3KULB

Kinase domain of human ephrin type-a receptor 8 (epha8)
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
273
structure length
271
Chain Sequence
TREIEASRIHIEKIIGSGDSGEVCYGRLRVPGQRDVPVAIKALKAGYTERQRRDFLSEASIMGQFDHPNIIRLEGVVTRGRLAMIVTEYMENGSLDTFLRTHDGQFTIMQLVGMLRGVGAGMRYLSDLGYVHRDLAARNVLVDSNLVCKVSDFGLSRVLEDDPDAATTGGKIPIRWTAPEAIAFRTFSSASDVWSFGVVMWEVLAYGERPYWNMTNRDVISSVEEGYRLPAPMGCPHALHQLMLDCWHKDRAQRPRFSQIVSVLDALIRSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Ephrin type-A receptor 8
publication title Kinase Domain of Human Ephrin Type-A Receptor 8 (Epha8)
rcsb
source organism Homo sapiens
total genus 83
structure length 271
sequence length 273
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2009-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3kulB02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3kulB01
4IWQA 5IQIA 3BIZA 4NM3A 1GIHA 3E64A 4NW5A 1JVPP 3DU8A 3V6SA 3AOXA 4XOZA 3UQGA 3I7CA 1IRKA 3DV3A 5CSHA 2IZRA 3ZLXA 3CR0A 3FI4A 4I4EA 5AUYA 5E8YA 2R3RA 5KMJA 1NVSA 3MTLA 4IWDA 3FPQA 2ZVAA 4FC0A 3PJ1A 4G9CA 4JBQA 4O96A 1TKIA 3O8PA 2VTPA 1ZOHA 3U8WA 3G6HA 3ZO2A 1Q41A 1OKVA 3ID6C 3KN5A 1ZMVA 3VS6A 3C9WA 4EUUA 3GQIA 3ZYAA 5A4QA 1ZYLA 2Z7RA 3HRBA 4FSYA 3Q4UA 4JQ8A 3UO4A 3FYKX 4O7WA 4OTHA 4QNYA 3ZM4A 2C68A 3PA5A 5IZFA 3T3UA 3ZS5A 1JKTA 2PUUA 3AC4A 5CU6A 4IB1A 2F7EE 4PNIA 1CDKA 1OI9A 1TQMA 2RIOA 5J8IA 4I6BA 3DNEA 3W8LA 5EOBA 4XEYA 4FV3A 2EXMA 4CFFA 5BYYA 3BX5A 4EOQA 3ZH8A 3KXMA 2JDVA 3HGKA 3IW6A 4WNMA 4ZSLA 4DH5A 5KMKA 1QPEA 4QTDA 3FHIA 5DVRA 3CQUA 4WD5A 2EUFB 2HWOA 3HZTA 2W5AA 1NY3A 3VW8A 5GZAA 2YHVA 4AN2A 3DDQA 4F63A 3GENA 4QMLA 4DGMA 3WZKA 4YTIA 4TTHB 2OSCA 3R7EA 5IQBA 2SRCA 3C13A 2F7ZE 4CVAA 4O21A 4XHKB 3A7FA 2HIWA 3E88A 4CXAA 3BGPA 2OXDA 5HVJA 5KKRC 4FL2A 1K9AA 2HOGA 4LL5A 4PDOA 4QP9A 4X3FC 3SW4A 4D55A 4GRBA 3HYHA 5AP2A 5JEBA 3F88A 4USDA 1GIJA 1MQ4A 3PG3A 4GJ2A 4DEBA 4DEEA 1FVRA 2XNOA 3TCPA 1PXNA 4KKEA 1OL7A 3L9NA 3B8RA 3OCSA 4RFMA 4FEUA 2QI8A 3Q32A 3A7GA 3MVJA 4MF0A 4DLIA 3C4WA 3R73A 4FTCA 4ACHA 2C1BA 3TT0A 4QTBA 4XG8A 5CSWA 4UMQA 4Y5QA 2YM6A 2J50A 2VX0A 2VAGA 4XG6A 2YM7A 1GZ8A 4Y5HA 4ALWA 4C62A 4YR8A 4QPAA 4M12A 3VRZA 5FBOA 2GCDA 5HNBA 4L01A 2YIRA 2F2UA 4Z9LA 4M14A 3TZ9A 5IUHA 4PP7A 2B54A 2OG8A 5FDXA 2ITTA 2VRXA 3BYSA 1EH4A 1YOJA 3GU4A 1MRYA 5H8EA 3RK7A 3MH2A 5A4CA 5D12A 4ZSJA 1WMKA 3IOKA 2C0TA 3KXZA 2Y6OA 4R3CA 4CD0A 1WFCA 4RZVA 4FSQA 4I92A 4FIIA 4JVGA 1PW2A 3OS3A 3LCOA 1XH9A 4BIEA 4X6QC 3ZOSA 3SHEA 1F5QA 2OICA 4FKQA 4BL1A 3UODA 3AD5A 3QQFA 5L2SA 2ZAZA 1YWRA 4FZ7A 4BTFA 5JMSA 1XJDA 1Y91A 5CZHA 1NA7A 1JKSA 2BHEA 4LGDA 4OGRA 1JQHA 2GQRA 3CP9A 4BCKA 4KBCA 1Q24A 5B2LA 3DBDA 3KK8A 4X7QA 5HE1A 1GJOA 4KB8A 4YJPA 4HNFA 4FV7A 3FQEA 1SM2A 3POZA 3R28A 1J91A 1F0QA 1OMWA 3EFLA 4XUFA 4AOIA 5LMKA 3R21A 4F6UA 3WIKA 4QMUA 4FNYA 4Y85A 4R8QA 4A4LA 3EWHA 3BYUA 1SNUA 3KXHA 3C0IA 3CC6A 4B0GA 2W7XA 5CI6A 2QCSA 4YJUA 3OC1A 2F4JA 2XKFA 3TV7A 4HYUA 3FZSA 1LP4A 1VYWA 4QP2A 3LMIA 5BVKA 3VUMA 3QZGA 4A7CA 1H1QA 4MWHA 4FNWA 4AUAA 4EHVA 4DHFA 4NCTA 4EZ5A 4GT3A 3F5UA 4K2RA 3FZTA 3GFEA 2OF2A 3R0TA 3QA8A 3QX4A 3RGFA 3ORXA 3DAJA 2JKQA 3R1NA 5ETCA 5HOAA 1UU8A 4FMQA 3LCKA 5JH6A 5AP0A 3TKUA 5IH6A 4GCJA 1ZRZA 2X8EA 4W8EA 5EQPA 3CEKA 5FP6A 4UB7A 4DTBA 4DN5A 4TL0A 4NH1A 3CS9A 5JGBA 4BYIA 3G15A 3BWFA 1A48A 5AX3A 2IWIA 5IUGA 3VS3A 2W17A 3NDMA 4FVQA 3G0FA 2JBOA 2X4FA 3C0GA 2YM4A 4BBMA 4UWCA 3ZHPC 1OL5A 3RVGA 2DS1A 1JBPE 5C4LA 1WZYA 4W9WA 1Y8YA 2H9VA 5CWZA 3TNWA 4PNKA 5HU3A 4C36A 4FKVA 4C4IA 5AX9A 3NVKI 4C61A 1J1CA 3EZVA 3UQFA 3K2LA 2BKKA 3DT1A 3R7YA 4FT3A 5DT0A 4IZ7A 2C6MA 3KRXA 3D7ZA 5IEXA 3QCSA 4AX8A 3OF0A 4ZLZA 1PYEA 3NW5A 4D2SA 3VUDA 3COHA 3CXWA 2AYPA 3K3JA 4U5JA 4OTQA 4CG8A 4D2VA 4FTJA 3RNIA 1H26A 2OXYA 3OWKA 3BLRA 4BGGA 2G15A 3OBJA 4FKIA 2EB2A 5EM6A 5GHVA 5CEKA 4C4GA 1PHKA 4EK4A 2XK7A 2ESMA 2QD9A 4JX7A 4MD9E 3HECA 2WQOA 4FNXA 3UO5A 4FICA 3FXXA 3FYJX 3TIYA 2DYLA 2VO3A 3MIAA 2ZMDA 3W2PA 3WIGA 5IA1A 4KS7A 4BY9E 2VTSA 3A7HA 4GV1A 4QD6A 2VNWA 4FYNA 4LOPA 3W2CA 5HTIA 4O83A 2QQ7A 1Q4LA 3E8EA 2BKZA 3ORLA 4IHPA 4DGLC 3R02A 3DFCB 4LRJA 4ZOGA 1PKDA 1QMZA 3AT4A 3SXRA 5J9LA 2YCFA 2ZMCA 3MGYA 5DT3A 4EHEA 5KX8A 4E4NA 3S95A 1QPCA 5TOZA 4RWJA 4S2ZA 2WQBA 3GNIB 2QHMA 2OH4A 4IDTA 4MHAA 5A4TA 3DB6A 3GC9A 2B53A 4WG4A 1BKXA 3GT8A 1Y57A 4ENYA 5AUWA 5I9XA 4IWPA 3Q4CA 1VZOA 1PF8A 4RC2A 2VU3A 1YHSA 3MVLA 4II5A 2PVKA 5AR7A 2IW9A 4DGOA 5J9YA 1Q5KA 2IVVA 4FK3A 4LYNA 4E5AX 3SOCA 5IA4A 3DBEA 3P23A 5CAVA 3G5DA 5M06A 3F2AA 5AV3A 1QPJA 3GCVA 3PXFA 3OUNB 5ANKA 3FBVA 2RGPA 3UIBA 3GOKA 3LFDA 4IAFA 3PDTA 3EZRA 4YJVA 5B2KA 4F1MA 3SC1A 2X8DA 3F82A 3PZEA 5IG1A 4BDBA 2WQNA 4YJOA 3O7LB 4TWPA 2CN8A 3VBVA 4EH5A 3R6XA 5DR9A 3IDCA 4FGRA 5FGKA 3ZSHA 2QURA 2C6LA 4IAKA 3V8WA 4LUDA 1BYGA 3ZC6A 5BUJA 3CTJA 2R3GA 2W1DA 3LFSA 4K8AA 2C6EA 2GNGA 2Z2WA 4L53A 4HZSA 4IX4A 3RK5A 2ITUA 4AT4A 3PUPA 3JXWA 4BWPA 4QMXA 1PXLA 4IX6A 4LUEA 5HBHA 2ZM3A 4MD7E 1PXPA 4M69B 1H1PA 4D28A 1T46A 3D9VA 3U6HA 2BR1A 4TNDA 4BDGA 3IDPA 4U0IA 5HG5A 2HW7A 3D7TA 4UN0C 3SA0A 2YJSA 4YZNA 1V0OA 4YZ9A 3ORNA 2YDIA 4NKAA 2PSQA 3ZBXA 3COKA 3F7ZA 4FEWA 3WZJA 1TQPA 2YDKA 4M13A 