA 4E1ZA 2YCSA 2P4IA 1W82A 3K5UA 3UYSA 2PZIA 3FMMA 3OWLA 4TWOA 2WMSA 5L6WL 3CTHA 4QMTA 2P2IA 1YXTA 2P33A 2EU9A 3C4WA 4I5MA 4O0SA 3HDNA 4C4IA 4L44A 3EHAA 4BFMA 2DWBA 5CZIA 3IK3A 5EFQA 4G2FA 4XP3A 2WELA 3EL7A 4E4MA 3ATSA 1Q99A 2VO6A 2PVNA 3VBVA 5KKRB 2R9SA 3Q04A 4XS2A 5ETCA 5DLSA 4Z7HA 1H07A 4BYJA 2UZVA 3VF8A 4BR3A 3W2SA 4J71A 4ZJJA 4YJQA 5LJJA 4JLCA 3FXZA 4O83A 5JZJA 1XHAA 1VZOA 4HGLA 3R7IA 5KKRC 2QOHA 2VWZA 3PVWA 4ZS0A 3Q2JA 3QAME 4LQMA 3HRFA 2WZJA 4YBKA 5CTPA 3H10A 4BDEA 2GPHA 2UVYA 3KK9A 2BHHA 3R21A 4IAYA 4V0GA 4YBJA 3V5TA 5HQ0A 2YM6A 3M2WA 4XMOA 3RNYA 4AU8A 4I0SA 3SX9A 3MTFA 3THBA 1XH8A 5D9HA 3E5AA 2V5QA 4LV5A 4AN2A 1H1SA 3F5UA 4HVHA 4FI1A 5FDPA 4CKRA 1H8FA 5EYCA 3U4UA 4BTFA 3SVVA 1YI6A 4LMNA 3L1SA 3MGYA 3R73A 4E6QA 3HA6A 1JBPE 3FC2A 2C30A 4ANQA 3QQJA 3VW8A 1H27A 2IZTA 3UVPA 3NZ0A 4ZJVA 3LMHA 5FBOA 4YJRA 3UMWA 3DCVA 4L43A 2OW3A 3UQGA 5LARA 1JKTA 3CEKA 2BUJA 3E64A 3FUPA 1KOBA 4DFZE 3REPA 4PL5A 2ZM1A 2PWLA 4I5CA 4EUUA 3WZKA 2VTTA 5LMKC 4FUXA 3ZRMA 1LR4A 4IDVA 4LFIA 4O7NA 3QHRA 5J79A 1UWHA 3QQLA 2WD1A 3V5JA 3FSKA 4O0XA 3PVGA 2UVZA 4HGEA 1XH5A 4CFWA 3KN6A 3I5ZA 1ZZ2A 1YRPA 1PXNA 2GSFA 3DTWA 4U0IA 4E73A 4PDYA 4HPTE 5D12A 1OL1A 4NUSA 5DRDA 5ANIA 1FMOE 3W2CA 1GY3A 3MA3A 1G5SA 4OTIA 3C51A 2WTDA 4DHFA 5I9ZA 2NP8A 4X21A 4LV8A 4EC9A 4WSQA 4DEAA 3MW1A 3W8QA 4YNEA 3D83A 4FTRA 2VTNA 5ETAA 4QP9A 4MWHA 2E9NA 3ACJA 4K8AA 4NJ3A 3ZO3A 4FKSA 5GIOE 4FNYA 5HEZA 3HYHA 4HOKA 3EQIA 3OEZA 3EKNA 4IIRA 2IVSA 4FKJA 5ANKA 4HZSA 3ROYA 2G9XA 4D1XA 5CSXA 5G1XA 1ZZLA 3EN4A 3QKLA 5CNOA 5AFVA 2H34A 3NUNA 3UTOA 1GNGA 3RM6A 1IAHA 4M13A 2B0QA 4UV0A 4CFUA 4U44A 4YO6A 3JR1A 4FZDB 4KKEA 3LKMA 3NRMA 4E3CA 3GCUA 4UMTA 1U5QA 4OT6A 3T9TA 1H0WA 2FA2A 1H28A 3V8SA 3GCPA 4S32A 3O71A 2GS2A 4BDGA 1GIJA 2PUNA 2KTYA 2FB8A 5IDNA 5JFSA 4NW6A 4AGWA 4MD8E 5JGBA 3A62A 4EZ7A 3C0IA 4BBEA 5IEVA 4FGBA 4IVAA 2PZPA 2VWXA 5M4CA 1DS5A 4O0RA 2ETKA 4GFOA 3VUDA 3KCFA 3M42A 4CT2A 4DTKA 2GQRA 3KGAA 4I20A 3LXKA 3PIYA 3FI8A 2ZB1A 4P7EA 3TTIA 5AUVA 4ORKA 2R3GA 3TI1A 3F69A 3EFWA 5AV4A 5AWMA 3U4WA 3GBZA 4KBCA 3DKOA 2B53A 4NWMA 4KIPA 5HE2A 3ATTA 4FT3A 5ANJA 5C03A 3TZ7A 1TQMA 3BLQA 3G6GA 5I0BA 5CYIA 3D5WA 3MB6A 2ERZE 2WMQA 4IAZA 4ALVA 4F70A 2KULA 4NTTA 1YHVA 2XK6A 4I1ZA 3V8WA 3QZFA 3EZRA 3PIXA 3R2YA 3QD2B 2XF0A 5AM6A 3CE3A 4D55A 4XOZA 1P14A 4BDDA 4YSJA 2X6DA 4Q5HA 1OMWA 1UKIA 5I9XA 4TZRA 2LAVA 4NYEA 3O50A 3PSCA 2YFXA 4KSPA 5AJQA 3IPHA 3UPXA 4O0VA 1XO2B 2WTVA 3HLLA 4PP9A 4R8QA 