3MH3A

Mutagenesis of p38 map kinase establishes key roles of phe169 in function and structural dynamics and reveals a novel dfg-out state
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
348
structure length
334
Chain Sequence
RPTFYRQELNKTIWEVPERYQNLSPVGSYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDRGLATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 14
publication title Mutagenesis of p38alpha MAP kinase establishes key roles of Phe169 in function and structural dynamics and reveals a novel DFG-OUT state.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 103
structure length 334
sequence length 348
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2010-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3mh3A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3mh3A01
4DLIA 3VQHA 3DJ5A 4X2GA 2UZNA 3F66A 2VO6A 5CXHA 4ZY6A 5C8KA 2R3GA 3AD5A 3CTQA 2ZB1A 3F5GA 3ZBFA 4AX8A 4IVAA 3SQQA 5LMBA 3IGGA 3OOGA 3QTWA 4UWYA 1OZ1A 4UN0C 5HX8A 5AADA 5TR6A 4DG3E 5LVPA 4M0YA 3KVXA 2O65A 5IA2A 1Y57A 4FC0A 3ALNA 5D7VA 1STCE 2UZVA 5I9YA 3PVBA 2FSTX 3TG1A 5DR6A 2ITNA 3D2IA 3W2PA 2DUVA 3KXXA 4APPA 5L6PA 2R3FA 2X7GA 2QOKA 3E93A 4L3PA 4DTBA 2QOBA 5FM2A 2AYPA 5EHYA 1LPUA 2H34A 4X3FA 5CLPA 5IPJA 1YVJA 4QQCA 3COKA 4JDKA 1NVSA 2R9SA 3DKCA 4QTAA 5FTGA 4PDSA 5J9LA 3QLGA 4OTHA 3NNXA 3NW7A 1S9JA 2J51A 2GS2A 2X2LA 2XEYA 3O8PA 4BF2A 5HHWA 5AV1A 3QA8A 3K5VA 3O8UA 4O2PA 3LZBA 3B2WA 3OBJA 4G3CA 4FKPA 5M55A 4YTCA 4ANMA 5AP5A 4FE2A 4YHTA 1FINA 1ZYSA 2ITTA 3OC1A 2JEDA 3RPRA 2VUWA 3TEIA 4FNYA 3VS5A 4ENXA 3FXXA 1ZZLA 2X7FA 3FLNC 2CDZA 3NAXA 5KNJA 3HL7A 1YXSA 3ORLA 3O2MA 4II5A 1OIRA 4L3LA 4MTAA 3ZM9A 5B7VA 2NRYA 3DAKA 5BVDA 1J7UA 3Q96A 2VTHA 2WOTA 4AG8A 2AC5A 3A99A 3OWJA 4P5QA 4A9UA 5IQDA 4RQVA 4TKSA 4XRJA 4MXAA 4U5JA 3TZ8A 1GIIA 1U54A 2XCKA 3UYTA 2YIRA 5D10A 3R63A 3JUHA 5E1EA 3R9DA 4L3JA 4QP3A 4U3ZA 3OROA 2UZUE 3IECA 5L8KA 4R7HA 3DBDA 3FQHA 1JSTA 1U5RA 3PXFA 5CF4A 3RCDA 3G2FA 2JDTA 2XEZA 4BBFA 2R3MA 3HYHA 4RJ6A 1GNGA 3TJCA 4QP6A 4N57A 4IB0A 5IQCA 1CKIA 2W96B 3OF0A 2QLUA 4J8NA 5HO7A 1Q8WA 1OUYA 1PXLA 1ZAOA 1ZYCA 2CGWA 3EL7A 3F88A 3NW5A 2WTVA 3G0FA 3HRFA 4GU6A 4EKKA 5KKRB 4IACA 4EOKA 2UW6A 4H3QA 4I5MA 4RGJA 1PKGA 2GNIA 4FEVA 