5E1SA 3P79A 4BTMA 3BU6A 4L68A 4L8MA 4JG8A 4ZAUA 3WE4A 4PTEA 3DQXA 2PE0A 4X0MA 4IFCA 3QKLA 3RCJA 2ITXA 5AP4A 3V01A 5CASA 3FMEA 2WMRA 3DQWA 3FKLA 5D7VA 1M17A 4GUBA 1ZXEA 3D5VA 3MSSA 3Q9ZA 1GZOA 4LMUA 4TYEA 5EI2A 2XJ0A 4WSYA 2CCIA 5EM5A 3EB0A 2FSOX 2JDSA 3R22A 5DN3A 3HV5A 4DH1A 5JT2A 5HBJA 2PE2A 3F7WA 4YC6A 3PXYA 3R8UA 2XK9A 3TDWA 1TQIA 4MBJA 4CMUA 1IAHA 3VS4A 4D1SA 1Z9XA 4D5HA 1ZY5A 4BZOA 3QKKA 1Q99A 5CEMA 5J1WA 1CSNA 2XS0A 3BU3A 3PY3A 4DC2A 4G5JA 4C38A 4O7TA 1WVXA 3HEGA 1UU7A 2JEDA 2VTQA 3U4UA 4C37A 4RSSA 5A6NA 2OIDA 5DT4A 2WQEA 5AR5A 4ANNA 5A4LA 3PIXA 4H3PA 4ERWA 3PJ8A 5ICPA 4H05A 3PPZA 4FIFA 1R0PA 1YXSA 3RPYA 2OKRA 4G6NA 4FR4A 4U3ZA 5HD4A 2B4SB 4JL9A 2P33A 2XF0A 3VBWA 3BHTA 4IADA 4GFGA 4IVBA 2QU6A 2PPQA 1BL7A 4G9RA 4AFJA 3UOJA 4PQNA 4WG5A 4OTDA 2QC6A 5K4JA 3Q96A 5IUIA 1Z57A 4QT1A 2PZ5A 2ERKA 3OOGA 4BBEA 5EKNA 4MYGA 3UZTA 4TPTA 4YUQA 4RC3A 4LL0A 1PMUA 4R6VA 4ITJA 4F64A 2VZ6A 2JITA 3FL5A 3PJCA 5DNRA 5L2QA 4D2RA 5FDPA 4AW5A 1UKHA 1DI9A 3P86A 3L8PA 2AC5A 4NUSA 4QMQA 4O38A 2ZB1A 4ERKA 4O2PA 2YAAA 3R1YA 5E8ZA 1Q8UA 2I0VA 2WU7A 5CEPA 2XNNA 4EI4A 2Y0AA 3KXNA 3EQFA 3MDYA 3PZHA 4NCTC 3RPSA 4BDKA 3RP9A 4YJSA 1A06A 3BV3A 4RIXB 4WIHA 4XG4A 3PRFA 4G3FA 3W2OA 2WIHA 3F3WA 3P7CA 4BTKA 4EH6A 5JQ5A 3U55A 4EHGA 3BBWA 4FZ6A 5FTOA 4XMOA 4OBQA 3OD6X 2BZJA 3Q53A 4CLIA 5FEQA 4I6FA 5AUZA 5TR6A 5LVMA 3QALE 4FV0A 2VX3A 4D58A 2G01A 1H01A 2QKRA 3GU7A 4OTWA 3UP2A 2JLDA 3H0YA 3QYWA 4MTAA 5HNGA 4ZY5A 4GG7A 1ZYSA 3LCTA 1REJA 1ZAOA 5E8TA 3UG2A 2OFUA 4HNIA 3ORZA 3COIA 4QQTA 1ERKA 2NNWB 2WEIA 1YOLA 2VWIA 3BHVA 4ZTSA 4YZBA 4AA5A 5GINE 2X2MA 4USEA 3NYNA 5M56A 3FL4A 3A99A 2BHHA 4EUTA 4O84A 3G0EA 3IECA 2XP2A 3MH3A 4FSNA 5TO8A 3RPOA 4X6RA 4QMPA 1OBGA 3RPVA 2VX1A 2W99B 3ROCA 4W4YA 2PULA 3MA3A 4F9BA 4YTFA 1OPLA 4FSZA 5LXMA 1OKZA 3HUBA 4O0WA 2GNLA 1IEPA 4GW8A 2QOBA 4IIRA 4D2TA 4E3CA 2GQSA 5F4NA 4D9TA 4AE6A 3PPJA 5JFSA 4YSMA 4F0FA 5M55A 1BL6A 4JBOA 4U43A 3OWJA 5GIPE 3PLAE 3PFQA 5CVGA 5GJGA 5CT0A 5EW9A 2WAJA 3JUHA 5LVLA 5AWMA 2OH0E 1G3NA 4Y72A 2AUHA 2GHLA 5J7HA 2ZV7A 2BUJA 2IPXA 4M15A 4W4XA 2QNJA 3U4WA 2XM9A 5LCKA 1XH8A 2UVYA 2BZKB 3MESA 2BFYA 4U79A 2OJGA 3C4ZA 4N6ZA 3UIUA 4TWOA 4EHZA 4AZSA 5LMBA 2UW5A 3AGMA 4K33A 2OFVA 4NYEA 5BVWA 3VIDA 3F2RA 3RHKA 4AT5A 5J1VA 1OIRA 2B1PA 4AXAA 4GFOA 4LG4A 2CGUA 1BI7A 4FTNA 4AF3A 3W55A 5IQEA 3D94A 4J98A 5AV4A 2G2FA 3OW3A 4O0YA 4BDFA 3FKNA 5TF9A 2J4ZA 4I1ZA 4BR3A 2GNIA 3NNXA 4RZWA 5CAPA 5J95A 4GJ3A 2EVAA 4JX3A 4XV1A 1H25A 3W2QA 3DOGA 3HV7A 4KBAA 4G16A 2XEYA 3I6UA 3O2MA 4EH4A 3FXZA 3TWJA 4UMPA 3PSCA 2BMCA 2RSVA 2Z60A 4GFMA 4C34A 4JDIA 5CF5A 3ZMMA 3AGLA 4MQ1A 3PP1A 3E8NA 3WF9A 2EWAA 2O5KA 4FV9A 4BKJA 1IASA 2IO6A 3QQHA 2WMWA 4I0RA 2Q0NA 4GU9A 4GYIA 4OLIA 3UIXA 4C3FA 2VTMA 2WTVA 1FQ1B 2OLCA 1UU9A 1FVVA 2R7BA 3DK7A 4OTFA 4GVAA 3QBNA 5HNIX 3KC3A 4DLJA 5JQ8A 2VWVA 4PPAA 1KSWA 3QHWA 1P14A 5HG7A 3WBLA 3UNJA 5HO6A 4C4FA 3WYXA 3KRLA 4IZAA 1BI8A 2UZDA 3QRKA 2R3OA 4G17A 3RHXA 3SOAA 2R64A 4E6DA 3EL7A 4GKIA 4QP3A 3P5KA 1H1SA 3UPXA 4KKHA 3GGFA 4J1RA 3FY2A 3C4XA 3CCNA 3SKCA 5A3XA 5AR4A 5KMOA 3QRTA 3KEXA 1SZMA 1WBNA 2CGWA 2BAQA 4O6LA 3HMIA 3ZLSA 4AW2A 2IVSA 4E73A 3DJ6A 5CEQA 3JVRA 3BHUA 4F9YA 5ACKA 4ZIMA 3I0QA 1M2PA 5JZNA 3BYVA 4XP2A 1QL6A 4LRMA 4LFIA 4XP3A 1FPUA 1Y6AA 2W4JA 4HGSA 5CF4A 4JDKA 4Q9SA 3LMGA 1O6KA 2Q0BA 3QRUA 3GI3A 4C3PA 4F4PA 4UMRA 2Z02A 1GNGA 4IX3A 3LVPA 4CZTA 5AMNA 4PPBA 2J6MA 3Q2JA 3FC2A 2OJJA 3R9OA 4FTAA 2BPMA 4M7IA 5KMLA 5HO8A 5IQGA 2A2AA 4LM5A 4CQGA 3G51A 2J0LA 3M1SA 4RWKA 3QTSA 3T9TA 2E9VA 3AC8A 4RVTA 5DEWA 3CBLA 2JDTA 3OBGA 4GYGA 5FQDC 3H30A 2JIVA 4DITA 2KTYA 3E3PA 3K5UA 2QO9A 3HNGA 3NWWA 4FKRA 4N70A 2X2KA 3G9LX 4H58A 3QQJA 3ODYX 4PF4A 3P78A 4GG5A 3IW4A 4FIEA 4F99A 5E92A 5LQFA 1J7UA 4LRKA 5DR6A 4XV9A 3KKVA 1H1RA 2C0IA 2OZAB 4DBNA 5EHLA 4HPTE 4RJ8A 3TKIA 4UWYA 1VR2A 3ZFMA 3TNIA 3QTWA 5CU2A 4D0XA 3R9RA 4EBWA 5BQ0A 5M07A 5CSPA 5I9ZA 2UV2A 3PY0A 2Y4IB 3E87A 3O17A 4CG9A 5LVNA 4C2WA 5E8WA 5GNKA 4JLCA 2R7IA 3DZQA 4ZS0A 1JWHA 3EFWA 5BNJA 4DA5A 4FG8A 2JFLA 4WBBB 5AEPA 3A7IA 2PVFA 1APME 5KE0A 1XBAA 4RIXA 2QLQA 2PZPA 2PVRA 3OEZA 1PYXA 3QD0A 4M68A 4U44A 4CT1A 3NPCA 3ZFYA 4YSJA 1H24A 4P5QA 2AC3A 1ND4A 4MXAA 3W10A 1FMOE 3BZ3A 1BUHA 3QHRA 2OZOA 3KF4A 3VVHA 4UEUA 4GT4A 3MFRA 3ROYA 4DT9A 4IDVA 5FD2A 3BQCA 4GIHA 4FEQA 4F0GA 5FM2A 3CTQA 1OIQA 4G1WA 3ZO4A 4YO4A 1YWVA 3KB7A 3LFFA 4F0IA 3EQGA 4FV6A 3QUDA 5D41A 4FTLA 2XJ1A 5A54A 3GXLA 4AZTA 4FKUA 5ACBC 4L9IA 3QWKA 5IH5A 4MD8E 2CKOA 4QMZA 4C57A 3OT3A 3S4QA 4NT4A 1NVRA 4BCIA 4QTCA 3QTIA 3F66A 3OXIA 4TYHB 4BZNA 1YDTE 3PRIA 3FLQA 4YO6A 4HCVA 4RWLA 2IVUA 2ERZE 4FZDB 1WBPA 2FO0A 4FGBA 4IM3A 4CT2A 2H34A 3O8UA 5K9IA 3Q52A 4MNFA 2W06A 2Y4PA 3GU5A 2WTKB 2ZOQA 3ZBFA 3K5VA 2W9FB 4RLKA 1KWPA 3OP5A 1M7QA 2C3JA 2CCHA 2E9UA 2XIYA 3NNUA 4RJ5A 3MJ1A 2GHGA 3QX2A 5FWKK 1YOMA 4ITIA 3OCGA 4U6RA 2XNEA 3VWAA 5BMSA 5IISA 4RIWB 2J9MA 4L7SA 3LLTA 2O0UA 5TE0A 3QXOA 4FIJA 2X4ZA 3FV8A 4XRLA 3KCKA 1ZARA 3EMGA 4NEUA 5AR8A 2C5YA 2HWPA 2YWPA 4G34A 4O0UA 4U40A 3UOHA 5LOHA 3V5JA 2ZDTA 4PMTA 4A4XA 3NIEA 2RL5A 2BRHA 2V0DA 4M8TA 4ONAA 3FMLA 3HRFA 5A14A 4OAVB 3BELA 4I0SA 3U9NA 4RFYA 5L6PA 3TDVA 