4FSQA 5GIPE 3S4QA 3UIUA 3PUPA 4G17A 4F1OA 5EHLA 3FQEA 2ZB0A 4UY9A 4Y8DA 3U51A 3HUBA 5M55A 3U87A 2OIDA 2BRHA 3PA4A 3KRJA 3PXYA 2W9FB 4MF1A 1CM8A 4JQ8A 2OH4A 2PL0A 3SHEA 4LRJA 2PUIA 5GZ8A 2PVYA 2R3FA 3VN9A 2YM5A 4WUNA 5FLFA 3WE8A 2R3OA 4BKJA 2R0IA 4DT9A 2WAJA 2JDVA 4WBBB 3I7CA 2ITUA 2ITOA 5E90A 3EYHA 4ACGA 5A4QA 4CG8A 4R6VA 5ETIA 1VJYA 1PKGA 4WD5A 3TTJA 5E8TA 4BWXA 2C6IA 3OZ6A 4FUYA 3OCBA 3QRTA 5H3QA 4L53A 5LVLA 5IF1A 3F82A 1OZ1A 3FKOA 4FSTA 4PDSA 4EC8A 3PIZA 4H58A 3H30A 3KF7A 3FMJA 5AV0A 2GNIA 1FOTA 3VS4A 2I0VA 4O0YA 3HMNA 3AGMA 1XQZA 1S9IA 1B6CB 2V62A 1WFCA 4J98A 4NK9A 4RA4A 4XV2A 3BRBA 4FTTA 3QC9A 2UZNA 3DXQA 5JFXA 5HOAA 2RG6A 1UV5A 5A4TA 4ZTRA 4CZYB 4ITHA 4E8AA 1ZMWA 3DK7A 2IWIA 3Q4ZA 2QOLA 2OZAA 2VGPA 3I4BA 4IXPA 4PX6A 2BKZA 4R5YA 3OC1A 5EYMA 2PK9A 2QG7A 1J3HA 3O2MA 4R7HA 3ZMMA 3ZTXA 2ZV9A 3MV5A 3P1AA 4JG7A 4RJ3A 4YPSA 4JXFA 1ZXEA 2V7AA 3LJ1A 3FWQA 2AC5A 2J0IA 2PUPA 2BTRA 3DBQA 3ERKA 3KB7A 5E92A 4FZAB 4ANOA 5IISA 3VWAA 2YIQA 5HG5A 1UNLA 3LZBA 5L2SA 3IOKA 4IZ7A 5TE0A 3MFSA 4FT7A 4CRSA 4DGMA 4J96A 2J90A 2W7XA 3I7BA 3T9IA 4C58A 3DB6A 4HYHA 4DH3A 2R3KA 4MVFA 2OJGA 3R7GA 3Q9XA 4RIYB 4WG5A 3MPTA 3NYNA 2A0CX 3MFRA 3FXWA 3LJ0A 4MNEA 4XUFA 3JVRA 3BGQA 3SOAA 2GHLA 4D4VA 1REKA 4DEGA 2OU7A 2XJ1A 4YC8A 4DBXA 3DS6A 1GIHA 4AZSA 2VWBA 4CSVA 2R3QA 2H8HA 5I9WA 2DUVA 2G2IA 1ZYDA 5AP2A 4AZEA 4FV3A 2OFUA 3UVRA 3R1SA 4FG8A 5L6PA 3GB2A 4KUJA 4DH8A 4XYFA 4WNKA 4E4LA 5KBRA 1SM2A 5CEKA 1KE8A 4CYIA 1F3MC 3TZMA 4IAKA 4L42A 3S2PA 2Y6OA 4X6QC 3TXOA 2O5KA 3L9PA 4EKKA 3NNVA 1B38A 2G2FA 5EW9A 5K0XA 2ONLA 1JQHA 1RW8A 3DKCA 4E93A 5LMBA 3LFBA 3AXWA 3NSZA 4M69A 1F0QA 1SVHA 4Y46A 3GU7A 2J7TA 4ZJIA 3C4CA 4DBNA 3GC7A 3HAVA 3OCGA 5B2LA 4C35A 4GS6A 4U41A 5LWMA 4ANBA 4OTRA 3VQHA 2FVDA 1V0PA 1Y91A 4M3QA 3VHEA 2X39A 1H0VA 3R9HA 3NUYA 3Q5IA 5IQGA 4PNKA 4FIJA 4Y5HA 5J5TA 5KE0A 5DI1A 4QD6A 2JAVA 4O81A 2IW9A 2FSLX 4L6QA 1FVTA 3MY1A 4RJ5A 5B0XA 2UW8A 3UG2A 3S3IA 2Z7QA 3JY0A 5HZNA 4S30A 4G9CA 3ANRA 3QTQA 1OL2A 1I09A 3N4VA 1BX6A 2Z7RA 4Y85A 4CTBA 2NPQA 4S33A 2WKMA 2C6OA 2VO3A 3E3PA 4JR7A 3TNPC 4IB1A 4YZBA 4XBUA 3B2TA 3BHYA 4LOOA 3L9MA 2UW9A 4MEDA 4XG3A 5CZHA 4FC0A 1DAYA 4WIHA 5J95A 5TKDA 3V04A 3W2PA 3ZRLA 3D4QA 4C4GA 4U3ZA 1FVRA 1OKYA 5E8UA 5C4LA 4RBLA 3QRKA 4WO5A 3R1QA 2OK1A 4E6CA 2OJFE 1GZNA 4RIXA 5TR6A 3BYSA 3VS7A 4BCQA 5JEBA 3VRYA 4GKHA 4TYHA 4NZWB 4XOYA 1Y8YA 5C8KA 3R7VA 5GZAA 4QP6A 3MH0A 3GCSA 1SNXA 4OAVB 4P90A 3D14A 3D94A 3QA8A 2JITA 4I21A 