3KULB

Kinase domain of human ephrin type-a receptor 8 (epha8)
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
273
structure length
271
Chain Sequence
TREIEASRIHIEKIIGSGDSGEVCYGRLRVPGQRDVPVAIKALKAGYTERQRRDFLSEASIMGQFDHPNIIRLEGVVTRGRLAMIVTEYMENGSLDTFLRTHDGQFTIMQLVGMLRGVGAGMRYLSDLGYVHRDLAARNVLVDSNLVCKVSDFGLSRVLEDDPDAATTGGKIPIRWTAPEAIAFRTFSSASDVWSFGVVMWEVLAYGERPYWNMTNRDVISSVEEGYRLPAPMGCPHALHQLMLDCWHKDRAQRPRFSQIVSVLDALIRSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ephrin type-A receptor 8
publication title Kinase Domain of Human Ephrin Type-A Receptor 8 (Epha8)
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 83
structure length 271
sequence length 273
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2009-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3kulB02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3kulB01
4KIKB 2BFXA 2PPQA 3C7QA 4QMLA 3OXIA 2ZMCA 4PDSA 2EB3A 4QPAA 5I9YA 2YCQA 4F6UA 1FMKA 2VWZA 3LJ1A 2YIYA 4Q9SA 4KD1A 3SX9A 4DGLC 1W98A 3PY3A 4LGHA 3TNPC 4PNIA 3Q60A 5AA9A 2R4BA 3FMJA 2GNFA 3WYYA 3CPBA 3FI2A 4J7BA 2BIYA 4QOXA 3MESA 3IW8A 4IDTA 3UDBA 1XQZA 3EHAA 2YAKA 1K2PA 2B9HA 4HGTA 5C26A 2X7OA 3RHXA 3DTCA 5CLPA 4FEUA 4NU1A 3QTSA 4XX9A 3GU8A 2YAAA 5CI6A 1ZARA 2VNWA 1K3AA 4J96A 5AP5A 5EI2A 5EW3A 5TO8A 4NM3A 4XG7A 1M17A 4I6QA 4RA5A 2YABA 1GIJA 3MI9A 2RKUA 4AGUA 4ANOA 2C4GA 3NYNA 5CWZA 5EFQA 1W83A 2C6DA 4LI5A 3FBVA 1RE8A 3ZCLA 3K3JA 3NAYA 4IWQA 4L7SA 5EQYA 2XK9A 4C36A 4IM0A 1WBSA 4MQ2A 5A46A 3R8ZA 4DA5A 2XA4A 2YCSA 5TR6A 5HBJA 3LCOA 3MWUA 2OXYA 2WKMA 4QTAA 2R0IA 3R8LA 3QXPA 3AC8A 4IH8A 3T9IA 2Y9QA 2YZAA 2CNVA 3OF0A 4FF8A 4XP0A 5HVJA 2XKEA 3R21A 1F0QA 2OJ9A 2VZ6A 3EN4A 4GFGA 3BEAA 4IAKA 4QYEA 4MNEB 3O7LB 5EDRA 2PVKA 2Q0BA 4I6HA 3LFAA 2R3OA 5D10A 3BQCA 3KXZA 4S33A 5HG9A 5HO7A 3O8UA 2GHMA 4I0RA 4UB7A 2C6OA 4B0GA 5IMXA 2X39A 4YJRA 4O7TA 2PMNX 2PVFA 2FSOX 3CD3A 3HX4A 3WF9A 5LVLA 4CFFA 3NMUF 2HK5A 3CD8A 4FKUA 3PIZA 2GU8A 2ONLC 4FA2A 4RX9A 5AR5A 3ENMA 3Q4CA 2X6DA 2UW8A 4FTCA 4USEA 5F9EA 1WZYA 4FZFB 2X2KA 4O6LA 2V7AA 5IQIA 3ZC6A 1H1PA 1ZZ2A 1H28A 4APPA 4KNBA 3UG2A 1YXSA 4JT3A 4E6DA 5BVFA 3LLTA 2CKEA 4NJ3A 4BKJA 5D41A 4TL0A 1W8CA 3EQHA 2C3IB 2HY81 2JKKA 3LFFA 3O96A 3UMWA 4CLIA 5BUIA 3HUCA 3Q04A 2WOTA 3THBA 4TN6A 3UO6A 4HPTE 4BGGA 4O1PA 5B7VA 2DS1A 2J0MB 2R7IA 4ACCA 4L42A 4TZRA 4XEYA 4BZDA 3DKGA 3PJ1A 5AP4A 3TWJA 2VGOA 3RCDA 1KE8A 3EWHA 1KE5A 2QOBA 4DH1A 3LVPA 2OICA 3HAMA 2B52A 3PWDA 1OVEA 5DT4A 3I60A 2ITPA 1JKLA 3PFQA 5CU6A 4N6ZA 3VWAA 3HYHA 4CFNA 2GTNA 4GJ3A 1G8SA 4I41A 2YM4A 3Q6UA 3JPVA 3C4FA 4JNWA 2IZUA 4LV8A 5FDPA 4IZYA 3MIYA 4I5HA 4EYMA 5CVFA 3O51A 1OM1A 4IB3A 5AUYA 5AR2A 3EZVA 5AP7A 1UKIA 1H0VA 3CGFA 3H3CA 1GIIA 5TF9A 5A4TA 4EZ3A 2PSQA 3OTUA 4YZBA 2IG7A 3QQKA 3POZA 1WBTA 4LGGA 3VUDA 5CAVA 4CQGA 1WVYA 3LFSA 3L9PA 5KMLA 3U55A 5ANOA 5IMEA 5IA5A 2ERKA 5HBEA 2UZLA 3H4JA 4DTAA 5KKRC 3SOCA 3Q32A 2EXEA 2ZV9A 3R01A 1OKYA 4PQNA 5CU0A 2XMYA 4A9UA 4X6QC 3UE4A 2QI8A 4KS7A 3VUMA 3R1YA 5CX9A 3QZHA 3HUBA 5FXSA 5KUPA 3DKOA 5GZ9A 3UQFA 3EQGA 5DNRA 4LMNA 4YJPA 4NTSA 2G2IA 2Q0NA 3FMMA 4DGMA 4ZSGA 4AP7A 3QQJA 2IO6A 3QXOA 4FI1A 5BMMA 4XV9A 3LXLA 2YZLA 4X3FC 4WNKA 1JVPP 1YOLA 2JLDA 3BI6A 3DZOA 3WARA 2YM3A 4WBBB 5IA2A 5C4LA 3F3UA 4JRVA 5DOSA 4D2VA 3R7UA 5EDPA 4CRSA 4YPSA 4WUAA 4BDJA 4U80A 4P7EA 3FMNA 3NYXA 2Z7RA 4JDJA 4MCVA 2Z02A 4EOOA 3C51A 4NCTC 3R28A 4ASEA 2RFSA 5E8VA 4HVGA 2ZM1A 3L8XA 4DLJA 4TPTA 5JFSA 3O50A 1DI8A 2B1PA 2XB7A 3HDNA 3MTLA 1XJDA 4L7FA 5JN2A 3ORMA 4E6CA 4WOVA 2C6TA 4ZMFA 5B2LA 4EH6A 4Y8DA 3DB8A 4D58A 2OH0E 3ZXTA 3ZLSA 3IG7A 4PPAA 2W5AA 4FZAB 4DGNA 2XCKA 5AX9A 1NXKA 4DFXE 3TNHA 4AG8A 2CN8A 4NFNA 5CSHA 2HWOA 2ZVAA 2X9EA 2G1TA 3PE1A 3OTVA 5HX8A 5C9CA 5KBQA 3FZ1A 1DS5A 3NZ0A 4PTEA 4FNZA 2QODA 3AD6A 5M55A 3V3VA 4DFZE 5CSPA 5KHXA 3AXWA 5J9LA 4P5ZA 3F69A 4JBQA 1U54B 3RKBA 3ZM9A 3Q53A 3R71A 2XNEA 4FTJA 4H58A 2VU3A 2OSCA 2XK8A 3PJ2A 4LQMA 4FVPA 4Z16A 3OT3A 4W4WA 3W55A 3NNWA 2PMOX 5J7HA 2VTRA 4CCBA 3MY1A 5BNJA 2ITXA 4MEDA 3NUUA 2J0LA 3E87A 2GNJA 5HG5A 4IHPA 5BQ0A 1IR3A 4J95A 1H01A 4BCFA 3KEXA 4AW5A 2XM8A 3CLYA 3ZSGA 3TTIA 5E9EA 5BUEA 3IDBA 3LIJA 2Y4IB 4RJ7A 4TYIA 5EH0A 3R9HA 4OAVB 1OBGA 2CNQA 2CGWA 1OPJA 1P14A 2WMBA 4EJNA 2BZHB 3FQEA 3PA4A 4YHJA 2R3NA 2E2BA 5HOAA 3SQQA 2WEIA 4FKLA 3V8TA 3S00A 4FTAA 4I5MA 2XNBA 3D5UA 5C8MA 3BV2A 3FZOA 3KK9A 3NAXA 4MXZA 4YP8A 4R5YA 3Q4ZA 4GRBA 5C8NA 4W4XA 5CEPA 5HORA 3HV5A 3K3IA 3TNIA 4ZLYA 5M56A 3PVUA 4MTAA 2C5OA 2JDOA 1BLXA 1GZKA 3DA6A 3N4UA 2ONLA 3BRBA 3ENHA 4U97A 1VZOA 4K8AA 5J8IA 3RZBA 1APME 2GFSA 2ZAZA 4QT1A 2IVSA 2PZRA 5J79A 4G1WA 3R02A 5HVKA 3GC8A 3ZLYA 4FEQA 5JK3A 2C30A 3MVHA 3MBLA 4QMOA 4HCTA 2X7GA 4FC0A 4NM5A 4RJ3A 4QD6A 3Q5IA 4B6LA 4F65A 4XNEA 2WTIA 1ZZLA 3I7CA 4L52A 3IDCA 2WTWA 4AA4A 2VTAA 4PMTA 3VBQA 2WQOA 4RJ8A 3W32A 1YI3A 3SW7A 1U5RA 3KL8A 4MAOA 3C1XA 2W4JA 2XCHA 3Q96A 4FV5A 2VTNA 5AP3A 1PKDA 4DEGA 3TV7A 5E8UA 4R3PA 3UIBA 1W7HA 4FIIA 4DH8A 4I92A 5L4QA 4LL0A 4FKSA 4OT6A 5HNBA 1OIYA 5IKWA 1BYGA 4G17A 3UNZA 4D2PA 4YC8A 4FSTA 3G9NA 5FQDC 4B8MA 3SAYA 2JAMA 3DJ7A 3LW0A 4L6QA 1ZYDA 4J8NA 5HD4A 3EJ1A 4N70A 3V5JA 3SA0A 