3MH3A

Mutagenesis of p38 map kinase establishes key roles of phe169 in function and structural dynamics and reveals a novel dfg-out state
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
348
structure length
334
Chain Sequence
RPTFYRQELNKTIWEVPERYQNLSPVGSYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDRGLATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 14
publication title Mutagenesis of p38alpha MAP kinase establishes key roles of Phe169 in function and structural dynamics and reveals a novel DFG-OUT state.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 103
structure length 334
sequence length 348
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2010-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3mh3A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3mh3A01
4HCUA 4FKPA 2PZ5A 1R78A 3HV4A 4RMZA 3TCPA 2YCQA 3NPCA 2ZDUA 3MFRA 4I94A 3UNKA 3HNGA 3Q4UA 4QP4A 3ZRKA 4PUZA 3HMPA 5CU0A 2QG5A 4W9WA 3UQGA 2R5TA 1TKIA 2OXXA 2PMLX 4EH7A 4M67A 5EQEA 3EQBA 3MV5A 5DHJA 5I9UA 3SX9A 5LVMA 3C13A 2E2BA 2XB7A 4RRVA 3LQ3A 3E92A 4UMTA 3DBDA 5B2KA 5CEKA 5FTQA 4FKRA 4RGJA 5BUEA 2VNWA 3OWKA 4I5CA 4KBAA 5HBJA 3TEIA 2PSQA 2BIYA 1FQ1B 3CQWA 2XIZA 5FEDA 5IISA 3AC5A 3QQLA 3ZUVA 4YSJA 3F7ZA 1GNGA 3BWFA 4IM3A 2EB3A 4DBXA 3QBNA 4FV6A 5G1XA 2C1AA 2X39A 2YIWA 5AR3A 4HOKA 4ZXTA 2RL5A 4NJ3A 5CSWA 4C7TA 1DI9A 3DJ6A 3GNIB 3FYKX 3P86A 4DEHA 2HY81 4F6SA 3GVUA 2G2HA 1WVXA 4LGGA 4U6RA 5J5SA 1JQHA 4G16A 5LJJA 1ZZ2A 2QOOA 4O0WA 2I6LA 4EH9A 3U6HA 4KABA 5EQPA 4MBIA 3KMUA 4L3JA 4U80A 4FKSA 5ETCA 3UIBA 5IQCA 1ATPE 3FKNA 2J0MB 5IMXA 3LXLA 4QYGA 4XG3A 3IDBA 4O38A 5AV1A 5HGIA 2HOGA 5A6OA 4GFGA 1H1WA 2NO3A 3R9NA 3E8DA 3VS6A 2QR7A 3QAME 5E7RA 4Q5EA 4JX7A 2GNJA 3OF0A 5E4HA 3W33A 2ITWA 5I3RA 4RSSA 4BDFA 2XK9A 4C4HA 2Y6MA 1BYGA 3AC4A 2GHMA 5F20A 3KREA 4GT3A 2HXLA 3RINA 2C6OA 1XH4A 2WQBA 4YHJA 2YN8A 3A60A 3HMOA 4FSQA 3LZBA 4OBOA 4RFZA 2UV2A 4N4SA 4IAKA 5HLPA 4FKQA 3ODZX 4WSQA 2BCJA 2IO6A 4CCBA 4MEDA 2GQRA 5IQGA 1YHSA 3TTJA 3UYTA 1TVOA 4XJ0A 5A4LA 1OUYA 3KMMA 4M69A 3V5JA 2BAKA 5HESA 3V3VA 3CEKA 4FT3A 4WO5A 5BYZA 2ERKA 2FSTX 3DTCA 3F3TA 4K8AA 5IUHA 4HGEA 4LOPA 3DK7A 2PTKA 4G3DA 3ZSGA 4HVDA 5K4JA 3MH3A 3RPRA 2C5VA 2X8EA 4S30A 5EKNA 2A2AA 4ID7A 2JBPA 4J52A 4EOIA 4WNMA 4YLJA 2X2KA 5HOAA 3EIDA 5ETAA 3I7CA 3V5LA 3DK6A 4KA3A 2CCHA 3FI3A 3O51A 4OBQA 4R6VA 4EH2A 5A4EA 4FV0A 1APME 2WELA 4K18A 3IECA 2V0DA 2QO9A 4U8ZA 4Y73A 3ZFMA 5AA9A 2CNQA 3P4KA 4IC8A 4U43A 4ZJVA 3PFQA 3BHYA 1U54A 3ELJA 5F94A 3KQ7A 2BIKB 4DGGA 4IHPA 4IZ5A 2WNTA 2CLQA 4XG7A 1Y57A 2VTIA 3KL8A 3RAHA 2VWBA 4AW0A 3Q60A 4OTPA 3D15A 3G6HA 4BTKA 1Y8YA 4O84A 3W8LA 2VO3A 4XRLA 2B0QA 1H00A 2YIXA 5JGBA 4PF4A 3DXNA 3GUBA 2PVYA 4XRJA 2ITOA 3MI9A 2JC6A 3RMFA 4BDGA 5K0XA 3OBGA 1J7LA 3NNUA 2R3NA 1JKLA 4PMTA 3AC3A 2XCHA 4RX5A 3BHTA 3FLZA 3Q52A 4RVMA 1A9UA 5BPYA 4QNAA 3EJ1A 4EOOA 2W7XA 3FDNA 4XX9A 1H01A 4IJPA 4GIHA 2XNNA 4RPVA 3SV0A 4H3PA 4IAFA 3KF7A 1CMKE 4MBJA 3F5UA 3ZRLA 4ANBA 5EDQA 2O2UA 3EQDA 1URWA 4D58A 1Q8WA 1XH9A 2C69A 2UW8A 3OXIA 3POOA 5FM2A 2UW4A 4KSQA 4D55A 3HUBA 4K1BA 2V22A 3G90X 1TQMA 4FEXA 4O7NA 3D7TB 5HIEA 3OCGA 3MFTA 3LFFA 3FL5A 2I0HA 4QMNA 2FO0A 3TJCA 3PRFA 4QQ5A 4E8AA 4EK8A 3HZTA 3TV6A 4QMQA 1CKIA 1REKA 2CGUA 2QLUA 4ANOA 3D2KA 1ZLTA 4BHNA 2VTSA 3G2FA 3NYOA 3COHA 2ZOQA 3R02A 2PK9A 4I5HA 1CM8A 4FNXA 3ORNA 3RNIA 3ZO4A 4BCGA 2P2IA 3DKCA 4FZAB 5CLPA 4BZOA 2B4SB 2WEVA 4XLIA 5EW9A 1OECA 3D2IA 3EQFA 4PQNA 4W9XA 3VBQA 2YCRA 4Y5HA 4RFYA 3GEQA 3Q6WA 5EH0A 4C35A 4O6EA 2SRCA 2BZIB 5AEPA 4R78A 1OKZA 3E8CA 4GK4A 2YM3A 3CKXA 4QYFA 4C0TA 3PXQA 3HVCA 3WZDA 1M2PA 4LM5A 3R71A 4II5A 3VQHA 5AM6A 5I5ZA 5CX9A 4DFXE 1LPUA 3C4EA 2JKKA 3AMYA 3QXPA 4FKJA 4M14A 5ANOA 2OXDA 5EDRA 3UOKA 1H1RA 3ZDUA 2XIRA 4AX8A 1A06A 4DLIA 1SZMA 4O96A 3A7JA 2YAAA 5LMKC 4FTOA 4CNHA 4ZSJA 2PE1A 5AAGA 3AC8A 3DLZA 3ID6C 2OO8X 2EXEA 4CGAA 4CFNA 3FLSA 4TWOA 3V01A 5B2LA 4EH5A 5J87A 2HWOA 3P5KA 3Q96A 4DA5A 3WI6A 1Z5MA 3R6XA 1OPJA 4PL4A 1UA2A 3NNWA 2HCKA 3QTSA 3U6IA 4IB1A 4ITIA 4LG4A 1Y8GA 4UWBA 4CFUA 2H96A 3QTUA 2PZRA 3R1SA 4U0IA 3UP2A 5D41A 2X8IA 2W1IA 3M1SA 5ANEA 4QTEA 4R77A 3D7ZA 2CMWA 2JFMA 2XYUA 3IDPA 3L8SA 3F3VA 5H3QA 5LARA 3RM7A 4FK6A 4FV3A 4YLLA 2W9ZB 3ZBFA 4BTFA 4OUCA 3ENHA 2OK1A 3ZO1A 4YO6A 3O0GA 3WIKA 4AN2A 2BTSA 3W2OA 3PVUA 1PKGA 4M13A 2QC6A 3E3PA 3PY0A 4FTIA 3BBTB 3ORTA 2HIWA 4JR7A 2BROA 3RK7A 3V6RA 3ZUUA 4CKRA 4MF1A 3R1QA 4YMJA 3MVLA 4H36A 4UMQA 2PUPA 2YITA 4EHZA 4ALWA 4NH1A 3RPSA 1WCCA 2IZTA 4U97A 4MXXA 2PY3A 4X2KA 3NRMA 3R9RA 1UNHA 3KK9A 4BBMA 4YJTA 2JAMA 2WOTA 1CTPE 3KRRA 2VX3A 1Q61A 1Q41A 1WBSA 2WZJA 2XCKA 3FLQA 2WIPA 2OXYA 2JIIA 4FODA 3TACA 3UC4A 4G6OA 4FK3A 4IFGA 1Q4LA 5BVOA 3JR1A 3JY9A 1FINA 2R2PA 4BN1A 1O6YA 3F3WA 5C1QB 4JRVA 3PXKA 3Q9XA 1Y6BA 4HPTE 3O2MA 5EM5A 5E8UA 4QMPA 4PMSA 3NIEA 4ZY6A 5EI2A 2XA4A 2QCSA 4MD9E 2CSNA 4FSTA 1OITA 4G17A 1KE9A 2EUFB 1W8CA 4MNEA 4G3EA 1Q5KA 5J95A 3U51A 3EQIA 4AGWA 4UV0A 4C8BA 3FPMA 3VS7A 3OUNB 1GZ8A 4EH8A 4NM0A 4BTMA 2VO7A 4P5ZA 4XP0A 1YWRA 4D9TA 1PXOA 2VTRA 4OTRA 1TQPA 2C3IB 4TTHB 3SRVA 4MXAA 2JIVA 2QHMA 4CV8A 5CEPA 5M07A 