3L8SA 4ZP5A 3OXZA 3AD4A 4OBQA 2PZIA 3E62A 3I6WA 3PVWA 4Y85A 4IB1A 2OBJA 2W4OA 3EWHA 3JYAA 3QX2A 2BRNA 2H9VA 4RA4A 4RIOA 4X6RA 5G6VA 4GUBA 4C02A 2O5KA 4G5PA 4PMPA 4X6QC 5E90A 3FZSA 1OUKA 4YJOA 4J53A 3G90X 4D55A 3EJ1A 2IVUA 1M52A 2IZSA 3EQFA 3FBVA 4RFMA 3BWJA 2PHKA 4KRDA 4ZTLA 4Q9SA 5C4KA 1UU9A 1JKTA 3ODZX 4XJ0A 5J9ZA 2GQGA 3PPJA 2BRMA 2ZM4A 3LJ2A 4P2KA 4YJPA 5DGZA 5BVWA 2RF9A 4MBJA 3RM7A 3NGAA 5DT0A 3RM6A 3WI6A 5K9IA 4GEOA 4AW2A 4I5HA 4J1RA 2B9IA 3A61A 4XG7A 1YQJA 3KFAA 4UMTA 3P7CA 4G6OA 5CQUA 4ZTNA 5AX9A 2JAMA 3EFJA 3LFBA 1WBNA 1S9IA 3I6UA 2FSOX 3NYXA 4FA2A 3BHTA 3ULZA 4G31A 3NCZA 3KRJA 4F09A 5IU2A 1PKDA 4EOMA 3Q9YA 2O3PA 4AFJA 3DLSA 3QRKA 5IQGA 2BILB 3A7IA 1PY5A 3EYGA 4LI5A 1OIYA 2OG8A 4LM5A 4TWNA 5JRSA 3RAKA 4FYNA 4A9RA 4C2WA 4BVUA 4KB8A 2WMRA 2RSVA 4CQEA 4FEXA 5IQBA 3MA3A 5IZFA 2W1EA 1X8BA 4C61A 1NW1A 5EDQA 5A9UA 4WG3A 4O22A 2ACXA 1GZNA 5FEQA 4IDTA 2UZEA 3E7OA 4EK5A 5D9HA 5AUVA 3AT3A 3CQUA 5EI2A 3QQFA 2CJMA 1WBPA 4AFEA 3I5NA 4O21A 4R1YA 5A46A 4KABA 3FHRA 4KWPA 3MWUA 4D1SA 4FTJA 1UKHA 1OL6A 2YIQA 5LMKC 3DXPA 3RJCA 3LM5A 3RPVA 3KRRA 4KINA 1OMWA 4G16A 2O63A 4CFXA 3HV7A 4IIRA 5DOSA 3ZLXA 1GIJA 3BHYA 3G9NA 1WCCA 2CN8A 5EQYA 5EYMA 4IM2A 2UVYA 3PWDA 2C5VA 2WTKB 2W5HA 4AW1A 3DBEA 3NZ0A 4AF3A 2ZV8A 4ALVA 3A7FA 2OFVA 2WMUA 1QPEA 3AC1A 1SNUA 4C38A 3QTQA 2PVKA 3RCJA 3FUPA 3VBTA 4ENYA 5M57A 4GH2A 2OJGA 3Q60A 4DEEA 4IB3A 3UIUA 2R3OA 4BDDA 3E63A 3F2RA 1O9UA 2J6MA 3PY0A 2VTQA 1PHKA 4FYOA 3GFWA 2B4SB 1GAGA 3ZFMA 4QP7A 4PDYA 4LFIA 5EFQA 3W2CA 3OCGA 4B8MA 4RWKA 4JDIA 2PMIA 3G51A 2EB2A 4FSZA 3VUIA 4IX5A 4EQUA 3ZHPC 5CI7A 2RGPA 4YJUA 3QRUA 3DFAA 5ANDA 2ZVAA 3BHHA 4MYGA 4AT5A 3ZBXA 1JKLA 4AXAA 4C8BA 5EH0A 1XH9A 3KGAA 4KIKA 5B2KA 4YHJA 4IE9A 5EHLA 4EWQA 2OZAB 2WTCA 3VIDA 3KULA 5HBEA 1WBSA 4B9DA 4K2RA 4CEGA 4MEDA 4AP7A 5IEVA 4U81A 3V3VA 3SRVA 4GT4A 5L8LA 4ZIMA 3B2TA 5IQAA 4CKRA 3U6JA 4OBOA 1H1RA 3H9OA 3SDJA 5EDPA 2P4IA 3V6SA 4KKEA 5I9XA 4FV2A 4BYIA 4KA3A 3EQIA 5L2TA 4KUJA 2QI8A 2V5QA 3ZLSA 3O51A 3KKVA 5I4NA 2UZTA 1IEPA 1OKVA 3OWLA 2Y4IC 2CCIA 4E26A 5CTPA 3C4EA 1LR4A 2R3LA 4K8AA 3NUSA 5J95A 1QMZA 2ZV9A 3MY5A 4O38A 2XNGA 4XLVA 4BC6A 1W0XC 4KRCA 3AGLA 2CHLA 1JQHA 3D0EA 5EDRA 3R1QA 3SOAA 3BU6A 4WG5A 4D58A 4QYEA 4EORA 1UU3A 4M69A 4OTRA 