4DITA 3CQEA 5AAEA 3ELJA 3SXSA 3NDMA 3R6XA 5JQ8A 4EH7A 3OWKA 1OBDA 3HMMA 4WG3A 3F2RA 1ZAOA 4AWIA 4UWBA 4D9UA 3R2BA 4FEWA 3GI3A 2WXVA 5KO1A 4OW8A 4MNFA 4IDTA 5KZIA 4UMQA 3IECA 2JD5A 5E8YA 2G01A 2E9OA 3W2RA 4D2VA 4X7QA 2HY81 4AAAA 4JIKA 2H9VA 3UPZA 3FDNA 4RJ6A 4IB5A 3N9XA 2OF2A 4W9WA 2B9IA 3ZXZA 4XCUA 2WTKC 2WPAA 2XYUA 3QKMA 4BIBA 1T45A 3HRBA 4XG2A 3RAWA 5HVJA 4BWPA 4AXAA 4AW1A 2XKFA 3AT3A 2BIKB 2R3LA 2IZUA 3BYUA 3FMNA 5GHVA 3TKUA 2JBPA 4F09A 5LWNA 3OW4A 5ACBC 2O0UA 4EOIA 3IONA 3IO7A 3PSDA 1OIYA 4M7IA 4RFMA 4HVIA 5M07A 4B8LA 5HG7A 1PMVA 3NW6A 1P5EA 1OIRA 4GG5A 1K2PA 3PJCA 4MBIA 5FUTA 3SKCA 3BBTB 1JLUE 4XNEA 5DR2A 3R02A 4IWPA 4KWPA 4Z9LA 4CFFA 4O96A 2BROA 2YACA 4IVBA 4BF2A 3GEQA 4ZOGA 3PLAE 3C7QA 3S95A 3RGFA 3NUSA 4ENYA 3QWJA 3I60A 3RPYA 3UG1A 4G31A 4C38A 1J7IA 4JRVA 4M66A 2VWVA 2O2UA 1M7QA 1I44A 4JBVA 1MP8A 4FEUA 2PE2A 5DFPA 2A1AB 4RX8A 3OHTA 5HCXA 4ZLYA 3K2LA 3LFSA 1T46A 4DLIA 2YJSA 3D7TB 3PXRA 3ZU7A 3TEIA 3VO3A 3VF9A 4IACA 3LPBA 3G6HA 2OKRA 4QP1A 1Z57A 4QMVA 3SDJA 2VWWA 4YURA 4V05A 5FXQA 5C1QB 2Y4IB 3JUHA 4HYUA
chains in the Genus database with same CATH superfamily
3CY2A 3O23A 2J4ZA 4RJ7A 4AA0A 4FF8A 3VULA 1XH7A 5F1ZA 5CVFA 4NM7A 3VUTA 4EL9A 2CGVA 3IKAA 2REIA 5CSVA 4F0IA 2WTWA 4IM2A 1H01A 1PYEA 2HK5A 2X4FA 4UZDA 2EXCX 1OPKA 4ITJA 5CS6A 3JY9A 4BVUA 4CXAA 2HXQA 2YCRA 3UOHA 4F1TA 3R8ZA 2PMIA 3BHVA 4HGTA 3ZYAA 4ASDA 4YLKA 4RWKA 4TN6A 3LCSA 2FSOX 3BCEA 3H0YA 3M11A 4YZCA 3PSBA 1G8KA 3PYYA 4L7SA 1W83A 3OW3A 1ST0A 3KL8A 4C36A 4P5QA 3R01A 4AT5A 4BIDA 5JQ5A 2WMTA 3IDPA 3IW8A 3PP1A 4J7BA 2PULA 4FV6A 5HHWA 2YHVA 5HO6A 3F3TA 4MWIA 3A7GA 2E9PA 4G3DA 1UWJA 4M68A 3UIBA 2OJ9A 3UZPA 4BC6A 5LOHA 4FKOA 2DQ7X 2QR8A 5JN2A 4G34A 4QYYA 3KREA 4U8ZA 3COKA 2XS0A 3FMDA 3PFQA 2F7ZE 4F6SA 3RK9A 3GC9A 2YA9A 5C9CA 2W99B 1Q8YA 5J7BA 3DB8A 2IW8A 1KOAA 3QZHA 2C0IA 1QPDA 2OJIA 3DDQA 4WNMA 5FQDC 3V5QA 2W1DA 4D2PA 1ZMUA 2YIXA 4JX7A 4E7WA 2W1IA 4AFJA 3C4XA 4ARKA 2J9MA 3RPSA 5L3AA 4NFMA 5EHYA 5JFWA 4YLLA 1WBPA 2ZMDA 3FZPA 4FTLA 2PVMA 2WHBA 4RWLA 2PZ5A 2C6TA 4R3CA 2R7IA 3ZO1A 3GXLA 3SW7A 2IJMA 4TRLA 1LEWA 1PY5A 3QGYA 4FT5A 5EI2A 1K3AA 2QHMA 4WHZA 5HBHA 1ST4A 2GNJA 3RZFA 4LDTA 3OBJA 4FT9A 4K9YA 4YZNA 3A2CA 4I0TA 4QMOA 3VW6A 1UU9A 1OGUA 4U79A 3EOCA 3CP9A 4EWQA 4HPUE 3BU3A 3HL7A 3PJ2A 4UEUA 4Y73A 5AP1A 3VHKA 2C4GA 4GFGA 3U6HA 1CMKE 1IASA 2BR1A 3D2IA 3IGOA 3TV4A 2BDJA 2ITNA 2YWVA 4EEVA 4QDEA 4QMWA 4ZY4A 1PKDA 3SRVA 4BTJA 4B8MA 4RGJA 5K9IA 