5EK7A 1B38A 3UOJA 3KY2A 5FM3A 2ESMA 4BB4A 1H26A 2VTOA 5KKRC 2YDIA 3U6JA 2Z2WA 5FXQA 3IGGA 5CU6A 2CPKE 3I1AA 3UC3A 4BGHA 2RSVA 3V8SA 4CXAA 2PVMA 4FTUA 3GB2A 5HO7A 4FR4A 3ORIA 4O21A 4QMOA 3NVKI 2VTJA 2HAKA 3GENA 4F7NA 1XBAA 3ORMA 3KULA 2HZ4A 4TYHB 2WMXA 4WHZA 4AW2A 4J97A 4HJOA 1WBOA 4FUYA 1G5SA 3KN6A 5DFPA 1ZMWA 3D94A 1YXUA 3OP5A 5G6VA 3RWPA 4IX5A 4CCUA 4P7EA 1YXSA 4LOOA 2YCFA 5JFVA 4YJVA 4B4LA 2REIA 3UZPA 1QPEA 2WFYA 3QCQA 4DH1A 5HG7A 4EWQA 3OROA 3QU0A 3BHUA 3LJ0A 4D5KA 3LFDA 4JLCA 3MDYA 1QL6A 2F2CB 3DTWA 4EHVA 4O1OA 3ZLWA 2RFDA 3EQGA 2UW6A 3IW8A 2PWLA 5LVNA 2Q0NA 4I4EA 3V5WA 1YQJA 4WT6A 4N57A 4HW7A 4E5AX 3OCBA 4ITHA 3MSSA 3NEWA 2WU7A 3PLAE 1FGKA 2WKMA 3MFSA 4RJ8A 3H0ZA 5EYDA 2X81A 2R3OA 5CVHA 5CSXA 4I6HA 3FHRA 5I9WA 2O5KA 3B8QA 4N0SA 2QVSE 4PNKA 2PVFA 2IZSA 2QKRA 3MH2A 2W4KA 4L3LA 4L44A 1O6KA 3DZQA 4IFCA 1GIJA 1Z9XA 2C6LA 1V1KA 3OWJA 2X7OA 3MB7A 4AUAA 2VUWA 3TUCA 5LMBA 2VO6A 3D5VA 1PYXA 3BELA 4FSRA 4DGMA 5KMOA 3EKKA 3OHTA 2IG7A 2XKEA 4HCVA 1P5EA 4MNFA 3SHEA 4BYIA 2IW8A 5GINE 3FSFA 1NW1A 2ITVA 4CRSA 3LFSA 4I0SA 3AG9A 3FLWA 3QQUA 3OTVA 3WF6A 3E64A 1PW2A 1MQBA 2BUJA 3AOXA 4FIHA 5T6KA 2F7EE 5ETFA 2PUIA 4HYIA 3VS3A 5CENA 3LLAA 5L8JA 3BU3A 3TZ8A 3F61A 4ZLYA 4EOPA 4FGBA 4IAYA 3RPVA 4AF3A 1DAYA 3ZEWA 2PVNA 2ZV9A 3LM5A 4LV5A 4U7ZA 3OT8A 5AV2A 5E8TA 3MYGA 3G15A 2OGVA 4DFZE 2XEYA 1WFCA 4QYEA 3P7CA 5C8KA 3RK5A 4YPDA 1REJA 3DV3A 3SDJA 1FMKA 1R39A 2XNOA 4KINA 1J1CA 1VEBA 1XQZA 2JITA 5H8BA 3KXZA 3EYGA 3OOGA 3QX4A 5JZNA 3FQHA 2OICA 3HLLA 5HE0A 3RHXA 3ET7A 4NCTA 2E9OA 5JGAA 3SGCA 1NA7A 3K5VA 3ROCA 1WBTA 2BFYA 2WO6A 3H9RA 4GMYA 3D0EA 4YZ9A 5AUXA 3VW6A 4DYMA 2WQOA 3C0HA 4G31A 3EHAA 5HORA 4RC3A 4D4VA 3NUAA 4UZHA 4AT3A 4ZTHA 4W4YA 3R00A 1KE8A 3IO7A 3SKCA 1K2PA 2IZRA 2OG8A 3H9FA 4KD1A 4CYJA 5ICPA 1GY3A 2WIHA 4O0UA 1JLUE 2Z8CA 3VF8A 4F0FA 4O7VA 2Y4IC 2B7AA 3OBJA 5DNRA 3NVMB 3GI3A 3HRFA 4CKIA 5DRDA 5EDPA 4QMWA 4EZ3A 4F7JA 4BTJA 4RZVA 3IQ7A 1MRVA 5M4IA 1VZOA 2QLQA 1XJDA 3PY3A 4NUSA 3D5UA 4C58A 2BDJA 4I4FA 4P90A 2EXCX 1Q3WA 2ZMCA 3TKUA 1LP4A 1WAKA 5TR6A 2RFNA 4GYIA 3VBYA 5IU2A 4FBXA 3C7QA 3FL4A 3UNJA 4AZSA 3F6XA 3DAJA 3BE2A 1OL6A 3NNXA 4O22A 4Z3VA 5C4LA 2O65A 5M4UA 5M56A 3E3BX 3FMDA 4W8EA 5HO6A 4FA2A 4NIFB 1KE7A 5CU2A 4Y85A 5D7AA 4QMVA 4RVKA 3C1XA 5C27A 3LPBA 4UXQA 5IH4A 4O7WA 4QMLA 1M2QA 3WARA 4DG0E 2QI8A 4GT5A 3ZSHA 3DA6A 5ETIA 4G9RA 1XH5A 3DPKA 2R3JA 4OT5A 3G51A 4EQCA 3B8RA 4FGRA 1UNGA 5DLSA 3I7BA 5C03A 3EN7A 3P0MA 1YOLA 3EKNA 1V0BA 1R3CA 3EZRA 3KMWA 4JT3A 4R5SA 4TN6A 4DINA 5KHWA 3NUNA 2C0TA 5L8KA 4IANA 4XV3A 2XNGA 2PMOX 4F0GA 1QCFA 4IJ9A 4A9TA 4TL0A 1XO2B 2PVRA 4FIEA 5ANDA 4CFWA 5KCVA 3DQWA 4JQEA 4M69B 4CTCA 2ZB0A 5LXMA 3ZM9A 4JBVA 3F82A 3R01A 4ENXA 4AOTA 4ARKA 3UMXA 4CG8A 4IH8A 4OAVB 3HDNA 3KCKA 5IDNA 3NW5A 4JI9A 2XVDA 3AQVA 5F95A 5HNBA 3SA0A 3PIZA 3ENMA 2PPQA 1PJKA 5HIDA 3PVGA 2C3KA 3PA3A 3ZUTA 4J7BA 5AV4A 2F9GA 4LFIA 1OIRA 3O50A 2YDKA 4RQVA 3ZDIA 4AFJA 3UDBA 4LL0A 4S32A 4XYFA 4CZTA 3CJGA 3MB6A 1DM2A 2ETRA 3OD6X 4N70A 5JQ8A 1U4DA 1LR4A 3EN6A 3R0TA 3TV4A 2F2UA 1IRKA 3MA6A 2OZAB 3NWWA 4GKIA 1NVRA 1PYEA 1U54B 3R21A 4ANQA 4DH5A 2XIXA 5L2WA 5HE3A 5IH6A 4WRSA 3S2PA 1YHVA 4GSBA 4PDOA 3W2QA 1DI8A 4E3CA 2X1NA 1XBCA 2YLFA 3LM0A 5DBXA 5ANJA 2GHGA 3FV8A 5CAPA 4LOQA 4KB8A 2AYPA 3QCXA 2C5NA 2ITYA 3HAMA 1PKDA 4QYHA 4AN3A 1XKKA 2Q0BA 4LRJA 4RA5A 5AP4A 1RE8A 4BZNA 3CPCA 3RNYA 4YHFA 3S1HA 3CD8A 5E8YA 3LXKA 1PMVA 5KE0A 3UPZA 5AR7A 3RTPA 4GFOA 4JL9A 3TTIA 3DKGA 4AZWA 4AN9A 3HGKA 2X4FA 2W06A 3R2YA 2JIUA 4R3RA 4GUBA 5HE1A 3RHKA 4C37A 2E9PA 2NP8A 5J9LA 1MUOA 5L4QA 4WA9A 4F08A 4ZS4A 4FEUA 4CFXA 5LVLA 4YHTA 1PXNA 5C8NA 3VBTA 2R3RA 3KKVA 5J9ZA 2W5HA 3RAWA 5DGZA 4ALVA 2R7IA 1PXIA 2BAQA 2OF4A 5L3AA 4L46A 2PZPA 4JQ7A 3REPA 5DOSA 3V51A 4ZSAA 3AMAA 2ZM1A 2CHLA 4RIWA 4IAZA 3PZEA 4EHGA 4B0GA 1K9AA 2ZVAA 3IK3A 2X8DA 4IADA 3HMIA 5DA3A 5BVEA 3OT3A 3DS6A 4XV2A 4CLIA 4FYNA 2PVJA 3R83A 2BAJA 1P2AA 2RG6A 3POZA 2XKCA 4FT5A 5IEYA 5AUZA 1KSWA 4TYGA 4CZUA 3QXOA 4C57A 4B7TA 5LQFA 2R64A 3SW7A 4KUJA 2R3HA 5IA5A 1AGWA 3KXHA 3R7EA 3TV7A 3SD0A 4CEGA 4GG5A 3NX8A 4L7SA 1UWHA 4CMUA 2OH4A 4M0YA 5AP5A 4PY1A 3KVWA 3W18A 3BU5A 4RC2A 5IQEA 3OFMA 2R7BA 2W1ZA 4X2FA 4TWCA 4Y95A 2CGXA 3GC9A 3DFAA 3RJCA 1IAHA 3WOWA 5FBNC 3W16A 5EYKA 2BR1A 2XM8A 3UO6A 1H8FA 2J51A 4F9YA 5A4QA 5E1EA 3GCQA 4FV4A 2VTNA 4H58A 3UQCA 3VS4A 4FSYA 4FVPA 1OKWA 3EN9A 4NKSA 2ZV8A 1W0XC 2CCIA 4ASZA 2C47A 4PMMA 5IQDA 2NPQA 2GS7A 2YACA 4GJ3A 3KEXA 4FTLA 1F3MC 1ZZLA 4IMYA 1W82A 3HA6A 1NY3A 3TG1A 3L9LA 4AP7A 3E63A 3EQCA 2E9NA 2WMVA 4BRXA 4ASEA 4YU2A 4HYHA 2JDOA 1FVVA 5FP5A 1SNUA 3GQLA 1BKXA 3O96A 5E8SA 4X2GA 3RZBA 3TIZA 5JMSA 1R0PA 4IQ6A 1HOWA 4PPCA 3I0OA 3HV6A 5FRIA 4TY1A 3ZSIA 4K2RA 2BZJA 2O63A 3K5UA 1SVHA 3QQKA 2QOLA 2BDWA 2OF2A 4AOIA 2WMWA 2VN9A 4DHFA 1KOAA 2V62A 4Y83A 4CYIA 5CI6A 1O9UA 3PPKA 1YOMA 5LVPA 4ASXA 2OFVA 5BX0A 2HW6A 4KSPA 3GGFA 4TXCA 1FVTA 2R3IA 2YEXA 5HE2A 2YDJA 3UIXA 4V0GA 4CT1A 1KOBA 5DT0A 4KS7A 2OWBA 3C4WA 3U4UA 5BMSA 2CLXA 2PHKA 1WMKA 5K9IA 1JKKA 1VYZA 3FC1X 4L53A 3QCSA 4NU1A 3P23A 2JEDA 4UZDA 4AT4A 4NM5A 3SG8A 4BDCA 4CVAA 4O7LA 4X3FC 3PRIA 1OPLA 2FYSA 