3RNYA 1U46A 1KE6A 3Q52A 5FRIA 1WVXA 2WTJA 5EQPA 2CN5A 2WQNA 3NS9A 2Y4PA 3NUYA 4NSTA 3PXZA 1ZARA 5CSHA 4C4HA 4PY1A 4XV1A 4IHPA 1H4LA 2OKRA 4M66A 3WZEA 3DNEA 4EUUA 2JC6A 3HV5A 4BIEA 2CNQA 3QKKA 3I5ZA 4MD9E 3FMEA 2VAGA 3TNWA 5I9ZA 3BGQA 2RFDA 5CSPA 2X8EA 3KMWA 3FI2A 3PRIA 4X3FC 4RWLA 3FXZA 4DGGA 4RIYA 4UB7A 4GVJA 3UOHA 2C69A 4YO4A 4BDEA 2RG5A 3I7BA 3CQWA 4RIXB 4HW7A 3HMMA 4JBVA 4FKJA 3PY1A 5TE0A 4L46A 5J7HA 4KSPA 4E6QA 3LFAA 1H24A 3TKUA 1SMHA 1QPCA 3NSZA 3LFNA 4NJ3A 5ETFA 5DRBA 4AGUA 2CKOA 3FI4A 3DK3A 3W16A 2X81A 3LKMA 3PP1A 4QOXA 5AFVA 3ZO4A 2FA2A 2VWIA 5ANOA 5HQ0A 3N4VA 4GK3A 3KK9A 4DGNA 3EQHA 3LMGA 4AT3A 3UE4A 5A6OA 3W8QA 4EH2A 5M4FA 2PVMA 3K54A 2JITA 4M7IA 5CYIA 2IPXA 3FZPA 2VGPA 3NX8A 1MUOA 3HGKA 2BTRA 4BI0A 1O6KA 4FR4A 3ZDUA 2RG6A 3F82A 4I0SA 5E8WA 3UIXA 4F9AA 4G9RA 4I6QA 5BQ0A 3D7TB 4WNKA 4OAVB 4DT9A 5FUTA 5EQEA 3F3WA 2ITZA 4NM0A 3QAME 4YJSA 2B9JA 3QL8A 4ZLYA 3MH2A 4FV9A 3WYXA 4W4YA 3TDWA 3P0MA 5CZIA 2WMTA 3L8XA 4FK3A 3RINA 5ACKA 2QD9A 3EN7A 4Y8DA 1PMNA 5K5NA 5K3YA 2ESMA 2E9PA 3PE1A 1FPUA 5LCJA 2QU6A 3RK9A 3RWPA 3Q9ZA 5GIPE 4D5KA 4RX9A 2P3GX 4K1BA 4OT5A 3NNUA 4E6DA 4PDOA 4QYFA 2V55A 1Y8YA 5KCVA 3ZRMA 3FMNA 2QR8A 4NEUA 4PTGA 2RIOA 3F7ZA 3P1AA 3EYHA 4IZ7A 3T9TA 2A19B 3PG1A 3TNQB 4IMYA 4UMUA 3IK3A 3EN5A 3KXMA 2BMCA 3IG7A 2R4BA 2GNJA 4C0TA 4O7SA 1FMOE 5BVNA 5H8BA 3COMA 4LRKA 3C4XA 4BRXA 1HOWA 1JSUA 2PVRA 4EH5A 1ZWSA 4O91A 4X3JA 3SAYA 3QQHA 3UODA 3VN9A 1MRUA 3R30A 5CX9A 4EJNA 3P9JA 3F5PA 4M14A 4L44A 2XYUA 2JGZA 3C4CA 2YWPA 1WFCA 4R5YA 3BYMA 3NLBA 4ZZMA 4G17A 5T68A 4OR5A 3I81A 4U6RA 5L3AA 4TZRA 2BHHA 3QQKA 1DAYA 3P86A 2A1AB 4RIWB 4TT7A 4EONA 4I6FA 3RKBA 4MBIA 4W9XA 4QTBA 4AGWA 4EZ7A 2Z7SA 1PYEA 3BLQA 3F3UA 4LOPA 4FUXA 4R3PA 4UMRA 1E1XA 3MVHA 2FUMA 4USFA 4JR7A 2WGJA 3C0IA 4KBCA 2GU8A 3DAJA 4YJNA 3K5UA 4CKJA 4ALWA 2VTOA 1XH7A 3TDVA 4L00A 5HNGA 4FOCA 3LVPA 5FDPA 3BBTB 2PZPA 2ZMCA 3FZ1A 2BRHA 3CCNA 5AR7A 3RPYA 5JZJA 3OG7A 4NKSA 3QYZA 5HLPA 2OFUA 5KZ0A 4BZNA 4BY9E 4QPSA 3MIYA 3JY9A 4OW8A 3ZO2A 4DLJA 3PJ8A 2CLQA 2XJ1A 2O8YA 3BWFA 4J99A 4JBOA 2YIXA 3QD4A 3PZEA 3QCXA 3R9HA 5DMZA 3KN6A 4DT8A 3PXKA 2J0JA 2Y6MA 3D5VA 1KV1A 5HLWA 3R7YA 3Q32A 4N6ZA 3R8ZA 2OW3A 1TQPA 3C4ZA 4M67A 1PJKA 4G3GA 5C8NA 1SNXA 4GJ2A 3WARA 5LXMA 4KSQA 