3FC1X 2XH5A 2BZIB 2WMQA 5EI8A 4FT9A 4A9TA 1IR3A 3AQVA 3BLHA 3H4JA 3TZ7A 2WMVA 4BDJA 1MRUA 4LOOA 4WKQA 4CMTA 4GEOA 4J52A 1TVOA 2BDFA 5EM8A 5EW8A 4BI1A 1PXMA 4CTBA 3N9XA 4D1XA 3EQBA 3TKHA 2P55A 4H1MA 2QOOA 5CU3A 2ZJWA 3SLSA 1ZYCA 5HX8A 3EIDA 1PJKA 2NRUA 2PE1A 3D14A 5FP5A 5EQYA 2W4OA 1OZ1A 3HV4A 4EK6A 3CPBA 2WHBA 3ZO3A 4R78A 2PVYA 3BCEA 3UMXA 1XH6A 1ZYDA 3I5ZA 4G5PA 3DZOA 4RX8A 2CDZA 3G6GA 1YI6A 5EOLA 3W18A 4EYMA 5DE2A 1WBTA 4HVSA 2WEVA 4IAYA 4JAJA 2ETMA 4K9YA 4QP1A 3A8XA 3UE4A 3VN9A 5L8JA 4BKYA 3QD3A 4F6SA 3F6XA 4FUXA 4J71A 4NU1A 2Y8OA 3VUTA 1KV2A 3ORKA 4NKSA 4Y46A 4KNBA 3UVQA 3ZSIA 3R04A 2G2IA 5D1JA 2QG5A 4I22A 2GTMA 3NX8A 3Q5IA 4PPCA 3UYTA 4CCUA 4GU6A 2CGXA 4LOQA 5HBEA 3W2RA 3PIYA 4JR3A 4IM2A 4H1JA 3DKOA 4P4CA 4DG3E 3D83A 4I41A 3KGAA 3TZMA 4AQCA 1IA9A 3PIZA 4FSRA 4L42A 2VTJA 3FJQE 4J53A 2WU6A 3H3CA 3QTRA 3PYYA 4EK8A 3NIZA 2EXEA 2X7GA 1Q8ZA 4D4VA 5AM6A 4C4HA 5CNNA 4MNEB 2WGJA 4NW6A 4WRGA 4QPSA 4MH7A 3ZCLA 4D4RA 4CLJA 3TUDA 3UC3A 3C4FA 1CMKE 1KE6A 3NUUA 1AGWA 4WNOA 1YVJA 3OY1A 4O0TA 3OUKA 3W8QA 4DG2E 4F9WA 2QLUA 4S34A 3W33A 2EXCX 3ERKA 4Q2AA 3L1SA 3VUKA 4FUYA 3ZEPA 4C8BA 5JSMA 2QOIA 2YLEA 1V0PA 4UALA 3I4BA 4UXLA 4XV3A 3BBTB 5AV0A 4BDDA 3NUYA 4IW0A 4IJPA 3E93A 4Y73A 2WMUA 4G3DA 4WRSA 2PVNA 3ETAA 5HG8A 2A0CX 2WMBA 2BDWA 4RVLA 5CT7A 5ANJA 1VJYA 3GC7A 4KINA 4YZMA 5E1EA 3VQUA 4ANOA 1GY3A 5BVFA 1OIYA 1W98A 3CQEA 1M14A 3WF8A 2IW6A 3GCUA 4BB4A 3R9DA 2GDOA 2V22A 5KMNA 4ZZMA 1WAKA 2ZV2A 3ELJA 3E7OA 4GH2A 4XG7A 3ZXTA 2QVSE 3SG8A 3QQGA 2F9GA 3RBWA 3VRYA 3KQ7A 4R5YA 5CAUA 5H8BA 2ITVA 4UZHA 5E8UA 4QNAA 4FKGA 4ASDA 3I7BA 4EOOA 1I44A 2HZ4A 5GJDA 4AP7A 4EEVA 4CKIA 2YM5A 4DTKA 2VGPA 3TUCA 5AP7A 3DS6A 2GSFA 4HVGA 5HQ0A 4PDYA 4R7HA 2CHLA 5IEVA 2QOFA 3QXPA 2JC6A 4I0TA 2DQ7X 3KVXA 4RVMA 3WOWA 4RGJA 3AXWA 3Q5ZA 2Z8CA 1IG1A 4FKLA 5L2TA 3CJFA 3MTFA 5BVEA 4QQJA 2QO2A 3BRBA 4QMYA 4IC7A 4KAOA 3TXOA 3UC4A 1ZWSA 3OOMA 5FM3A 2WFYA 2XMYA 3KN6A 1NT2A 2R0UA 3LXPA 3NNWA 4P2KA 4YLLA 4QYGA 1V1KA 2OJIA 4GMYA 5LMAA 4E93A 5JKGA 4EZ3A 3BYMA 2QKWB 4IMYA 5BVDA 1XR1A 3O0GA 1KV1A 2VO7A 4FTTA 4KUJA 4YZDA 4FOCA 3LCDA 5LVOA 2WIPA 3VBXA 2JKKA 1U54B 5HESA 5KUPA 4D4YA 2WTJA 5EYMA 3FLYA 2VTHA 2PHKA 3PSDA 4DBXA 4FTIA 1R39A 4G31A 3OEFX 4XOYA 4N4SA 4U45A 4YMJA 3S0OA 3LFEA 2CKQA 1YQJA 4LQMA 5K5XA 4EKKA 5J5TA 2YIYA 3P0MA 3DGKA 3A61A 3QUPA 3RZBA 3L8VA 5IA2A 3R2YA 2W1FA 3C4EA 2J7TA 2B7AA 5HE2A 3QC9A 3EQRA 4FL1A 3V51A 5DMZA 1OM1A 2I0YA 3PXRA 4AZWA 5EHOA 5HCXA 3KRRA 1J1BA 2CPKE 4R3PA 3HDNA 3UJGA 3UGCA 2CGVA 3GFWA 1PXOA 4CNHA 5TT7A 2X81A 4QQCA 3MN3A 3HDMA 3I79A 3FMDA 2PMNX 4JOAA 5EW3A 1Y8GA 3P4KA 3RWPA 4HVHA 4YTCA 3D15A 4J97A 3HAMA 4FTKA 4BKZA 3E5AA 4ZSAA 2J0JA 4IZ5A 3MIYA 3UZRA 3CIKA 2VWBA 3NRMA 3KMWA 3AMYA 4H3QA 4QMOA 3BGZA 4UMTA 2VTIA 4DEGA 5IA0A 3BEGA 5EH0A 4HCTA 3SGCA 2C3LA 3EHAA 4NJ3A 4D0WA 4BCMA 4PY1A 2YABA 4IX5A 4X21A 1NXKA 4FBXA 3F2NA 3HP2A 4L3LA 2C1AA 3FUPA 5AUVA 4E6CA 3N51A 4EYJA 3DJ7A 5CSVA 4CTCA 5KMIA 2PUIA 5L3AA 5BYZA 4PL3A 4TNBA 5IQAA 4I4FA 3MWUA 4DCEA 4D2PA 5KO1A 2XNBA 3UYSA 2CKPA 4IVAA 1YXVA 4ZJIA 4Q9ZA 3MVMA 5M4FA 4QQ5A 4OBOA 2PZRA 4ASZA 2YACA 1WBVA 4X3FB 5KKRB 5T68A 4CKJA 1W82A 3BV2A 3LFQA 1XWSA 4Y8DA 3O23A 4ZTLA 2XEZA 2OBJA 2VWUA 3FMNA 4FKSA 2YEXA 3VS2A 1UNLA 3H9RA 3V8TA 3Q6UA 3BHHA 4NTTA 1H27A 2W1CA 3D5UA 4QMTA 4ANLA 2GNHA 4FEVA 1W83A 4MXZA 3V5PA 4ZSGA 5A4EA 4N0SA 1CTPE 2C6DA 4FG9A 4O7YA 4DFNA 4PL5A 5M57A 4L45A 5G1XA 1WBWA 5EHYA 2BAJA 4I20A 3V3VA 4R3RA 4I23A 2IZTA 2OO8X 3NAYA 3V5TA 4GK2A 4C02A 3WARA 3PA3A 5JZJA 1P2AA 1UU3A 1H8FA 4EZ7A 2YFXA 4ARKA 4ZTMA 2HZNA 3CKXA 2YAKA 3SX9A 3T8OA 3ZC5A 4BCFA 3OCBA 3R9NA 1YDRE 3R8MA 2QOQA 1YXUA 2WTDA 3QGWA 4MNEA 5ANGA 2WOUA 5FEDA 3RAKA 4Z7HA 1RJBA 2NO3A 4B7TA 1OB3A 1JKKA 4JG6A 1UVRA 3PWYA 4HCUA 1UNHA 3VJOA 4X2NA 1O6LA 4ASEA 3NVMB 4QO9A 4WT6A 4IH8A 4TYGA 2PMOX 1XH5A 4C58A 4DYMA 5J79A 4O7LA 4IANA 5BUIA 2VWYA 3UNZA 3KFAA 3OTUA 5JRQA 1J3HA 4IAAA 1PMNA 3EN7A 3VBTA 1E1VA 2VWZA 1DAWA 2VO6A 3V5QA 2JD5A 3KULB 4E7WA 4FV2A 5E4HA 4YPSA 4BCOA 4ACCA 4FKOA 4AG8A 2C0OA 4PV0A 1UV5A 2ZV9A 2Z7LA 2OK1A 3QAME 3TV6A 3ZONA 3L8SA 1JSVA 2WMTA 5CENA 3BLQA 2HZIA 2ONLA 2WB8A 4O27B 4QMMA 4F7LA 3FPMA 4FTMA 5C8MA 3QLGA 4KD1A 4U9AA 4ZY6A 4ASXA 4Z16A 3T9IA 4R7BA 1XH4A 1JLUE 5DR2A 4DTAA 3S3IA 3VW6A 5CQWA 3PA4A 4IVDA 1S9IA 1XHAA 3QL8A 5ETIA 3LQ8A 3T3VA 5LMKC 4FOBA 4O0XA 4M97A 1W7HA 2VWXA 3LM0A 3C5IA 3W32A 5CU4A 4CYJA 2JDRA 3DJ5A 1R3CA 4PWNA 3VUHA 5CF6A 3K54A 2PMLX 4BCNA 2XRUA 2HW6A 1H00A 2O64A 4UZDA 1DI8A 5CX9A 2G9XA 4C2VA 5LWNA 2QR8A 3PG1A 4BZDA 2EU9A 1MRVA 2X1NA 3IW5A 3TJDA 3TUBA 3P9JA 4FT0A 2UZOA 3R7OA 4FV8A 2E2BA 3HMNA 4KIQA 5IU2A 4QTEA 5TKDA 1R0EA 2R3MA 4HYHA 5CVFA 4CFVA 3C51A 4D9UA 3FZOA 4IZYA 4FODA 3FQSA 4M0ZA 3RTPA 2X8IA 2ZDUA 3VO3A 3KK9A 4EH3A 5M09A 3O96A 3VUIA 5CY3A 2HELA 4TRLA 4E5BA 5HD7A 5CANA 2GHMA 3TACA 3TTJA 5G6VA 2UW3A 3WYYA 1M2QA 3ATSA 1OL6A 3R00A 4XG3A 2Y6MA 5AV1A 4OT6A 4E4XA 4KKGA 3PY1A 4FV1A 3CE3A 4CGAA 3Q3BA 3ITZA 2QG7A 5JGDA 3OCTA 3WE8A 3AD6A 4BRXA 4OAUC 2CJMA 3GB2A 3DXQA 1W84A 1MUOA 2QOLA 3BEAA 5HU9A 4WHZA 4LGGA 2YIXA 2W9ZB 3A4PA 3PE2A 5I9UA 2OGVA 2XNMA 5FG8A 2XK6A 4B6LA 2XYUA 2JBPA 3ALOA 