3FAAA 4O27B 2VTTA 4RIXA 5DRBA 5EHOA 2J5FA 3FZTA 4BCIA 3FI8A 5A54A 1S9JA 1FGIA 4UBAA 2PL0A 4QYYA 4UEUA 3T9TA 2IVUA 4ANMA 4D2VA 5TO8A 2OJGA 3O17A 3NYVA 3P7AA 3AMBA 4NTSA 3VW8A 5KNJA 4AWIA 5FEQA 3TKIA 2ZM3A 3C4CA 1Q8YA 4X0MA 5ANKA 5CASA 4YR8A 1ZOEA 2F4JA 2XKDA 3DT1A 2C6DA 2P3GX 5CNOA 4U41A 1FOTA 2QOIA 3BX5A 3FY2A 2IZUA 4XG2A 4BFMA 3ZFXA 5CEOA 2YM5A 3MESA 3COIA 4OTGA 4MH7A 3KFAA 3FI4A 3SXRA 3TZ7A 1JSVA 3ZLSA 4W8DA 4CLJA 2WD1A 3NSZA 3IPHA 5C26A 2X6EA 4ZMFA 2BKKA 1KV1A 2HXQA 1G8SA 4OT6A 5HKMA 3FPQA 4FC0A 3OWPA 3WIGA 5HNGA 4ANNA 1XH7A 2X7GA 4BWKA 3ZM4A 3PJCA 4A9SA 3I0QA 4R3CA 2CKPA 4CRLA 4CKJA 4MX9A 3LMGA 2G2IA 3PVBA 1YHWA 3R8MA 4BGQA 3DOGA 3DGKA 4GKHA 4F70A 4UMPA 1H1QA 3PY1A 4YUQA 4GT4A 1XH6A 2W0JA 5AV0A 4EYJA 2W99B 4BI1A 4MAOA 2XM9A 1WBNA 4O2PA 3V6SA 4NKAA 1BI7A 2BRMA 4G3FA 2ZDTA 3ITZA 3QL8A 4BIBA 2IVVA 2OJFE 4ZTNA 5M08A 4O0YA 2WTKB 1YXXA 2V7AA 5J9YA 4C59A 3PXRA 2ITUA 3QA8A 1H1PA 4X3FA 5IH5A 3QA0A 4EKLA 4UMUA 5AP7A 4BCHA 3EB0A 5CNNA 3FI2A 5EHLA 4QP6A 3GU7A 5JKGA 5D11A 4QO9A 4XNEA 2C6EA 2QQ7A 4H1MA 2XKFA 4FKUA 5C01A 5CAUA 3WF9A 1U5RA 3SXSA 3ULZA 2XNPA 1YDRE 3GCSA 4AE6A 4O0SA 3FYJX 4FI1A 4YBKA 3HKOA 2CGVA 4QMMA 4RX8A 4U40A 5K5XA 4MD7E 2OJIA 4ZTLA 3ZC5A 3ZS5A 3HRCA 4BWXA 4GL9A 4IM0A 4AFEA 4M3QA 3MFUA 5BQ0A 3UE4A 3TI1A 3QTWA 3ZBXA 3ZONA 4XBUA 4R8QA 4AA5A 4APCA 3N4VA 3PG1A 4FTCA 3UVQA 4ALUA 3D4QA 1B39A 2BRGA 2UZUE 3BLQA 2QO7A 4IEBA 4O82A 5ANGA 5M51A 2PVKA 4U5JA 4A9UA 2UW7A 2BZKB 4QQJA 3A4OX 2C6KA 2H34A 3HV3A 3LVPA 2QOHA 4X7QA 5KZ0A 1PY5A 5L6OA 2RG5A 2H8HA 3FZ1A 4LMUA 2C68A 2A1AB 5BVFA 2OJJA 4CFMA 4H3QA 4RIYB 4ZZOA 5KMIA 3QLFA 2VAGA 2PMIA 3GU6A 5E8XA 4BCQA 1HCKA 2CGWA 5CU3A 3R8VA 5AUVA 4D2RA 4ZLOA 3VN9A 2GSFA 2O8YA 2PZIA 4C2WA 2YM4A 2WAJA 3R28A 4BCMA 4J95A 2C1BA 3D5XA 4F0IA 5GIOE 3UZTA 3JXWA 3VUGA 1ZYLA 3KCFA 3QUDA 5IQAA 1I09A 4UX9A 3ACKA 3BV3A 2YWVA 4TZRA 4BL1A 4EBWA 5HG8A 5CAOA 3CJFA 3KA0A 4AGDA 5EM8A 5K3YA 2PVHA 4R1YA 2WQEA 2XF0A 2X9EA 4HVGA 4YZMA 3OOMA 2GS6A 2WOUA 4L01A 4C3PA 3RGFA 1IASA 1OIUA 2A27A 2VGOA 4D1ZA 2JFLA 3BV2A 3VS0A 2FA2A 4C33A 4KIKA 3LIJA 5KUPA 4DH3A 3E62A 3GOKA 5EW3A 2G1TA 3A61A 2IPXA 3BPRA 5IA3A 4YBJA 4E4NA 4OAUC 4D5HA 3LFEA 4IDTA 4EQUA 2OBJA 2C6IA 3BLHA 4R7IA 5T3QA 4DN5A 5CXZA 3PSCA 2PYWA 2XBAA 1RW8A 5I9ZA 5K5NA 2HZ0A 3QC4A 4L7FA 4XHKB 4E6DA 3A99A 2JD5A 2QURA 3M42A 4UB7A 3DBCA 5J5TA 1ZYCA 2CN5A 4FL1A 3PG3A 4JR3A 1J7UA 5A4CA 3FMKA 3NIZA 4IC7A 4O7TA 3HV7A 3ORZA 4HZRA 5AUUA 1PXPA 4DGNA 4M68A 5AAFA 3LLTA 1ZAOA 1OL2A 4L42A 2BHEA 3ZTXA 4B8MA 5BVNA 4WNKA 4EORA 4IX4A 4O81A 5H2UA 2XK6A 3EQHA 4QMZA 2BRNA 3BCEA 3LCOA 1VJYA 5ACBC 5AADA 3E8NA 3O71A 3QZIA 4F09A 4AE9A 2Y0AA 1ZXEA 5IQHA 1U46A 3F5XA 3EZVA 3GFWA 4H1JA 4O2ZA 3LQ5A 3QWJA 3C9WA 1YDSE 4D4YA 2G01A 2W17A 4EOMA 1Z57A 4WIHA 4BYJA 3ZXTA 4BCFA 4YC8A 4NW6A 3NUSA 3Q53A 3VUDA 3UO5A 2YFXA 3C4FA 3LW0A 4IZAA 4AA4A 4E4MA 3TNIA 4D1SA 4RLLA 2GPHA 2VTQA 4CFFA 5HX8A 4HYUA 3OZ6A 3KK8A 3GC0A 2ACXA 4FZ7A 2A4LA 1OKYA 4WNOA 4KNBA 2ITNA 4XOYA 3DXPA 1M52A 4A4OA 4FIFA 3DCVA 5DI1A 4QTDA 1R0EA 5GZ9A 3RALA 4LL5A 4D2SA 4ZOGA 4A4LA 2VTLA 5CSPA 2XZSA 5JH6A 5M06A 4PDPA 3D14A 1IAJA 2PU8A 1EH4A 2XYNA 3PWYA 4IB5A 4RX9A 5KZIA 4C02A 4FSMA 5LMKA 5ACKA 3IONA 3HP2A 4B9DA 3EYHA 3BRBA 3Q2MA 2GDOA 2UZLA 2X9FA 5LWNA 5BVDA 2YLEA 4O1PA 2GCDA 3ETAA 4EWHA 4JNWA 2XNMA 3JUHA 3L9MA 3U87A 3W2PA 4JG8A 3H10A 4GIIA 4DLJA 2IVTA 4IX6A 3W8QA 4RT7A 3R2BA 3R22A 1Q97A 3Q2JA 1ZMVA 4YZBA 3QX2A 3QRTA 4NTTA 3BGPA 2DUVA 3IW5A 2C3LA 2BRHA 4EYMA 5AMNA 4KIOA 2GFCA 4JBOA 3WE4A 2ETKA 2QOKA 3PJ8A 4PX6A 2LGCA 3Q6UA 5AX3A 5J7BA 3R8ZA 5KMLA 4I3ZA 2W1HA 3AD5A 5K4IA 4EOQA 5KHXA 4M84A 4PWNA 5M4FA 5FXRA 4EEVA 2X2LA 5J79A 2GTMA 5AAEA 3ALNA 3BIZA 3OC1A 4XLVA 3RCJA 2UW5A 5KMJA 2JAVA 1A48A 3PSDA 3VJNA 5FEEA 4QMTA 4W4WA 3CIKA 3NUYA 3RBWA 5DR9A 3LXNA 5E8VA 2VRXA 4LGHA 4UYNA 4PL5A 4WG5A 4FSWA 4I22A 4BCJA 3QF9A 2ZMDA 4Y8DA 4WBBB 4LV8A 1ZY5A 5AJQA 4ERWA 4KKHA 3VULA 2EWAA 5HBHA 4G6NA 3QUEA 3VBWA 1RDQE 3VBXA 3NCZA 2YAKA 2OH0E 4OTWA 4MTAA 4QQTA 2Y8OA 1NXKA 4O86A 3EH9A 4R3PA 3VJOA 2IVSA 3F5GA 3AXWA 3TN8A 1YRPA 1G3NA 2UUEA 2WHBA 4KBCA 3QKMA 1I44A 3BKBA 3LFAA 2C0IA 3IW6A 4YTFA 5IF1A 3TDVA 2RFEA 1Q8TA 4XBRA 5HIBA 2OIBA 3FZOA 1OUKA 1UNLA 2PMNX 4IACA 3VC4A 3PE2A 4AXAA 5I9VA 1WVWA 5FG8A 4D2WA 4BI2A 3PXZA 4DEDA 1H07A 2VTHA 2XK7A 3FXWA 2XIYA 4HGSA 4J96A 3VS5A 4QMXA 2X2MA 2RGPA 2VWUA 3NUUA 3I79A 3QD0A 3FMEA 1GZNA 1SYKA 2DWBA 3Q9WA 5AP0A 4XG6A 3QRUA 4IWPA 2P2HA 3AT3A 5LOHA 5CEMA 4D2PA 1U59A 1ZYDA 2XEZA 4FKLA 5JZJA 3ZMMA 2EXMA 2W1EA 1OVEA 4USDA 5JFSA 5A6NA 2WMQA 5D12A 2ZYBA 1Q8ZA 3E87A 4IIRA 4FF8A 4QPSA 3TT0A 5KO1A 1YXTA 3CBLA 4QQCA 3NNVA 3C4ZA 2CNUA 2ITPA 2B1PA 2VX1A 3JPVA 4YJSA 5L8LA 3BHVA 5JRQA 1H25A 1OKVA 3FKOA 4GFMA 5AP6A 5AV3A 4HVSA 3MY1A 2RFSA 2F49A 3MIAA 2IJMA 4IVBA 4YJRA 3CQEA 3FKLA 2B52A 3R63A 4JAJA 5HCZA 3HYHA 3Q4ZA 3ZLYA 4UMRA 3DXQA 4RQKA 3BEGA 1YXVA 4PTCA 4YLKA 4FVQA 4KIQA 4AGCA 2OJ9A 4QRCA 2W1FA 5KX8A 3L8PA 3U8WA 1UKIA 4QT1A 4AZTA 1T46A 2ITQA 4FIGA 4MWHA 1BX6A 3KVXA 4I0TA 4LRMA 4GVJA 2G2FA 4MHAA 5HCXA 2WMAA 3A7IA 4QP9A 4DG3E 3W2CA 1GIIA 4JIAA 2I40A 4G5JA 3PWDA 4K0YA 4NM7A 3CR0A 2PUNA 2Q83A 