3AD4A 3BLAA 4FV9A 3BZ3A 3BHUA 5AEPA 3OG7A 3ZZWA 3W0RA 3COIA 4ZY5A 3V8TA 2F4JA 5AP6A 1TQIA 4W8EA 3H9OA 1P2AA 4FTMA 1H1WA 4K0YA 5DEYA 3DBEA 4E5BA 2F7EE 1W84A 4GVJA 2UVXA 2YM4A 3OT3A 2OXYA 2GQSA 4MK0A 2YM3A 3ZDIA 2C68A 4RVTA 1XH4A 4DFYA 4FNWA 5A46A 5HGIA 1IRKA 3GCVA 3TM0A 5HO8A 4NT4A 2HZ4A 3ZC5A 3PRFA 4UALA 2B9HA 5GNKA 3V5PA 4O86A 1FMKA 1M52A 3MBLA 4G3EA 1YKRA 5T3QA 4B6LA 4PPBA 4QTBA 4WA9A 4BGQA 4EZ3A 1WVWA 1WBOA 2UZLA 2QOKA 3HZTA 3PE2A 3NYVA 4FKVA 4IWQA 3NW5A 2OGVA 4QO9A 4CD0A 4AA5A 5IUGA 2YITA 4DC2A 4J8MA 3LXLA 4GYIA 2LGCA 3OP5A 2EVAA 5CU2A 2X4ZA 4LUEA 4OTGA 5JRSA 1BMKA 4TXCA 3RWQA 4C3RA 1YWRA 2X8EA 4CMOA 4DFLA 2NNWB 2X0QA 2BFXA 3ID6C 5AUZA 3R9OA 2VTJA 2IVVA 3LXPA 3Q9ZA 4E4XA 3SG9A 2FYSA 3LM5A 4B4LA 2WMAA 3BKBA 4TKSA 5LQFA 3NS9A 3W0SA 5IQHA 3LM0A 3CJFA 2BZJA 3N4TA 4O4EA 5CNNA 4YHFA 4FL2A 4OGRA 2I0HA 2WQBA 5TT7A 1Y6BA 4EYMA 3PWYA 3WARA 4LOQA 4R1YA 4EK4A 4YJTA 1YOLA 2YIYA 4A9SA 2B4SB 2C5VA 4DDGA 1Z5MA 3CCNA 3UO6A 4YJNA 2PY3A 4QMQA 3PZEA 4NCTC 3RVGA 1U5RA 4IVDA 3DPKA 2R4BA 3CQWA 4FTNA 3HV5A 4MQ2A 5AP3A 1BKXA 1VR2A 3QZGA 4FKIA 3ALOA 3W16A 4D0WA 4EH2A 5LCJA 2ITPA 2UW5A 3JVSA 3QQKA 3K5VA 4NH1A 4QMYA 4NCTA 5C26A 5JK3A 1GZKA 3QX2A 3OOMA 4YNOA 3W18A 1JSTA 4PUZA 3IQ7A 4S34A 3W0QA 2WQMA 5FXRA 3RBWA 3AC2A 1QPCA 3K3IA 1PMNA 3CY3A 1KE9A 3NCGA 4RIWA 4TT7A 5IA5A 4BCGA 4ASEA 3HKOA 4YR8A 4E5WA 3LLTA 3QTUA 4M8TA 3R7UA 4CRLA 1XH9A 3VNTA 1XBBA 2QOCA 4ANLA 4I0RA 3ORIA 4U42A 2CGXA 1WBWA 4XH6A 3ZM9A 2XIZA 1HCLA 3PJ3A 4XV3A 3WYXA 3U8WA 4IWOA 2VWIA 2ZDTA 4PMSA 4A4LA 4BDKA 2ETRA 5EM5A 2FSMX 4ZTLA 3E8DA 4RPVA 3ZLSA 3LFDA 2WO6A 1R1WA 5I9YA 3QCYA 4J52A 4LMUA 4MD9E 4GIHA 2NRUA 4EH4A 2W5HA 3A4PA 4J8NA 3TNQB 5KMNA 4EJNA 5AUTA 5KZ0A 1Q8UA 4KD1A 3ORXA 1YI3A 2JDOA 1A06A 4FKGA 4X3FA 5EG3A 5AV1A 1OL6A 2XKEA 2BRNA 4L46A 4AN9A 1PXJA 4YTCA 3BEGA 5IG1A 3RAKA 4K77A 3KULA 3VBYA 3ZO2A 4AGDA 3NFGB 4IB3A 4UYNA 3KXXA 3HAMA 4AA4A 1TQPA 3GU5A 3IW6A 3NR9A 3I81A 5EH0A 2NO3A 1W8CA 3L8PA 4DFNA 3F2AA 3RMFA 2WMXA 3AKLA 2VV9A 4IC7A 5CXHA 4AGCA 4GCJA 4DEIA 3ZH8A 4EZ5A 4O0WA 4JAJA 5AIRA 4FV7A 4ERKA 1PXMA 2ITXA 4BTKA 3DY7A 5EW3A 3ML1A 4D9TA 2C3JA 3BL7A 4G1WA 1TZDA 2V7OA 4TYGA 3EQGA 4N6YA 4FOBA 2J0MB 3SQQA 3KMUA 4C59A 2WIHA 1V0BA 3U9NA 4Z3VA 4QNAA 4AUAA 4GG7A 1LUFA 4NW5A 3BLHA 4CYJA 3RM7A 3W32A 2QOIA 4MXCA 3KC3A 4KIOA 1PMUA 4G6LA 2O8YA 3I0OA 4G16A 3G15A 5F9EA 3HV7A 2EB2A 4O1OA 5E8WA 4UX9A 3L9LA 4LI5A 2CJMA 2X7OA 3G2FA 1PRYA 3UP7A 3DNEA 3P79A 5HG9A 4AW0A 4M67A 