5CXZA 4PL3A 3JVRA 4X6RA 4JG8A 4XRJA 4QMNA 4X0MA 4ALUA 4C4JA 4G34A 4BC6A 3O8PA 3PXZA 4GK3A 3LCKA 2I0YA 5FEQA 1J7IA 3LZBA 4FMQA 4O0XA 3DNEA 4JQ7A 2PE0A 4FSMA 4QYGA 2WU7A 2YWVA 4K2RA 4FSQA 4YJSA 4JDKA 4BDBA 2WQBA 4C2WA 4GMYA 3W1FA 3TACA 2WTDA 3V01A 1PYEA 4XBRA 4XV3A 3A7JA 1YI4A 4HJOA 4I1ZA 2KULA 3WBLA 4D2TA 2YA9A 4JIKA 4BTMA 3G0FA 3V5TA 3U9CA 3VJOA 4DTKA 5JFWA 3F3TA 3EB0A 4UWYA 4YSJA 1Z9XA 3PRIA 3QAME 3II5A 4QP9A 1Q62A 4YLJA 2NNWB 1QPJA 2YIWA 2W5BA 3BHVA 5E8SA 3UYTA 5FXQA 4BI0A 4RVMA 2OGVA 1YKRA 2G9XA 4EOSA 3F3VA 3UC4A 3K54A 5L6PA 4JS8A 3SGCA 3D2IA 3BU5A 1JKSA 3EL7A 4DT9A 4FSYA 4KBKA 4ANLA 3RNYA 3UIXA 4EOMA 3DS6A 4GJ2A 4PNKA 5HTBA 4FIJA 2GNLA 2UW5A 4X3FA 2PVRA 3WF6A 3G2FA 4JDHA 2A4LA 2QOCA 4DFYA 4OAUC 2UV2A 1NT2A 5FD2A 1R0PA 1WBVA 2ITTA 1REJA 3ETAA 5DGZA 3QUPA 4FGRA 4C35A 5KZIA 4BI1A 4DEDA 5DEYA 1Q24A 5AUZA 2JGZA 2W99B 4FKOA 1YQJA 2J9MA 4FUXA 2BZIB 1SZMA 3FKNA 4EC8A 3OEFX 5IF1A 3AT2A 4L3JA 4NCTA 2ETMA 2YEXA 4ARKA 4YHTA 4BFMA 3R30A 1UNGA 3S3IA 2PTKA 3EN9A 4D1XA 5J9ZA 4CYJA 2P2IA 1LPUA 2PMLX 4IX3A 4AAAA 2J6MA 3PXFA 3TKUA 2OJIA 4NH1A 2QLQA 4X7QA 5H3QA 5JGBA 3GU5A 3BWJA 4DEAA 2XKFA 3E5AA 3DU8A 3L9LA 4M69B 1JAMA 2WQMA 4CSVA 5JSMA 4MD8E 3R04A 2X9FA 5HIDA 4ZTHA 5ACBC 3VBWA 5CQWA 3LCDA 4ZP5A 2X4ZA 3UNKA 3OC1A 4FV8A 4ZAUA 2WTKB 2HZIA 5HCXA 4FT9A 1XBAA 1JQHA 3F61A 4AX8A 1CKIA 2W17A 4EWHA 5J5SA 4BDIA 4EOPA 4C34A 3GOKA 3U6IA 4FKQA 4D0XA 4D4SA 1T46A 1ZMVA 5CU2A 1W0XC 2WMUA 3ZO4A 2BCJA 4GW8A 4EEVA 2YCRA 4Y5HA 3LFEA 5CSVA 5FP5A 1OPKA 2Y6OA 4EKKA 2QVSE 3KFAA 3OBJA 4XG9A 4Q5HA 5LJJA 1MQBA 4HZRA 2GMXA 4EK6A 4EWQA 4YU2A 5AFVA 4Z55A 3BYMA 4M84A 3C4XA 2UVZA 4R7HA 4U41A 1URWA 1DM2A 4BDKA 1JKTA 1CM8A 1RW8A 2OH4A 2XBAA 3JY0A 3MY0A 1KOAA 4BZNA 3RPOA 3GC9A 1VJYA 4IVBA 4AZTA 3AC5A 4L01A 4RWKA 2R5TA 4IE9A 1OL6A 3D5WA 5J87A 2X6EA 2ITUA 3CIKA 3OROA 3PVBA 4NKAA 1LEZA 5HQ0A 5IH5A 4EL9A 1HCKA 3CQEA 3R7GA 4W8EA 3GBZA 3SXRA 4MF1A 2P2HA 4C3PA 4C4GA 3PRFA 5LMAA 3NNUA 5EM6A 4RT7A 4F6WA 2E9VA 3LOKA 2R3PA 2E9UA 3FZSA 3GCQA 4ENXA 4BCIA 2IJMA 4M14A 5E7RA 5HKMA 3VIDA 2RSVA 4U3YA 4R8QA 3UIMA 4AE9A 5BPYA 3MVJA 2PZYA 4FK6A 3CE3A 4CYIA 2CGVA 2UZBA 2X4FA 3UOLA 3U54A 5HU3A 4RFMA 5AWMA 3HV4A 3UMXA 5I3RA 1YXTA 2IW9A 4FTUA 3BHYA 2C47A 4O6EA 3CJFA 2OZAA 4EH9A 3FWQA 1ZYCA 2C68A 2VTPA 2ZMDA 5K4JA 2EU9A 4QTBA 5EOLA 3DKCA 3MPAA 3OFMA 3S2PA 2WEVA 4BVUA 2YIQA 2XYNA 2UW7A 3VW6A 3LXKA 4FT7A 2HZ4A 5E91A 3EZRA 2W9FB 4PMSA 1OPLA 3FMEA 3QRIA 4F09A 2GSFA 5HZNA 5KHWA 5AX3A 5AV4A 4RC4A 5J7BA 1ZYSA 4B4LA 2C5VA 4P4CA 4YTIA 3CTQA 3FLSA 2UW3A 2I0HA 1XH4A 1I09A 3EKKA 3NUSA 4HYSA 1Y8YA 4IQ6A 4EK4A 3GC7A 3GQIA 3HA8A 3JYAA 4M0YA 1AD5A 5DT3A 4CG9A 4OLIA 1M7NA 5A4EA 4GEOA 3KXHA 4EZ5A 1ZYLA 3C4CA 4QTDA 4KA3A 5FUTA 1PXKA 2OW3A 3QD3A 3CGOA 4E6QA 3O7LD 3ORNA 4MKCA 3IW5A 4LUDA 3HEGA 5LWMA 2XS0A 1JPAA 1FVTA 2YISA 2YLFA 3U8WA 3BV3A 4IZ5A 1H1RA 3P9JA 3FXWA 3IKAA 4PP7A 2X8DA 4FG8A 4U9AA 2GHGA 4HYUA 2DWBA 2QURA 4QMUA 2C1BA 3MV5A 1YXVA 5A4LA 5DPVA 4XJ0A 4JXFA 2HYYA 4OR5A 2OWBA 4IW0A 4IB0A 2QU5A 3UODA 3R8UA 1Q8WA 4I22A 2JFMA 3IQ7A 2VX1A 3A2CA 4ZZMA 1PY5A 2B53A 3FUPA 4DGOA 4F0FA 5BVWA 5EQPA 4G16A 3SHEA 2GQRA 2J0JA 4L9IA 4HPUE 2FSTX 1O9UA 2W1EA 2XF0A 5AV1A 3AGMA 5GJGA 3C0HA 4FVQA 4F0GA 4ERKA 3UYSA 1T45A 3OY3A 4TYJA 3VAPA 2PUUA 3NYVA 3E8CA 4RSSA 2G15A 5JGDA 3E8NA 5FTGA 3MFRA 2BTSA 2OJGA 4UALA 3RI1A 5LMKC 2PL0A 3NUXA 4KKEA 5EYMA 4QMQA 4E4MA 4FKRA 4ZZOA 4WIHA 3A99A 4RZVA 3FY0A 2BKZA 3QQLA 1QPCA 4K6ZA 5AIKA 5GIPE 4MH7A 4IBMA 4IVCA 4XG6A 1GJOA 3RBWA 4LOQA 4RC3A 4TWOA 5EG3A 2GS6A 5F20A 4EOJA 5CF6A 4MBIA 3QUDA 3LPBA 4TYGA 3R22A 2W4KA 3FI3A 3BEGA 4WT6A 4CKJA 2VWBA 2CLXA 3E88A 4O7VA 3VVHA 3VQUA 1URCA 3MIAA 3ZDIA 3RGFA 2JBOA 5K5XA 4CMUA 1H4LA 2YWPA 4EQMA 1ZAOA 2RFNA 2GQGA 2F57A 1IRKA 5AAEA 4DYMA 4BF2A 3LQ8A 3RINA 1IAJA 2QHMA 5IUIA 3PPKA 2I0EA 1OUYA 2O2UA 4FIEA 4AZEA 1IA8A 3ET7A 3TI1A 5HEZA 3M2WA 2BHEA 3C4ZA 5M57A 4IMYA 4XLIA 4O2ZA 2WNTA 4G2FA 2QQ7A 3OP5A 5EM8A 2QG5A 3ID6C 2WMTA 4FSWA 3VUGA 4DH5A 3MS9A 3TJCA 3V5QA 1AGWA 1NA7A 2W5HA 2UUEA 3EOCA 4TWPA 4W9WA 4GUEA 5A54A 5CEMA 2I40A 4FKPA 4FZ6A 5AV0A 3P23A 4IEBA 4O96A 4E6AA 4EORA 4QPMA 4D9TA 4LRJA 5K0XA 3H9FA 3ZSHA 2ITYA 2PUNA 4WRSA 3OS3A 4QYHA 3ZRKA 4KKGA 1ND4A 4O7NA 3P4KA 3VS4A 4LRMA 3TTJA 2GS7A 3HV3A 2O65A 3CTJA 3GFWA 3PZEA 3UP7A 5J1VA 2XP2A 3DXQA 4K1BA 1M14A 4L68A 3O2MA 4M97A 4J97A 5H2UA 3VUHA 3QC9A 4AA0A 5IEXA 3IOPA 1G8AA 1FGKA 3NVMB 1Q4LA 5CEKA 3ZEPA 3BYUA 3MVLA 3GQLA 3DGKA 2BZKB 3NIZA 4BB4A 4F1OA 4RIOA 2BAJA 5ITAA 4NJDA 1YWNA 5IISA 3DLZA 4U45A 4I4EA 5LOHA 5CASA 3RJCA 1Q8YA 4B8LA 1OECA 3SG8A 4QMZA 4ZXTA 4FNYA 3AMBA 3QCYA 4KS8A 1ERKA 4OTHA 4UMQA 4WG4A 4C2VA 5IG1A 2V7OA 3UZTA 4Y73A 3TEIA 4FYOA 4BBMA 5H8EA 5HE0A 3VS0A 2HAKA 3HGKA 4WSYA 4O7SA 2PVNA 4RFYA 4H3PA 3FMDA 3TCPA 3TUDA 4BDDA 3DT1A 1SM2A 4ACGA 2GTMA 3QTWA 3ZFMA 2HENA 2VGPA 4C0TA 4JVGA 4NKSA 2F2UA 4RRVA 4YZ9A 2ETRA 4C57A 4ZS4A 4IAFA 4CFWA 5LWNA 3I79A 1NY3A 5E90A 5AUUA 4I4FA 2VTLA 2WIPA 1U46A 3A62A 3ZUTA 5IA1A 4O7ZA 1OL2A 3DDQA 3K5VA 2IVTA 4KIQA 4CV9A 1B38A 2EB2A 1WBNA 2B54A 3MJ2A 1UNHA 4I0SA 4LGDA 3QD0A 3COKA 4RC2A 4DF3A 5AV2A 3S4QA 1Q8TA 4C62A 5GNKA 2WMRA 4D5KA 4O81A 3ZSIA 4DG3E 