3WYXA 3AD4A 3FUPA 1ZARA 3FMLA 2AC5A 4FTAA 4JDHA 2VWWA 3CTJA 4QPMA 5J7HA 4C3RA 2VV9A 3LCTA 4DT8A 4P4CA 5JSMA 5CSVA 2E9VA 2ITZA 1PMNA 3MVMA 2A19B 4K11A 3DBQA 4QP1A 4BICA 4TNBA 3G9LX 5IEXA 5A14A 2R3QA 5EI8A 4JQ8A 3R73A 5HU3A 4FIIA 1U5QA 3JVSA 4XV9A 2CJMA 1BUHA 4FG8A 2GNLA 2YIYA 1MP8A 4RWKA 4CMTA 4EJ7A 4LUEA 1M2RA 4CT2A 5CF5A 4F7SA 3DNEA 2G15A 2X4ZA 3R7UA 4B6LA 3R9OA 4ZS0A 5I0BA 4FICA 4E26A 3LHJA 2UZTA 4RX7A 3PIYA 3FZSA 2UZVA 3I6UA 4I0RA 3TUBA 3LMHA 1VR2A 2FSMX 3EMGA 3BHHA 4UYAA 4BCPA 3O8PA 4LGDA 5IG1A 2HK5A 5EYMA 4DEGA 3A62A 3DDQA 4L00A 4BCNA 2J9MA 3QQHA 4JDJA 4W4VA 5K0KA 4AS0A 3PLSA 4KKEA 4RG0A 4DH7A 1ZY4A 3QQGA 3UMWA 3TXOA 5EQYA 2R9SA 4TRLA 3L1SA 4JBQA 3W55A 1BMKA 3IKAA 3FMMA 4FG7A 2VWVA 1OPKA 1OGUA 1ZMUA 4S34A 3V8WA 1JSTA 5AP1A 4UN0C 3C5UA 2F7ZE 2J4ZA 4WD5A 5IA0A 4I24A 3NW7A 4K6ZA 3CKWA 4GYGA 3HDMA 3R8PA 1KE5A 1PXKA 5HBEA 5CYIA 5KBQA 4IW0A 4RFMA 1JWHA 2BFXA 4MCVA 4JG6A 2R3MA 2W5AA 3H3CA 1ZOHA 5CVGA 3RWQA 1ZYSA 4CD0A 4OLIA 3UQFA 3OCSA 3VS2A 4TW9A 5AP2A 3DKFA 3QD4A 5AIRA 4RIOA 4AOJA 1P4FA 4WOVA 4RWIA 1YI4A 4YC3A 5DT3A 4ZY5A 1LEWA 5HTBA 1RQQA 3BU6A 4R5YA 4XP3A 4EBVA 3W10A 2VNYA 3PZHA 4G34A 4ZP5A 2OIDA 4RVTA 4F6UA 2UZBA 1M7NA 1SM2A 1Q62A 4U42A 2P4IA 2YA9A 5J8IA 3GU8A 3SC1A 4G1WA 3DB8A 3S00A 4PDYA 3F2RA 3DBEA 1UVRA 3DBFA 4DFBA 4DT9A 4EZ7A 5TKDA 3TWJA 3AC1A 3UG2A 3EFLA 4F63A 4ZJIA 3R8LA 3BZ3A 3W2SA 3NAYA 5TE0A 5HHWA 4O0TA 3FJQE 5HTIA 4M7IA 1SNXA 4G2FA 1M17A 1J91A 2KULA 4MD8E 4M97A 5GJGA 3Q4CA 4JIKA 4BF2A 2PUUA 2W1GA 4OTHA 4ACDA 4IZYA 3I5ZA 3R1YA 4D0XA 4F9CA 3FQSA 2PE0A 3GBZA 3NGAA 3S95A 5AM7A 1BI8A 2GHLA 4XCUA 3FEGA 5H8GA 4O0RA 5AR5A 4CQGA 4UXLA 4ERKA 3F9NA 4DGOA 2BRBA 5CANA 3CE3A 4NW5A 3OXZA 4O6LA 4G9CA 5F9EA 2BDFA 3QTRA 4ACHA 1R1WA 3MS9A 3GQIA 4JRNA 3SOAA 2VWXA 4BVUA 1W83A 3QTIA 4EZ5A 3TZMA 3A7HA 5TF9A 3IDCA 3OCTA 4Q9SA 1GAGA 4IDVA 5LVOA 2YIRA 4U9AA 3QC9A 2XP2A 4DCAA 1DAWA 5GNKA 4C61A 4DG2E 3F69A 1W98A 4TYHA 5C9CA 4BGGA 1JAMA 4RC4A 2JDTA 1CDKA 1V0PA 2PZYA 2JDSA 4ORKA 3BYVA 2YCSA 3GC7A 3CXWA 4MXCA 1Y6AA 3C50A 5DEYA 4FTTA 5DG5A 3UIUA 3VUMA 2GU8A 4EOLA 1PHKA 5BYLA 1ZYJA 2QR8A 5DH3A 2QHNA 4A07A 4BCKA 3F88A 2WMBA 4UWCA 4L6QA 1UWJA 5D1JA 4M15A 2E9UA 2WMTA 3AGLA 3VHEA 2GMXA 3SW4A 4TWPA 2RIOA 3Q04A 4DCEA 1UU3A 2JLDA 2WB8A 4NM3A 5L6WL 3MPTA 4YZNA 3CQUA 5GIPE 4ZIMA 3U55A 3I81A 3LMIA 1P14A 5BUIA 3FSKA 4JS8A 3BQRA 2CN8A 3TKHA 4FT9A 2PVLA 2B9IA 4XH6A 2ONLC 3FZPA 4BKJA 4Z9LA 5C8MA 3CC6A 3RM6A 2YIQA 3WF7A 1XBBA 3IG7A 4EOJA 2UVXA 3VQUA 3FC2A 4YNEA 4X3JA 3V5QA 1WBVA 3A7FA 4ACCA 3IS5A 5EM6A 2IWIA 4OTQA 2QO2A 3K3IA 3LQ8A 3VAPA 3E8EA 3RI1A 2OI4X 4D1XA 2QOFA 4B99A 4YZCA 2GNHA 4BIEA 3TM0A 2PE2A 2Z60A 4BKZA 4F9AA 2UZOA 3H9OA 3VUHA 2V7OA 1WVYA 4KIKB 4ONAA 1FVRA 4TYEA 3KF4A 5D7VA 4F7LA 3KRLA 2JGZA 4GG7A 4TPTA 4IZ7A 2AUHA 2W1CA 5FTOA 2V55A 3IW7A 4OTIA 4AW5A 4O7RA 3AC2A 5J1VA 3AD6A 2UW0A 4DITA 4HCTA 4F64A 3FY0A 3THBA 1XHAA 4BR3A 4FNZA 1Q8UA 3UIMA 3A7GA 3OUKA 3UJGA 3E7VA 3KXGA 3BEAA 4FZDB 1XR1A 3ALOA 3P1AA 4YNOA 3ROYA 5M55A 4H39A 2VX0A 1JPAA 5CSHA 3K54A 4QOXA 5CZHA 3GCPA 5EM7A 1PXJA 1W84A 3MH0A 4E5WA 2B9JA 5A46A 4O7YA 3UODA 1IA8A 3K2LA 5B0XA 3WZUA 2QONA 3TNHA 4YSMA 2J0IA 1B6CB 5TOZA 4FV1A 4U45A 4J98A 4DBNA 2W1DA 1PMUA 5EI6A 3HMNA 3VUKA 2O0UA 2AC3A 4JG7A 2QU6A 5IQFA 4PMPA 3RK9A 3B2TA 4L67A 5AP3A 3CTHA 4MBLA 2VD5A 2VTMA 4RJ7A 2OFUA 2ONLA 3RP9A 3PUPA 5DN3A 5CS6A 5HICA 4NL0A 3UVPA 4FT0A 2HELA 4H05A 4ACMA 4I93A 1JOWB 2BMCA 5LCJA 3P79A 5E8WA 1E9HA 5CQUA 3NUPA 5DIAA 4BDIA 4J53A 3P78A 3NCGA 5DPVA 3UZRA 4DTBA 3R7GA 4IX3A 5HD7A 2F7XE 3RZFA 3VNTA 3OS3A 3R7OA 4AQCA 4X21A 2XK4A 3VVHA 3EN5A 4Z7HA 3VHKA 1UV5A 1H28A 3UPXA 2ZV2A 4DAWA 2BILB 4OGRA 4CQEA 3CCNA 2FSOX 3BLRA 3Q5ZA 2CKQA 1KE6A 5DEWA 1YOJA 3VF9A 3CD3A 3FMJA 2OIQA 3I5NA 3WZJA 4EQMA 2GQSA 2WTIA 3MIYA 4FTJA 3BWJA 3F3UA 2XJ1A 3ORXA 4FTNA 1NVSA 4NFNA 3ZEPA 4S2ZA 4F65A 1UKHA 3GT8A 3GP0A 3L8XA 4ZZNA 4L43A 4ACGA 4E7WA 2UZWE 3QTZA 4MNEB 4D9UA 5CALA 3S4QA 5FTGA 4A9RA 2FH9A 3Q4TA 1YWNA 4S31A 4BC6A 4I5PA 4G5PA 4L8MA 4WG3A 3QZFA 1H0VA 1Q24A 4MYGA 5GHVA 3FMNA 4DE4A 4NIFA 5AUTA 3CP9A 4TYIA 5AUYA 5M4CA 1YVJA 3SRVB 3ATSA 3TZ9A 1JBPE 5HX6A 4D4RA 2X7FA 3E88A 4FKOA 3R30A 1J7IA 3N4TA 4FZ6A 5DMZA 4KKGA 2ZM4A 4ZTRA 4GEOA 3B2WA 5CT0A 2P33A 4KWPA 4CSVA 2J7TA 4L68A 2NRUA 3KXNA 2G9XA 3OW3A 2GNIA 4GS6A 3WILA 5FDPA 4USEA 5HZNA 2DQ7X 3OEFX 4BHZA 3U4WA 4KS8A 2YWPA 2FVDA 5ANIA 4J8MA 3CSVA 1X8BA 2XK3A 4FZFB 5DE2A 3KULB 5JN2A 3F66A 3LJ2A 4QTAA 3PXFA 2XMYA 4R7HA 4F9WA 3NMUF 5EFQA 2C4GA 5JRSA 4C4IA 4OTDA 5DYJA 4XG8A 4J8NA 3PA5A 3V5PA 4LI5A 2CKEA 3QHWA 4QMYA 2WTWA 3S0OA 4Q2AA 1O6LA 2YZAA 4FTKA 5IA2A 2YZLA 1YI3A 2ZB1A 3K3JA 2XBJA 2Z7RA 4ZJJA 1GZOA 4D2TA 3QZHA 2WTDA 2BTRA 4BBFA 3EQPA 2QOQA 4EUUA 3EFWA 4EJNA 3RAIA 4GU6A 4C4JA 2FSLX 5EOLA 4FL3A 3QKLA 2XRUA 3M11A 4DFUA 3EOCA 3DAKA 2VWYA 4K77A 4TYJA 3A2CA 4YJQA 2VU3A 4X2JA 4JXFA 1FBNA 3ZO2A 3C0GA 5J1WA 3COKA 2BALA 2QODA 3O7LD 5T68A 3I6WA 3FQEA 2WQMA 3QRKA 2W05A 4WKQA 4W4XA 4IE9A 4DGLC 2WTVA 2OZAA 4ZLZA 5CI7A 2QU5A 5LWMA 2XS0A 1QPDA 2VGPA 3MH1A 3MA3A 3NDMA 5JGDA 1F0QA 3ORPA 4CMOA 3KU2A 5IA1A 3ODYX 3O23A 4YGAA 4ZSGA 3QQFA 3MN3A 5I3OA 3GFEA 