2O2UA 4L45A 3C51A 4D9TA 3RZBA 2QONA 5BNJA 3BZ3A 2Z2WA 2XK6A 4EKLA 1WZYA 5CEPA 3BYVA 2EU9A 3BI6A 3ZFXA 4BGHA 3S0OA 2I0VA 3IW7A 1ZYDA 2BAKA 2RL5A 3N4TA 4APCA 4HNIA 3LQ5A 4FTUA 2WMWA 4YO6A 5FEDA 3HNGA 3RGFA 2CKQA 5JZNA 2B1PA 4RG0A 5H8EA 4P7EA 4D1ZA 1F0QA 4Y95A 4HPTE 2UZOA 3QWJA 5ETAA 1NVRA 1R1WA 1M7QA 3ZC6A 3COIA 4DFYA 2W99B 3QZFA 2PVFA 5GINE 4NT4A 4OTIA 3ZU7A 1GZKA 1WBWA 3QTIA 4CFVA 1P14A 3PLSA 2XRWA 1V1KA 4GG5A 3QRTA 4IJPA 4J71A 4K9YA 4XV9A 4FV8A 5CNOA 2XBAA 1CTPE 4KBAA 2R3NA 3FKNA 2OZOA 3V8SA 4F1OA 4WHZA 1YXXA 3NNVA 4BR3A 3ZLWA 4F7SA 4CV9A 4AUAA 4IB5A 3QBNA 3DFCB 2QHNA 2VN9A 4MF1A 4YURA 4WSQA 3FC2A 5CSVA 5CF8A 1APME 3PTGA 3GC8A 5J1VA 2R3QA 4MWHA 2BVAA 5EYCA 1YKRA 2GFSA 4U45A 4U44A 1YHVA 1SM2A 5KMLA 5IQFA 1ZMWA 3VBWA 3A2CA 5F95A 5H9BA 5FWKK 2JIVA 2XA4A 3TNPC 2BZKB 2WNTA 1ZOGA 2W06A 4JOAA 5FLFA 2J0LA 1NXKA 3EZRA 2YIYA 3GCPA 4RA5A 2WU7A 4FT0A 3U51A 4BZDA 4RC2A 1Q41A 4JT3A 2XNBA 5KBRA 4EYMA 3LCSA 4I22A 2XNPA 3KEXA 2VWUA 3NUPA 2ITUA 2FYSA 3CP9A 2YCFA 4JNWA 4U79A 4CFMA 4AT4A 3CY3A 2YM8A 2W1GA 3GBZA 5GJDA 4EQMA 5HX6A 4NJDA 3L9PA 3DT1A 4C37A 3WIKA 4WNPA 5AV4A 4KIOA 5JFXA 3H9RA 4F9CA 2GS6A 2C6MA 4WUNA 2LAVA 4D2RA 3WZKA 2R0IA 4ZTRA 1PXJA 4FSUA 4U97A 4F08A 3O8TA 3D7ZA 3QTZA 4NIFA 4V0GB 4Y73A 4CT2A 4D4SA 5LOHA 3CTJA 5A3XA 1MRYA 2FVDA 2X6EA 4P90A 5CAOA 1MRVA 4IJ9A 2P2IA 4RVKA 5CU4A 3CS9A 4QTCA 1M2QA 4ID7A 4O1OA 5AUYA 4CFFA 5GZAA 1QL6A 5LCKA 2DS1A 5ACBC 4W4VA 3BYUA 5HG7A 2JKMA 3ORZA 2VTRA 3TZ7A 5TO8A 3DTCA 2BKZA 3CKXA 4IADA 5F1ZA 3KL8A 3UQFA 3V8TA 4H58A 4TW9A 5AA9A 2BR1A 3QFVA 1M14A 3CJGA 3HUBA 4GU9A 5HD7A 3V8WA 3EN6A 2IO6A 3LMIA 2YZAA 2BIYA 1V0PA 2HZNA 1BL6A 2WMVA 3MY0A 3HAVA 1O6LA 4H05A 1OKYA 5HE2A 5LMAA 4WKQA 3POOA 2XIZA 4GIIA 3AC4A 5M4UA 4R7IA 2UUEA 2OK1A 3CR0A 4M97A 1LEWA 2P55A 3Q4ZA 4DF3A 5DE2A 5A54A 3E64A 5M06A 2CSNA 4HGEA 5JGAA 4MH7A 4FKIA 4IVDA 4FZAB 3BEGA 4I4EA 2G2IA 4JIAA 2P2HA 3BQCA 3TT0A 5KMIA 4IQ6A 1BLXA 2WXVA 2XBJA 1E9HA 2W5AA 5CASA 4DG2E 1PXMA 4MKCA 5EM7A 4LGHA 5BVOA 2QG5A 3CSVA 2C0OA 2VWBA 5F94A 2IN6A 5EW8A 4O0SA 4NCTA 1RJBA 1REJA 3Q04A 4ZTMA 4FV0A 3FY2A 4AU8A 3G6GA 3C5IA 1DI9A 3TUCA 4FTQA 4UWCA 4X7QA 1W98A 3R00A 5HESA 1FOTA 4TYEA 3COHA 3QD2B 3R8MA 4FL3A 3WF7A 3QKMA 3HV6A 1J7IA 3AC8A 3MW1A 1CM8A 3UO6A 