5KMKA 2XM9A 2HELA 3W2CA 3EH9A 3FMHA 2FO0A 1UNLA 2WB8A 3NEWA 3QTUA 4I93A 3VJNA 5CENA 2XIZA 2EXCX 3JS2A 5CEIA 5M07A 4BR3A 3UQGA 5M4IA 3F5UA 3SD0A 3D4QA 4BI2A 1R3CA 3ORZA 5D9HA 3CS9A 4PF4A 2F4JA 3ZLWA 3WYXA 4ZTLA 3V51A 1PJKA 1WVXA 4N57A 4RX7A 1YVJA 5HBHA 2CCIA 3BPRA 4FBXA 2OI4X 4TYHB 3M11A 4WHZA 3QYZA 3VHKA 4UN0C 1FVVA 4EKLA 5L2TA 4PX6A 5KZ0A 5F94A 3VF8A 4R78A 3AD4A 3BYOA 4PWNA 4RA4A 4UYNA 4RIWA 5HGIA 3HLLA 5HLWA 5F1ZA 2BPMA 5DR6A 2A1AB 3VBTA 5LARA 5GHVA 4AN9A 5KX8A 1JSUA 1OITA 5HHWA 3G6HA 5H8GA 1QPEA 1QMZA 4QNYA 3R7OA 3ZOSA 5E1SA 4OTGA 4H1JA 2E9NA 2PULA 2X8EA 4F7LA 1B39A 2QO7A 4UEUA 4F9CA 3MH1A 5KMNA 5J1WA 5LCKA 3SDJA 2UVXA 5TKDA 5LMKA 3MB6A 4G3EA 2C0TA 3DZQA 3HMNA 1MUOA 3QHRA 4LM5A 1KSWA 2OZAB 4RJ5A 3VNTA 3QD2B 4RIYA 2UZDA 3KRLA 1A48A 1QCFA 4FOBA 3GC0A 3L8SA 4YC3A 3DXNA 4FV0A 4YBKA 3RHKA 4BKYA 2C5XA 3DK6A 4DCAA 2QONA 3DOGA 5JKGA 3DBQA 1KE9A 4H1MA 3LMGA 2OU7A 4JAIA 4ZSEA 4OBOA 4JOAA 3DBEA 3QRJA 5JGAA 4LMUA 4W4VA 5LVNA 4FK3A 2VTSA 5AJQA 5CQUA 2FSMX 3KMMA 3ZXZA 3MY5A 2QKRA 3PA5A 5AV3A 2J4ZA 5H9BA 4EJ7A 2YM5A 4HGEA 3ZTXA 4R7BA 5IH4A 4II5A 4RG0A 4YLKA 4EHVA 4DG2E 4RZWA 4J1RA 5GJFA 3KKVA 4G5PA 4GIHA 3M1SA 4F7NA 5ANJA 4FUYA 3NNXA 2UZNA 4YSMA 3HVCA 4HW7A 3FYKX 1SNUA 4ACHA 4NTTA 4Y46A 2WFYA 3SRVA 2Q83A 5DHJA 4FTNA 3KQ7A 4WD5A 3WZDA 5I9ZA 5CTPA 5CANA 2IZRA 3PUPA 4HYHA 1OL7A 3QALE 4YJNA 2X8IA 2JIVA 5I9XA 2C5YA 2QNJA 4YURA 3PIXA 1OGUA 4ZJIA 2QOIA 4XG2A 5IA0A 5L8KA 4XV2A 3BLRA 2I1MA 5DEWA 4IJ9A 3ZRMA 2BRHA 2IN6A 2JAVA 2Y8OA 2YCFA 2JKMA 4AWIA 4ENYA 5A6OA 1BL6A 4S32A 4FKGA 1UU7A 5ACKA 4DGGA 5DRDA 2W96B 3PXYA 4IWPA 2BVAA 3FL5A 4V05A 1KE7A 5AIRA 3VBVA 3FMLA 2J90A 4E73A 4U0IA 3RWQA 3GB2A 5JEBA 3W10A 4YNEA 4PMPA 3KRJA 2X1NA 4WO5A 5H8BA 4XMOA 2R3FA 4B99A 4WSQA 1LR4A 3GU4A 3G15A 4A4XA 2CGUA 1YDTE 3DB6A 5T6KA 4BHZA 2XH5A 4EOIA 4AOIA 5J9YA 4JBOA 3GFEA 3UOHA 4A9TA 3VS1A 4UV0A 1BL7A 1QL6A 3PXQA 4K33A 1IEPA 2CN5A 2W1ZA 2BRBA 4M8TA 2Y6MA 4HVDA 3SG9A 2FGIA 3LMIA 3Q5ZA 3Q52A 1IASA 3FV8A 3WIKA 5DLSA 4FTTA 3DLSA 4BDGA 4DEEA 3P7BA 4CMTA 4F6SA 5HG8A 2Y0AA 4FSRA 4ITIA 3KCKA 1JLUE 4JQEA 5DG5A 3OWKA 1ZY4A 3ANQA 5GZ8A 2GPHA 3P08A 4LRKA 4CTBA 2XK6A 2FYSA 2Y7JA 4DLIA 4F08A 3A7FA 3JVSA 4FEXA 3ACKA 4J71A 4DBXA 4IACA 4BCGA 3G5DA 3IONA 1JKKA 3P1AA 3PE2A 4O0WA 3PA3A 3OOMA 2RIOA 5A4CA 4DITA 1V1KA 3RPSA 3OCGA 4DHFA 1BI8A 3TG1A 3DAJA 2X7FA 3ROCA 1A9UA 4KWPA 2GNGA 4O1OA 3AOXA 4NM7A 3R1QA 3FYJX 2CKOA 2OZOA 4ZY5A 1O6LA 1WVWA 3D15A 3UZPA 3PSDA 5T3QA 4AUAA 3LXPA 2QOQA 4I20A 3L8VA 3GNIB 4MXAA 3NPCA 2HY0A 2ITNA 2H6DA 4WNPA 4O7YA 1TQPA 3GCUA 4USFA 4BGQA 2V0DA 5L8JA 1UWHA 4NIFA 2QO2A 3ZEWA 1PXJA 4QRCA 2CNUA 1J3HA 2DYLA 2VN9A 1H26A 4V04A 3BHTA 5CY3A 5E8ZA 4RBLA 4HVIA 4ITHA 2GHLA 4R5SA 4LOOA 2C1AA 3TDWA 2CHLA 2P33A 1NVQA 3FE3A 5AP6A 5F95A 2B7AA 3F3ZA 3OOGA 1AQ1A 4WNMA 4GFOA 1H25A 4D1SA 2GDOA 5AP2A 1F5QA 4ANSA 3HP5A 3S95A 4JI9A 4X21A 2O64A 5M4UA 2ZOQA 2GNIA 2NPQA 4D55A 1XHAA 2PZPA 4F7SA 2QLUA 3DJ6A 2HIWA 3I6UA 3BHUA 3P79A 3WZKA 4FTIA 2X2MA 4BCJA 2R9SA 3QGYA 4UMPA 4QP7A 3P78A 4R6VA 4ALVA 4EOKA 1WMKA 4EOLA 4WG5A 5ETCA 4EUTA 2BRGA 2W1GA 1YHWA 4QMMA 3B8RA 3EFWA 4FIGA 4JQ8A 3CR0A 1L8TA 3ELJA 4OGRA 4RLKA 1G3NA 4CZTA 3R9NA 2FA2A 3P0MA 3F2RA 2PUIA 4H39A 3W2RA 4R3CA 3CJGA 1XH5A 3KVWA 1GOLA 5IEVA 3QCSA 3FKOA 4MHAA 1PMNA 5G1XA 5TE0A 5LVMA 2B9JA 3W8LA 3CY3A 3FSKA 3E7VA 3KULA 4Y85A 1YDSE 3D9VA 4FTOA 4IX6A 4YZMA 3VQHA 5JH6A 4C37A 4O0TA 5DN3A 4HVSA 5ANIA 3FQSA 2YDIA 2AYPA 4QTEA 1XBBA 2W05A 2WMVA 4FL2A 3ZUUA 3PXRA 5JRQA 3T3UA 4BTKA 3FLQA 4YLLA 5M4FA 3DBCA 4UMUA 4FNXA 2JKOA 2PYWA 3BLHA 2VV9A 4I24A 4KINA 1TQIA 5HNGA 3ZS5A 4RWJA 1M2RA 4ANMA 3A61A 4IAIA 4ZOGA 3NIEA 3PYYA 4QP4A 3NDMA 3E93A 5A3XA 2QR7A 3NW6A 4EBWA 3FI8A 3R7VA 3RWPA 1UA2A 5IQGA 3I0OA 3BX5A 3PVWA 4U3ZA 3PJ3A 5IA4A 4ZK5A 4N6YA 3UVRA 4NWMA 3PIYA 3C13A 4OTFA 2XVDA 4JR3A 3DFCB 4XG4A 1ZYJA 2OO8X 4BHNA 2VO6A 1YOJA 1ZMUA 3LFDA 4L00A 3QTIA 4JX3A 4QQCA 4RIWB 1ZXEA 3OUNB 2VWIA 4G6NA 3RM6A 3ZRLA 4PL5A 4L46A 5HO6A 3TL8A 4OTIA 3CCNA 4FV9A 4BDFA 4XBUA 2QO9A 4EQCA 4RQVA 4R1YA 3ANRA 5I9WA 4PDYA 3EQIA 4AS0A 4USDA 3QWJA 4HGSA 5DFPA 3KA0A 4CT2A 4L45A 4ACMA 4DC2A 2IZTA 4AZSA 4ASXA 2JBPA 5M44A 4UZDA 3TNWA 5IH6A 2ZB0A 3EN5A 3CEKA 4ZS0A 4D2SA 4IFGA 3CKWA 1JNKA 2RF9A 4HNIA 5AP1A 5J5TA 2C6LA 1MRUA 3ZO1A 4YO4A 3IS5A 4Q2AA 1H07A 2OFVA 3EQPA 3LFQA 4FIFA 4IDVA 2CGXA 3HDMA 3PJ8A 5GZAA 3T3VA 3TUBA 1P4OA 2YM7A 4NFMA 2J5EA 3QQFA 4DH3A 3TN8A 3BCEA 4MXCA 5M53A 4UX9A 3P86A 4ANBA 2GQSA 4D4YA 3C4EA 3F7WA 3NRMA 4PDPA 1IG1A 3GXLA 3KXMA 5IDNA 3L8PA 5BVDA 5ANGA 4S34A 5HNIX 3VS7A 1TKIA 2JDSA 3LHJA 3UVPA 3ZHPC 1U4DA 4GL9A 5DH3A 1YOMA 4R77A 2ZV7A 3KN6A 3TIZA 3G9LX 2O63A 4ZTNA 4A7CA 3W2QA 2BAKA 2QOKA 4RWLA 5IQFA 4P5QA 4GIIA 2WQNA 4BCOA 5IA3A 4O0SA 5AM6A 4EH4A 2ZV2A 3DQXA 4X2KA 2QC6A 3DQWA 1Q8UA 4DCEA 3S0OA 3BGPA 4JAJA 1FINA 3N9XA 2ZM4A 2P55A 3PLAE 3QCXA 4QMYA 5EKOA 2BHHA 4IVAA 2F2CB 3OT8A 5IDPA 1H08A 4X2FA 3QL8A 3UTOA 2AC5A 4CXAA 2KTYA 4EZ7A 3QZGA 3KREA 4C3FA 3QQGA 3G6GA 3W8QA 4ORKA 4OTPA 5DVRA 3SLSA 5HIBA 3WZUA 4XUFA 4A07A 4MD7E 2HW6A 4EHEA 3OEZA 3PY0A 4C33A 2XBJA 4BRXA 4QPSA 1J1BA 4YNOA 4BCKA 5FLFA 3N4VA 5JQ5A 1VEBA 4FV6A 4GYGA 4O0YA 