3PDTA 4FSUA 4NEUA 4JDKA 3FWQA 4D0WA 4FUXA 1QPCA 2UW9A 3WBLA 3L8VA 2DYLA 4OBPA 3MBLA 4KRCA 1E1XA 5BYYA 1NT2A 2A0CX 3NYNA 3PIXA 3DKOA 2DS1A 5HQ0A 3Q32A 4C4GA 5KKRB 4NSTA 3QGWA 4IAIA 3E93A 3LFNA 4EOSA 2CKOA 5A9UA 1Q3DA 3RAKA 2OSCA 2VTAA 2C5OA 4CG9A 1HCLA 3DFCB 4PP7A 3GCVA 3ORKA 3LFBA 3HL7A 4ASDA 2ZAZA 4GRBA 5CEIA 4NZWB 1H24A 1OB3A 3MY5A 2ETMA 4DH8A 5EG3A 4XG9A 5HTCA 4BDDA 1SVEA 3DQXA 5HG9A 4CZYB 4O0XA 2OLCA 4Z55A 5H8EA 2KTYA 5FXSA 5HEZA 2W4JA 3FXZA 4CFVA 3II5A 3KB7A 2HW7A 4M12A 4YJPA 5FQDC 4WRGA 3M2WA 4P5QA 2JKQA 1IR3A 1TQIA 3HV5A 3ZZWA 3NS9A 4JOAA 4YTIA 4JBPA 3SXFA 3ULIA 4C34A 4FT7A 5FLFA 3ZO3A 1SVGA 1ZRZA 3WF8A 5TT7A 5HU9A 1BLXA 2VZ6A 4C4EA 3L9PA 4S33A 5F1ZA 4C38A 3BGZA 4ZAUA 2WGJA 2YABA 3JY0A 3F7WA 5I9XA 4OW8A 5IKWA 2Z02A 3CGFA 2Z7QA 4FTMA 3QQJA 5HO8A 4IM2A 3VUTA 5CAQA 1OZ1A 4FIJA 4QP8A 2B54A 2HZIA 2YJRA 4J71A 3TJDA 5HLNA 1YW2A 5L2IA 3N51A 3CY3A 3LE6A 3A8XA 5BMMA 1YDTE 3MY0A 2R0UA 1Y91A 1PXLA 4FKGA 4IVCA 4E6QA 4FYOA 1OIQA 3O7LB 4Z16A 1XH8A 2FB8A 4YJUA 3VBVA 5E90A 3ZHPC 4O7SA 2RKUA 3WE8A 5CTPA 2XUUA 5CF6A 4ZZMA 5H9BA 3PVWA 4ZK5A 2J6MA 3TNWA 5BVKA 3HECA 5M53A 2X6DA 3VWAA 4JDIA 2GNFA 3E7OA 5IA4A 2QD9A 4IB0A 4EK6A 2P55A 4EK3A 4FSNA 2Z7SA 5L2TA 3KN5A 3RCDA 4HNFA 5HI2A 3PPJA 3ZOSA 4OR5A 3QFVA 4QP2A 4FV2A 2H9VA 3DB6A 3G5DA 1JKTA 1WBPA 4RJ5A 4E73A 3I60A 2HWPA 4DTAA 4U3YA 4F99A 4F1MA 1OMWA 4YTCA 1URCA 2ZV7A 3Q5IA 3WF5A 2UZEA 1XWSA 4J1RA 5L2SA 3CS9A 4FTQA 3T3VA 3GC8A 4FNYA 1L8TA 2WPAA 4BBEA 1CSNA 3GOPA 4BCOA 3OXTA 5IUIA 4BDJA 4BI0A 2GFSA 3HUCA 3RKBA 5CT7A 3U9CA 1J3HA 3V5TA 3VRZA 5JFWA 4YURA 4FEWA 2JKOA 3LCDA 2XK8A 5IPJA 4MXOA 5M57A 3DY7A 3FHIA 4FKVA 5EW8A 3C5IA 2WTKC 4FG9A 4XP2A 4PRJA 4E4XA 3DDPA 2ERZE 3EQRA 3DJ7A 2XJ2A 3HEGA 3QZGA 4QTBA 4IWOA 4B8LA 4MQ2A 2CNVA 2BKZA 4C3FA 3AT4A 3MW1A 4U81A 3VO3A 3LKMA 5GJFA 2GNGA 3F3ZA 4FX3A 3W32A 2BZHB 2YJSA 3QHRA 4FNWA 5FUTA 4E5BA 2Y4IB 3PYYA 3FZRA 3ZU7A 4AZVA 4XEYA 5DR2A 4MQ1A 2XH5A 4EHEA 1GZKA 4K33A 4MXZA 5A4TA 3IOKA 3MJ2A 4DFYA 1ND4A 3PP0A 4FV7A 1BL6A 4A7CA 5JK3A 4BDEA 5BUJA 4Q5HA 1MQ4A 2OZOA 5CF4A 3W2RA 4AACA 4IVAA 1T45A 2OKRA 2YM6A 4ZTMA 3DAEA 1SMHA 5FD2A 4EH6A 4BDBA 4KIPA 4C36A 5CWZA 3V8TA 4QMSA 5LMAA 3HP5A 4IXPA 2JKMA 1IG1A 4M66A 2J90A 4FOCA 4ZTSA 5HD4A 4FV9A 3HMMA 2X0GA 5HCYA 2JDRA 3S3IA 4YP8A 3LAUA 3P9JA 3UO4A 4KRDA 2WMSA 2Z7LA 3O8UA 3WYYA 5CAVA 2C30A 3CGOA 4DEBA 3D9VA 3KXMA 3TL8A 2R3LA 3QYZA 3LXPA 2XRWA 3A4PA 3GCUA 4F4PA 4D28A 3AGMA 2JDVA 2WEIA 1MRYA 4CTBA 4FEVA 5HVKA 2F57A 4JAIA 4EH4A 4RJ4A 4A9YA 3HRBA 2UVZA 2C5YA 3R7YA 4BDAA 1G8AA 1Q99A 4TNDA 3WZKA 1OBDA 3ZYAA 3HAVA 3CLYA 3RPYA 3DNDA 4BDHA 3ZCLA 1M7QA 4E1ZA 5KMNA 4M8TA 3EFKA 1WBWA 1OM1A 4AZEA 4M0ZA 1MRUA 3UBDA 3OY1A 4RIWB 1ZOGA 2QG7A 2Y6OA 4I41A 5CY3A 4BY9E 4MXYA 3DZOA 3FXXA 4JX3A 2ITTA 2BVAA 4MWIA 4EUTA 2W9FB 1F5QA 3CTQA 4IAAA 5KMMA 1JKSA 2WTJA 2YM7A 3OTUA 4FV5A 4H3BA 4NCTC 3ATTA 4O83A 3TNQB 3PTGA 2V5QA 5CF8A 4MK0A 2R3KA 3KRXA 4I20A 2OW3A 2WXVA 5HLWA 4V05A 4A06A 3L9NA 2QNJA 1BL7A 2J0KA 3NLBA 2CDZA 5IQIA 3W1FA 4TT7A 1V0OA 2C5XA 3AT2A 3UOLA 4KBKA 3UVRA 3QD3A 3QKKA 1GOLA 5DVRA 1CKJA 4RLKA 4RWLA 3TIYA 3G6GA 4FVRA 3MTFA 2XNEA 3WZEA 5IDPA 5JEBA 3ZXZA 2BPMA 3MVHA 4LYNA 3OW4A 4XG4A 3D7TA 1UU9A 3E5AA 3HX4A 3QGYA 3BYSA 2RF9A 3OMVA 4GV1A 4RIYA 4DEEA 4TKSA 4O7ZA 3OG7A 3SVVA 1FPUA 5CXHA 4DFNA 4Y72A 5CVFA 2C3JA 3KGAA 2QOBA 3PJ3A 4U44A 3TNPC 4E4LA 3KXXA 3LFQA 4GW8A 5E9EA 4F9BA 3KC3A 3D83A 1KUTA 3EWHA 4YJNA 4PTEA 4MKCA 4PPBA 4PV0A 5FWKK 1AD5A 4BWPA 3VUIA 1LEZA 4YC6A 4MVFA 4AA0A 3OVVA 2YERA 2B9FA 5IQBA 1H27A 4EK4A 1W7HA 2J5EA 4FMQA 3SOCA 4K9YA 2VO0A 4FSZA 2WU6A 1STCE 3SG9A 4GH2A 4N6ZA 2IW9A 3TDWA 1VYWA 3A8WA 3BGQA 3BYUA 3MTLA 2I1MA 5A3XA 4QP7A 2C0OA 2J0JA 2W96B 3U54A 4GK3A 4EH3A 3F2AA 5AA8A 4F1TA 5ITAA 4DTKA 2UZDA 4ZEGA 2Y7JA 3FLNC 3F5PA 4V0GB 3UNZA 5IUGA 3SLSA 3PPZA 4AZFA 3GU4A 4NK9A 4PNIA 4EL9A 2VWIA 3T8OA 3T3UA 4PP9A 1PXMA 5AR2A 1OIYA 3I4BA 5AR4A 4C62A 5L2QA 4QMUA 4AT5A 4Z7GA 4YJOA 1P4OA 4I1ZA 2EVAA 2YISA 4D4SA 4FKIA 4XV1A 4RIXB 4HYSA 4XS2A 2C6TA 1M14A 2R4BA 4HZSA 4I5MA 4GJ2A 4QPAA 4ANSA 2J2IB 3HA8A 3MVJA 5FDXA 5FGKA 3BYOA 5E92A 5KBRA 4L45A 3G0FA 2I0EA 2JBOA 2J50A 4IWDA 3PJ2A 4RZWA 2BHHA 3PA4A 5IEVA 3MPAA 4BKYA 3LCKA 5AWMA 3JYAA 4MF0A 3FMHA 5JT2A 4GU9A 3VS1A 5I9YA 4RVLA 2Y9QA 4DFLA 4X6RA 5CZIA 5LCKA 5AFVA 4AG8A 4ZSEA 4UALA 4ZTQA 4IWQA 3MJ1A 4YPSA 3EFJA 3JS2A 3Q3BA 4X2NA 4A4XA 4I21A 2WQNA 3ZZEA 5IZFA 3ACJA 4RA4A 5F4NA 4ANLA 4QTCA 1YKRA 2PULA 4HGTA 4XUFA 5EOBA 1WZYA 1YWVA 4FEQA 2I0YA 3TUDA 2I7QA 3QRJA 4WNPA 2EU9A 1ERKA 4FE2A 4GK2A 4NWMA 3ZH8A 4BIDA 2UW3A 2YM8A 4DC2A 2WMRA 1RJBA 3IW4A 3PE1A 4G6LA 3C0IA 3QD2B 5HVJA 3DJ5A 4F6WA 4WUNA 4I92A 1E1VA 3NR9A 5FP6A 2ZJWA 4I6QA 3P7BA 1K3AA 2R3FA 3BI6A 4WG4A 5GZAA 4O91A 3ZLXA 4E6CA 1S9IA 3EN4A 4CV9A 2XIKA 5D10A 3R7IA 4LRKA 1GJOA 3SAYA 1OL7A 3OEZA 2O64A 2NRYA 3LFCA 4QP3A 2NNWB 4HVHA 1J1BA 2J0LA 4LUDA 3COMA 4WSYA 4Q9ZA 3R1NA 3D5WA 3MPMA 5AIKA 4IB3A 2WTCA 4X3FB 3PXYA 4NJDA 2R0IA 2P0CA 5EHYA 3QTXA 2C6MA 3R04A 5BVWA 4GUEA 4R1VA 3G9NA 3ZFYA 3MGYA 1KWPA 4LQMA 4RJ6A 4XOZA 4OTFA 2B53A 4FKWA 3NYXA 4EOKA 3UGCA 3QUPA 3FE3A 3NZ0A 1AQ1A 2GQGA 2QOCA 2XNBA 2IW6A 