3FLNC 4EL9A 3R7GA 2BRGA 3DBCA 4FG7A 4NJDA 3CSVA 1JKLA 4FEXA 3HP5A 4JIAA 3D5WA 4J95A 4Y83A 4TYJA 3LFBA 2UW7A 2WNTA 3ZLYA 4L3PA 4G3EA 3AT3A 5H3QA 5HE3A 1BMKA 5HLWA 3OROA 3DBQA 3SD0A 5AAGA 5AP1A 4AN3A 4AZVA 3LKMA 4ZS4A 3DLSA 4E6QA 4F1OA 2IW8A 3AG9A 4FVRA 4M3QA 3DTWA 5HIDA 1ZOEA 4EJNA 3HMMA 3UP7A 3OHTA 3HAVA 1OVEA 5ANDA 4RA5A 4QMVA 3LM5A 2XVDA 4A9RA 4A9YA 1FGKA 1G5SA 2FVDA 2YIWA 3K3IA 5DPVA 2CNUA 4DEHA 3LJ1A 3DA6A 3MFUA 4S32A 4I5PA 5AP6A 5L4QA 4JDJA 2B52A 2XM8A 4YC3A 5IQCA 5LJJA 4FV5A 3QF9A 3SDJA 2UZNA 5CEIA 4GK3A 2BZHB 1UNGA 2ETRA 2XK4A 3DFAA 3R2BA 4Z3VA 3M42A 4CFWA 4EH2A 2Z7SA 3S00A 2P0CA 2PTKA 5CTPA 3OMVA 4BIDA 4PRJA 4DF3A 3WF5A 4X3FA 4ENXA 5FTGA 1ZLTA 4IEBA 4KA3A 4EKLA 2CLQA 1KOBA 4C33A 2YZLA 4EWQA 4UYNA 3NYXA 3LAUA 3VS0A 3WILA 4M69A 4CV8A 4JBVA 4DAWA 4C0TA 4HW7A 4ACMA 1I09A 3PXKA 1OPKA 3KRWA 1YRPA 2H96A 2IN6A 4KSPA 4G6LA 3JYAA 4Z55A 4X2JA 3EQCA 3UOLA 3C5UA 3B2TA 3U54A 4TT7A 3SW7A 3DK3A 3FDNA 3SAYA 4E4LA 3LLAA 4D1ZA 1CKPA 3LXKA 3II5A 2WMSA 5I3RA 5L6OA 1VEBA 5E90A 1AQ1A 4FZAB 2FYSA 2X9EA 5LARA 3CKWA 5F9EA 3KMUA 4QYHA 1URWA 4IC8A 4ZP5A 4FVPA 3FI2A 3GQLA 4M66A 2FSMX 3NAXA 3IO7A 4NIFB 4WA9A 4WG3A 3TIZA 4A9SA 4BDHA 2BIKB 1ZZLA 3FLSA 3HMOA 5B7VA 5KZ0A 4KRCA 4YJTA 2A19B 1M52A 3RI1A 3DAEA 3LZBA 4JBPA 5CQUA 4OTPA 4MWIA 2UUEA 4FTRA 3IGGA 3ZUVA 3C50A 3FAAA 3IGOA 4S31A 5FXSA 2BAKA 2WXVA 4L67A 2R5TA 5IPJA 5DFPA 1L8TA 4YZCA 2BTSA 4Q5EA 1WBSA 2CN5A 3NGAA 4BGHA 4F7SA 1LEZA 2YDJA 4UYAA 3R7IA 4HVDA 4C3RA 2JDOA 1RQQA 4DH7A 3QZFA 3P7BA 5DRDA 1XQZA 2KULA 3OT8A 1GZKA 3COMA 3E8CA 3C7QA 5HEZA 2FUMA 3MPAA 3TM0A 3MVHA 4V01A 1H0WA 2R3HA 5CEOA 4O0RA 2EB3A 5L6WL 3E7VA 4YJNA 4ZY4A 4MBLA 5E9EA 3NEWA 5D11A 1OUYA 4U3YA 5L2WA 3BU5A 3SRVB 4NK9A 2V55A 3G9NA 2ZM4A 3IW8A 4AGDA 2JAVA 3LXNA 4PTCA 2NRYA 5CZIA 5HLPA 4NFMA 4IBMA 4WNKA 3EFKA 5IQHA 4IAZA 4A9UA 3CTHA 4JRNA 4EOIA 3JS2A 2C5XA 2YA9A 4HYIA 5JFVA 4HOKA 2YLFA 3RAWA 2XUUA 3EQDA 5DOSA 2OJFE 1RW8A 5BPYA 3M2WA 1DS5A 4WO5A 5IA3A 3ORIA 4J8MA 3VS5A 2J2IB 1KE7A 3Q2MA 3PP0A 1OIUA 2R9SA 4KABA 3R63A 3W1FA 4EBVA 4YJRA 4ZZOA 2J0MB 4G3CA 4E1ZA 4O81A 3TZ8A 3UOKA 1UWJA 5AA8A 2V7OA 3EFJA 3NUNA 3R01A 3VHEA 1K3AA 3F61A 3QLFA 1U59A 2CLXA 5HGIA 2YJRA 2R3IA 3OXTA 2V5QA 4FIGA 3VULA 4MX9A 3UTOA 2RG6A 5C26A 4JT3A 4TZRA 5B2MA 3CQWA 3JPVA 3FKOA 5FTQA 5J9ZA 5CYIA 3TL8A 4FYOA 4K6ZA 4O7NA 3TJCA 3N4UA 4FIHA 3UNKA 1U46A 4JDHA 4KIKB 1JOWB 5FXQA 4ALUA 1GOLA 3BHYA 3LHJA 1S9JA 5EDRA 3TNHA 5AR3A 4E5WA 4PMPA 5IDNA 2RFDA 2PZIA 2YISA 4M0YA 4GL9A 3RJCA 4BDIA 2F49A 4AAAA 1Q97A 5M4UA 3SXFA 3R8PA 3VQHA 3QCYA 4O0SA 2PUPA 4RX7A 4K0YA 3DXNA 2QOCA 4HYSA 4YJQA 3FXWA 1PXIA 2HAKA 5H9BA 2OJ9A 4W4WA 3NMUF 3RMFA 4DGGA 5JRSA 2GTNA 1R1WA 4YPDA 2UW8A 4LMNA 1GZNA 4GT5A 4A06A 3Q4ZA 5I0BA 4MBIA 3F5GA 3OVVA 2JIUA 5CVHA 4OTGA 3ZU7A 1P4OA 2J5EA 2W96B 2H8HA 3FE3A 2XIKA 4ZTNA 2XCHA 1YI3A 5AV2A 4AWIA 2R2PA 2VWWA 1KOAA 4CRLA 4U41A 2HXLA 3DTCA 3LCSA 5KHWA 2UVZA 4MAOA 4DFBA 2ZYBA 3ATTA 3F3TA 3GC0A 2GFSA 2O2UA 4O1OA 5KBQA 5C03A 4K11A 3MV5A 4TKSA 4EQMA 2C6OA 1JSTA 4V0GB 4N57A 4MVFA 1CKIA 3EH9A 3KXGA 3KY2A 4YLKA 3Q9YA 1PMEA 2OF4A 3GC8A 3A4OX 2YM8A 4OTIA 3AC2A 2V7AA 3QKMA 5LWMA 2W4KA 3POOA 3V5WA 3HKOA 4F1TA 3C0HA 4CYIA 2C30A 4XP0A 3EJ1A 3QFVA 4B4LA 2XIRA 3U87A 4C4JA 2OXXA 5M4IA 2QU5A 5GIOE 4L46A 2C5VA 2GFCA 1FGIA 4YNOA 2YCRA 2C6IA 5EK7A 4BCJA 2OU7A 1ZYJA 3HL7A 3CD8A 5KZIA 3G2FA 4HPUE 5BYLA 2UW9A 3BE9A 4QRCA 5BX0A 5B0XA 3BGQA 3RM7A 1X8BA 1YW2A 1H1WA 1PY5A 5FBNC 4DH3A 5DWRA 4BDEA 4ZZNA 2I0EA 3GUBA 4KRDA 2W0JA 3G33A 4B9DA 5L2IA 5IMEA 4BHZA 2B0QA 1JPAA 3FLZA 2X9FA 4XCUA 3PXQA 4JJRA 3F3ZA 3LW0A 2I6LA 3Q9WA 3EYGA 4M84A 4CRSA 3LFAA 2XNGA 1V0BA 2H6DA 5ETAA 4GKHA 2W1EA 1PXKA 3PVWA 4EOKA 2GU8A 3KL8A 3DDPA 1IA8A 2IJMA 4FKPA 4AGUA 3NZ0A 4RQKA 3O50A 4CMOA 4IACA 3SVVA 4EOMA 2NPQA 2NP8A 2QONA 3KRJA 3ORPA 1PXJA 4JAIA 4PTGA 5K0KA 2QOKA 4LV5A 3ET7A 2FB8A 4O22A 3Q4TA 3R1SA 3L9LA 1OKWA 2HY0A 2HZ0A 1B6CB 2W5HA 3ZEWA 4DFZE 5AA9A 2R3JA 5CALA 2XYNA 4NIFA 3RAIA 1KE5A 3S1HA 5DGZA 5BVNA 4L52A 4TN6A 4PX6A 4P90A 4RX9A 4BGQA 4D2WA 2QR7A 3LOKA 2PVHA 5HIEA 4DFUA 3EN5A 5I4NA 4ANBA 1J7LA 3UQCA 3VNTA 3GCQA 3NW7A 2B9IA 2VNYA 3FZPA 4H3BA 4NTSA 4A4OA 3DNDA 3IPHA 2ZB0A 4J7BA 1UKIA 2C5OA 2UZBA 3QTQA 2WELA 4MXOA 2Q83A 4RJ7A 4AOTA 4JG7A 3ENHA 3MY0A 3GU6A 3H9OA 3UZPA 5A46A 3D7TB 4MXYA 3ZUUA 4DFYA 3ZUTA 4UBAA 3OWPA 1BLXA 3DY7A 3QU0A 4NM5A 5IA5A 3E62A 2C4GA 4PMSA 2YERA 4RJ3A 3PJ3A 2FSLX 4F6WA 3BYOA 5HO7A 3QCXA 3UO6A 5IH4A 3A62A 4DEIA 1HCLA 2C47A 2WKMA 2XCKA 3PLSA 2R3LA 3FHRA 5D7AA 5IDPA 4P5ZA 5K5NA 2UZWE 4ACDA 3AC1A 4ZTRA 5BVOA 2C6TA 3IDBA 4YNEA 2UZLA 2QOHA 3RAHA 4OT5A 4FT5A 3SRVA 1ZZ2A 3KVWA 2X6EA 4MKCA 4AA0A 5ITAA 4WUNA 3PVBA 3OY3A 1OKYA 3E3BX 3QD4A 4RRVA 5BMMA 2CKEA 3SV0A 1P5EA 2BALA 2PVMA 2W1GA 3O71A 3MS9A 4BN1A 3DB8A 3GBZA 2BRBA 4ZMFA 1OBDA 3BI6A 3HA8A 5H2UA 5C01A 2BILB 2JKMA 3ODZX 4RMZA 5D10A 5EYDA 4FSWA 4A07A 3ACJA 2OZAA 2V62A 1YKRA 4XRJA 4U8ZA 4ZK5A 3ANRA 2VO0A 3QTUA 3F9NA 1Q61A 3W2SA 1YHWA 2OIQA 5FXRA 2O3PA 5AUXA 4UXQA 2FGIA 4RJ6A 5K4IA 5AR2A 2XKCA 2PK9A 1WBOA 1JSUA 3RM6A 2RFSA 1DM2A 3R8VA 4EOJA 3BPRA 1H07A 3EKKA 4RG0A 3ZTXA 4J8NA 4U97A 3NUSA 4C4EA 4L43A 4F65A 3DXPA 