5EW8A 3BZ3A 3OW3A 3UC3A 4GSBA 4KBCA 3MB7A 4KBAA 3PP1A 1JSVA 3R1NA 1ZMWA 4NK9A 3KF7A 2EXMA 4H36A 2HXQA 5HIEA 5EQEA 5AAGA 3UBDA 4J8MA 1XH7A 4GK2A 3UJGA 3SVVA 3B2TA 3AT4A 3KXGA 3G51A 2C69A 1JSTA 3QA8A 4U42A 4FSNA 4U5JA 2OBJA 2OK1A 3C50A 4Z7HA 4IXPA 2R3JA 2H96A 2OF4A 2E9OA 3BU6A 3BYSA 3CPCA 5HI2A 3V5WA 4CCUA 2FVDA 3GEQA 5FBOA 4YMJA 4CEGA 3E62A 4AGWA 4EHGA 1Q41A 2E9PA 4FTKA 4KRCA 4JDIA 3DAKA 3BWFA 4FKVA 3U87A 4MNEA 5EHOA 3UNJA 3LFBA 3GENA 4JBPA 2XNMA 3PXKA 3P7CA 1OUKA 3FLYA 4BIBA 5ICPA 4RLLA 1P5EA 4JG7A 2YJRA 3G90X 5C01A 3B2WA 4IAYA 3D2KA 4NM0A 5JZNA 2WAJA 5CZIA 1ZOGA 3MFUA 1UVRA 1X8BA 3C0IA 3H9OA 4OUCA 4F1TA 4OT5A 3QTQA 3ACJA 2JDRA 2YJSA 5GIOE 3COMA 3FI4A 3I1AA 3KGAA 4L67A 3W33A 3NUYA 2LAVA 2WHBA 2J5FA 5D12A 2BUJA 3A4PA 4NIFB 2O5KA 2IZSA 2B4SB 2O3PA 4YR8A 1PKGA 3VC4A 2ITWA 3IECA 5JFXA 2WU6A 4O22A 1SVGA 3FZTA 3KRXA 3FC2A 4MVFA 4W9XA 3ZLXA 3DY7A 2UW4A 4KIPA 4YHFA 4XV1A 4CQEA 2YFXA 4BL1A 4YTCA 4DFBA 4ERWA 3NUAA 3P5KA 3HV6A 1JOWB 4E7WA 4GU6A 3LCTA 1A06A 4CGAA 1YDRE 1FVRA 1OL5A 4BCHA 3Q9YA 4D5HA 3E64A 2Z7SA 4BWKA 3OCSA 4FVRA 2A0CX 4E5BA 3UGCA 3AQVA 4FKWA 2I7QA 3GU7A 2X81A 2C6KA 3HMIA 3QX4A 1PHKA 5M09A 1XH9A 3Q9ZA 5HE3A 4G3GA 3IPHA 4NT4A 5HO8A 3ZZEA 2CLQA 3KXXA 1NVRA 2V55A 4RJ6A 2F7ZE 1PMUA 5CT0A 1PXLA 1OIUA 5EK7A 4IWDA 3CKXA 3C4WA 4C3RA 4CFUA 5HTCA 5K9IA 3OUKA 1PF8A 3N4TA 4F0IA 1NVSA 3AC4A 2VTHA 4ZEGA 4BZOA 2CPKE 1VYWA 5D7AA 3W16A 4C8BA 3DXPA 4XHKB 4LUEA 3QHWA 3Q6WA 5ETAA 3R73A 4MXXA 4O84A 2B9IA 2VRXA 3KULB 3LJ0A 2IW6A 2JKQA 2YDKA 4WRGA 1WFCA 3D94A 3I7BA 4WA9A 5L8LA 3I81A 4F4PA 5FTOA 2XZSA 4FKTA 4L3LA 4UY9A 5AUXA 5KMJA 4RJ4A 5ANDA 2FUMA 3UPZA 4KUJA 2CJMA 4HCVA 2VD5A 4WNOA 4BGHA 3D0EA 3G33A 3QUEA 5CF8A 1BI7A 1Q8ZA 4EH7A 2WPAA 5DIAA 4IWOA 3BU3A 3GT8A 4PPBA 1WBOA 4QP3A 3TUCA 2C3LA 4IJPA 4F7JA 3Q2JA 1BMKA 1YWVA 2JDTA 3EQBA 2DQ7X 2VO0A 2XJ2A 3O71A 4EH5A 3RP9A 5JFVA 3EL8A 1KUTA 5IUHA 3H10A 4QYYA 5A6NA 1O6KA 5DT0A 2HOGA 4R1VA 4BDHA 5EDQA 3EQDA 2OIBA 3KRWA 3GU6A 5M4CA 2BALA 4F9BA 4ZY6A 3R63A 4MX9A 2R3HA 3QRUA 4AZFA 5DA3A 5HICA 2VUWA 3DBDA 3EQRA 4RIXA 3H30A 4U7ZA 3WE8A 1UU9A 3SXSA 5KKRB 1DI9A 3OHTA 3R8PA 2BRNA 4MBLA 3MH0A 3NUPA 1OMWA 3E63A 3WE4A 2YACA 3HKOA 2B55A 4QMTA 3D7ZA 3H0ZA 3OBGA 4XCUA 5CAQA 4CKRA 2GS2A 4IADA 4GT3A 2EVAA 3VUKA 2PVYA 4CG8A 1CSNA 5FXRA 2PE1A 4G9CA 3Q3BA 3EQCA 3W2PA 2W4OA 3UIUA 3ULZA 5G6VA 4AFJA 3MA6A 1ATPE 3HRFA 3Q4TA 4X3FB 2WTKC 3NCZA 4G9RA 2YLEA 3FHIA 5JMSA 1MQ4A 3EFKA 4F64A 1PXPA 2WELA 3U51A 4BIEA 4KB8A 2OFUA 4D0WA 2R3MA 2ZB1A 4IM3A 2V5QA 3LE6A 4TTHB 2Z60A 5CALA 5DYJA 2JEDA 3OZ6A 3QRTA 5FEDA 1YXUA 4X2NA 5KBRA 4DT8A 4L3PA 3QKLA 2B9FA 3PSBA 3RPVA 3OWJA 4ASDA 1YW2A 3C5UA 3AMAA 2VTIA 3QYWA 2G2FA 4TNBA 3TZ7A 2XK3A 2VAGA 3V04A 1H1SA 4YZCA 4XYFA 4G31A 5AMNA 2BIKB 2PVJA 3QA0A 3E8DA 4FX3A 4HOKA 5CS6A 4BDEA 5B2KA 3PG1A 4ASZA 4DINA 4L43A 4EI4A 3MJ1A 3DKFA 5AR7A 3ZU7A 5EYCA 3RVGA 3FPMA 3OCTA 3OD6X 3F5PA 4D2RA 4RX5A 5CVHA 1J7LA 2FB8A 2JIUA 5E8TA 4L8MA 4BDAA 4GFMA 3QBNA 2F9GA 3ORXA 2XNGA 3LQ5A 5FM3A 5EW9A 4IAAA 2VTTA 2ERZE 5HX6A 4FT0A 1SNXA 4J53A 4UZHA 5CYIA 3RALA 4C61A 3HRBA 3F9NA 3D5VA 4S30A 3MTFA 5HCZA 3E3PA 4BY9E 4GH2A 3TKHA 5IUGA 4AN3A 2XRWA 3VS3A 4AOJA 4CFVA 3L9MA 3NW5A 2PVLA 2C6IA 3K5UA 1G5SA 4BWXA 4FSUA 1YWRA 4O7WA 3ZONA 4KRDA 3R0TA 1RDQE 5A9UA 1J91A 1UWJA 2I0VA 4CMOA 3NUNA 5HTIA 3D7TA 4RMZA 3AC2A 3RMFA 2BR1A 2H9VA 5EHLA 2VX0A 4E26A 3ALOA 4HNFA 5IZFA 3EQFA 3QQHA 3BHHA 5AR3A 3OXZA 3PJCA 3R9OA 4ZTMA 4ZTSA 3CXWA 4M67A 4EOQA 1Z57A 2W1FA 3DTWA 3IW4A 4ONAA 2VO3A 5I4NA 3LM0A 4GVJA 5C8KA 4TYEA 3GOPA 1PXIA 1Q3WA 2H8HA 4YTFA 4ZLOA 1FBNA 1SMHA 4ZSLA 3KY2A 1Q5KA 5I5ZA 4FT5A 2W0JA 3OCBA 4QQ5A 5FDXA 3FZPA 4IB5A 3GP0A 5K4IA 1GZOA 4LOPA 5CF4A 5HE2A 1YRPA 4TW9A 5IQEA 3ZBFA 2QOLA 4DFNA 1Y6BA 2P0CA 4NYEA 3VBXA 4I6BA 5AM7A 4E3CA 5CF5A 3DBFA 4CT1A 1S9IA 2G01A 2PHKA 3NSZA 1OKWA 4JLCA 4PTGA 4YZDA 4H3QA 3MVMA 1OKVA 4GG5A 4YGAA 4FICA 3I6WA 2R3GA 4GVAA 2Y4PA 3F7ZA 3LM5A 2XIRA 4D9UA 1GY3A 4IZAA 4DEBA 2HXLA 4G3FA 2XNNA 1MP8A 1KWPA 1YI6A 2J50A 5FEEA 5FRIA 3ZFXA 1H0WA 5A14A 1ZOEA 3PPZA 4K18A 3FC1X 4MXOA 4TT7A 3IW6A 2WTJA 3BBWA 5EM5A 1YHVA 2RG5A 1M7QA 3ZO3A 4BWPA 3QC4A 2BMCA 2NP8A 2LGCA 1GNGA 4OTWA 3HL7A 4XG8A 4AU8A 3R9RA 2PVHA 1ZY5A 3OY1A 4U8ZA 3TKIA 2XJ0A 3SKCA 4OTDA 3R7EA 4O21A 2ITOA 3F2AA 4FOCA 1WBPA 3UO4A 2SRCA 5M06A 1XBCA 1FMOE 4XH6A 5KE0A 2OJJA 4U81A 3I0QA 5BYZA 3A7HA 4FTLA 4AGDA 5AUWA 5IQBA 4DE4A 4HGLA 4BYIA 1EH4A 3PP0A 3NYOA 2R7BA 2PUPA 4O82A 4LFIA 2C3JA 4FSZA 3ROYA 4PUZA 1E9HA 4PP9A 4IM2A 4F9WA 2WMQA 3OW4A 3A8WA 3PY1A 1DAYA 2XRUA 3WI6A 4L53A 4JR7A 3BKBA 3DDPA 4WKQA 5AP0A 1UU3A 1OI9A 2BZJA 3MA3A 3NX8A 3IO7A 3SXFA 5J95A 1U5QA 2IPXA 4K0YA 5EYDA 4LG4A 3BE2A 4M69A 3ODYX 4X3JA 1WBWA 2BAQA 4BN1A 4MF0A 3PSCA 3A8XA 2R0UA 4MYGA 4TWCA 3SOAA 3D5XA 4BBEA 3A7IA 3RZFA 3VW8A 3PG3A 3U4UA 5HD7A 4AN2A 4D4VA 3R7IA 3TIYA 4QMVA 2BILB 2VNYA 3O8TA 4FTQA 4GT4A 4UXLA 3ZUVA 3F5GA 3FZRA 5L2IA 3KU2A 3V8SA 1E1XA 4EH8A 3TXOA 3POOA 5M08A 3QKKA 4ZSAA 1XKKA 4FG9A 4BCQA 3VRYA 4UBAA 4WUNA 2YIRA 4JJRA 4O7LA 4YO6A 3TJDA 5BVKA 4EH3A 3CBLA 1LUFA 2BDWA 3IOKA 4TKSA 5FBNC 3V5PA 4ID7A 4UYAA 2EUFB 4F9YA 5CXHA 1H8FA 4CLJA 3F6XA 3V6RA 4DTBA 