5IQEA 4BL1A 4IAIA 5BYYA 4GK2A 2GTMA 1B38A 4HYUA 3SX9A 4ZTSA 2X6DA 3RHKA 4S32A 4I3ZA 5KZIA 3ROCA 4O7TA 3H10A 4FODA 4BCPA 4AZFA 2UZLA 5AIKA 4BYJA 1R39A 1BKXA 2XVDA 5KE0A 3FKLA 2VNWA 2R0UA 4EH3A 5AAEA 4XBUA 4FGRA 4LUEA 3H3CA 1FGKA 4FG9A 4M12A 3VF8A 3VUMA 5KHXA 3E3PA 2GHMA 2C1AA 3T8OA 3S95A 4C2VA 4BIBA 4DTAA 3Q9WA 5J5TA 5DA3A 4FKGA 5CT7A 2BAJA 1J3HA 1RQQA 1Z9XA 2YERA 4IX6A 3TWJA 5AR2A 4HVIA 2P33A 4FK6A 3MB7A 4QYHA 4ZMEA 4FT3A 4MD7E 3R9RA 2JKKA 4XP0A 5M4IA 3V5LA 4B7TA 3SW4A 1W83A 4CFWA 4I21A 3HMPA 3F2AA 4QMTA 2PTKA 4IAAA 5AUUA 3OWPA 3PA4A 4JXFA 3D15A 3EKNA 3NPCA 3QRIA 5FBNC 1WAKA 2JDOA 3II5A 4FVQA 4D2WA 3MTFA 3P23A 3DAEA 5JFVA 1OIQA 3FPMA 4M8TA 3PIZA 3A7HA 3BV3A 4LGGA 4BFMA 4D2PA 3CD3A 1ZZ2A 2PU8A 4FZFB 2YITA 3RHXA 3QUDA 5K0XA 3ZSIA 2XNOA 4F4PA 4WD5A 1P4FA 4FIGA 1YDTE 2X1NA 4FVPA 4CXAA 4FKLA 4AE9A 3ZSHA 2G2HA 4HGLA 4L42A 2XK4A 4QMNA 3BLHA 4QMLA 4D2TA 3SLSA 4DFBA 3UG2A 3NNWA 5L2SA 4L53A 4UWBA 4YPSA 5LVLA 5E92A 5HE1A 2YM4A 2B9HA 4D0WA 5GHVA 2GQRA 2G9XA 4PTCA 3A62A 3JR1A 2VZ6A 2R3KA 3VJNA 3MDYA 2C5YA 3D5UA 3W2OA 4EHZA 5IF1A 3SVVA 2BAQA 4AN2A 4O7YA 2XM9A 1PYXA 4F1TA 2E2BA 3Q6UA 4ACMA 4YBJA 1L8TA 3OUNB 4BCGA 3O50A 1VYWA 4MWIA 5DVRA 4D5HA 4YLJA 3A8XA 4TWPA 4CMOA 2XK8A 4QMQA 4I1ZA 4FTMA 3UBDA 3FLYA 2ZM1A 1Y6AA 3MIAA 5L6WL 3CE3A 4R7BA 3UVQA 2VTTA 3MVJA 4USEA 2OJIA 3NDMA 4BGQA 1KE5A 4LL5A 3QCYA 4LMNA 5C27A 1FMKA 2QHMA 5KMMA 5DBXA 4PRJA 4DH8A 2B7AA 2QNJA 3E7VA 2W4KA 3VHEA 4DEDA 5AP7A 4CTCA 3HDMA 3R1SA 4GKIA 2C3LA 4PP7A 3W1FA 3MPAA 3OZ6A 4ZEGA 2Q0NA 4GIHA 4QMXA 5BVEA 4AGDA 4I93A 5IEXA 4FTLA 1UNHA 4CKIA 1YWNA 1XWSA 3UGCA 4E6AA 1Q5KA 4WNOA 5E8SA 5ANGA 2HZ0A 4XV2A 4J7BA 1YOLA 4HYIA 5JEBA 3KREA 2QOQA 3KRWA 3FC1X 4O1PA 5K0KA 3GQIA 5HVKA 2IJMA 3FI3A 4S34A 5GZ9A 4BCQA 3DQWA 1W84A 3RMFA 3MJ1A 2ONLA 4QMYA 4DC2A 2Y0AA 2YAAA 3MFRA 3P08A 3CLYA 4MQ1A 2BZJA 2R3IA 4QMVA 5CU0A 2GNFA 3VRZA 4CGAA 1H28A 4G34A 3MH0A 3R22A 2PE0A 3PXRA 2WEVA 1ERKA 3A7JA 4JX7A 5J5SA 3CJFA 4UMQA 3ET7A 3NCGA 4YBKA 2C6TA 1W82A 4FKWA 5HIEA 2QLQA 3IDCA 4QMOA 3R01A 4WSYA 3SOCA 4YNOA 2BHEA 4DFNA 1B39A 2ITXA 2ETKA 2UW0A 4E5AX 3PXQA 5CSWA 3QUPA 4EK3A 1H27A 5HO8A 4XYFA 2NP8A 2CGVA 3NUXA 2ITYA 1H26A 4QRCA 5DR2A 2XNNA 5FDXA 4L8MA 1NA7A 3JPVA 5EOBA 4CRLA 5KMKA 4JG7A 2I0YA 2I6LA 