2G1TA 2ITNA 4RLLA 4AOJA 3Q6WA 4WOVA 3B2WA 1MP8A 4G6OA 5AUUA 1REKA 3HV3A 3UVPA 3NW6A 1U4DA 3D5XA 3N4TA 2R3PA 4KIKA 4I6HA 3WF6A 3GU8A 3DKGA 2Y7JA 1H0VA 2W5BA 4KBKA 5D9HA 3VF8A 3FEGA 3NLBA 3OZ6A 3U51A 5ANEA 3CGOA 4XV2A 2JKOA 4WUAA 5C27A 3ZO1A 3SG9A 1YWNA 3PWDA 4EJ7A 4C59A 2XIZA 4MK0A 4OBPA 2LAVA 3S2PA 3HVCA 3LQ3A 3I5NA 3ZZEA 3LXLA 5I9VA 3DPKA 4GVJA 3O8TA 4BHNA 3DK6A 5DA3A 3W16A 5BUEA 3LFCA 4E4MA 2G2HA 2YWVA 3BQRA 4FE2A 4CFMA 4JRVA 4Y95A 5DH3A 2JAMA 4EOSA 1GIIA 3QRJA 2GS2A 4GIIA 1F3MC 2JIIA 2CNVA 4AW0A 2Z7QA 1Q8WA 1YI4A 3A60A 3NYOA 3DLZA 3CY3A 4TYHA 4W9XA 5DHJA 5IEYA 4FTQA 1DAYA 1YXXA 4CV9A 4CFUA 3HX4A 5C1QB 5HIBA 4QP6A 3ZRMA 4BICA 3QC4A 1FINA 3KCFA 3LIJA 2XA4A 4X3JA 3NUPA 2B9HA 3F3VA 4YURA 3KA0A 3QUEA 4U80A 1WCCA 2X7FA 3FSKA 3AD4A 4B99A 4N6YA 4V0GA 3NNVA 4U42A 4JI9A 4RIWA 5JK3A 4J99A 4O7RA 4X2GA 3FSFA 2BRNA 3MA6A 4AZFA 5DEYA 4FX3A 3IONA 3HRCA 4EC9A 3V5LA 4RC4A 3EQHA 4IAIA 5AJQA 3LFNA 4YHTA 3A8WA 4IQ6A 4RIYB 3FMMA 4BBFA 4KIPA 2E9OA 3D2KA 5HICA 2W1HA 2VTNA 3CY2A 3O51A 4IXPA 3VUGA 2PVJA 4IFGA 2YM3A 5C9CA 2RFEA 4APCA 3LPBA 2P2HA 4F70A 3LMHA 4RIOA 4NZWB 4QTAA 4EOLA 4L7FA 1OECA 4E26A 2FSTX 4FT7A 3GVUA 4QYEA 2VD5A 4GUEA 5H8GA 4ANQA 4NFNA 4UY9A 4AS0A 3Q9XA 4CSVA 1SYKA 3PPKA 3PXZA 2BIYA 2PVLA 3PVUA 1K2PA 2GS6A 4FA2A 5CXHA 2DWBA 3VF9A 4FV4A 4BCPA 4DT8A 4JIKA 4EC8A 3F5XA 3ZRLA 4DEAA 2R4BA 3BE2A 2P4IA 4FKJA 4WNPA 3AT2A 1OL2A 2WMXA 1O6YA 3DKCA 3Q60A 3I81A 5HLNA 1STCE 4I5MA 4W4VA 3MFSA 1NVQA 2XBAA 3ORMA 5AM7A 1RDQE 4IM0A 4BFMA 4RX5A 2E9NA 4JXFA 4R7IA 2VUWA 5ETFA 4AFEA 1M7NA 2C3IB 4Q5HA 5A9UA 2VTRA 5AP5A 4S33A 1H4LA 4EWHA 3ZDIA 3MH0A 3MB7A 1OGUA 3H9FA 5EKOA 2F7XE 3RINA 3SXSA 3FZ1A 2X6DA 2YZAA 5AP3A 4YU2A 1WVYA 2R3KA 2J90A 4I24A 4TWNA 4XS2A 4RQVA 5KCVA 4EH7A 3U6JA 3AC5A 3R71A 2IZUA 3WZEA 4ZJJA 2GMXA 3TNPC 2GQGA 5EDQA 3QD2B 4IJ9A 4YBKA 4C35A 2XK3A 4AACA 5E7RA 2IZSA 2P3GX 2YCQA 2XBJA 2ZV8A 4R1VA 1M2RA 5DBXA 4I94A 4D5KA 3I6WA 5E8VA 2I1MA 3BKBA 2HXQA 2QODA 3QZIA 4CQEA 4E20A 4HVIA 4Z7GA 1ZY4A 3VS1A 5HORA 2UZUE 3L9PA 4R5SA 3VS7A 4ANSA 1FMKA 4MXXA 5LCJA 1WVWA 3V04A 5EDPA 1IAJA 2JGZA 1PRYA 4L00A 4TY1A 5C4KA 5LVPA 4AGWA 2BRMA 2ETKA 2LGCA 4HJOA 2O8YA 3D0EA 3RCDA 3ZSGA 5M4CA 4RWIA 2BFXA 3E8DA 3JY9A 4K77A 4C7TA 4EK3A 4H39A 2C3KA 2PZYA 5CF8A 2W1ZA 3UMWA 5F1ZA 4F7NA 4USFA 2J0KA 5E91A 4ACGA 3NCZA 2PMIA 2R3FA 5EI6A 4GK4A 2HK5A 3AMAA 5CXZA 3RNYA 2B55A 3E63A 3HLLA 4PL4A 1LEWA 1NW1A 2PUNA 4X2FA 3UBDA 3EQIA 3HUCA 4IVCA 2UZTA 3P1AA 3R8LA 4R77A 4HGLA 1CKJA 4DG0E 2F2CB 5HTCA 1BX6A 4FNZA 2C5NA 3V6RA 4BDCA 3QQLA 4OW8A 2X7OA 4I6QA 2VV9A 5DRBA 4XH6A 5GZ9A 4DGNA 2WTIA 1E9HA 2BROA 2WMAA 3FMJA 3MBLA 5AAEA 3ANQA 4B8LA 5IKWA 2ZM1A 5FRIA 1LPUA 4I21A 5I3OA 3FWQA 3RKBA 3ZLWA 1O9UA 4CEGA 3ZRKA 1XBCA 3JY0A 2YN8A 4RA4A 3CPCA 3ZM9A 1W8CA 4V05A 3TN8A 4F9AA 3R8ZA 2YCSA 1LR4A 2ITZA 4CFXA 3FMHA 4TYIA 4O86A 4EQUA 3EKNA 4ZEGA 5M51A 4PUZA 5KMMA 5IMXA 4I5CA 2PY3A 3UDBA 4ZMEA 4XLVA 5CLPA 5J87A 4DE4A 1FVTA 1Z5MA 4NWMA 4IB3A 3P08A 3LJ2A 5HTBA 4NM7A 1XH7A 2HENA 3L8XA 2XZSA 2ITQA 3OG7A 3KU2A 3C4CA 4FF8A 4LV8A 3V8SA 3JVSA 3ZZWA 4QYFA 4KSQA 2RKUA 2HYYA 3MPMA 2XKDA 2Y4IC 4AZEA 3FI8A 4MXCA 3M11A 3A2CA 2PU8A 4FZFB 2GNJA 2OWBA 5AUTA 1U54A 1GAGA 4S30A 5EQEA 3NSZA 5HCYA 4EONA 4XYFA 1ATPE 3PVGA 4JNWA 2ITOA 3IK3A 2OIBA 4EK5A 5JGAA 2XRWA 5L8KA 4FSUA 1LUFA 3TI1A 4YGAA 5I5ZA 2ITWA 4BCHA 5CAQA 4BIBA 3F5PA 4QMNA 5AIRA 3SQQA 4ZLOA 3OW4A 5L8LA 4JQ7A 4QMWA 4O7SA 1H28A 4MF1A 5I9YA 3TNQB 3A7JA 4F08A 5DG5A 3H0ZA 5ANIA 3HA6A 5EFQA 1W0XC 3OXZA 5J7BA 2ITPA 1R78A 4MCVA 4X2KA 4JQEA 1Q8YA 1A9UA 4LI5A 4MQ2A 2I40A 4R1YA 2A4LA 4RBLA 4RT7A 3KREA 4NL0A 1OPJA 4QMSA 1UWHA 3IOPA 5GJFA 3UVRA 1AD5A 3RWQA 3RPRA 2DUVA 3VAPA 4D4SA 4L44A 4OR5A 4L6QA 2UW0A 4OTRA 4PDSA 4CZUA 3U6IA 4DFLA 3DKFA 5HVKA 3GCPA 2PL0A 2HCKA 4FK6A 3MYGA 1U5RA 3QQUA 4G2FA 4HGEA 4ITHA 4XJ0A 5F94A 3Q04A 4W8DA 5J5SA 2VTAA 3KMMA 3DAKA 4UWBA 3R83A 4ZLYA 4RIYA 4XNEA 4JS8A 2RFNA 3IQ7A 3REPA 2WO6A 3RK9A 4WBOA 4O7ZA 2J5FA 4FI1A 1FOTA 3QTXA 5T3QA 3FMKA 4PDPA 1KE9A 5KHXA 2I0HA 3PJ2A 2WTKC 4KWPA 1Q3WA 2F57A 4YLJA 4I5HA 3TV4A 1ZMWA 3QGYA 3G90X 4FTUA 4KS8A 2CMWA 1G8SA 4FKTA 2E9PA 3MY5A 2Y9QA 4JR7A 4DEDA 1Q62A 3CJGA 4CCBA 1URCA 1Q3DA 2X39A 1MQBA 2IG7A 1L3RE 2O65A 2WOTA 3CGFA 5HCZA 2QO7A 4EH8A 1XKKA 2WPAA 2WTWA 2A1AB 4U7ZA 4EOPA 3MY1A 5HZNA 4F09A 2W05A 4RJ4A 4QYYA 2YIQA 3QA0A 3F3UA 1G8AA 2UZEA 3EYHA 4FL3A 4BVUA 1SMHA 5ANOA 4FTOA 1T45A 2X0GA 5E8XA 2BDJA 3U9CA 5C8NA 2R0IA 4O7VA 5EYKA 1HCKA 4QP7A 3IS5A 4RVKA 1P4FA 3RZFA 4UV0A 5EM7A 2XIXA 2FA2A 3AMBA 3FLWA 4PMMA 2BTRA 3I1AA 2X2LA 2GS7A 1JNKA 4K1BA 4NM0A 4TW9A 4ZTQA 5DLSA 3C1XA 4J96A 4O6EA 1B39A 2UVXA 4GS6A 4V04A 2UW4A 4DFXE 3R7VA 4YP8A 4E6AA 2WQMA 3GOPA 5A6OA 2XK8A 3MJ2A 5K0XA 2VTTA 3EOCA 4P7EA 5M44A 3RALA 3THBA 2UZVA 2GPHA 4U81A 3EL8A 4BDAA 3OTVA 3ALNA 3WZDA 5DYJA 2CSNA 2RG5A 4AA4A 2XB7A 4LGHA 5K3YA 3MI9A 3QYZA 4M67A 5DI1A 5JFWA 5KNJA 1CM8A 2XJ2A 4QP4A 4PP9A 3JR1A 5AADA 5FLFA 1YXTA 3GEQA 5JFXA 4TWCA 3MH1A 2PYWA 5KBRA 1Y6BA 3IW7A 4DINA 5EYCA 4EQCA 2BVAA 1OL1A 3FZRA 3QZHA 1J7IA 5HI2A 1QPDA 4BF2A 5JN2A 4ZJVA 4O2ZA 4YTHA 1ZOGA 2WTCA 3FY0A 4WSQA 4XG9A 4CFNA 2J51A 5EG3A 3QCQA 3N4VA 2ACXA 