1TQMA 3F5XA 4GUBA 3QTZA 3ORLA 1OL1A 4PRJA 2F7EE 1XO2B 2ITVA 3DK7A 4KSQA 4BCPA 2W1HA 4FZ7A 1VYZA 5B0XA 5BYYA 4EK3A 4M66A 1O6YA 3KF4A 1SVEA 4GT5A 4I21A 3UVQA 2WO6A 3ZBXA 4AA5A 4PY1A 4G6OA 2WD1A 1IA9A 3G0EA 4N0SA 1ZRZA 1R39A 2BKKA 4RX8A 4O7RA 3IGGA 1Y6AA 2A27A 3RK7A 5IQDA 4FODA 2QR8A 5ETIA 2X2LA 2CSNA 4AT5A 3TV6A 3TT0A 3OVVA 3P7AA 4MQ1A 2W1DA 4K11A 5I9UA 3T9TA 2IVVA 2BDJA 2VWXA 1U59A 4JX7A 3RNIA 5JRSA 4D1ZA 4Q9ZA 1KV1A 1BKXA 4JL9A 3WOWA 4C38A 5IU2A 2ETKA 4RGJA 1ZOHA 4CNHA 3NNVA 3QFVA 2PZIA 2XK7A 3EFJA 3FY2A 3K2LA 5CT7A 3R7YA 1STCE 3MH2A 2RFEA 3E92A 4CVAA 2PZ5A 4RIXB 1MRVA 2OIQA 1W82A 1OB3A 5T68A 3VS5A 3JR1A 1WAKA 2BRMA 3HMOA 3KK8A 4Y72A 5K3YA 3AD5A 3RM7A 4E5WA 2ITQA 4MWHA 5KMMA 2Z7LA 5CEQA 2VTMA 2XIYA 3FDNA 4RFZA 3VF9A 4QQTA 3KVXA 2PWLA 2BTRA 3PDTA 2PY3A 3KXNA 3R2YA 4BDCA 4QMPA 5KMOA 1PYXA 4CFMA 4E20A 4FGBA 3LMHA 1PRYA 1W84A 4WBOA 2PK9A 2I6LA 2PMIA 2WXVA 1IAHA 3ITZA 3JUHA 3ZFYA 3ATTA 3UQCA 1RJBA 3FSFA 3RPRA 2OXXA 2QOOA 3LJ2A 2WZJA 4I23A 4PPCA 5E8XA 4AQCA 4RVLA 4BKZA 1JBPE 5E8WA 3ERKA 3QCQA 3OMVA 3C5IA 3MSSA 3L1SA 5EI6A 4E93A 5LVPA 2HCKA 3EIDA 5C03A 1M2PA 3QRKA 4RPVA 3BELA 2RGPA 4I94A 4GYIA 4E5AX 4H3BA 4TNDA 2UZEA 2X0GA 1Y57A 2GCDA 5D7VA 2NRYA 3EKNA 5L2QA 4OW8A 5B2MA 4AF3A 1UU8A 2XKCA 1GIHA 2JFLA 1L3RE 4DFLA 3EMGA 5ANEA 3FEGA 2W1IA 2VO7A 4G6LA 5BVNA 4NEUA 4U43A 4G3CA 4GS6A 5K5NA 4GKIA 3UO5A 1YHSA 4TWNA 3W18A 4OBPA 5DMZA 2R3LA 1H24A 5BVEA 3NGAA 2ACXA 2QCSA 3BBTB 3FMKA 4XOYA 2EWAA 4X2GA 3R00A 5D1JA 3MFSA 4PTCA 3ZM4A 5EOBA 2O0UA 3TNQB 1LEWA 1GZ8A 5KMIA 4EK5A 3VS6A 3HP2A 2XIKA 4IIRA 4R7IA 5C27A 2DUVA 4Q5EA 4XRLA 4BTFA 3LFCA 5AEPA 3LKMA 3COIA 4J52A 1B6CB 3WZEA 3ZZWA 4ANNA 3MGYA 4M12A 2ITZA 4S31A 4IAZA 3FXZA 3B8QA 2W06A 3GI3A 3PTGA 3QLFA 3U6HA 4IX5A 4O38A 3E7OA 3HECA 3IK3A 4ZTRA 5FG8A 4CD0A 4F70A 3WZJA 4I5PA 4NUSA 3VHEA 4QNAA 3BE9A 4DN5A 5IPJA 2J51A 2C0IA 4KSPA 5IQHA 3D7TB 4F9AA 1OIQA 3C0GA 4ZJJA 4ZY4A 4V0GA 2QOFA 4BYJA 2RL5A 4HYIA 3UOKA 4KKHA 3ZO2A 3HAVA 5DR2A 1S9JA 5E1EA 4C4EA 3AT3A 3SW4A 5TOZA 2YIXA 4APCA 4DAWA 4FZDB 2F7XE 3MPMA 3OXTA 3C9WA 3RAWA 5EI8A 4CZYB 5AADA 2YN8A 4Y83A 3F3WA 3FLNC 4QP6A 2A19B 4EK8A 1F3MC 3HRCA 4K9YA 4D28A 1FPUA 2Z7QA 4EQUA 5L6WL 2C3KA 3EFLA 4XP2A 4W8DA 4MXYA 3UP2A 3R8VA 4MK0A 2R2PA 1CTPE 5C1QB 4S2ZA 3Q9XA 3U6JA 2QKWB 4KAOA 2UZTA 3QWKA 5CNNA 3AC3A 2VTOA 1Y8GA 3EYGA 5DBXA 5LMBA 5CU4A 2G2HA 3ZYAA 1E1VA 1PXNA 3LQ3A 2XNOA 5HVYA 2UW9A 3AGLA 4AT3A 2C0OA 2UZOA 5CVGA 3EYHA 3RAKA 2WGJA 1PMEA 5I3OA 3CTHA 2QG7A 4MBJA 3T8OA 5A4QA 4QMXA 4XP3A 5JT2A 4AFEA 4RIYB 3QKMA 3U4WA 4O0RA 5DR9A 5E8YA 4FV7A 1XH6A 3AG9A 3L9NA 4A06A 5HU9A 1OBDA 4YJOA 5CNOA 2HW7A 4TXCA 3ALNA 4ALWA 3UOJA 4OBQA 3I5ZA 4ZZNA 5C4KA 4FL1A 4EUUA 2ESMA 4XS2A 5F4NA 5CAOA 4RVKA 4UWCA 2WMAA 4PMMA 3WIGA 4NZWB 1P2AA 4AGCA 3IGOA 4BCNA 4CFXA 3AC1A 2FH9A 3HMMA 3O0GA 2JDVA 4NW5A 1OZ1A 5KNJA 4YPDA 1KE6A 2P4IA 4E4NA 5HLNA 4I5CA 5FTQA 4MD9E 4FL3A 2NO3A 4FV2A 4B9DA 4E4LA 3KRRA 5AAFA 5E4HA 5HG7A 2QD9A 5I9VA 4PDOA 4M7IA 3N51A 4UXQA 3UPXA 1Q97A 2GNHA 4R3RA 3E8EA 3NLBA 1I44A 3PZHA 5BMSA 3VUIA 4F1MA 1GAGA 5CEOA 3Q4UA 3SRVB 1R1WA 5AUVA 1BX6A 3CQUA 5EM7A 4HCUA 5FGKA 4FV4A 1KV2A 1K9AA 3FJQE 3M42A 4GG7A 3A7GA 3QU0A 3VO3A 4F63A 1TVOA 2ZYBA 3D14A 1J1CA 5DWRA 3Q2MA 3ODZX 3TZMA 4U79A 2XUUA 4KIKA 4E1ZA 5IQAA 3KMUA 1XR1A 1PW2A 3DJ5A 3PVGA 5FM2A 3DK3A 2WQEA 2ZJWA 4IX4A 2CKPA 3HA6A 2WTVA 3WF5A 3BIZA 5L6OA 4TRLA 1M52A 4Z3VA 5EKNA 4ZIMA 1V0BA 5D11A 1VR2A 5CAUA 3ATSA 2V22A 2R3KA 4PV0A 5EYKA 3UG1A 3RK5A 5I0BA 3TZ8A 5L2SA 5L3AA 4RVTA 5FP6A 3TV4A 4DEHA 3TDVA 3TM0A 3GGFA 3RAHA 4ANQA 2WIHA 5KO1A 5CI7A 5CU3A 3F88A 3EN7A 4V01A 2A2AA 4A4LA 4C58A 3EN6A 4RQKA 1Q3DA 4QO9A 4AZVA 2VWUA 1ZWSA 3QTRA 4KABA 5BYLA 2YDJA 4O0UA 3CSVA 4D4RA 1OIRA 2CMWA 2W7XA 3HMPA 1P4FA 2NRUA 4ITJA 3VUTA 4I6FA 4GCJA 2OKRA 3CY2A 2Z8CA 3PWYA 3KCFA 5EHYA 3ORIA 4A9YA 3FL4A 4DEIA 3I5NA 1LP4A 4GV1A 5HESA 3QZIA 1Q99A 1OKZA 4LL5A 3BGZA 3HZTA 4TYHA 4YTHA 3DPKA 3F82A 4IC8A 4DG0E 3RAIA 2VWYA 4EC9A 3H0YA 4U40A 5JQ8A 1GZNA 5FWKK 2Y4IC 3QLGA 1XH8A 3AMYA 2BDFA 2CDZA 3Q9WA 2YM8A 5IEYA 4QMWA 3R1SA 2C5NA 5JZJA 4DFUA 2ZV8A 3CQWA 4OTQA 2IW8A 4XLVA 3MPTA 4IVDA 3KN5A 4C59A 3O23A 2XKDA 2ZM3A 1MRYA 2H34A 1H1QA 3ORKA 2GFCA 1YXXA 2JIIA 2QHNA 3D83A 4EONA 2HZNA 5CSXA 5BVOA 2UW6A 3GCVA 1FQ1B 4U44A 1H27A 4NL0A 5IQCA 4QP8A 4YJQA 4DBNA 2PVMA 5AUTA 3QF9A 3KB7A 4BTJA 3A4OX 2XEZA 3FLWA 3VRZA 4FYNA 3RPYA 1JWHA 4QP2A 2PU8A 4FE2A 1UKHA 4J98A 3VBYA 4P2KA 4FKIA 4FTMA 1SYKA 3BGQA 4TY1A 4CZUA 2HWPA 1J7UA 1XWSA 2J0KA 4ZMEA 3NVKI 4YZNA 3R9DA 4ZLZA 4CRLA 4C4HA 3TZ9A 2VTJA 4W4YA 3RCJA 4X2JA 4KIOA 4IB1A 5ETFA 3LLAA 1V0PA 2UW0A 2UZWE 3FPQA 5TT7A 4YC6A 4E8AA 5M51A 4AW0A 2OF2A 5HE1A 1Y91A 2CCHA 2WMSA 4IC7A 4JG6A 5GINE 4FNWA 4AE6A 2AUHA 3CC6A 4JIAA 4XOZA 3ZDUA 2W9ZB 4ZSJA 4FEWA 3BLQA 2Z2WA 1FOTA 2PE2A 3FHRA 3E3BX 4N4SA 2WOUA 4Y5QA 2QOHA 4YJTA 4EYJA 4A9RA 2BROA 2OIDA 3V5LA 5CAPA 2O8YA 2JD5A 2VX3A 3IW7A 4IANA 3F2NA 5L2WA 3OWPA 3SV0A 5DRBA 3R8MA 4BBFA 3QD4A 1FGIA 2P3GX 4LYNA 4J99A 4NSTA 5K0KA 2IWIA 2YITA 4OTRA 3DCVA 3S1HA 4D2WA 3LXNA 3NCGA 4GU9A 3LCSA 3COHA 3ORPA 4K77A 4FIHA 3R83A 4G5JA 4FV3A 4IZ7A 5E92A 3PLSA 4I3ZA 3V6SA 4LV5A 3I4BA 