2XUUA 4K18A 1AD5A 2CNVA 4IWDA 5BV3A 4F64A 2QOFA 4DCEA 2Y4PA 1BYGA 3RPOA 2IW6A 4BB4A 4DGNA 5DT4A 5K4JA 2XANA 3ZBFA 4D58A 4O7WA 2PE0A 4UMRA 1Y57A 3DKGA 3BWFA 4GIIA 3O17A 3QHWA 5CVGA 3G0EA 3EH9A 5HTCA 2XNMA 3MN3A 3A7IA 1GIIA 4M0ZA 5DA3A 4CZTA 1OKVA 3OCSA 5A4LA 2XK3A 3DZOA 4JBOA 1ND4A 3V6RA 3QX4A 4FKRA 5DN3A 5LMKA 1W98A 4YZMA 3QA0A 2V55A 3EQRA 2HZ0A 2XKCA 5DR9A 5C01A 2WQNA 3R8MA 4BCFA 4CZUA 2I40A 4DG3E 4LGHA 5EHOA 4J97A 3GOPA 4ZSGA 4F7NA 5L6OA 5M4FA 3W0OA 3C5UA 3O7LD 4AZFA 4BZOA 3WF8A 2Z2WA 2CKQA 3QL8A 2R2PA 5EYDA 3S1HA 4H1JA 5J9YA 4YO4A 4O7YA 3MWUA 1SMHA 2RF9A 4O7ZA 3QUPA 4RVLA 2R3NA 3W10A 5EDPA 4L8MA 2YERA 3QKKA 3QQFA 2WOTA 4TNBA 3Q4UA 4C62A 3SXRA 3N4UA 2HW7A 4BI0A 4IVCA 4U97A 4KAOA 4KS8A 3FKNA 3QCXA 2XNPA 4C2VA 5KX8A 1M14A 3NUAA 2PHKA 2SRCA 1Q62A 2ACXA 4E5AX 4XG6A 1OUYA 2JDSA 4DTAA 3QC4A 3H9FA 4NIFB 1J7UA 3H4JA 4BDFA 3ZLWA 4EWHA 1FPUA 2X9EA 3PG1A 4AFEA 3I5NA 3U6JA 4AS0A 4O22A 4ZLZA 1PXOA 2CKPA 2YM7A 4JG8A 3QALE 3EN6A 4X2GA 4AOJA 1U54B 2C6DA 4AQCA 2I6LA 5FXSA 3TUCA 2XMYA 4J95A 4C4FA 3W55A 4UXQA 4C02A 5IEYA 5M51A 2O3PA 5FEDA 4PPAA 4X2KA 4YUQA 3FJQE 4AQKA 1OB3A 5BYYA 4B0GA 4NL0A 5M08A 5CSHA 3RHKA 5DWRA 4FGRA 4BCNA 5BVDA 2X1NA 3HGKA 2X8IA 4FSWA 3UNKA 1APME 1BLXA 4W4YA 5DMZA 4M14A 4ASZA 2G2HA 4FICA 4CVAA 2OZOA 4FV5A 3ZFXA 3OY1A 1YOMA 4IM0A 2XB7A 4MBJA 4YGAA 3FLSA 5FTQA 3IDBA 2C5NA 3GQLA 3BE2A 2OICA 5IQIA 2WTIA 2Y9QA 3VS1A 4GUBA 4C37A 2JIVA 3TNWA 4IW0A 4ACDA 4FJVA 3Q2MA 4O7RA 3P0MA 4BZNA 4I6HA 1LPUA 2GDOA 4UBAA 4CV9A 4RWJA 4XP0A 4C8BA 4Z7GA 1V0OA 3QTXA 4AP7A 1YI4A 1WAKA 2BRGA 4FNXA 4IFGA 4C57A 5AP4A 1U59A 3KA0A 3HP5A 3PXFA 3LFCA 2Y0AA 5ANDA 3LMIA 1XKKA 3W2OA 2QLQA 2V22A 3AC4A 3UGCA 4FTOA 2XNOA 5AP7A 3V6SA 4YTHA 1ZRZA 5D7AA 3ZUVA 3QD4A 5G6VA 3ZUUA 5CSPA 5K5XA 4YJSA 3CSVA 3OWPA 3RALA 5BYZA 4D2TA 5EDRA 3O8PA 3POZA 4EOSA 2YLEA 4KKGA 4O0UA 4RLKA 3EQDA 4FTJA 3QCQA 4AW5A 4F7JA 4DEBA 1PF8A 4JDKA 3TL8A 2JDTA 4L01A 4B7TA 5M44A 3ZLXA 1Q61A 2YAAA 3O8UA 4QMSA 2BZHB 3KVXA 4F9WA 4HCVA 5AR3A 1CTPE 4RC3A 3GT8A 3AMBA 3DFCB 4A4XA 4X2JA 1DI8A 4R1VA 2ZOQA 3HECA 3OTVA 4LL0A 4F0GA 3ZO4A 1CKJA 2RFEA 4WUAA 5E9EA 3EMGA 3PTGA 3R00A 3UYTA 4DYMA 3OUKA 2XK8A 2BRBA 1PXIA 4O4FA 3FKLA 4GRBA 4S2ZA 4BJJB 2R3HA 3F5XA 1UKHA 1WCCA 4QTAA 4KBAA 4QMXA 5F20A 5HBEA 3TJCA 4AX8A 2YN8A 3FY0A 1OPLA 4F08A 2WQEA 2OIQA 4YJUA 3EFKA 5TF9A 3C1XA 3KQ7A 5HE1A 5CEPA 5IQCA 1M17A 4BICA 3RKBA 4EI4A 4FR4A 5AM7A 3MA6A 4D5KA 4RRVA 3GU8A 3QZIA 2W4JA 2ZMCA 3U9CA 4GKIA 