3E5AA 2JAVA 3I60A 3PVGA 4XG4A 4BKZA 2UVXA 4F1MA 2X9FA 3RP9A 4EZ3A 5IMEA 3ENMA 4IM3A 3N9XA 3ZDIA 4N6YA 3TACA 2CKPA 5EW3A 1DM2A 2OICA 4QMWA 2XCHA 3RPOA 3KQ7A 3JY0A 4H36A 3WZDA 3U55A 4LMUA 4I92A 1Q61A 5EI6A 5FBOA 1PXPA 4TWOA 4AN9A 4O82A 2VWYA 2YABA 3OTUA 3C9WA 5EM5A 4HPUE 2Z02A 1BI7A 5JQ5A 1UVRA 3CPBA 4FKSA 5CNNA 1DS5A 4UMPA 2GQSA 2E9VA 1XQZA 4HVSA 4RC4A 2OJJA 4O0VA 3ACKA 4ZSGA 4YZNA 2NO3A 4ASEA 3DZQA 3REPA 3U6HA 1PXKA 2HWPA 5EK7A 2F2CB 2OJFE 2IZTA 2YEXA 3DKFA 3OHTA 3SW7A 3PWYA 5AR4A 3QD3A 1ATPE 1IAHA 3ZLYA 4TN6A 3U87A 3LM0A 1B6CB 4E5BA 4FX3A 4ERKA 1KE8A 2EWAA 1MQBA 5CQWA 2J4ZA 4X2JA 5EOLA 1K2PA 3V5PA 2A0CX 5IH6A 1MQ4A 4WT6A 1OL1A 4NL0A 1VR2A 2OF2A 3VQUA 2GPHA 2JBOA 3RNIA 1KSWA 2P0CA 5C1QB 3EFWA 4NKAA 3DJ6A 3WF8A 2WMSA 3E92A 4ANQA 5J7BA 3VBVA 4CG9A 4EK6A 3R7UA 4L7SA 2CCHA 3DU8A 4X21A 4ZAUA 4QMSA 4K11A 3C50A 2YM3A 3UIBA 3PJ1A 2B54A 4JVGA 1FBNA 2BTSA 4NH1A 4NCTC 4IVBA 4EWHA 5HU9A 3AGMA 3KN5A 4F7JA 5KX8A 3CBLA 5CEIA 2WQEA 3HA6A 5E7RA 3QF9A 4TRLA 3VUTA 3PY3A 3UNKA 3PZHA 4ACGA 4L7FA 2XIXA 4Q2AA 2UZBA 2XS0A 1GIHA 2QU5A 2YLEA 3RPSA 5A14A 2F7XE 3CEKA 2REIA 5ANKA 2XM8A 3L9MA 5ANIA 1YW2A 3N51A 4MXOA 2Q83A 3VUKA 4O7WA 4IZYA 4NYEA 2WTIA 2VRXA 4U8ZA 3O7LB 2FO0A 3W55A 4D1XA 2C0IA 3FHIA 4BDKA 1AD5A 3TZMA 4EHVA 5B2MA 5I3OA 4IM0A 2GMXA 3B8QA 4USDA 3V5JA 1TQMA 2R3JA 4EYJA 2VTIA 5AUXA 3GGFA 3UMXA 3R71A 3UVRA 1CMKE 1XO2B 2PE1A 2WKMA 2YM5A 4RRVA 2OI4X 4FNXA 4XHKB 1VYZA 4FT9A 1QCFA 4UBAA 1NT2A 1ZMUA 2H96A 4CG8A 3TV7A 3EQBA 4GL9A 4XLIA 1VEBA 4NM7A 5DWRA 3WE4A 3O17A 4C7TA 5IUHA 4FKTA 4ONAA 3SG9A 4DH1A 4V04A 4KKGA 4J96A 3E88A 1YDRE 2OJ9A 5LQFA 2B0QA 1LP4A 2R3PA 2JD5A 4HZRA 4AACA 4BDGA 4DG0E 1LUFA 1UA2A 1YOJA 3HX4A 3PE2A 5C4LA 3TNHA 2VU3A 4MXCA 1UU7A 4BHZA 4DBNA 3OMVA 3PJ3A 4F99A 1WVWA 4OTGA 4XG8A 3ZC5A 2Y9QA 5HG5A 3VBYA 2EXCX 5ICPA 4YC8A 2HENA 4HCTA 3JS2A 1UV5A 4W4XA 4RX7A 5M53A 2XKDA 2PMNX 1F5QA 3I1AA 5HVJA 4S33A 3FDNA 4A7CA 3GU6A 1SVHA 3LLAA 4EH6A 5AEPA 4C4IA 3FKOA 1K3AA 3L1SA 3UZTA 3SXRA 1OPKA 3RAHA 4KNBA 5E8UA 2Y4IB 4CQGA 4O7LA 3PRFA 4MNEA 4QD6A 3VUDA 3RWQA 4A9SA 4I0TA 5JKGA 3F5UA 4FTNA 4CVAA 3D94A 3VBQA 4YNEA 3RAWA 5L2QA 3KXNA 3BYOA 4U3YA 3LXLA 3A4OX 3VW8A 4I6BA 3KC3A 2WTDA 4AZWA 3FAAA 3KMUA 3LFDA 4F0GA 5FGKA 4EH8A 2GNHA 3BU5A 2J2IB 