4A4OA 2XYUA 4JBVA 2VWVA 4ZJVA 4GKHA 3LFNA 2XNPA 4C4FA 2R3IA 4QTCA 4ACDA 4BIDA 2WTCA 3KMWA 3MDYA 3CP9A 3R2BA 4RWIA 1H1WA 3V8WA 4AW1A 4FT3A 4HZSA 4EBVA 4JRNA 5AR4A 2ZDTA 2QU6A 2REIA 1HCLA 4MWIA 4C7TA 4DH7A 1PMVA 4L44A 4QQJA 4O2PA 1CDKA 4YJVA 4CKIA 2C6MA 5DI1A 1CKPA 3QGWA 4QP1A 5HCYA 4CV8A 4FR4A 2J2IB 1WCCA 1R78A 3IDPA 4AT4A 4M0ZA 4V0GB 4BCMA 4AACA 5LVOA 4M68A 4UMRA 5BUJA 3MH3A 2YM6A 4H05A 2IVUA 4C02A 4QYFA 5LQFA 2R3RA 3NR9A 3ZC5A 2C6EA 2F49A 1UV5A 2VWWA 5AR8A 1ZLTA 1DAWA 3FXXA 4YUQA 3H9RA 1REKA 2OG8A 4HVHA 2FSLX 3GCSA 4Z9LA 2J0IA 3GCPA 2V62A 3FKLA 4MNFA 4XG3A 4YJUA 5LCJA 3LAUA 4AW2A 1CKJA 3VS2A 1HOWA 3NS9A 3QX2A 3NWWA 3VULA 3FAAA 4FV1A 1SVHA 2XJ1A 4C4IA 4IFCA 3BQRA 4U6RA 3O17A 4PL4A 1QPDA 2JITA 3W2OA 4E4XA 2W1CA 4G3DA 3OG7A 3MYGA 4ZTQA 1PXOA 3F66A 4EHZA 4FG7A 4CTCA 3QQUA 1BUHA 2BFYA 3GVUA 3BYVA 3DAEA 4O27B 4EH2A 2UZUE 1V0OA 4O86A 2AC3A 4I0TA 1U54A 3JXWA 2WMWA 4Y95A 5AA8A 4A9SA 2UVYA 1Z5MA 4Z7GA 4BICA 2R3QA 1RQQA 2J7TA 3FQHA 3R6XA 5CSWA 3RTPA 3FLZA 1H00A 3DV3A 1PXMA 4WG3A 3JY9A 2RFDA 3REPA 2WMXA 3NW7A 4O83A 2OXDA 3ORTA 3GUBA 3PPJA 2XK4A 3QZFA 3U9NA 2ZDUA 3ZMMA 3MFTA 3MN3A 4FKJA 3RK9A 4UWBA 1Q61A 2HZ0A 2JC6A 1KOBA 3DNDA 4AOTA 5KCVA 2OJFE 1R0EA 3WF7A 3WILA 2VTQA 3HNGA 3KC3A 2YHVA 4M3QA 5GJDA 5HLPA 1M2QA 4O0VA 1CMKE 3ZH8A 2R64A 3VN9A 4AZWA 4B7TA 4M13A 4M15A 4F99A 3DFAA 5LXMA 2CKQA 4FEVA 3UZRA 3MW1A 2UZVA 4NW6A 1NW1A 2RG6A 3OWLA 3W2SA 5BX0A 4QMSA 2OLCA 3SC1A 3ULIA 3HV7A 4AXAA 2XIXA 4P90A 4O91A 2B0QA 5ANKA 5CZHA 2YERA 4YBJA 4FTRA 2XEYA 4GK4A 3A60A 3QTXA 5DE2A 4UMTA 3WF8A
chains in the Genus database with same CATH superfamily
4KIKB 2BFXA 2PPQA 3C7QA 4QMLA 3OXIA 2ZMCA 4PDSA 2EB3A 4QPAA 5I9YA 2YCQA 4F6UA 1FMKA 2VWZA 3LJ1A 2YIYA 4Q9SA 4KD1A 3SX9A 4DGLC 1W98A 3PY3A 4LGHA 3TNPC 4PNIA 3Q60A 5AA9A 2R4BA 3FMJA 2GNFA 3WYYA 3CPBA 3FI2A 4J7BA 2BIYA 4QOXA 3MESA 3IW8A 4IDTA 3UDBA 1XQZA 3EHAA 2YAKA 1K2PA 2B9HA 4HGTA 5C26A 2X7OA 3RHXA 3DTCA 5CLPA 4FEUA 2AEGA 4NU1A 3QTSA 4XX9A 3GU8A 2YAAA 5CI6A 1ZARA 2VNWA 1K3AA 4J96A 5AP5A 5EI2A 5EW3A 5TO8A 4NM3A 4XG7A 1M17A 4I6QA 4RA5A 2YABA 1GIJA 3MI9A 2RKUA 4AGUA 4ANOA 2C4GA 3NYNA 5CWZA 5EFQA 1W83A 2C6DA 4LI5A 3FBVA 1RE8A 3ZCLA 3K3JA 3NAYA 4IWQA 4L7SA 5EQYA 2XK9A 4C36A 4IM0A 1WBSA 4MQ2A 5A46A 3R8ZA 4DA5A 2XA4A 2YCSA 5TR6A 5HBJA 3LCOA 3MWUA 2OXYA 2WKMA 4QTAA 2R0IA 3R8LA 3QXPA 3AC8A 4IH8A 3T9IA 2Y9QA 2YZAA 2CNVA 3OF0A 4FF8A 4XP0A 5HVJA 2XKEA 3R21A 1F0QA 2OJ9A 2VZ6A 3EN4A 4GFGA 3BEAA 4IAKA 4QYEA 4MNEB 3O7LB 5EDRA 2PVKA 2Q0BA 4I6HA 3LFAA 2R3OA 5D10A 3BQCA 3KXZA 4S33A 5HG9A 5HO7A 3O8UA 2GHMA 4I0RA 4UB7A 2C6OA 4B0GA 5IMXA 2X39A 4YJRA 4O7TA 2PMNX 2PVFA 2FSOX 3CD3A 3HX4A 3WF9A 5LVLA 4CFFA 3NMUF 2HK5A 3CD8A 4FKUA 3PIZA 4DHJA 2GU8A 2ONLC 4FA2A 4RX9A 5AR5A 3ENMA 3Q4CA 2X6DA 2UW8A 4FTCA 4USEA 5F9EA 1WZYA 4FZFB 2X2KA 4O6LA 2V7AA 5IQIA 3ZC6A 1H1PA 1ZZ2A 1H28A 4APPA 4KNBA 3UG2A 1YXSA 4JT3A 4E6DA 5BVFA 3LLTA 2CKEA 4NJ3A 4BKJA 5D41A 4TL0A 1W8CA 3EQHA 2C3IB 2HY81 2JKKA 3LFFA 3O96A 3UMWA 4CLIA 5BUIA 3HUCA 3Q04A 2WOTA 3THBA 4TN6A 3UO6A 4HPTE 4BGGA 4O1PA 5B7VA 2DS1A 2J0MB 2R7IA 4ACCA 4L42A 4TZRA 4XEYA 4BZDA 3DKGA 3PJ1A 5AP4A 3TWJA 2VGOA 3RCDA 1KE8A 3EWHA 1KE5A 2QOBA 4DH1A 3LVPA 2OICA 3HAMA 2B52A 3PWDA 1OVEA 5DT4A 3I60A 2ITPA 1JKLA 3PFQA 5CU6A 4N6ZA 3VWAA 3HYHA 4CFNA 2GTNA 4GJ3A 4O4DA 1G8SA 4I41A 2YM4A 3Q6UA 3JPVA 3C4FA 4JNWA 2IZUA 4LV8A 5FDPA 4IZYA 3MIYA 4I5HA 4EYMA 5CVFA 3O51A 1OM1A 4IB3A 5AUYA 5AR2A 3EZVA 5AP7A 1UKIA 1H0VA 3CGFA 3H3CA 1GIIA 5TF9A 5A4TA 4EZ3A 2PSQA 3OTUA 4YZBA 2IG7A 3QQKA 3POZA 1WBTA 4LGGA 3VUDA 5CAVA 1OGYA 4CQGA 1WVYA 3LFSA 3L9PA 5KMLA 3U55A 5ANOA 5IMEA 5IA5A 2ERKA 5HBEA 2UZLA 3H4JA 4DTAA 5KKRC 3SOCA 3Q32A 4DDGA 2EXEA 2ZV9A 3R01A 1OKYA 4PQNA 5CU0A 2XMYA 4A9UA 4X6QC 3UE4A 2QI8A 4KS7A 3VUMA 3R1YA 5CX9A 3QZHA 3HUBA 5FXSA 5KUPA 3DKOA 5GZ9A 3UQFA 3EQGA 5DNRA 4LMNA 4YJPA 4NTSA 2G2IA 2Q0NA 3FMMA 4DGMA 4ZSGA 4AP7A 3QQJA 2IO6A 3QXOA 4FI1A 5BMMA 4XV9A 3LXLA 2YZLA 4X3FC 4WNKA 1JVPP 1YOLA 2JLDA 3BI6A 3DZOA 3WARA 2YM3A 4WBBB 5IA2A 5C4LA 3F3UA 4JRVA 5DOSA 4D2VA 3R7UA 5EDPA 4CRSA 4YPSA 4WUAA 4BDJA 4U80A 4P7EA 3FMNA 3NYXA 2Z7RA 4JDJA 4MCVA 2Z02A 4EOOA 3C51A 4NCTC 3R28A 4ASEA 2RFSA 5E8VA 4HVGA 2ZM1A 3L8XA 4DLJA 4TPTA 5JFSA 3O50A 1DI8A 2B1PA 2XB7A 3HDNA 3MTLA 1XJDA 4L7FA 5JN2A 3ORMA 4E6CA 4WOVA 2C6TA 4ZMFA 5B2LA 4EH6A 3W0RA 4Y8DA 3DB8A 4D58A 2OH0E 3ZXTA 3ZLSA 3IG7A 4PPAA 2W5AA 4FZAB 4DGNA 2XCKA 5AX9A 1NXKA 4DFXE 3TNHA 4AG8A 2CN8A 4NFNA 5CSHA 2HWOA 2ZVAA 2X9EA 2G1TA 3PE1A 3OTVA 5HX8A 5C9CA 5KBQA 3FZ1A 1DS5A 3NZ0A 4PTEA 4FNZA 2QODA 3AD6A 5M55A 3V3VA 4DFZE 5CSPA 5KHXA 3AXWA 5J9LA 4P5ZA 3F69A 4JBQA 1U54B 3RKBA 3ZM9A 3W0QA 3Q53A 3R71A 2XNEA 4FTJA 4H58A 2VU3A 2OSCA 2XK8A 3PJ2A 4LQMA 4FVPA 4Z16A 3OT3A 4W4WA 3W55A 3NNWA 2PMOX 5J7HA 2VTRA 4CCBA 3MY1A 5BNJA 2ITXA 4MEDA 3NUUA 2J0LA 3E87A 2GNJA 5HG5A 4IHPA 5BQ0A 1IR3A 4J95A 1H01A 4BCFA 3KEXA 4AW5A 2XM8A 3CLYA 3ZSGA 3TTIA 5E9EA 5BUEA 3IDBA 3LIJA 2Y4IB 4RJ7A 4TYIA 5EH0A 3R9HA 4OAVB 4O4BB 1OBGA 2CNQA 2CGWA 1OPJA 1P14A 2WMBA 4EJNA 2BZHB 3FQEA 3PA4A 4YHJA 2R3NA 2E2BA 5HOAA 3SQQA 2WEIA 4FKLA 3V8TA 3S00A 4FTAA 4I5MA 2XNBA 3D5UA 5C8MA 3BV2A 3FZOA 3KK9A 