4FTRA 1ZWSA 5HVYA 3CY2A 1JNKA 3Q9YA 2LAVA 3R8UA 3QTQA 3R9DA 4EC9A 3NUXA 1PF8A 2WMUA 4O0VA 5M44A 4N6YA 4RJ3A 4FV8A 4HVIA 1IA9A 2IN6A 3VRYA 4E6AA 5E1SA 2VWZA 3NW6A 4I23A 3PP1A 4JVGA 4C4FA 4EI4A 3ZC6A 4PPAA 1H4LA 4C2VA 2QKWB 1H0WA 3R7VA 1IEPA 1H1SA 1UU8A 3BE9A 2FUMA 4YO4A 5D9HA 3LCSA 4KAOA 5EYCA 3DU8A 5GJDA 5HNIX 4AGUA 2HZNA 3BQCA 4P2KA 4TWNA 5AX9A 4R7BA 5CEQA 3KRJA 3EL8A 5B2MA 3C4XA 4USFA 3VIDA 4DEIA 3PSBA 3U9NA 4ITJA 3SQQA 1KV2A 3QLGA 3F2NA 5DWRA 5M09A 3ZRMA 5AUWA 1JVPP 5EKOA 4QD6A 4LMNA 3IOPA 4YTHA 4RWJA 1OI9A 4QNYA 4FL2A 4G3GA 4EK5A 4UWYA 5AR8A 3QYWA 4ZY4A 2FGIA 3OY3A 4HNIA 5GZ8A 4Y46A 4IVDA 3OWLA 1OL1A 4XMOA 4EC8A 3QCYA 3DLSA 3BYMA 4AW1A 4L52A 5L6PA 3UYSA 1OL5A 4NFMA 3IGOA 4BDKA 3H0YA 4IBMA 5DR6A 2OU7A 3UOHA 3V04A 3Q9ZA 4E20A 3PJ1A 4EKKA 4RBLA 5C4KA 1QPJA 4YZDA 5E91A 3N9XA 3H30A 4ENYA 3ERKA 5CQWA 5JQ5A 4U3ZA 3QALE 4HPUE 4WBOA 3GU5A 4E93A 4L3PA 4UY9A 3UTOA 4J99A 5DT4A 4BZDA 1H08A 1FMOE 4U79A 3JVRA 4AU8A 1DS5A 3UG1A 4DF3A 3LJ1A 1OBGA 4I6BA 4EONA 3C51A 3LOKA 4Y5QA 2R3GA 4F1OA 3QRIA 3R9HA 1PRYA 4WUAA 3ORLA 4HGLA 3MWUA 4NT4A 5IMEA 1NVQA 4DEAA 1QMZA 3GXLA 4GCJA 2H6DA 2VTPA 4L9IA 2XJ0A 3ANRA 5CU4A 3T9IA 5BNJA 2ITXA 2HY0A 4PL3A 4JJRA 2GTNA 3BBWA 3NAXA 1UU7A 3ANQA 3UP7A 5HG5A 2B9HA 5FBOA 1LUFA 1CKPA 4AAAA 3QWKA 4PTGA 2YHVA 4X6QC 2UVYA 2W4OA 4G3CA 4APPA 3G0EA 5KMKA 3FLYA 3RPOA 4ZSLA 1PMEA 3H4JA 1YI6A 3KRWA 2Y4PA 3G33A 4GVAA 5E8ZA 4NYEA 3FBVA 2I0VA 2EB2A 3P08A 4PDSA 1JSUA 1L3RE 4V01A 5JFXA 5I4NA 4ZMEA 2B55A 3CPBA 1GIHA 2HYYA 2O3PA 2W5BA 3EL7A 2UZNA 3RVGA 5B7VA 3N4UA 2R3PA 2HENA 2GS2A 4FOBA 3O8TA 4I6FA 3DK3A 4FKTA 4V04A
chains in the Genus database with same CATH superfamily
4HCUA 4FKPA 2PZ5A 1R78A 3HV4A 4RMZA 3TCPA 2YCQA 3NPCA 2ZDUA 3MFRA 4I94A 3UNKA 3HNGA 3Q4UA 4QP4A 3ZRKA 4PUZA 3HMPA 5CU0A 2QG5A 4W9WA 3UQGA 2R5TA 1TKIA 2OXXA 2PMLX 4EH7A 4M67A 5EQEA 3EQBA 3MV5A 5DHJA 5I9UA 3SX9A 5LVMA 3C13A 2E2BA 2XB7A 4RRVA 3LQ3A 3E92A 4UMTA 3DBDA 5B2KA 5CEKA 5FTQA 4FKRA 4RGJA 5BUEA 2VNWA 3OWKA 4I5CA 4KBAA 5HBJA 3TEIA 2PSQA 2BIYA 1FQ1B 3CQWA 2XIZA 5FEDA 5IISA 3AC5A 3QQLA 3ZUVA 4YSJA 3F7ZA 1GNGA 3BWFA 4IM3A 2EB3A 4DBXA 3QBNA 4FV6A 5G1XA 2C1AA 2X39A 2YIWA 5AR3A 4HOKA 4ZXTA 2RL5A 4NJ3A 5CSWA 4C7TA 4AXCA 1DI9A 3DJ6A 3GNIB 3FYKX 3P86A 4DEHA 2HY81 4F6SA 3GVUA 2G2HA 1WVXA 4LGGA 4U6RA 5J5SA 1JQHA 4G16A 5LJJA 1ZZ2A 2QOOA 4O0WA 2I6LA 4EH9A 3U6HA 4KABA 5EQPA 4MBIA 3KMUA 4L3JA 4U80A 4FKSA 5ETCA 3UIBA 5IQCA 1ATPE 3FKNA 2J0MB 5IMXA 3LXLA 4QYGA 4XG3A 3IDBA 4O38A 5AV1A 5HGIA 2HOGA 5A6OA 4GFGA 1H1WA 2NO3A 3R9NA 3E8DA 3VS6A 2QR7A 3QAME 5E7RA 4Q5EA 4JX7A 2NYAA 2GNJA 3OF0A 5E4HA 3W33A 2ITWA 5I3RA 4RSSA 4BDFA 2XK9A 4C4HA 2Y6MA 1BYGA 3AC4A 2GHMA 5F20A 3KREA 4GT3A 2HXLA 3RINA 2C6OA 1XH4A 2WQBA 4YHJA 2YN8A 3A60A 3HMOA 4FSQA 3LZBA 4OBOA 4RFZA 2UV2A 4N4SA 4IAKA 5HLPA 4FKQA 3ODZX 4WSQA 2BCJA 2IO6A 4CCBA 4MEDA 2GQRA 5IQGA 1YHSA 3TTJA 3UYTA 1TVOA 4XJ0A 5A4LA 1OUYA 3KMMA 4M69A 3V5JA 2BAKA 5HESA 3V3VA 3CEKA 4FT3A 4WO5A 5BYZA 2ERKA 2FSTX 3DTCA 3F3TA 4K8AA 5IUHA 4HGEA 4LOPA 3DK7A 2PTKA 4G3DA 3ZSGA 4HVDA 5K4JA 3MH3A 3RPRA 2C5VA 2X8EA 4S30A 5EKNA 2A2AA 4ID7A 2JBPA 4J52A 4EOIA 4WNMA 4YLJA 2X2KA 5HOAA 3EIDA 5ETAA 3I7CA 3V5LA 3DK6A 4KA3A 2CCHA 3FI3A 3O51A 4OBQA 4R6VA 4EH2A 5A4EA 4FV0A 1APME 2WELA 4K18A 3IECA 2V0DA 2QO9A 4U8ZA 4Y73A 3ZFMA 5AA9A 2CNQA 3P4KA 4IC8A 4U43A 4ZJVA 3PFQA 3BHYA 1U54A 3ELJA 5F94A 3KQ7A 2BIKB 4DGGA 4IHPA 4IZ5A 2WNTA 2CLQA 4XG7A 1Y57A 2VTIA 3KL8A 3RAHA 2VWBA 4AW0A 3Q60A 4OTPA 3D15A 3G6HA 4BTKA 1Y8YA 4O84A 3W8LA 2VO3A 4XRLA 2B0QA 1H00A 2YIXA 5JGBA 4PF4A 3DXNA 3GUBA 2PVYA 4XRJA 2ITOA 3MI9A 2JC6A 3RMFA 4BDGA 5K0XA 3OBGA 1J7LA 1VLRA 3NNUA 2R3NA 1JKLA 4PMTA 3AC3A 2XCHA 4RX5A 3BHTA 3FLZA 3Q52A 4RVMA 1A9UA 5BPYA 4QNAA 3EJ1A 4EOOA 2W7XA 3FDNA 4XX9A 1H01A 4IJPA 4GIHA 2XNNA 4RPVA 3SV0A 4H3PA 4IAFA 3KF7A 1CMKE 4MBJA 3F5UA 3ZRLA 4ANBA 5EDQA 2O2UA 3EQDA 1URWA 4D58A 1Q8WA 1XH9A 2C69A 2UW8A 3OXIA 3POOA 5FM2A 2UW4A 4KSQA 4D55A 3HUBA 4K1BA 2V22A 3G90X 1TQMA 4FEXA 4O7NA 3D7TB 5HIEA 3OCGA 3MFTA 3LFFA 3FL5A 2I0HA 3BL7A 3AKJA 4QMNA 2FO0A 3TJCA 3PRFA 4QQ5A 4E8AA 4EK8A 3HZTA 3TV6A 4QMQA 1CKIA 1REKA 2CGUA 2QLUA 4ANOA 3D2KA 1ZLTA 4BHNA 2VTSA 3G2FA 3NYOA 3COHA 2ZOQA 3R02A 2PK9A 4I5HA 1CM8A 4FNXA 3ORNA 3RNIA 3ZO4A 4BCGA 2P2IA 3DKCA 4FZAB 5CLPA 4BZOA 2B4SB 2WEVA 4XLIA 5EW9A 1OECA 3D2IA 3EQFA 4PQNA 4W9XA 3VBQA 2YCRA 4Y5HA 4RFYA 3GEQA 3Q6WA 5EH0A 4C35A 4O6EA 2SRCA 2BZIB 5AEPA 4R78A 1OKZA 3E8CA 4GK4A 2YM3A 3TMOA 3CKXA 4QYFA 4C0TA 3PXQA 3HVCA 3WZDA 1M2PA 4LM5A 3R71A 4II5A 3VQHA 5AM6A 5I5ZA 5CX9A 4DFXE 1LPUA 3C4EA 2JKKA 3AMYA 3QXPA 4FKJA 4M14A 5ANOA 2OXDA 5EDRA 3UOKA 2XAOA 1H1RA 3ZDUA 2XIRA 4AX8A 1A06A 4DLIA 1SZMA 4O96A 3A7JA 2YAAA 5LMKC 4FTOA 3PUFC 4CNHA 4ZSJA 2PE1A 5AAGA 3AC8A 3DLZA 3ID6C 2OO8X 2EXEA 4CGAA 4CFNA 3FLSA 4TWOA 3NFGB 3V01A 5B2LA 4EH5A 5J87A 2HWOA 3P5KA 3Q96A 4DA5A 3WI6A 1Z5MA 3R6XA 1OPJA 4PL4A 1UA2A 3NNWA 2HCKA 3QTSA 3U6IA 4IB1A 4ITIA 4LG4A 1Y8GA 4UWBA 4CFUA 2H96A 3QTUA 2PZRA 3R1SA 4U0IA 3UP2A 5D41A 2X8IA 2W1IA 3M1SA 5ANEA 4QTEA 4R77A 3D7ZA 2CMWA 2JFMA 2XYUA 3IDPA 3L8SA 3F3VA 5H3QA 5LARA 3RM7A 4FK6A 4FV3A 4YLLA 2W9ZB 