3QQUA 4R6VA 4O7NA 5KHWA 4RSSA 4F9YA 5AV3A 3E8DA 2QC6A 5FEEA 4DFXE 3CD8A 5M56A 5BX0A 3HMNA 4FSWA 4YC3A 5HTIA 1SVEA 1PMVA 3R28A 5E8VA 5L2IA 2I0HA 3MVMA 4PPAA 2R64A 2QOOA 2Z7QA 3DOGA 4JAJA 3ROYA 3PG3A 5DN3A 4GFOA 2HWOA 4X3FB 5IA3A 2XJ0A 3EL8A 5L8JA 3EKKA 4RWIA 4DE4A 1ZYJA 1ZXEA 2XUUA 4ASXA 2B52A 5LARA 3F9NA 3GU7A 3EZVA 4FZDB 4CMTA 1HCKA 3BV2A 2WFYA 4L43A 5AX3A 4IZAA 4FIFA 5IDNA 3TV6A 4WOVA 4DINA 4LYNA 2NRUA 3EHAA 5CU6A 3BHUA 4AA4A 3VS0A 4JDHA 3RK7A 5FP5A 4GCJA 3Q5IA 3IS5A 4EZ5A 4LG4A 2UW3A 4JQEA 3MH1A 3ZO1A 1GZ8A 2ONLC 3NVMB 1Z57A 1K9AA 4OUCA 3FSKA 4RMZA 1Y6BA 4CSVA 5GIOE 5CI6A 4JIKA 2HYYA 3UJGA 4YLKA 2VTLA 1U59A 3CTHA 3S2PA 1H1PA 5AP1A 2HXLA 4E8AA 1G8AA 5JK3A 3IW5A 1V0OA 4F0FA 4E4LA 3ATSA 5JRQA 4DFZE 1U54B 2PE2A 4GT5A 4RVLA 5B0XA 5LVOA 3LFSA 3LLTA 4PDPA 1BUHA 3VBXA 1Q3DA 3O23A 4RPVA 3AMYA 2NPQA 3FL4A 4FTRA 3QC4A 1A9UA 3UOJA 2ZYBA 4YGAA 2J7TA 4ZTHA 2QO7A 5AR5A 4L67A 5C26A 2F7EE 2YM6A 4JG6A 4XEYA 5AP4A 5BMMA 3MV5A 4I41A 4JDJA 2R7IA 3HV4A 4ACHA 1XR1A 1J1CA 2OH0E 3IPHA 4PMMA 4YPDA 3HAMA 5D12A 2A4LA 4BBEA 4O83A 3DDQA 2GDOA 4FNZA 5C01A 1ND4A 4AZSA 3L9LA 3ETAA 2OIQA 3GCVA 5JN2A 3BX5A 3KXZA 4UYNA 1J91A 5HO6A 4A06A 3UNZA 3RK5A 3DBFA 4QYGA 4LUDA 4BDCA 4JQ7A 2E9NA 4QT1A 4FTAA 3U4WA 3O71A 4ZLZA 3W10A 5FP6A 1OL5A 4ZLOA 5HE3A 2AUHA 3CIKA 2UW5A 4I20A 3W18A 4W8DA 4C4EA 4XV3A 5D11A 1KOAA 1IA9A 4BWPA 5DEYA 2BCJA 3R21A 4XP3A 3T3VA 2JFLA 4TPTA 3MFTA 5IMXA 5LVMA 1SVGA 3RALA 2VNYA 4HJOA 3E8NA 5CSXA 4MBLA 3PSCA 2HY81 3SGCA 3TCPA 3D14A 1UNGA 3PA5A 4V05A 2J90A 4YZBA 3F7WA 2BDFA 2DYLA 4ASZA 3BHVA 3RZFA 3MBLA 4QQTA 4U40A 4FMQA 1WMKA 3WILA 4FBXA 2ZAZA 4PQNA 4Q5HA 3ZO3A 3SD0A 4ITHA 5HTBA 4YLLA 4O2ZA 4RBLA 3GOPA 3TKHA 3VULA 4PNKA 1V0BA 2CNVA 1I09A 4C59A 2XKFA 2E9OA 4CYJA 4IC7A 5A4LA 3ZRLA 2QKWB 2PPQA 2VO3A 2JDSA 4AZTA 1M7NA 1XH5A 3GU5A 3C0GA 3OP5A 4QPAA 3GU8A 2BDJA 3ORXA 3H0ZA 1JNKA 3ENHA 5DEWA 5F20A 5HZNA 5CWZA 5H2UA 2QO2A 4LRJA 3H4JA 2EB3A 5HE0A 5M07A 4FSNA 3AT4A 3DCVA 3CPCA 5TKDA 1VJYA 4H3PA 2J9MA 3LJ0A 4CD0A 4FT5A 4AW5A 5E8XA 3NRMA 1U5QA 1OPLA 2FSLX 4BB4A 3C0HA 5IUGA 2I1MA 3NAYA 4EOSA 4J95A 4PL5A 2A27A 2XNMA 4BKYA 4U0IA 1AGWA 4J8MA 4CNHA 2RFSA 2H6DA 5HIDA 4S30A 4HGTA 3EN4A 1G5SA 1Q8ZA 5JFWA 3P5KA 5J1WA 4QTDA 1FVVA 4QNYA 3BRBA 3GB2A 3HECA 