3NAXA 4MXZA 4YP8A 4R5YA 3Q4ZA 4GRBA 5C8NA 4W4XA 5CEPA 5HORA 3HV5A 3K3IA 3TNIA 4ZLYA 5M56A 3PVUA 4MTAA 2C5OA 2JDOA 1BLXA 1GZKA 3DA6A 3N4UA 2ONLA 3BRBA 3ENHA 4U97A 1VZOA 4K8AA 5J8IA 3RZBA 1APME 2GFSA 2ZAZA 4QT1A 2IVSA 2PZRA 5J79A 4G1WA 3R02A 5HVKA 3GC8A 3ZLYA 4FEQA 5JK3A 2C30A 3MVHA 3MBLA 4QMOA 4HCTA 2X7GA 4FC0A 4NM5A 4RJ3A 4QD6A 3Q5IA 4B6LA 4F65A 4XNEA 4MUQA 2WTIA 1ZZLA 3I7CA 4L52A 3IDCA 2WTWA 4AA4A 2VTAA 4PMTA 3VBQA 2WQOA 4RJ8A 3W32A 1YI3A 3SW7A 1U5RA 3KL8A 4MAOA 3C1XA 2W4JA 2XCHA 3Q96A 4FV5A 2VTNA 5AP3A 1PKDA 4DEGA 3TV7A 5E8UA 4R3PA 3UIBA 1W7HA 4FIIA 4DH8A 4I92A 5L4QA 4LL0A 4FKSA 4OT6A 5HNBA 1OIYA 5IKWA 1BYGA 4G17A 3UNZA 4D2PA 4YC8A 4FSTA 3G9NA 5FQDC 4B8MA 3SAYA 2JAMA 3DJ7A 3LW0A 4L6QA 1ZYDA 4J8NA 5HD4A 3EJ1A 4N70A 3V5JA 3SA0A 5CXZA 4PL3A 3JVRA 4X6RA 4JG8A 4XRJA 4QMNA 4X0MA 4ALUA 4C4JA 4G34A 4BC6A 3O8PA 3PXZA 4GK3A 3LCKA 2I0YA 5FEQA 1J7IA 3LZBA 4FMQA 4O0XA 3DNEA 4JQ7A 2PE0A 4FSMA 4QYGA 2WU7A 2YWVA 4K2RA 4FSQA 4YJSA 4JDKA 4BDBA 2WQBA 4C2WA 4GMYA 3W1FA 3TACA 2WTDA 3V01A 1PYEA 4XBRA 3BLAA 4XV3A 3A7JA 1YI4A 4HJOA 4I1ZA 2KULA 3WBLA 4D2TA 2YA9A 4JIKA 4BTMA 3G0FA 3V5TA 3U9CA 3VJOA 4DTKA 5JFWA 3F3TA 3EB0A 4UWYA 4YSJA 1Z9XA 3PRIA 3QAME 3W0NA 3II5A 4QP9A 1Q62A 4YLJA 2NNWB 1QPJA 2YIWA 2W5BA 3BHVA 5E8SA 3UYTA 5FXQA 4BI0A 4RVMA 2OGVA 1YKRA 2G9XA 4EOSA 3F3VA 3UC4A 3K54A 5L6PA 4JS8A 3SGCA 3D2IA 3BU5A 1JKSA 3EL7A 4DT9A 4FSYA 4KBKA 4ANLA 3RNYA 3UIXA 4EOMA 3DS6A 4GJ2A 4PNKA 5HTBA 4FIJA 2GNLA 2UW5A 4X3FA 2PVRA 3WF6A 3G2FA 4JDHA 2A4LA 2QOCA 4DFYA 4OAUC 2UV2A 1NT2A 5FD2A 1R0PA 1WBVA 2ITTA 1REJA 3ETAA 5DGZA 3QUPA 4FGRA 4QDEA 4C35A 5KZIA 4BI1A 4DEDA 5DEYA 1Q24A 3UDTA 5AUZA 2JGZA 2W99B 4FKOA 1YQJA 2J9MA 4FUXA 2BZIB 1SZMA 3FKNA 4EC8A 3OEFX 5IF1A 3AT2A 4L3JA 4NCTA 2ETMA 2YEXA 4ARKA 4YHTA 4BFMA 3R30A 4DDIA 1UNGA 3S3IA 2PTKA 3EN9A 4D1XA 5J9ZA 3O5AA 4CYJA 2P2IA 1LPUA 2PMLX 4IX3A 4AAAA 2J6MA 3PXFA 3TKUA 2OJIA 4NH1A 4QEBA 2QLQA 4X7QA 5H3QA 5JGBA 3GU5A 3BWJA 4DEAA 2XKFA 3E5AA 3DU8A 3L9LA 4M69B 1JAMA 2WQMA 4CSVA 5JSMA 4MD8E 3R04A 2X9FA 5HIDA 4ZTHA 5ACBC 3VBWA 5CQWA 3LCDA 4ZP5A 2X4ZA 3UNKA 3OC1A 4FV8A 4ZAUA 2WTKB 2HZIA 5HCXA 4FT9A 1XBAA 1JQHA 3F61A 4AX8A 1CKIA 2W17A 4EWHA 5J5SA 4BDIA 4EOPA 4C34A 3GOKA 3U6IA 4FKQA 4D0XA 4D4SA 1T46A 1ZMVA 5CU2A 1W0XC 2WMUA 3ZO4A 2BCJA 4GW8A 4EEVA 2YCRA 4Y5HA 3LFEA 5CSVA 5FP5A 1OPKA 2Y6OA 4EKKA 2QVSE 3KFAA 3OBJA 4XG9A 4Q5HA 5LJJA 1MQBA 4HZRA 2GMXA 4EK6A 2IF8A 4EWQA 4YU2A 3P5JC 5AFVA 4Z55A 3BYMA 4M84A 3C4XA 2UVZA 4R7HA 4U41A 1URWA 1DM2A 4BDKA 1JKTA 1CM8A 1RW8A 2OH4A 2XBAA 3JY0A 3MY0A 1KOAA 4BZNA 3RPOA 3GC9A 1VJYA 4IVBA 4AZTA 3AC5A 4L01A 4RWKA 2R5TA 4IE9A 1OL6A 3D5WA 5J87A 2X6EA 2ITUA 3CIKA 3OROA 3PVBA 4NKAA 1LEZA 5HQ0A 2AQXA 5IH5A 4EL9A 1HCKA 3CQEA 3R7GA 4W8EA 3GBZA 3SXRA 4MF1A 2P2HA 4C3PA 4C4GA 3PRFA 5LMAA 3NNUA 5EM6A 4RT7A 4F6WA 2E9VA 3LOKA 1W2FA 2R3PA 2E9UA 3FZSA 3GCQA 4ENXA 4BCIA 2IJMA 4M14A 5E7RA 5HKMA 3VIDA 2RSVA 4U3YA 4R8QA 3UIMA 4AE9A 5BPYA 3MVJA 2PZYA 4FK6A 3CE3A 4CYIA 2CGVA 2UZBA 2X4FA 3UOLA 3U54A 5HU3A 4RFMA 5AWMA 3HV4A 3UMXA 2IEWA 5I3RA 1YXTA 2IW9A 4FTUA 3BHYA 2C47A 4O6EA 3CJFA 2OZAA 4EH9A 3FWQA 1ZYCA 2C68A 2VTPA 2ZMDA 5K4JA 2EU9A 4QTBA 5EOLA 3DKCA 3MPAA 3OFMA 3S2PA 2WEVA 4BVUA 2YIQA 2XYNA 2UW7A 3VW6A 3LXKA 4FT7A 2HZ4A 5E91A 3EZRA 2W9FB 4PMSA 1OPLA 3FMEA 3QRIA 4F09A 2GSFA 5HZNA 5KHWA 5AX3A 5AV4A 4RC4A 5J7BA 1ZYSA 4B4LA 2C5VA 4P4CA 4YTIA 3CTQA 3FLSA 2UW3A 2I0HA 1XH4A 1I09A 3EKKA 3NUSA 4HYSA 1Y8YA 4IQ6A 4EK4A 3GC7A 3GQIA 3HA8A 3JYAA 4M0YA 1AD5A 5DT3A 4CG9A 4OLIA 1XMLA 1M7NA 5A4EA 4GEOA 3KXHA 4EZ5A 1ZYLA 3C4CA 4QTDA 4KA3A 5FUTA 1PXKA 4DHZA 2OW3A 3QD3A 3CGOA 4F78A 4E6QA 3O7LD 3ORNA 4MKCA 3IW5A 4LUDA 3HEGA 5LWMA 2XS0A 1JPAA 1FVTA 2YISA 2YLFA 3U8WA 3BV3A 4IZ5A 1H1RA 3P9JA 3FXWA 3IKAA 4PP7A 2X8DA 4FG8A 4U9AA 2GHGA 4HYUA 2DWBA 2QURA 4QMUA 2C1BA 3MV5A 1YXVA 5A4LA 5DPVA 4XJ0A 4JXFA 2HYYA 4OR5A 2OWBA 4IW0A 4IB0A 2QU5A 3UODA 3R8UA 1Q8WA 4O4CA 4I22A 2JFMA 3IQ7A 2VX1A 3A2CA 4ZZMA 1PY5A 2B53A 3FUPA 4DGOA 4F0FA 5BVWA 5EQPA 4G16A 3SHEA 2GQRA 2J0JA 4L9IA 4HPUE 2FSTX 1O9UA 2W1EA 2XF0A 5AV1A 3AGMA 5GJGA 3C0HA 4FVQA 4F0GA 4ERKA 3UYSA 1T45A 3OY3A 4TYJA 3VAPA 2PUUA 3NYVA 3E8CA 4RSSA 2G15A 5JGDA 3E8NA 5FTGA 3MFRA 2BTSA 2OJGA 4UALA 3RI1A 5LMKC 2PL0A 3NUXA 4KKEA 5EYMA 4QMQA 4E4MA 4FKRA 4ZZOA 4WIHA 3A99A 4RZVA 3FY0A 2BKZA 3QQLA 1QPCA 4K6ZA 5AIKA 5GIPE 4MH7A 4IBMA 4IVCA 4XG6A 1GJOA 3RBWA 4LOQA 4RC3A 4TWOA 3AKLA 5EG3A 2GS6A 5F20A 4EOJA 5CF6A 4MBIA 3QUDA 3LPBA 4TYGA 3R22A 2W4KA 3FI3A 3BEGA 4WT6A 4CKJA 2VWBA 2CLXA 3E88A 4O7VA 3VVHA 3VQUA 1URCA 3MIAA 3ZDIA 3RGFA 2JBOA 5K5XA 4CMUA 1H4LA 2YWPA 4EQMA 1ZAOA 2RFNA 2GQGA 2F57A 1IRKA 5AAEA 4DYMA 4BF2A 3LQ8A 3RINA 1IAJA 2QHMA 5IUIA 3PPKA 2I0EA 1OUYA 2O2UA 4FIEA 4AZEA 1IA8A 3ET7A 3TI1A 5HEZA 3M2WA 2BHEA 3C4ZA 5M57A 4IMYA 4XLIA 4O2ZA 2WNTA 4G2FA 2QQ7A 3OP5A 5EM8A 2QG5A 3ID6C 2WMTA 4FSWA 3VUGA 4DH5A 3MS9A 3TJCA 3V5QA 1AGWA 1NA7A 2W5HA 2UUEA 3EOCA 4TWPA 4W9WA 4GUEA 5A54A 5CEMA 2I40A 4FKPA 4FZ6A 5AV0A 3P23A 4IEBA 4O96A 4E6AA 4EORA 4QPMA 4D9TA 4LRJA 5K0XA 3H9FA 3ZSHA 2ITYA 2PUNA 4WRSA 3OS3A 4QYHA 3ZRKA 4KKGA 1ND4A 4O7NA 3P4KA 3VS4A 4LRMA 3TTJA 2GS7A 3HV3A 2O65A 