3ZBFA 4BTFA 4OUCA 3ENHA 2OK1A 3ZO1A 4YO6A 3O0GA 3WIKA 4AN2A 2BTSA 3W2OA 3PVUA 1PKGA 4M13A 2QC6A 3E3PA 3PY0A 4FTIA 3BBTB 3ORTA 2HIWA 4JR7A 2BROA 3RK7A 3V6RA 3ZUUA 4CKRA 4MF1A 3R1QA 4YMJA 3MVLA 4H36A 4UMQA 2PUPA 2YITA 4EHZA 4ALWA 4NH1A 3RPSA 1WCCA 2IZTA 4U97A 4MXXA 2PY3A 4X2KA 3NRMA 3R9RA 1UNHA 3KK9A 4BBMA 4YJTA 2JAMA 2WOTA 1CTPE 3KRRA 2VX3A 1Q61A 1Q41A 1WBSA 2WZJA 2XCKA 3FLQA 2WIPA 2OXYA 2JIIA 4FODA 3TACA 3UC4A 4G6OA 4FK3A 4IFGA 1Q4LA 5BVOA 3JR1A 3JY9A 1FINA 2R2PA 4BN1A 1O6YA 3F3WA 5C1QB 4FRFA 3PXKA 3Q9XA 1Y6BA 4HPTE 4JRVA 3O2MA 5EM5A 5E8UA 4QMPA 4PMSA 3NIEA 4ZY6A 5EI2A 2XA4A 2QCSA 4MD9E 2CSNA 4FSTA 1OITA 4G17A 1KE9A 2EUFB 1W8CA 4MNEA 4G3EA 1Q5KA 5J95A 3U51A 3EQIA 4AGWA 4UV0A 4C8BA 3FPMA 3VS7A 3OUNB 1GZ8A 3TYKA 4EH8A 4NM0A 4BTMA 2VO7A 4P5ZA 4XP0A 1YWRA 4D9TA 1PXOA 2VTRA 4OTRA 1TQPA 2C3IB 4TTHB 3SRVA 4MXAA 2JIVA 2QHMA 4CV8A 5CEPA 5M07A 5EK7A 1B38A 3UOJA 4DDIA 3KY2A 5FM3A 2ESMA 4BB4A 1H26A 2VTOA 5KKRC 2YDIA 3U6JA 2Z2WA 5FXQA 3IGGA 5CU6A 2CPKE 3I1AA 3UC3A 4BGHA 2RSVA 3V8SA 4CXAA 2PVMA 4FTUA 3GB2A 5HO7A 4FR4A 3ORIA 4O21A 4QMOA 3NVKI 2VTJA 2HAKA 3GENA 4F7NA 1XBAA 3ORMA 3KULA 2HZ4A 4TYHB 2WMXA 4WHZA 4AW2A 4J97A 4HJOA 1WBOA 4FUYA 1G5SA 3KN6A 5DFPA 1ZMWA 3D94A 1YXUA 3OP5A 5G6VA 3RWPA 4IX5A 4CCUA 4P7EA 1YXSA 4LOOA 2YCFA 5JFVA 4YJVA 4B4LA 2REIA 3UZPA 1QPEA 2WFYA 3QCQA 4DH1A 5HG7A 4EWQA 3OROA 3QU0A 3BHUA 3LJ0A 4D5KA 3LFDA 4JLCA 3MDYA 1QL6A 2F2CB 3DTWA 4EHVA 4O1OA 3ZLWA 2RFDA 3EQGA 2UW6A 3IW8A 2PWLA 5LVNA 2Q0NA 4I4EA 3V5WA 4DHJA 1YQJA 4WT6A 4N57A 4HW7A 4E5AX 3OCBA 4ITHA 3MSSA 3NEWA 2WU7A 3PLAE 1FGKA 4O4FA 2WKMA 3MFSA 4RJ8A 3H0ZA 5EYDA 2X81A 2R3OA 5CVHA 5CSXA 4I6HA 3FHRA 5I9WA 2O5KA 3B8QA 4N0SA 2QVSE 4PNKA 2PVFA 2IZSA 2QKRA 3MH2A 2W4KA 4L3LA 4L44A 1O6KA 3DZQA 4IFCA 1GIJA 1Z9XA 2C6LA 1V1KA 3OWJA 2X7OA 3MB7A 4AUAA 2VUWA 3TUCA 5LMBA 2VO6A 3D5VA 1PYXA 3BELA 4FSRA 4DGMA 5KMOA 3EKKA 3OHTA 2IG7A 2XKEA 4HCVA 1P5EA 4MNFA 3SHEA 4BYIA 2IW8A 5GINE 3FSFA 1NW1A 2ITVA 4CRSA 3LFSA 4I0SA 3AG9A 3FLWA 3QQUA 3UDSA 3OTVA 3WF6A 3E64A 1PW2A 1MQBA 2BUJA 3AOXA 4FIHA 2XALA 5T6KA 2F7EE 5ETFA 2PUIA 4HYIA 3VS3A 5CENA 3LLAA 5L8JA 3BU3A 3TZ8A 3F61A 4ZLYA 4EOPA 4FGBA 4IAYA 3RPVA 4AF3A 1DAYA 3ZEWA 2PVNA 2ZV9A 3LM5A 4LV5A 4U7ZA 3OT8A 5AV2A 5E8TA 3MYGA 3G15A 2OGVA 4DFZE 2XEYA 1WFCA 4QYEA 3P7CA 5C8KA 3RK5A 4YPDA 1REJA 3DV3A 3SDJA 1FMKA 1R39A 2XNOA 4KINA 1J1CA 1VEBA 1XQZA 2JITA 5H8BA 3KXZA 3EYGA 3OOGA 3QX4A 5JZNA 3FQHA 2OICA 3HLLA 5HE0A 3RHXA 3ET7A 4NCTA 2E9OA 5JGAA 3SGCA 1NA7A 3K5VA 3ROCA 1WBTA 2BFYA 2WO6A 3H9RA 4GMYA 3D0EA 4YZ9A 5AUXA 3VW6A 4DYMA 2WQOA 3C0HA 4G31A 3EHAA 5HORA 4RC3A 4D4VA 3NUAA 4UZHA 4AT3A 4ZTHA 4W4YA 3R00A 1KE8A 3IO7A 3SKCA 1K2PA 2IZRA 2OG8A 3H9FA 4KD1A 4CYJA 5ICPA 4DHZA 1GY3A 2WIHA 4O0UA 1JLUE 2Z8CA 3VF8A 4F0FA 4O7VA 2Y4IC 2B7AA 3OBJA 5DNRA 3NVMB 3GI3A 3HRFA 4CKIA 5DRDA 5EDPA 4QMWA 4EZ3A 4F7JA 4BTJA 4RZVA 3IQ7A 1MRVA 5M4IA 1VZOA 2QLQA 1XJDA 3PY3A 4NUSA 3D5UA 4C58A 2BDJA 4I4FA 4P90A 2EXCX 4MUQA 1Q3WA 4AQKA 2ZMCA 3TKUA 1LP4A 1WAKA 5TR6A 2RFNA 4GYIA 3VBYA 5IU2A 4FBXA 3C7QA 3FL4A 3UNJA 4AZSA 3F6XA 3DAJA 3BE2A 1OL6A 3NNXA 4O22A 4Z3VA 5C4LA 2O65A 5M4UA 5M56A 3E3BX 3FMDA 4W8EA 4JMQA 5HO6A 4FA2A 4NIFB 1KE7A 5CU2A 4Y85A 5D7AA 4QMVA 4RVKA 3C1XA 5C27A 3LPBA 4UXQA 5IH4A 4O7WA 4QMLA 1M2QA 3WARA 4I6LA 4DG0E 2QI8A 4GT5A 3ZSHA 3DA6A 5ETIA 4G9RA 1XH5A 3DPKA 2R3JA 4OT5A 3G51A 4EQCA 3B8RA 4FGRA 1UNGA 5DLSA 3I7BA 5C03A 3EN7A 3P0MA 1YOLA 3EKNA 1V0BA 1R3CA 3EZRA 3KMWA 4JT3A 4R5SA 4TN6A 4DINA 5KHWA 3NUNA 2C0TA 5L8KA 4IANA 4QDEA 4XV3A 2XNGA 2PMOX 4F0GA 1QCFA 4IJ9A 4A9TA 4TL0A 1XO2B 2PVRA 4FIEA 5ANDA 4CFWA 5KCVA 3DQWA 4JQEA 4M69B 4CTCA 2ZB0A 5LXMA 3ZM9A 4JBVA 3F82A 3R01A 4ENXA 4AOTA 4ARKA 3UMXA 4CG8A 4IH8A 4OAVB 3HDNA 3KCKA 5IDNA 3NW5A 4JI9A 2XVDA 3AQVA 5F95A 5HNBA 3SA0A 3PIZA 3ENMA 2PPQA 1PJKA 5HIDA 3PVGA 2C3KA 3PA3A 3ZUTA 4J7BA 5AV4A 2F9GA 4LFIA 1OIRA 3O50A 2YDKA 4RQVA 3ZDIA 4AFJA 3UDBA 4LL0A 4S32A 4XYFA 4CZTA 3CJGA 3MB6A 1DM2A 2ETRA 3OD6X 4N70A 5JQ8A 1U4DA 1LR4A 3EN6A 3R0TA 3TV4A 2F2UA 1IRKA 3MA6A 2OZAB 3NWWA 4GKIA 1NVRA 1PYEA 3AKKA 1U54B 3R21A 4ANQA 4DH5A 2XIXA 5L2WA 5HE3A 5IH6A 4WRSA 3S2PA 1YHVA 4GSBA 4PDOA 3W2QA 1DI8A 4E3CA 2X1NA 1XBCA 2YLFA 3LM0A 5DBXA 5ANJA 2GHGA 3FV8A 5CAPA 4LOQA 4KB8A 2AYPA 3QCXA 2C5NA 2ITYA 3HAMA 1PKDA 4QYHA 4AN3A 1XKKA 2Q0BA 4LRJA 4RA5A 5AP4A 1RE8A 4BZNA 3CPCA 3RNYA 4YHFA 3S1HA 3CD8A 5E8YA 3LXKA 1PMVA 5KE0A 3UPZA 5AR7A 3RTPA 4GFOA 4JL9A 3TTIA 3DKGA 4AZWA 4AN9A 3HGKA 2X4FA 2W06A 3R2YA 2JIUA 4R3RA 4GUBA 5HE1A 3RHKA 4C37A 2E9PA 2NP8A 5J9LA 1MUOA 5L4QA 4WA9A 4F08A 4ZS4A 4FEUA 4CFXA 5LVLA 4YHTA 1PXNA 5C8NA 3VBTA 2R3RA 3KKVA 5J9ZA 2W5HA 3RAWA 5DGZA 4ALVA 2R7IA 1PXIA 2BAQA 2OF4A 5L3AA 4L46A 2PZPA 4JQ7A 3REPA 5DOSA 3V51A 4ZSAA 3AMAA 3UDZA 2ZM1A 2CHLA 4RIWA 4IAZA 3PZEA 4EHGA 4B0GA 1K9AA 2ZVAA 3IK3A 2X8DA 4IADA 3HMIA 5DA3A 5BVEA 3OT3A 3DS6A 4XV2A 4CLIA 4FYNA 2PVJA 3R83A 2BAJA 1P2AA 2RG6A 3POZA 2XKCA 4FT5A 5IEYA 5AUZA 1KSWA 4TYGA 4CZUA 3QXOA 4C57A 4B7TA 5LQFA 2R64A 3SW7A 4KUJA 2R3HA 5IA5A 1AGWA 3KXHA 3R7EA 3TV7A 3SD0A 4CEGA 4GG5A 3NX8A 4L7SA 1UWHA 4CMUA 4DHIB 2OH4A 4M0YA 5AP5A 4PY1A 3KVWA 3W18A 