1OBGA 2JKOA 2F9GA 2JDRA 3F88A 1UNHA 3NPCA 4HGSA 3UIXA 4ALWA 5CT7A 3HEGA 3QTRA 2W96B 4BYIA 4GK3A 3LMGA 1H1PA 3RCDA 5IQDA 3DK6A 2PMLX 4FV0A 4AW2A 3R71A 4A07A 4JI9A 5DIAA 4QMMA 2C1BA 4ZMFA 3DBDA 4L67A 5H9BA 2QODA 3IOPA 3PJ1A 4IZ5A 3E88A 2BVAA 4I92A 4J99A 4WRGA 5CF8A 3BYOA 3QTZA 5ANGA 4CGAA 3FI4A 4FVPA 4N0SA 2JEDA 1SYKA 5HE0A 4UZHA 3UDTA 2VGOA 3NVKI 3PDTA 3LQ5A 4FV2A 5E4HA 3EKKA 4ZZNA 2OXXA 1E1XA 3CJGA 4DFBA 3COMA 3QXOA 3MIYA 3Q53A 5DG5A 5CALA 1VEBA 5EQYA 5HI2A 1SNUA 2ETMA 1H08A 3QTSA 2J6MA 1KWPA 1W2FA 4ZTSA 5M4UA 3QLGA 4RT7A 4TW9A 3D15A 4C3PA 4G6NA 3WILA 2JC6A 4FV1A 4I94A 2HWOA 4RIYA 5DR6A 2XK4A 4G3CA 2XRWA 4YSMA 4CLIA 4EYJA 4I6QA 5AA8A 4QMUA 1QMZA 1JSUA 4BRXA 3LJ2A 4FSUA 3OROA 3DDPA 1PMEA 3AKJA 2VTSA 4BY9E 3UODA 4JVGA 3CLYA 3V51A 5IQAA 4EHVA 3BGZA 4IE9A 4BBMA 2UW6A 5EKNA 3AG9A 4C3FA 3MPAA 5GJGA 1A9UA 1KSWA 3Q52A 5AX3A 4AT4A 1MUOA 4MCVA 1L8TA 4MXXA 3D2KA 4XRJA 2G15A 4W4VA 1M2RA 5L8LA 2CNQA 5EDQA 1MQBA 2CN5A 4F78A 1ERKA 3DAJA 4XG8A 4YZ9A 4YJOA 2IN6A 5CEQA 5FD2A 4X3JA 3QQHA 2EWAA 3DNDA 2PPQA 4AE6A 5BMMA 3GNIB 1PXKA 4O6EA 4XHKB 4L7FA 4DFXE 3ORTA 4JMQA 3TYKA 2XCHA 4MX9A 5DEWA 2WMVA 3KCKA 1CDKA 4UMPA 4HJOA 5AV3A 3R04A 3W8LA 4XV9A 2Y7JA 2HZNA 2UZUE 3Q9YA 3F9NA 5CY3A 4C4HA 2EXMA 1XH6A 3O96A 2WFYA 1ZY4A 4BI2A 1XR1A 4I4FA 5IUHA 2JAMA 2EB3A 4L52A 4FEVA 4C33A 4O7VA 3NNUA 4M15A 3V01A 1PXLA 5EM7A 1R0PA 4FKQA 1O6KA 5I9UA 5F95A 1V1KA 3PZHA 3G90X 2CPKE 3NVMB 3HMIA 3D9VA 3GOKA 5T68A 3PA3A 1YQJA 1JAMA 5C8NA 4RJ8A 4ACMA 4F6UA 5FM3A 4BCHA 1PHKA 2QO2A 2P2HA 5HNIX 5DPVA 3MB7A 4EHZA 1TKIA 4ZSLA 3FPQA 2V0DA 4HVDA 1J1BA 2VTQA 3R9RA 3MFUA 4OBPA 4D28A 2BAJA 4IH8A 4XG9A 4FVQA 3QQGA 4FKLA 4RQKA 5D10A 4HYIA 3R9NA 1PXPA 2YIRA 3IG7A 3W33A 2VTOA 4QQ5A 3ZCLA 4PMPA 3ODZX 4O0TA 3NWWA 3FZOA 4GSBA 3T3VA 2W1ZA 3L9NA 4PDPA 5EYKA 1WBNA 1UU3A 3A7FA 3VUMA 5HTIA 3ORNA 1NVQA 4IZYA 3VQUA 1M7NA 1W2DA 2OJJA 4EQMA 5B7VA 4X2NA 4MXAA 3A8WA 2QOOA 4DEHA 4WG4A 3ZBXA 4MUQA 1OPJA 2IG7A 1NVRA 4RFYA 1YVJA 3MI9A 1ZYJA 1STCE 4I23A 1BI7A 4K33A 2OO8X 1ZARA 2RKUA 4NM3A 4QYHA 1QPEA 3RZBA 4EK5A 2XYNA 3WZEA 5FWKK 3FLQA 4UWYA 3SAYA 4TWCA 4AZTA 4C0TA 2W9ZB 4U7ZA 2A19B 3LCKA 2HWPA 5A3XA 4A9TA 3GC0A 2PU8A 3Q96A 5BPYA 3LE6A 3H0ZA 3KF4A 4QQTA 2ZAZA 2IZRA 4FTAA 3FLNC 5DRBA 2C3KA 2Q0NA 5D11A 4EHEA 2XIXA 4XLIA 4EUTA 3AC8A 4I24A 3SXFA 2YISA 4FIGA 3FLYA 2CKEA 1MRYA 4R7BA 3BU6A 5DYJA 1OL5A 3MH2A 2A27A 2W0JA 1O9UA 5E1EA 3C50A 4MF0A 4CKJA 5J1WA 2FH9A 4JG6A 3NFFB 4PTCA 4OTPA 4M0YA 