4FKWA 3TEIA 1PMVA 2OW3A 5CS6A 2P2IA 2A27A 3KULA 3VBQA 2HY81 2XKEA 3MW1A 4ZSEA 3FI3A 4BCQA 5I9WA 4XBRA 3QWJA 3DCVA 3VBYA 3P7AA 5T6KA 2FH9A 2JFMA 4BYJA 3ACKA 4B8MA 3NR9A 1SNXA 2J0IA 4AT3A 4DH8A 5AIKA 2I7QA 2C69A 4GSBA 2R3NA 2VTOA 2PWLA 3CLYA 4K18A 3WZUA 2OI4X 2XNPA 4AN9A 1OITA 1XBBA 4XX9A 4HZRA 4BC6A 3ZXZA 4HGTA 3VJNA 3QTZA 1ZMUA 2VTLA 3I0OA 3R1QA 4O91A 3NUAA 4I93A 4ANMA 4BTJA 1KUTA 5HE0A 4AW1A 2YITA 4OUCA 5FEEA 3TTIA 1SVHA 1QCFA 3PTGA 2IVTA 4QP8A 3VHKA 2C6KA 4EORA 5GZ8A 2O63A 2WZJA 2RF9A 3R9HA 1U5QA 5DIAA 3MFTA 3PE1A 4IE9A 3CD3A 1YHVA 2GNFA 3OFMA 4XBUA 4FSMA 4BWKA 1Q8TA 5E8SA 3UG1A 3VC4A 4FSTA 1RE8A 1PKGA 1KE8A 5F20A 5HX6A 5IQFA 4ORKA 5CU0A 4O82A 2ONLC 4EH9A 3MB6A 2B9JA 3LJ0A 3NCGA 2UW6A 5HHWA 4RFZA 2WD1A 5AAFA 2REIA 3ULIA 4APPA 3TG1A 3O7LD 3UPZA 5AFVA 3R7UA 3MPTA 3OWLA 3QRIA 3ZFXA 4UX9A 3E92A 2VGOA 4MEDA 4BCGA 3EN6A 2R3QA 3LE6A 4YBJA 5HG9A 1UA2A 2CNQA 2ITYA 4AE9A 4CZYB 4BWXA 3I60A 4ID7A 1SVGA 4ZTHA 3WI6A 3PSBA 3L9MA 4IWOA 4O0VA 5CI7A 3D4QA 4XLIA 4AGCA 3IG7A 4AU8A 5IF1A 3R30A 5C8KA 1JAMA 1FBNA 3B8QA 3DBFA 1SVEA 5CAOA 5M08A 5CSXA 4DCAA 4QPMA 1HOWA 3EN9A 4QOXA 2BCJA 4YC8A 5M53A 3EQPA 4IB0A 4F9CA 4NSTA 4O1PA 4BI0A 3HV6A 4E8AA 1E1XA 3HMPA 5IQDA 1XO2B 2VN9A 2W1IA 3KF7A 4L3JA 5HVYA 3LQ5A 2QHNA 3UIMA 3QQKA 1H08A 4ZXTA 4ALVA 3BWJA 4F7JA 3AC3A 4RPVA 3NYVA 3KXXA 4IB5A 3FQHA 4BI2A 1B38A 5CNOA 4YHJA 4UMUA 3ORTA 4I3ZA 3GCSA 4YHFA 3ULZA 4CKRA 3WF7A 4H36A 3EN4A 5F95A 1YDSE 3ENMA 3H10A 3F69A 5HKMA 3ZDUA 4G3GA 1OUKA 3D2IA 4XG2A 3NS9A 2B9FA 3IKAA 4KIOA 4TXCA 5FUTA 3NUXA 1VYZA 3GP0A
chains in the Genus database with same CATH superfamily
4IWQA 5IQIA 3BIZA 4NM3A 1GIHA 3E64A 4NW5A 1JVPP 3DU8A 3V6SA 3AOXA 4XOZA 3UQGA 3I7CA 1IRKA 3DV3A 5CSHA 2IZRA 3ZLXA 3CR0A 3FI4A 4I4EA 5AUYA 5E8YA 2R3RA 5KMJA 1NVSA 3MTLA 4IWDA 3FPQA 2ZVAA 4FC0A 3PJ1A 4G9CA 4JBQA 4O96A 1TKIA 3O8PA 2VTPA 1ZOHA 3U8WA 3G6HA 3ZO2A 1Q41A 1OKVA 3ID6C 3KN5A 1ZMVA 3VS6A 3C9WA 4EUUA 3GQIA 3ZYAA 5A4QA 4FJVA 1ZYLA 2Z7RA 3HRBA 4FSYA 3Q4UA 4JQ8A 3UO4A 3FYKX 4O7WA 4OTHA 4QNYA 3ZM4A 2C68A 3PA5A 5IZFA 3T3UA 3ZS5A 1JKTA 2PUUA 3AC4A 5CU6A 4IB1A 2F7EE 4PNIA 1CDKA 1OI9A 1TQMA 2RIOA 5J8IA 4I6BA 3DNEA 3W8LA 5EOBA 4XEYA 4FV3A 2EXMA 4CFFA 5BYYA 3BX5A 4EOQA 3ZH8A 3KXMA 2JDVA 3HGKA 3IW6A 4WNMA 4ZSLA 4DH5A 5KMKA 1QPEA 4QTDA 3FHIA 2XALA 5DVRA 3CQUA 4WD5A 2EUFB 2HWOA 3HZTA 2W5AA 1NY3A 3VW8A 5GZAA 2YHVA 4AN2A 3DDQA 4F63A 3GENA 4QMLA 4DGMA 3WZKA 4YTIA 4TTHB 2OSCA 3R7EA 5IQBA 2SRCA 3C13A 2F7ZE 4CVAA 4O21A 4XHKB 3A7FA 2HIWA 3E88A 4CXAA 3BGPA 2OXDA 5HVJA 5KKRC 4FL2A 1K9AA 2HOGA 4LL5A 4PDOA 4QP9A 4X3FC 3SW4A 4D55A 4GRBA 3HYHA 5AP2A 5JEBA 3F88A 4USDA 1GIJA 1MQ4A 3PG3A 4GJ2A 4DEBA 4DEEA 1FVRA 2XNOA 3TCPA 1PXNA 4KKEA 1OL7A 3L9NA 3B8RA 3OCSA 4RFMA 4FEUA 2QI8A 3Q32A 3A7GA 3MVJA 4MF0A 4DLIA 3C4WA 3R73A 4FTCA 4ACHA 2C1BA 3TT0A 4QTBA 4XG8A 5CSWA 4UMQA 4Y5QA 2YM6A 2J50A 2VX0A 2VAGA 4XG6A 2YM7A 1GZ8A 4Y5HA 4ALWA 4C62A 4YR8A 4QPAA 4M12A 3VRZA 5FBOA 2GCDA 5HNBA 4L01A 2YIRA 2F2UA 4Z9LA 4M14A 3TZ9A 5IUHA 4PP7A 2B54A 2OG8A 5FDXA 2ITTA 2VRXA 3BYSA 1EH4A 1YOJA 3W0PA 3GU4A 1MRYA 5H8EA 3RK7A 3MH2A 5A4CA 5D12A 4ZSJA 1WMKA 3IOKA 2C0TA 3KXZA 2Y6OA 4R3CA 4CD0A 1WFCA 4RZVA 4FSQA 4I92A 4FIIA 4JVGA 1PW2A 4O4BB 3OS3A 3LCOA 1XH9A 4BIEA 4X6QC 3ZOSA 3SHEA 1F5QA 2OICA 4FKQA 4BL1A 3UODA 3AD5A 3QQFA 5L2SA 2ZAZA 1YWRA 4QDVA 4FZ7A 4BTFA 5JMSA 1XJDA 1Y91A 5CZHA 1NA7A 1JKSA 2BHEA 4LGDA 4OGRA 1JQHA 2GQRA 3CP9A 4BCKA 4KBCA 1Q24A 5B2LA 3DBDA 3KK8A 4X7QA 5HE1A 1GJOA 4KB8A 4YJPA 4HNFA 4FV7A 3FQEA 1SM2A 3POZA 3R28A 1J91A 1F0QA 1OMWA 3EFLA 4XUFA 4AOIA 5LMKA 3R21A 4F6UA 3WIKA 4QMUA 4FNYA 4Y85A 4R8QA 4A4LA 3EWHA 3BYUA 1SNUA 3KXHA 3C0IA 3CC6A 4B0GA 2W7XA 5CI6A 2QCSA 4YJUA 3OC1A 2F4JA 2XKFA 3TV7A 4HYUA 3FZSA 1LP4A 1VYWA 4QP2A 3LMIA 5BVKA 3VUMA 3QZGA 4A7CA 1H1QA 4MWHA 4FNWA 4AUAA 4EHVA 4DHFA 4NCTA 4EZ5A 1W2DA 4GT3A 3F5UA 4K2RA 3FZTA 3GFEA 2OF2A 3R0TA 3QA8A 3QX4A 3RGFA 3ORXA 3DAJA 2JKQA 3R1NA 5ETCA 5HOAA 1UU8A 4FMQA 3LCKA 5JH6A 5AP0A 3TKUA 5IH6A 4GCJA 1ZRZA 2X8EA 4W8EA 5EQPA 3CEKA 5FP6A 4UB7A 4DTBA 4DN5A 4TL0A 4NH1A 3CS9A 5JGBA 4BYIA 3G15A 3BWFA 1A48A 5AX3A 2IWIA 5IUGA 3VS3A 2W17A 3NDMA 4FVQA 3G0FA 2JBOA 2X4FA 3C0GA 2YM4A 4BBMA 4UWCA 3ZHPC 1OL5A 3RVGA 2DS1A 1JBPE 5C4LA 1WZYA 4W9WA 1Y8YA 2H9VA 5CWZA 3TNWA 4PNKA 5HU3A 4C36A 4FKVA 4C4IA 5AX9A 3NVKI 4C61A 1J1CA 3EZVA 3UQFA 3K2LA 2BKKA 3DT1A 3R7YA 4FT3A 5DT0A 4IZ7A 2C6MA 3KRXA 3D7ZA 5IEXA 3QCSA 4AX8A 3OF0A 4ZLZA 1PYEA 3NW5A 4D2SA 3VUDA 3COHA 3CXWA 2AYPA 3K3JA 4U5JA 4OTQA 4CG8A 4D2VA 4FTJA 3RNIA 1H26A 2OXYA 3OWKA 3BLRA 4BGGA 2G15A 3OBJA 4FKIA 2EB2A 5EM6A 5GHVA 5CEKA 4C4GA 1PHKA 4EK4A 1XMMA 2XK7A 2ESMA 2QD9A 4JX7A 4MD9E 3HECA 2WQOA 4FNXA 3UO5A 4FICA 3FXXA 3AKJA 3FYJX 3TIYA 2DYLA 2VO3A 3MIAA 2ZMDA 3W2PA 3WIGA 5IA1A 4KS7A 4BY9E 2VTSA 3A7HA 4GV1A 4QD6A 2VNWA 4FYNA 4LOPA 3W2CA 5HTIA 1VLRA 4O83A 2QQ7A 1Q4LA 3E8EA 2BKZA 3ORLA 4IHPA 4DGLC 3R02A 3DFCB 4LRJA 4ZOGA 1PKDA 1QMZA 3AT4A 3SXRA 5J9LA 2YCFA 2ZMCA 3MGYA 5DT3A 4EHEA 5KX8A 4E4NA 3S95A 1QPCA 5TOZA 4RWJA 4S2ZA 2WQBA 3GNIB 2QHMA 2OH4A 4IDTA 4MHAA 5A4TA 3DB6A 3GC9A 2B53A 4WG4A 1BKXA 3GT8A 1Y57A 4ENYA 5AUWA 5I9XA 4IWPA 3Q4CA 1VZOA 