3BU5A 4RC2A 5IQEA 3OFMA 2R7BA 2W1ZA 4X2FA 4TWCA 4Y95A 2CGXA 3GC9A 3DFAA 3RJCA 1IAHA 3WOWA 5FBNC 3W16A 5EYKA 2BR1A 2XM8A 3UO6A 1H8FA 2J51A 4F9YA 5A4QA 5E1EA 3GCQA 4FV4A 2VTNA 4H58A 3UQCA 3VS4A 3O5AA 4FSYA 4FVPA 1OKWA 3EN9A 4NKSA 2ZV8A 1W0XC 2CCIA 4ASZA 2C47A 4PMMA 5IQDA 2NPQA 2GS7A 2YACA 4GJ3A 3KEXA 4FTLA 1F3MC 1ZZLA 4IMYA 1W82A 3HA6A 3W0MA 1NY3A 3TG1A 3L9LA 4AP7A 3E63A 3EQCA 2E9NA 2WMVA 4BRXA 4ASEA 4YU2A 4HYHA 2JDOA 1FVVA 5FP5A 1SNUA 3GQLA 1BKXA 3O96A 5E8SA 4X2GA 3RZBA 3TIZA 5JMSA 1R0PA 4IQ6A 1HOWA 4PPCA 3I0OA 3HV6A 5FRIA 4TY1A 3ZSIA 4K2RA 2BZJA 2O63A 3K5UA 1SVHA 3QQKA 2QOLA 2BDWA 2OF2A 4AOIA 2WMWA 2VN9A 4DHFA 1KOAA 2V62A 4Y83A 4CYIA 5CI6A 1O9UA 3PPKA 1YOMA 5LVPA 4ASXA 2OFVA 5BX0A 2HW6A 4KSPA 3GGFA 4TXCA 1FVTA 2R3IA 2YEXA 5HE2A 2YDJA 3UIXA 4V0GA 4CT1A 1KOBA 4QDVA 5DT0A 4KS7A 2OWBA 3C4WA 3U4UA 5BMSA 2CLXA 2PHKA 1WMKA 5K9IA 1JKKA 1VYZA 3FC1X 4L53A 3QCSA 4NU1A 4QEBA 3P23A 2JEDA 4UZDA 4AT4A 4NM5A 3SG8A 4BDCA 4CVAA 4O7LA 4X3FC 3PRIA 1OPLA 2FYSA 3FAAA 4O27B 2VTTA 4RIXA 5DRBA 5EHOA 3W0SA 2J5FA 3FZTA 4BCIA 3FI8A 5A54A 1S9JA 1FGIA 4UBAA 2PL0A 4QYYA 4UEUA 3T9TA 2IVUA 4ANMA 4D2VA 5TO8A 2OJGA 3O17A 3NYVA 3P7AA 3AMBA 4NTSA 3VW8A 5KNJA 4AWIA 5FEQA 3TKIA 2ZM3A 3C4CA 1Q8YA 4X0MA 5ANKA 5CASA 4YR8A 1ZOEA 2F4JA 2XKDA 3DT1A 2C6DA 2P3GX 5CNOA 4U41A 1FOTA 2QOIA 3BX5A 3FY2A 2IZUA 4XG2A 4BFMA 3ZFXA 5CEOA 2YM5A 3MESA 3COIA 4OTGA 4MH7A 3KFAA 3FI4A 3SXRA 3TZ7A 1JSVA 3ZLSA 4W8DA 4CLJA 2WD1A 3NSZA 3IPHA 5C26A 2X6EA 4ZMFA 2BKKA 1KV1A 2HXQA 1G8SA 4OT6A 2X0OA 5HKMA 3FPQA 4FC0A 3OWPA 3WIGA 5HNGA 4ANNA 1XH7A 2X7GA 4BWKA 3ZM4A 3PJCA 4A9SA 3I0QA 4R3CA 2CKPA 4CRLA 4CKJA 4MX9A 3LMGA 2G2IA 3PVBA 1YHWA 3R8MA 4BGQA 2XANA 3DOGA 3DGKA 4GKHA 4F70A 4UMPA 1H1QA 3PY1A 4YUQA 4GT4A 1XH6A 2W0JA 5AV0A 4EYJA 2W99B 4BI1A 4MAOA 2XM9A 1WBNA 4O2PA 3V6SA 4NKAA 1BI7A 2BRMA 4G3FA 2ZDTA 3ITZA 3QL8A 4BIBA 4F78A 2IVVA 2OJFE 4ZTNA 5M08A 4O0YA 2WTKB 1YXXA 2V7AA 5J9YA 4C59A 3PXRA 2ITUA 3QA8A 1H1PA 4X3FA 5IH5A 3QA0A 4EKLA 4UMUA 5AP7A 4BCHA 3EB0A 5CNNA 3FI2A 5EHLA 4QP6A 3GU7A 5JKGA 5D11A 4QO9A 4XNEA 2C6EA 2QQ7A 4H1MA 2XKFA 4FKUA 5C01A 5CAUA 3WF9A 1U5RA 3SXSA 3ULZA 3BLAA 2X0PA 2XNPA 1YDRE 3GCSA 4AE6A 4O0SA 3FYJX 4FI1A 4YBKA 3HKOA 2CGVA 4QMMA 4RX8A 4U40A 5K5XA 4MD7E 2OJIA 4ZTLA 3ZC5A 3ZS5A 3HRCA 4BWXA 4GL9A 4IM0A 4AFEA 4M3QA 3MFUA 4LV7A 5BQ0A 3UE4A 3W0RA 3TI1A 3QTWA 3ZBXA 3ZONA 4XBUA 4R8QA 4AA5A 4APCA 3N4VA 3PG1A 4FTCA 3UVQA 4ALUA 3D4QA 1B39A 2BRGA 2UZUE 3BLQA 2QO7A 4IEBA 4O82A 5ANGA 5M51A 2PVKA 4U5JA 4A9UA 2UW7A 2BZKB 4QQJA 3A4OX 2C6KA 2H34A 3HV3A 3LVPA 2QOHA 4X7QA 5KZ0A 1PY5A 5L6OA 2RG5A 2H8HA 3FZ1A 4LMUA 2C68A 2A1AB 5BVFA 2OJJA 4CFMA 4AXEA 4H3QA 4RIYB 4ZZOA 5KMIA 3QLFA 4DDGA 2VAGA 2PMIA 3GU6A 5E8XA 4BCQA 1HCKA 2CGWA 5CU3A 3R8VA 5AUVA 4D2RA 4ZLOA 3VN9A 2GSFA 2O8YA 2PZIA 4C2WA 2YM4A 2WAJA 3R28A 4BCMA 4J95A 2C1BA 3D5XA 4F0IA 5GIOE 3UZTA 3JXWA 3VUGA 1ZYLA 3KCFA 3QUDA 5IQAA 1I09A 4UX9A 3ACKA 3BV3A 2YWVA 4TZRA 4BL1A 4EBWA 5HG8A 5CAOA 1TFFA 3CJFA 3KA0A 4AGDA 5EM8A 5K3YA 2PVHA 4R1YA 2WQEA 2XF0A 2X9EA 4HVGA 4YZMA 3OOMA 2GS6A 2WOUA 4L01A 4C3PA 3RGFA 1IASA 1OIUA 2A27A 2VGOA 4D1ZA 2JFLA 3BV2A 1XMMA 3VS0A 2FA2A 4C33A 4KIKA 3LIJA 5KUPA 4DH3A 3E62A 3GOKA 5EW3A 2XARA 2G1TA 3A61A 1ST4A 2IPXA 3BPRA 3VONA 5IA3A 4YBJA 4E4NA 4OAUC 4D5HA 3LFEA 4IDTA 4EQUA 2OBJA 2C6IA 3BLHA 4R7IA 5T3QA 4DN5A 5CXZA 3PSCA 2PYWA 2XBAA 1RW8A 5I9ZA 5K5NA 2HZ0A 3QC4A 4L7FA 4XHKB 4E6DA 3A99A 2JD5A 2QURA 3M42A 4UB7A 3DBCA 5J5TA 1ZYCA 2CN5A 4FL1A 3PG3A 4JR3A 1J7UA 5A4CA 3FMKA 3NIZA 4IC7A 4O7TA 3HV7A 3ORZA 4HZRA 5AUUA 3PFYA 1PXPA 4DGNA 4M68A 5AAFA 3LLTA 1ZAOA 1OL2A 4L42A 2BHEA 3ZTXA 4B8MA 5BVNA 4WNKA 4EORA 4IX4A 4O81A 5H2UA 2XK6A 3EQHA 4QMZA 2BRNA 3BCEA 3LCOA 1VJYA 4LDTA 5ACBC 5AADA 3E8NA 3O71A 3QZIA 4F09A 4AE9A 2Y0AA 1ZXEA 5IQHA 1U46A 3F5XA 3EZVA 3GFWA 4H1JA 4O2ZA 3LQ5A 3QWJA 3C9WA 1YDSE 4D4YA 2G01A 2W17A 4EOMA 3W0OA 1Z57A 4WIHA 4BYJA 3ZXTA 4BCFA 4YC8A 4NW6A 3NUSA 3Q53A 3VUDA 3UO5A 2YFXA 3C4FA 3LW0A 4IZAA 4AA4A 4E4MA 3TNIA 4D1SA 4RLLA 2GPHA 2VTQA 4CFFA 5HX8A 4HYUA 3OZ6A 3KK8A 3GC0A 2ACXA 4FZ7A 2A4LA 1OKYA 4WNOA 4KNBA 2ITNA 4XOYA 3DXPA 1M52A 4A4OA 4FIFA 3DCVA 5DI1A 4QTDA 1R0EA 5GZ9A 3RALA 4LL5A 4D2SA 4ZOGA 4A4LA 2VTLA 5CSPA 2XZSA 5JH6A 5M06A 4PDPA 3D14A 1IAJA 2PU8A 1EH4A 2XYNA 3PWYA 4IB5A 4O4BB 4RX9A 5KZIA 4C02A 4FSMA 5LMKA 5ACKA 3IONA 3HP2A 4B9DA 3EYHA 3BRBA 3Q2MA 2GDOA 2UZLA 2X9FA 5LWNA 5BVDA 2YLEA 4O1PA 2GCDA 3ETAA 4EWHA 4JNWA 2XNMA 3JUHA 3L9MA 3U87A 3W2PA 4JG8A 3H10A 4GIIA 4DLJA 4BR3A 2IVTA 4IX6A 3W8QA 4RT7A 3R2BA 3R22A 1Q97A 3Q2JA 1ZMVA 4YZBA 3QX2A 3QRTA 4NTTA 3BGPA 2DUVA 3IW5A 2C3LA 2BRHA 4EYMA 5AMNA 4KIOA 2GFCA 4JBOA 3WE4A 2ETKA 2QOKA 3PJ8A 4PX6A 2LGCA 3Q6UA 5AX3A 5J7BA 3R8ZA 5KMLA 4I3ZA 2W1HA 3AD5A 1W2FA 4EOQA 5K4IA 5KHXA 4M84A 4PWNA 5M4FA 5FXRA 4EEVA 2X2LA 5J79A 2GTMA 5AAEA 3ALNA 3BIZA 3OC1A 4XLVA 3RCJA 2UW5A 5KMJA 2JAVA 1A48A 3PSDA 3VJNA 5FEEA 4QMTA 4W4WA 3CIKA 3NUYA 3RBWA 5DR9A 3LXNA 5E8VA 2VRXA 4LGHA 4UYNA 4PL5A 4WG5A 4FSWA 4I22A 4BCJA 3QF9A 2ZMDA 4Y8DA 4WBBB 4LV8A 1ZY5A 5AJQA 4ERWA 4KKHA 3VULA 2EWAA 5HBHA 4G6NA 3QUEA 3VBWA 1RDQE 3VBXA 3NCZA 2YAKA 2OH0E 4OTWA