3CTJA 3GFWA 3PZEA 3UP7A 5J1VA 2XP2A 3DXQA 4AXDA 4K1BA 1M14A 4L68A 3O2MA 4M97A 4J97A 5H2UA 3VUHA 3QC9A 4AA0A 5IEXA 3IOPA 1G8AA 1FGKA 3NVMB 1Q4LA 5CEKA 4QDVA 3ZEPA 3BYUA 3MVLA 3GQLA 3DGKA 2BZKB 3NIZA 4BB4A 4F1OA 4RIOA 2BAJA 5ITAA 4NJDA 1YWNA 5IISA 3DLZA 4U45A 4I4EA 5LOHA 5CASA 3RJCA 1Q8YA 4B8LA 1OECA 3SG8A 4QMZA 4ZXTA 4FNYA 3AMBA 3QCYA 4KS8A 1ERKA 4OTHA 4UMQA 4WG4A 4C2VA 5IG1A 2V7OA 3UZTA 4Y73A 3TEIA 4FYOA 4BBMA 5H8EA 5HE0A 3VS0A 2HAKA 3HGKA 4WSYA 4O7SA 2PVNA 4RFYA 4H3PA 3FMDA 3TCPA 3VONA 3TUDA 2XARA 4BDDA 3DT1A 1SM2A 4ACGA 2GTMA 3QTWA 3ZFMA 2HENA 2VGPA 4C0TA 4JVGA 4NKSA 2F2UA 4RRVA 4YZ9A 2ETRA 4C57A 4ZS4A 4IAFA 4CFWA 5LWNA 3I79A 1NY3A 5E90A 5AUUA 1XMMA 4I4FA 2VTLA 2WIPA 1U46A 3A62A 3ZUTA 5IA1A 4O7ZA 1OL2A 3DDQA 3K5VA 2IVTA 4KIQA 4CV9A 1B38A 2EB2A 1WBNA 2B54A 3MJ2A 1UNHA 4I0SA 4LGDA 3QD0A 3COKA 4RC2A 4DF3A 5AV2A 3S4QA 1Q8TA 4C62A 5GNKA 2WMRA 4D5KA 4O81A 3ZSIA 4DG3E 5KMKA 2XM9A 2HELA 3W2CA 3EH9A 3FMHA 2FO0A 1UNLA 2WB8A 3NEWA 3QTUA 4I93A 3VJNA 5CENA 2XIZA 2EXCX 3JS2A 5CEIA 5M07A 4BR3A 3UQGA 5M4IA 3F5UA 3SD0A 3D4QA 4BI2A 1R3CA 3ORZA 5D9HA 3CS9A 4PF4A 2F4JA 3ZLWA 3WYXA 4ZTLA 3V51A 1PJKA 1WVXA 4N57A 4RX7A 1YVJA 5HBHA 2CCIA 3BPRA 4FBXA 2OI4X 4TYHB 3M11A 4WHZA 3QYZA 3VHKA 4UN0C 1FVVA 4EKLA 5L2TA 4PX6A 5KZ0A 5F94A 3VF8A 4R78A 3AD4A 3BYOA 4PWNA 4RA4A 4UYNA 4RIWA 5HGIA 3HLLA 5HLWA 5F1ZA 2BPMA 5DR6A 2A1AB 3VBTA 5LARA 5GHVA 4AN9A 5KX8A 1JSUA 1OITA 5HHWA 3G6HA 5H8GA 1QPEA 1QMZA 4QNYA 3R7OA 3ZOSA 5E1SA 4OTGA 4H1JA 2E9NA 2PULA 2X8EA 4F7LA 1B39A 2QO7A 4UEUA 4F9CA 3MH1A 5KMNA 1TFFA 5J1WA 5LCKA 3SDJA 2UVXA 5TKDA 5LMKA 3MB6A 4G3EA 2C0TA 3DZQA 3HMNA 1MUOA 3QHRA 4LM5A 1KSWA 2OZAB 4RJ5A 3VNTA 3QD2B 4RIYA 2UZDA 3KRLA 1A48A 1QCFA 4FOBA 3GC0A 3L8SA 4YC3A 3DXNA 4FV0A 4YBKA 3RHKA 4BKYA 2C5XA 3DK6A 4DCAA 2QONA 3DOGA 5JKGA 3DBQA 1KE9A 4H1MA 3LMGA 2OU7A 4JAIA 4DHIB 4ZSEA 4OBOA 4JOAA 3DBEA 3QRJA 5JGAA 4LMUA 4W4VA 5LVNA 4FK3A 2VTSA 5AJQA 5CQUA 2FSMX 3KMMA 3ZXZA 3MY5A 2QKRA 3PA5A 5AV3A 2J4ZA 5H9BA 4EJ7A 2YM5A 4HGEA 3ZTXA 4R7BA 5IH4A 4II5A 4RG0A 4YLKA 4EHVA 4DG2E 4RZWA 4J1RA 5GJFA 3KKVA 4G5PA 4GIHA 3M1SA 4F7NA 5ANJA 4FUYA 3NNXA 2UZNA 4YSMA 3HVCA 4HW7A 3FYKX 1SNUA 4ACHA 4NTTA 4Y46A 2WFYA 3SRVA 2Q83A 5DHJA 4FTNA 3KQ7A 4WD5A 3WZDA 5I9ZA 5CTPA 5CANA 2IZRA 3PUPA 4HYHA 1OL7A 3QALE 4YJNA 2X8IA 2JIVA 5I9XA 2C5YA 2QNJA 4YURA 3PIXA 1OGUA 4ZJIA 2QOIA 4XG2A 5IA0A 5L8KA 4XV2A 3BLRA 2I1MA 5DEWA 4IJ9A 3ZRMA 2BRHA 2IN6A 2JAVA 2Y8OA 2YCFA 2JKMA 4AWIA 4ENYA 5A6OA 1BL6A 4S32A 4FKGA 1UU7A 5ACKA 4DGGA 5DRDA 2W96B 3PXYA 4IWPA 2BVAA 3FL5A 4V05A 1KE7A 5AIRA 3VBVA 3FMLA 2J90A 4E73A 4U0IA 3RWQA 3GB2A 5JEBA 3W10A 4YNEA 4PMPA 3KRJA 2X1NA 4WO5A 5H8BA 4XMOA 2R3FA 4B99A 4WSQA 1LR4A 3GU4A 3G15A 4A4XA 2CGUA 1YDTE 3DB6A 5T6KA 4BHZA 2XH5A 4EOIA 4AOIA 5J9YA 4JBOA 3GFEA 3UOHA 4A9TA 3VS1A 4UV0A 1BL7A 1QL6A 3PXQA 4K33A 1IEPA 2CN5A 2W1ZA 2BRBA 4M8TA 2Y6MA 4HVDA 3SG9A 2FGIA 3LMIA 3Q5ZA 3Q52A 1IASA 3FV8A 3WIKA 5DLSA 4FTTA 3DLSA 4BDGA 4DEEA 3P7BA 4CMTA 4F6SA 5HG8A 2Y0AA 4FSRA 4ITIA 3KCKA 1JLUE 4JQEA 5DG5A 3OWKA 1ZY4A 3ANQA 5GZ8A 2GPHA 3P08A 4LRKA 4CTBA 2XK6A 2FYSA 2Y7JA 4DLIA 4F08A 3A7FA 3JVSA 4FEXA 3ACKA 4J71A 4DBXA 4IACA 4BCGA 3G5DA 3IONA 1JKKA 3P1AA 3PE2A 4O0WA 3PA3A 3OOMA 2RIOA 5A4CA 4DITA 1V1KA 3RPSA 3OCGA 4DHFA 1BI8A 3TG1A 3DAJA 2X7FA 3ROCA 1A9UA 4KWPA 2GNGA 4O1OA 3AOXA 4NM7A 3R1QA 3FYJX 2CKOA 2OZOA 4ZY5A 1O6LA 1WVWA 3D15A 3UZPA 3PSDA 5T3QA 4AUAA 3LXPA 2QOQA 4I20A 3L8VA 3GNIB 4MXAA 3NPCA 2HY0A 2ITNA 2H6DA 4WNPA 4O7YA 1TQPA 3GCUA 4USFA 4BGQA 2V0DA 5L8JA 1UWHA 4NIFA 2QO2A 3ZEWA 1PXJA 4QRCA 2CNUA 1J3HA 2DYLA 2VN9A 1H26A 4V04A 3BHTA 5CY3A 5E8ZA 4RBLA 4HVIA 4ITHA 2GHLA 4R5SA 4LOOA 2C1AA 3TDWA 2CHLA 2P33A 1NVQA 3FE3A 5AP6A 5F95A 2B7AA 3F3ZA 3OOGA 1AQ1A 4WNMA 4GFOA 1H25A 4D1SA 2GDOA 5AP2A 1F5QA 4ANSA 3HP5A 3S95A 4JI9A 4X21A 2O64A 5M4UA 2ZOQA 2GNIA 2NPQA 3W0MA 4D55A 1XHAA 2PZPA 4F7SA 2QLUA 3DJ6A 2HIWA 3I6UA 3BHUA 3P79A 3WZKA 4FTIA 2X2MA 4BCJA 2R9SA 3QGYA 4UMPA 4QP7A 3P78A 4R6VA 4ALVA 4EOKA 1WMKA 4EOLA 4WG5A 5ETCA 4EUTA 2BRGA 2W1GA 1YHWA 4QMMA 3B8RA 3EFWA 4FIGA 4JQ8A 3CR0A 1L8TA 3ELJA 4OGRA 4RLKA 1G3NA 4CZTA 3R9NA 2FA2A 3P0MA 3F2RA 2PUIA 4H39A 3W2RA 4R3CA 3CJGA 1XH5A 3KVWA 1GOLA 5IEVA 3QCSA 3FKOA 4MHAA 1PMNA 5G1XA 5TE0A 5LVMA 2B9JA 3W8LA 3CY3A 3FSKA 3E7VA 3KULA 4Y85A 1YDSE 3D9VA 4FTOA 4IX6A 4YZMA 3VQHA 5JH6A 4C37A 4O0TA 5DN3A 4HVSA 5ANIA 3FQSA 2YDIA 2AYPA 4QTEA 1XBBA 2W05A 2WMVA 4FL2A 3ZUUA 3PXRA 5JRQA 3T3UA 4BTKA 3FLQA 4YLLA 5M4FA 3DBCA 4UMUA 4FNXA 2JKOA 2PYWA 3BLHA 2VV9A 4I24A 4KINA 1TQIA 5HNGA 3ZS5A 4RWJA 1M2RA 4ANMA 3A61A 4IAIA 4ZOGA 3NIEA 3PYYA 4QP4A 3NDMA 3E93A 5A3XA 2QR7A 3NW6A 4EBWA 3FI8A 3R7VA 3RWPA 2ZFYA 1UA2A 5IQGA 3I0OA 3BX5A 3PVWA 4U3ZA 3PJ3A 5IA4A 4ZK5A 4N6YA 3UVRA 3PFYA 4NWMA 3PIYA 3C13A 4OTFA 2XVDA 4JR3A 3DFCB 4XG4A 1ZYJA 2OO8X 4BHNA 2VO6A 1YOJA 1ZMUA 3LFDA 4L00A 3QTIA 4JX3A 4QQCA 4RIWB 1ZXEA 3OUNB 2VWIA 4G6NA 3RM6A 3ZRLA 4PL5A 4L46A 5HO6A 3TL8A 4OTIA 3CCNA 4FV9A 4BDFA 4XBUA 3W0OA 2QO9A 4EQCA 4RQVA 4R1YA 3ANRA 5I9WA 4PDYA 3EQIA 4AS0A 4USDA 3QWJA 4HGSA 5DFPA 3KA0A 4CT2A 4L45A 4ACMA 4DC2A 2IZTA 4AZSA 4ASXA 2JBPA 5M44A 4UZDA 3TNWA 5IH6A 2ZB0A