1PF8A 4RC2A 2VU3A 1YHSA 3MVLA 4II5A 2PVKA 5AR7A 2IW9A 4DGOA 5J9YA 1Q5KA 2IVVA 4FK3A 4LYNA 4E5AX 3SOCA 5IA4A 3DBEA 3P23A 5CAVA 3G5DA 5M06A 3F2AA 5AV3A 1QPJA 3GCVA 3PXFA 3OUNB 5ANKA 3FBVA 2RGPA 3UIBA 3GOKA 3LFDA 4IAFA 3PDTA 3EZRA 4YJVA 5B2KA 4F1MA 3SC1A 2X8DA 3F82A 3PZEA 5IG1A 4BDBA 2WQNA 4YJOA 3O7LB 4TWPA 2CN8A 3VBVA 4EH5A 3R6XA 5DR9A 3IDCA 4FGRA 5FGKA 3ZSHA 2QURA 2C6LA 4IAKA 3V8WA 4LUDA 1BYGA 3ZC6A 5BUJA 3CTJA 2R3GA 2W1DA 3LFSA 4K8AA 2C6EA 2GNGA 2Z2WA 4L53A 4HZSA 4IX4A 3RK5A 2ITUA 4AT4A 3PUPA 3JXWA 4BWPA 4QMXA 1PXLA 4IX6A 4LUEA 5HBHA 2IF8A 2ZM3A 4MD7E 1PXPA 4M69B 1H1PA 4D28A 1T46A 3D9VA 3U6HA 2BR1A 4TNDA 4BDGA 3IDPA 4U0IA 5HG5A 2HW7A 3D7TA 4UN0C 3SA0A 2YJSA 3W0OA 4YZNA 3R9RA 1V0OA 4YZ9A 3ORNA 2YDIA 4NKAA 2PSQA 3ZBXA 3COKA 3F7ZA 4FEWA 3WZJA 1TQPA 2YDKA 4M13A 5E1SA 3P79A 4BTMA 3BU6A 4L68A 4L8MA 4JG8A 4ZAUA 3WE4A 4PTEA 3DQXA 2PE0A 4X0MA 4IFCA 3QKLA 3RCJA 2ITXA 5AP4A 3V01A 5CASA 3FMEA 2WMRA 3DQWA 3FKLA 5D7VA 1M17A 4GUBA 1ZXEA 3D5VA 3MSSA 3Q9ZA 1GZOA 4LMUA 4TYEA 5EI2A 2XJ0A 4WSYA 2CCIA 5EM5A 3EB0A 1OGYA 2FSOX 2JDSA 3R22A 5DN3A 3HV5A 4DH1A 5JT2A 5HBJA 3AKLA 2PE2A 3F7WA 4YC6A 3PXYA 3R8UA 2XK9A 3TDWA 1TQIA 4MBJA 4CMUA 1IAHA 3VS4A 4D1SA 1Z9XA 4D5HA 1ZY5A 4BZOA 3QKKA 1Q99A 5CEMA 5J1WA 1CSNA 2XS0A 3BU3A 3PY3A 4DC2A 3VONA 2X0PA 4G5JA 4C38A 4O7TA 1WVXA 3HEGA 1UU7A 2JEDA 2VTQA 3U4UA 4C37A 4RSSA 5A6NA 2OIDA 5DT4A 2WQEA 5AR5A 4ANNA 5A4LA 3PIXA 4H3PA 4ERWA 3PJ8A 5ICPA 4H05A 3PPZA 4FIFA 1R0PA 1YXSA 3RPYA 2OKRA 4G6NA 4FR4A 4U3ZA 5HD4A 2B4SB 4JL9A 2P33A 2XF0A 3VBWA 3BHTA 4IADA 4GFGA 4IVBA 2QU6A 2PPQA 1BL7A 4G9RA 4AFJA 3UOJA 4PQNA 4WG5A 4OTDA 2QC6A 5K4JA 3Q96A 5IUIA 1Z57A 4QT1A 2PZ5A 2ERKA 3OOGA 4BBEA 5EKNA 4MYGA 3UZTA 4TPTA 4YUQA 4RC3A 4LL0A 1PMUA 4R6VA 4ITJA 4F64A 2VZ6A 2JITA 3FL5A 3PJCA 5DNRA 5L2QA 4D2RA 5FDPA 4AW5A 1UKHA 1DI9A 3P86A 3L8PA 2AC5A 4NUSA 4QMQA 4O38A 2ZB1A 4ERKA 4O2PA 2YAAA 3R1YA 5E8ZA 1Q8UA 2I0VA 2WU7A 5CEPA 2XNNA 2A98A 4EI4A 2Y0AA 3KXNA 3EQFA 3MDYA 3PZHA 4NCTC 3RPSA 4BDKA 3RP9A 4YJSA 1A06A 3BV3A 4RIXB 4WIHA 4XG4A 3PRFA 4G3FA 3W2OA 2WIHA 3F3WA 3P7CA 4BTKA 4EH6A 5JQ5A 3U55A 4EHGA 3BBWA 4FZ6A 5FTOA 4XMOA 4OBQA 3OD6X 2BZJA 3Q53A 4CLIA 5FEQA 4I6FA 5AUZA 5TR6A 5LVMA 3QALE 4FV0A 2VX3A 4D58A 2G01A 1H01A 2QKRA 3GU7A 4OTWA 3UP2A 2JLDA 3H0YA 3QYWA 4MTAA 5HNGA 4ZY5A 4GG7A 1ZYSA 3LCTA 1REJA 1ZAOA 5E8TA 3UG2A 2OFUA 4HNIA 3ORZA 3COIA 4QQTA 1ERKA 2NNWB 2WEIA 1YOLA 2VWIA 3BHVA 4ZTSA 4YZBA 4AA5A 5GINE 2X2MA 4USEA 3NYNA 5M56A 3FL4A 3A99A 2BHHA 4EUTA 4O84A 3G0EA 3IECA 2XP2A 3MH3A 4FSNA 5TO8A 3RPOA 4X6RA 4QMPA 1OBGA 3RPVA 2VX1A 2W99B 3ROCA 4W4YA 2PULA 3MA3A 4F9BA 4YTFA 1OPLA 4FSZA 5LXMA 1OKZA 3HUBA 4O0WA 2GNLA 1IEPA 4GW8A 2QOBA 4IIRA 4D2TA 4E3CA 2GQSA 5F4NA 4D9TA 4AE6A 3PPJA 5JFSA 4YSMA 4F0FA 5M55A 1BL6A 4JBOA 4U43A 3OWJA 5GIPE 3PLAE 3PFQA 5CVGA 5GJGA 5CT0A 5EW9A 2WAJA 3JUHA 5LVLA 5AWMA 2OH0E 1G3NA 4Y72A 2AUHA 2GHLA 5J7HA 2ZV7A 2BUJA 2IPXA 4M15A 4W4XA 2QNJA 3U4WA 2XM9A 5LCKA 1XH8A 2UVYA 2BZKB 3MESA 2BFYA 4U79A 2OJGA 3C4ZA 4N6ZA 3UIUA 4TWOA 4EHZA 4DHZA 4AZSA 5LMBA 2UW5A 3AGMA 4K33A 2OFVA 4NYEA 5BVWA 3VIDA 3F2RA 3RHKA 4AT5A 5J1VA 1OIRA 2B1PA 4AXAA 4GFOA 4LG4A 2CGUA 1BI7A 4FTNA 4AF3A 3W55A 5IQEA 3D94A 4J98A 5AV4A 2G2FA 3OW3A 4O0YA 4BDFA 3FKNA 5TF9A 2J4ZA 4I1ZA 4BR3A 2GNIA 3NNXA 4RZWA 5CAPA 5J95A 4GJ3A 2EVAA 4JX3A 4XV1A 1H25A 3W2QA 3DOGA 3HV7A 4KBAA 4G16A 2XEYA 3I6UA 3O2MA 4EH4A 3FXZA 3TWJA 4UMPA 3PSCA 2BMCA 2RSVA 2Z60A 4GFMA 4C34A 3O5AA 4JDIA 5CF5A 3ZMMA 3AGLA 4MQ1A 3PP1A 3E8NA 3WF9A 2EWAA 2O5KA 4FV9A 4BKJA 1IASA 2IO6A 3QQHA 2WMWA 4I0RA 2Q0NA 4GU9A 4GYIA 4OLIA 3UIXA 4C3FA 3AKKA 2VTMA 2WTVA 1FQ1B 2OLCA 1UU9A 1FVVA 2R7BA 3DK7A 4OTFA 4GVAA 3QBNA 5HNIX 3KC3A 4DLJA 5JQ8A 2VWVA 4PPAA 1KSWA 3QHWA 1P14A 5HG7A 3WBLA 3UNJA 5HO6A 4C4FA 3WYXA 3KRLA 4IZAA 1BI8A 2UZDA 3QRKA 2R3OA 4G17A 3RHXA 3SOAA 2R64A 4E6DA 3EL7A 4GKIA 4QP3A 3P5KA 1H1SA 3UPXA 4KKHA 3GGFA 4J1RA 3FY2A 3C4XA 3CCNA 3SKCA 5A3XA 5AR4A 5KMOA 3QRTA 3KEXA 1SZMA 3ML1A 1WBNA 2CGWA 2BAQA 4O6LA 3HMIA 3ZLSA 4AW2A 2IVSA 4E73A 3DJ6A 5CEQA 3JVRA 3BHUA 4F9YA 5ACKA 4ZIMA 3I0QA 1M2PA 5JZNA 3BYVA 4XP2A 1QL6A 4LRMA 4LFIA 4XP3A 1FPUA 1Y6AA 2W4JA 4HGSA 5CF4A 4JDKA 4Q9SA 3LMGA 1O6KA 2Q0BA 3QRUA 3GI3A 4C3PA 4F4PA 4UMRA 2Z02A 1GNGA 4IX3A 3LVPA 4CZTA 5AMNA 4PPBA 2J6MA 3Q2JA 3FC2A 2OJJA 3R9OA 4FTAA 2BPMA 4M7IA 5KMLA 5HO8A 5IQGA 2A2AA 4LM5A 4CQGA 3G51A 2J0LA 3M1SA 4RWKA 3QTSA 3T9TA 2E9VA 3AC8A 4RVTA 5DEWA 3CBLA 2JDTA 3OBGA 4GYGA 5FQDC 3H30A 2JIVA 4DITA 2KTYA 3E3PA 3K5UA 2QO9A 3HNGA 3NWWA 4FKRA 4N70A 2X2KA 3G9LX 4H58A 3QQJA 3ODYX 4PF4A 3P78A 4GG5A 3IW4A 4FIEA 4F99A 5E92A 5LQFA 1J7UA 4LRKA 5DR6A 4XV9A 3KKVA 1H1RA 2C0IA 2OZAB 4DBNA 5EHLA 4HPTE 4RJ8A 3TKIA 4UWYA 1VR2A 3ZFMA 3TNIA 3QTWA 5CU2A 4D0XA 4HW7A 4EBWA 5BQ0A 5M07A 5CSPA 5I9ZA 2UV2A 3PY0A 2Y4IB 3E87A 3O17A 4CG9A 5LVNA 4C2WA 5E8WA 5GNKA 4JLCA 2R7IA 3DZQA 4ZS0A 1JWHA 3EFWA 5BNJA 4DA5A 4FG8A 2JFLA 4WBBB 5AEPA 3A7IA 2PVFA 1APME 5KE0A 1XBAA 4RIXA 2QLQA 2PZPA 2PVRA 3OEZA 1PYXA 3QD0A 4M68A 4U44A 4CT1A 3NPCA 3ZFYA 4YSJA 1H24A 4P5QA 2AC3A 1ND4A 4MXAA 3W10A 1FMOE 3BZ3A 1BUHA 3QHRA 2OZOA 3KF4A 3VVHA 4UEUA 4GT4A 3MFRA 3ROYA 4DT9A 4IDVA 