4MXZA 4ZXTA 5IDPA 5DVRA 5CEOA 1KUTA 4CFMA 2IO6A 4DE4A 3D7TA 3OVVA 3A8XA 2Y4IC 1AQ1A 2H96A 4L3PA 5IPJA 3DLSA 5AR4A 3ACKA 4II5A 2F49A 3ZHPC 4RC2A 2QKRA 4J1RA 4MHAA 4Y95A 1YXXA 5IA1A 5JRQA 4DEEA 2BHEA 1TVOA 3DXPA 3QRIA 4PTEA 3VS5A 3VONA 3AT2A 3PVBA 3WZJA 1YWVA 2YAKA 5FP5A 3ZS5A 2J50A 4JT3A 4CEGA 2C6MA 4EORA 3G9NA 4O7LA 3ORMA 4GK4A 3G5DA 3R7EA 3SGCA 3EZVA 4RZVA 2C5XA 3RCJA 2VRXA 3VS0A 3HUCA 5LCKA 1G8SA 4GK2A 3QU0A 5E8VA 2ITVA 4KIKB 4WSYA 4JOAA 2GCDA 5EM6A 1KE7A 2RG5A 3BE9A 3LFQA 5HNBA 4E6AA 5BVNA 3Q6WA 3RPVA 4G9RA 1XBAA 2X9FA 3PVUA 3UC4A 4BDJA 5HLNA 3OCTA 2BDWA 3ZOSA 4JBQA 1R3CA 2F2CB 1O6YA 2WTCA 4BDHA 2JFMA 3FXXA 2B1PA 2XEYA 3LLAA 2H6DA 3CTQA 3P78A 5GJDA 1RDQE 1UU7A 5AAFA 5AP5A 4A9RA 2O65A 4CLJA 5M57A 3QF9A 4YHTA 3E87A 4HNFA 3WZDA 4IBMA 5HNGA 3LXNA 4IX4A 2WOUA 5BVWA 4CTCA 5CF4A 2YZLA 4YP8A 2XM8A 4GW8A 3WF9A 3C5IA 5KCVA 2CGUA 3FZTA 3DJ6A 3QGWA 2AYPA 3QRUA 2B9JA 2C1AA 4BCKA 1URCA 3KU2A 4IAFA 4ZSEA 3FAAA 3KMMA 4OUCA 4RZWA 4U80A 3DJ7A 2RFDA 2YABA 3H9RA 4KKHA 2I1MA 3NW7A 3A61A 5CAUA 4LRMA 3VS3A 1TFFA 2ESMA 3PLSA 5EQEA 2ZV2A 5E8ZA 2PVRA 4IX5A 2OI4X 2VTPA 1FBNA 5E91A 2WU6A 3JXWA 4OLIA 2OWBA 3LCOA 4K2RA 1NT2A 3OWJA 3DQWA 5AR8A 5A6NA 4MQ1A 1NY3A 2GS6A 3ZONA 2C5OA 3E8NA 4QT1A 5H2UA 4FVRA 1PJKA 2GTNA 1ZOGA 3EQCA 4U9AA 4DDIA 3BYMA 3FMHA 3NX8A 2F7XE 5J8IA 5KMMA 3UO5A 3UE4A 3ZDUA 4EQUA 2GNLA 4GVAA 5K3YA 2XALA 3UQFA 2XAOA 2IZSA 5GJFA 3VUKA 4G5PA 5HD4A 4BCOA 2IPXA 3HVCA 4BZDA 4CFXA 3AC1A 3OXZA 4FKPA 1FVVA 2HZIA 3BBWA 5EK7A 3FI2A 2UZOA 4IX3A 4ACCA 3I0QA 3OT8A 2QR7A 4KNBA 3AMYA 3RK7A 3RP9A 2X2LA 5LMAA 2QKWB 3JPVA 4L3LA 4JBPA 5L2TA 1GAGA 4FSYA 5I3RA 3FY2A 3PA5A 4YHJA 3DA6A 5CU4A 2PYWA 4U81A 2XIYA 3CPBA 3ZRKA 3LCTA 4DGOA 3C0GA 5FTOA 3MS9A 2P3GX 3TDVA 4ZMEA 3PE1A 4A9YA 3ORPA 1E9HA 4EHGA 3DKFA 3QWKA 4FG9A 2BTSA 5LVPA 2ERKA 3NLBA 3NYOA 2Y6MA 3F2NA 4DT8A 5A9UA 1ZWSA 4F65A 3HV4A 2OIBA 2ITTA 1OL7A 3BLRA 1OVEA 3F3WA 3FMLA 4ONAA 3F7ZA 2QG5A 1MRVA 2QOQA 5JT2A 3A7JA 1J1CA 2BALA 4YU2A 3FZ1A 2RFSA 3QD3A 3LIJA 3HNGA 1R78A 1RQQA 2G1TA 4MAOA 4CFVA 2HXLA 4O4BB 3LFNA 1YXSA 2HOGA 2UUEA 2A2AA 3MYGA 5FM2A 5KMIA 1ZYSA 3O8TA 2WMRA 3U55A 2RIOA 4G3FA 4ENXA 4FTIA 4O7TA 3NMUF 2GS7A 2PZYA 5HX8A 1Q4LA 3CTJA 2P55A 5IQBA 5F94A 2XBAA 3T3UA 4KSQA 2XH5A 5EKOA 2W05A 5LVOA 4DTBA 3P23A 4I5HA 1BL7A 4MD7E 3BEAA 2XNGA 3R63A 4O2PA 4V01A 2J0JA 4TYJA 2CSNA 3VVHA 1IEPA 2GFSA 2W1GA 4AOTA 4D0XA 2WU7A 2QO9A 2R3JA 2XA4A 3TKIA 3TT0A 3DT1A 4W4XA 4F9CA 2WNTA 2ZDUA 3EN5A 