5FD2A 3BQCA 4GIHA 4FEQA 3UDZA 4F0GA 5FM2A 3CTQA 1OIQA 4G1WA 3ZO4A 4YO4A 1YWVA 3KB7A 3LFFA 4F0IA 3EQGA 4FV6A 3QUDA 5D41A 4FTLA 2XJ1A 5A54A 3GXLA 4AZTA 4FKUA 5ACBC 4L9IA 3QWKA 5IH5A 4MD8E 2CKOA 4QMZA 4C57A 3OT3A 3S4QA 4NT4A 1NVRA 4BCIA 4QTCA 3QTIA 3F66A 3OXIA 4TYHB 4BZNA 1YDTE 3PRIA 3FLQA 4YO6A 4HCVA 4RWLA 2IVUA 2ERZE 4FZDB 1WBPA 2FO0A 4FGBA 4IM3A 4CT2A 2H34A 3O8UA 5K9IA 3Q52A 4MNFA 2W06A 2Y4PA 3GU5A 2WTKB 2ZOQA 3ZBFA 3K5VA 2W9FB 4RLKA 1KWPA 3OP5A 1M7QA 2C3JA 2CCHA 2E9UA 2XIYA 3NNUA 4RJ5A 3MJ1A 2GHGA 3QX2A 5FWKK 1YOMA 4ITIA 3OCGA 4U6RA 2XNEA 3VWAA 5BMSA 5IISA 4RIWB 2J9MA 4L7SA 3LLTA 2O0UA 5TE0A 3QXOA 4FIJA 2X4ZA 3FV8A 4XRLA 3KCKA 1ZARA 3EMGA 4NEUA 5AR8A 2C5YA 2HWPA 2YWPA 4G34A 4O0UA 4U40A 3UOHA 5LOHA 3V5JA 2ZDTA 4PMTA 4A4XA 4AQKA 3NIEA 2RL5A 2BRHA 2V0DA 4M8TA 4ONAA 3FMLA 3HRFA 5A14A 4OAVB 3BELA 4I0SA 3U9NA 4RFYA 5L6PA 3TDVA 3FC1X 2XH5A 2BZIB 2WMQA 5EI8A 4FT9A 4A9TA 1IR3A 3AQVA 3BLHA 3H4JA 3TZ7A 2WMVA 4BDJA 1MRUA 4LOOA 4WKQA 4CMTA 4GEOA 4J52A 1TVOA 2BDFA 5EM8A 5EW8A 4BI1A 1PXMA 4CTBA 3N9XA 4D1XA 3EQBA 3TKHA 2P55A 4H1MA 2QOOA 5CU3A 2ZJWA 3SLSA 4O4EA 1ZYCA 5HX8A 3EIDA 1PJKA 2NRUA 2PE1A 3D14A 5FP5A 5EQYA 2W4OA 1OZ1A 3HV4A 4EK6A 3CPBA 2WHBA 3ZO3A 4R78A 2PVYA 3BCEA 2X0QA 3UMXA 1XH6A 1ZYDA 3I5ZA 4G5PA 3DZOA 4RX8A 2CDZA 3G6GA 1YI6A 5EOLA 3W18A 4EYMA 5DE2A 1WBTA 4HVSA 2WEVA 4IAYA 4JAJA 2ETMA 4K9YA 4QP1A 3A8XA 3UE4A 3VN9A 5L8JA 4BKYA 3QD3A 4F6SA 3F6XA 4FUXA 4J71A 4NU1A 2Y8OA 3VUTA 1KV2A 3ORKA 4NKSA 4Y46A 4KNBA 3UVQA 3ZSIA 3R04A 2G2IA 5D1JA 2QG5A 4I22A 2GTMA 3NX8A 3Q5IA 4PPCA 3UYTA 4CCUA 4GU6A 2CGXA 4LOQA 5HBEA 3W2RA 3PIYA 4JR3A 4IM2A 4H1JA 3DKOA 4P4CA 4DG3E 3D83A 4I41A 3KGAA 3TZMA 4AQCA 1IA9A 3PIZA 4FSRA 4L42A 2VTJA 3FJQE 4J53A 2WU6A 3H3CA 3QTRA 3PYYA 4EK8A 3NIZA 2EXEA 2X7GA 1Q8ZA 4AXCA 4D4VA 5AM6A 4C4HA 5CNNA 4MNEB 2WGJA 4NW6A 4WRGA 4QPSA 4MH7A 3ZCLA 4D4RA 4CLJA 3TUDA 3UC3A 3C4FA 1CMKE 1KE6A 3NUUA 1AGWA 4WNOA 1YVJA 3OY1A 4O0TA 3OUKA 3W8QA 4DG2E 4F9WA 2QLUA 4S34A 3W33A 2EXCX 3ERKA 4Q2AA 3L1SA 3VUKA 4FUYA 3ZEPA 4C8BA 5JSMA 2QOIA 2YLEA 1V0PA 4UALA 3I4BA 4UXLA 4XV3A 3BBTB 5AV0A 4BDDA 3NUYA 4IW0A 4IJPA 3E93A 4Y73A 2WMUA 4G3DA 4WRSA 2PVNA 3ETAA 5HG8A 2A0CX 2WMBA 2BDWA 4RVLA 5CT7A 2AQXA 1VJYA 3GC7A 4KINA 4YZMA 5ANJA 5E1EA 3VQUA 1GY3A 4ANOA 1OIYA 5BVFA 1W98A 3CQEA 1M14A 3WF8A 2IW6A 3GCUA 4BB4A 3R9DA 2GDOA 2V22A 5KMNA 4BJJB 4ZZMA 1WAKA 2ZV2A 3ELJA 3E7OA 4GH2A 4XG7A 3ZXTA 2QVSE 3SG8A 3QQGA 2F9GA 3RBWA 3VRYA 3KQ7A 4R5YA 5CAUA 5H8BA 2ITVA 4UZHA 5E8UA 4QNAA 4FKGA 4ASDA 3I7BA 4EOOA 1I44A 2HZ4A 5GJDA 4AP7A 4EEVA 4CKIA 2YM5A 4DTKA 2VGPA 3TUCA 5AP7A 3DS6A 2GSFA 4HVGA 5HQ0A 4PDYA 4R7HA 2CHLA 5IEVA 2QOFA 3QXPA 2JC6A 4I0TA 2DQ7X 3KVXA 4RVMA 3WOWA 4RGJA 3AXWA 3Q5ZA 2Z8CA 1IG1A 4FKLA 3UDSA 5L2TA 3CJFA 3MTFA 5BVEA 4QQJA 2QO2A 3BRBA 4QMYA 4IC7A 4KAOA 3TXOA 3UC4A 1ZWSA 3OOMA 5FM3A 2WFYA 2XMYA 3KN6A 1NT2A 2R0UA 3LXPA 3NNWA 4P2KA 4YLLA 4QYGA 1V1KA 2OJIA 4GMYA 5LMAA 4E93A 5JKGA 4EZ3A 3BYMA 2QKWB 4IMYA 5BVDA 1XR1A 3O0GA 1KV1A 2VO7A 4FTTA 4KUJA 4YZDA 4FOCA 3LCDA 5LVOA 2WIPA 3VBXA 2JKKA 1U54B 5HESA 5KUPA 4D4YA 2WTJA 5EYMA 3FLYA 2VTHA 2PHKA 3PSDA 4DBXA 4FTIA 1R39A 4G31A 3OEFX 4XOYA 4N4SA 4U45A 4YMJA 3S0OA 3LFEA 2CKQA 1YQJA 4LQMA 5K5XA 4EKKA 5J5TA 2YIYA 3P0MA 3DGKA 3A61A 3QUPA 3RZBA 3L8VA 5IA2A 3R2YA 2W1FA 3C4EA 2J7TA 2B7AA 5HE2A 3QC9A 3EQRA 4FL1A 3V51A 5DMZA 1OM1A 2I0YA 3PXRA 4AZWA 5EHOA 5HCXA 3KRRA 1J1BA 2CPKE 4R3PA 3HDNA 3UJGA 3UGCA 2CGVA 3GFWA 1PXOA 4CNHA 5TT7A 2X81A 4QQCA 3MN3A 3HDMA 3I79A 3FMDA 2PMNX 4JOAA 5EW3A 1Y8GA 3P4KA 3RWPA 4HVHA 4YTCA 3D15A 4J97A 3HAMA 4FTKA 4BKZA 3E5AA 4ZSAA 2J0JA 4IZ5A 3MIYA 3UZRA 3CIKA 2VWBA 3NRMA 3KMWA 3AMYA 4H3QA 4QMOA 3BGZA 4UMTA 2VTIA 4DEGA 5IA0A 3BEGA 5EH0A 4HCTA 3SGCA 2C3LA 3EHAA 4NJ3A 4D0WA 4BCMA 4PY1A 2YABA 4IX5A 4X21A 1NXKA 4FBXA 3F2NA 4QEBA 3HP2A 4L3LA 2C1AA 3FUPA 5AUVA 4DHJA 4E6CA 3N51A 4EYJA 3DJ7A 5CSVA 4CTCA 5KMIA 2PUIA 5L3AA 5BYZA 4PL3A 4TNBA 5IQAA 4I4FA 3MWUA 4DCEA 4D2PA 4O4DA 5KO1A 2XNBA 3UYSA 2CKPA 4IVAA 1YXVA 4ZJIA 4Q9ZA 3MVMA 5M4FA 4QQ5A 4OBOA 2PZRA 4ASZA 2YACA 1WBVA 4X3FB 5KKRB 5T68A 4CKJA 1W82A 3BV2A 3LFQA 1XWSA 4Y8DA 3O23A 4ZTLA 2XEZA 2OBJA 2VWUA 3FMNA 4FKSA 2YEXA 3VS2A 1UNLA 3H9RA 3V8TA 3Q6UA 3BHHA 4NTTA 1H27A 2W1CA 3D5UA 4QMTA 4ANLA 2GNHA 4FEVA 1W83A 4MXZA 3V5PA 4ZSGA 5A4EA 4N0SA 1CTPE 2C6DA 4FG9A 4O7YA 4DFNA 4PL5A 5M57A 4L45A 5G1XA 1WBWA 5EHYA 2BAJA 4I20A 3V3VA 4R3RA 4I23A 2IZTA 2OO8X 3NAYA 3V5TA 4GK2A 4C02A 3WARA 3PA3A 5JZJA 1P2AA 1UU3A 1H8FA 4EZ7A 2YFXA 4ARKA 4ZTMA 2HZNA 3CKXA 2YAKA 3SX9A 3T8OA 3ZC5A 4BCFA 3OCBA 3R9NA 1YDRE 3R8MA 2QOQA 1YXUA 2WTDA 3QGWA 4MNEA 5ANGA 3W0QA 2WOUA 5FEDA 3RAKA 4Z7HA 1RJBA 2NO3A 4B7TA 1OB3A 1JKKA 4JG6A 1UVRA 3PWYA 4HCUA 1UNHA 3VJOA 4X2NA 2XANA 1O6LA 4O4CA 4ASEA 3NVMB 4QO9A 4WT6A 4IH8A 4TYGA 2PMOX 1XH5A 4C58A 4DYMA 5J79A 4O7LA 4IANA 5BUIA 2VWYA 3UNZA 3KFAA 3OTUA 5JRQA 1J3HA 4IAAA 1PMNA 4LDTA 3EN7A 3VBTA 1E1VA 2VWZA 1DAWA 2VO6A 3V5QA 2JD5A 3KULB 4E7WA 4FV2A 5E4HA 4YPSA 4BCOA 4ACCA 4FKOA 4AG8A 2C0OA 4PV0A 1UV5A 2ZV9A 2Z7LA 2OK1A 3QAME 3TV6A 4BJJA 3ZONA 3L8SA 1JSVA 2WMTA 5CENA 3BLQA 2HZIA 2ONLA 2WB8A 4O27B 4QMMA 4F7LA 3FPMA 4FTMA 5C8MA