4AXFA 3AQVA 5TO8A 1XBCA 5HIDA 4AT3A 3FBVA 3BGPA 2Y8OA 1JKSA 1JPAA 4KB8A 1E1VA 4ANSA 4YPDA 3UOLA 5DGZA 4EOJA 3QLFA 3TIYA 4F4PA 1FGKA 2HIWA 2BAKA 3RI1A 4Z16A 1QL6A 1VLRA 4HW7A 5A4CA 5BNJA 3B8QA 4FKUA 3EFJA 4HVGA 4H39A 3BWJA 2BZKB 3FQHA 4XP2A 4OBQA 5HE3A 5CT0A 4RFZA 3MSSA 3GFEA 3OY3A 4GT3A 4H36A 4LGDA 5AUXA 5HVKA 5IMEA 5CQUA 4QQJA 4R7IA 1HOWA 2XCKA 2VX0A 3DLZA 2PVHA 3UC3A 4DF3A 2I7QA 4K1BA 3UP2A 4GV1A 5I5ZA 4O4DA 4BN1A 3MVJA 3UDBA 4FIFA 4RX9A 4RX5A 2A98A 4UB7A 1W7HA 4LM5A 3VJNA 3MFTA 4FA2A 3VC4A 4JS8A 3KRXA 2O63A 4YC6A 3F5PA 4WNPA 2XNBA 3RK5A 2BRMA 4ZK5A 2JKQA 2OF4A 4I41A 1U46A 5L8JA 4IX6A 5HCYA 5J7HA 2GNGA 5JMSA 4E20A 3DJ5A 2QO7A 3UIMA 4FMQA 2E2BA 3DAKA 3FC1X 4EKLA 2C6KA 4O6LA 2X8DA 5CI6A 3CQUA 4L9IA 4EOMA 4RQVA 4FIHA 4I6FA 4QYFA 4Y72A 3GFWA 3WI6A 1WZYA 3BHHA 1S9JA 3NIEA 4RWIA 3B2WA 4WOVA 2WEVA 4OTHA 2WGJA 4PMTA 2BPMA 2OXDA 3WF6A 4ALUA 4E26A 3SV0A 3EL8A 5ACKA 1Q3WA 4X0MA 4O4CA 2ZV8A 4FL1A 5A54A 4W9XA 4IZAA 4M12A 5KMJA 2B54A 2X2KA 3ITZA 2B9FA 5H8GA 2P0CA 5EM8A 5AA9A 1G8JA 5AP0A 4M84A 5FEEA 2IVTA 1KV2A 1YDTE 4FV4A 3FLWA 1WBTA 3AD6A 5KUPA 2YLFA 3HMPA 4RLLA 4N70A 4G6OA 2PMOX 4ZZMA 4AOIA 3MTLA 4RA5A 3EB0A 4F7LA 3P7CA 2RFNA 4AXDA 4KRDA 4BHZA 3BQCA 3FLZA 4V0GB 4AGUA 4QP3A 4IANA 3ULIA 3NAXA 4V04A 3ORZA 3DU8A 4D2WA 4CMUA 2GNHA 5M53A 3V5WA 4DAWA 2WQOA 2CCIA 1OI9A 3FPMA 3RHXA 3CKWA 3HV3A 2UW3A 3R8UA 4AG8A 1OIUA 2ZM4A 2BDFA 3GVUA 3W2QA 4JQEA 4BGHA 4FSMA 3Q32A 4EBVA 2QOBA 3QYWA 3FYKX 3KRWA 4NSTA 5LVNA 4GMYA 2YDKA 2EXEA 3C9WA 4EH3A 2JKKA 3UNJA 3MIAA 2JLDA 4OT5A 3F5GA 4BDBA 4N4SA 2QNJA 3ZSHA 4XG4A 5AAGA 2HELA 4QNYA 2FUMA 4I3ZA 5HO7A 4FE2A 4F0FA 2PVKA 3WOWA 4PV0A 5K5NA 3I79A 3R7OA 5ANEA 4A06A 4QYEA 4RX7A 4U3YA 3MJ2A 4IJ9A 4BIEA 3UDSA 4GFMA 4EOOA 3E62A 2WMBA 1GZOA 3EQBA 5HU9A 5M09A 3V3VA 4IAAA 1IA9A 4PRJA 2UZDA 3RTPA 3VUGA 4TYIA 3WYYA 5FP6A 3VRZA 1M2QA 4KIQA 5DOSA 1WBSA 4PWNA 3VBWA 3NNWA 4I93A 3TIZA 2WMUA 5AADA 2YDJA 5EW8A 5JKGA 4N57A 4TYEA 5AX9A 3PPKA 4FV8A 4R3RA 1O6LA 4H3QA 4JDJA 3WBLA 4APCA 4U5JA 2CLQA 4I4EA 3NGAA 3PY3A 4CMTA 4EJ7A 3FZRA 4P5ZA 4JRNA 4TPTA 5HG8A 3R7YA 4Q9SA 3P9JA 4BKYA 4FTKA 2XK9A 3DFAA 5EOLA 3G9LX 5CF6A 5L2QA 4D4YA 3R0TA 4YTFA 3B8RA 3BV2A 3QFVA 4EOPA 5EI8A 2GU8A 1P4OA 4K6ZA 4EH5A 2W5BA 4UXLA 3PP0A 3A4OX 3FHIA 4QTEA 5LVMA 5F4NA 2B52A 4ASXA 1Q5KA 2QC6A 2W1FA 2X7GA 2GNFA 3G51A 2ZM3A 3L8XA 4LRKA 4Y5QA 4F9YA 4MXOA 1WBVA 4G3GA 4IB0A 4XLVA 2VO0A 1B39A 2QVSE 3O5AA 1R39A 5L2IA 3AOXA 3QD0A 4DEDA 3EIDA 3RPRA