5GZ8A 4CZUA 3QQGA 4NM3A 4WBBB 1OI9A 3QXPA 4K6ZA 2OXYA 2EXMA 3QXOA 2I7QA 4EUTA 4R5SA 1HCLA 4RJ5A 5JGDA 3F69A 3JXWA 4BIDA 4NWMA 3WZJA 2PUNA 1Z5MA 4FEWA 1PMUA 3F3TA 2C6LA 2PY3A 1RW8A 4LL0A 1J1BA 1NY3A 3GC0A 4JR3A 2Y6OA 2WMBA 3Q4TA 2QCSA 4XP2A 4EL9A 1XH6A 4U80A 3V5QA 1UWJA 3JVSA 1JOWB 1PXOA 3VAPA 1ZLTA 3GI3A 2BDWA 2OXDA 4YP8A 5M08A 4AAAA 4ZY5A 4DTKA 5AV2A 4GV1A 4IAKA 2PWLA 2VTAA 2XKCA 4W8EA 3AC2A 3HRCA 2F57A 4AA5A 4CFUA 3EB0A 4M3QA 2GHLA 1Y8GA 3DDPA 2IW8A 1CKJA 3FYKX 4DCEA 2F2UA 3MS9A 4O0UA 4G2FA 5D41A 5FG8A 4QMZA 4R78A 3Q9XA 5I9UA 4AWIA 4ZMFA 4KIKB 4X0MA 5IH4A 1H0VA 1Q8YA 5AP6A 5E4HA 3KULB 2CMWA 3NVKI 5BUEA 1NVQA 1XHAA 4F7NA 4E4MA 5HNIX 3M1SA 4CFNA 2G01A 2X2KA 2HY0A 4QP1A 2VWZA 4TNBA 4QQJA 5FQDC 4QQ5A 2XYNA 3SRVB 5HIBA 4A9TA 5IA4A 2WZJA 3D83A 5HD4A 1YXTA 2F9GA 2VO7A 2WEIA 3DK7A 4FICA 3QZIA 2O0UA 4OTQA 3GQLA 4IWQA 1P2AA 3ALOA 4X2KA 1ZY5A 2NNWB 2BZHB 3A7GA 5D1JA 5I9VA 1IRKA 4IBMA 4FI1A 4RVMA 3FLQA 5E8ZA 4DH7A 4D4RA 3VW6A 3F6XA 1YI3A 3P79A 2YLFA 4FKVA 3TL8A 5CEOA 3GP0A 3CY2A 4GUEA 4UY9A 3LQ3A 4GKHA 4FF8A 5DT3A 3D4QA 4ACCA 1J7LA 4RLLA 1H8FA 2CKEA 2ERKA 4XH6A 4MAOA 5CEQA 5TT7A 3UVPA 4MHAA 4AS0A 4KBKA 2QQ7A 3OW4A 5HICA 4QYYA 2HK5A 5T6KA 3TUBA 3QQLA 4M69B 2QR7A 4AW0A 4NTSA 1FVTA 2VWWA 5AP3A 3IO7A 3PVUA 3VWAA 3UIMA 5HKMA 3LCDA 3K2LA 2PULA 1YXVA 4ZS4A 4M68A 4BCIA 4D0XA 5I5ZA 2ITOA 3E8EA 1JBPE 2C6EA 2YCSA 4WBOA 4Z16A 5LWNA 5AIRA 3ZTXA 3GEQA 3F5XA 4FV6A 2BRBA 5ANEA 3OVVA 3PPZA 4FSTA 4RIYB 4JX3A 3UO4A 4EHGA 2UW7A 5CF6A 5KO1A 5JQ8A 3K3JA 2PZYA 1KE9A 2XK9A 5CEKA 2XIKA 1WBTA 5HCZA 2Z7RA 5DIAA 5A4TA 4FSRA 4AA0A 4ARKA 2OZAA 2GNLA 4IDVA 3ZXTA 3VJOA 5AR8A 2WB8A 2J0KA 3C4FA 5HVYA 3ZUVA 5K4IA 3LJ1A 4J98A 4CRSA 2PVLA 3D5WA 3QGWA 2WQBA 2C6KA 2X8DA 3MGYA 4MQ2A 4NFNA 4Y72A 5B2LA 2CNUA 3KXGA 4Y83A 3OY3A 3Q6WA 4FG8A 3VS7A 3MI9A 3GNIB 4I24A 4KD1A 4PP9A 3OOMA 1Q8UA 1ZY4A 2WU6A 4MXXA 3WBLA 4FUYA 4OTWA 3AT2A 2WTWA 1H25A 2WPAA 2UZDA 4RJ7A 3MFSA 1REKA 3ID6C 5HGIA 4F6UA 4ZS0A 2QKRA 1FVRA 3SV0A 4O0XA 2Y7JA 3QWKA 2HZ4A 2ITVA 3I4BA 4DA5A 1GZOA 2W4JA 4XX9A 4FGBA 5HLNA 5LWMA 5J87A 4RJ3A 3UOKA 4TWCA 4DN5A 5CU3A 3Q3BA 4XS2A 3TIZA 2X9EA 3GC9A 3AC5A 3DA6A 5GJGA 5C9CA 3GC7A 3TIYA 2XZSA 4FV1A 4LRMA 3HUCA 3KCKA 4NW5A 2AC3A 4JRNA 3ZZEA 4R77A 2DWBA 4CYIA 4PF4A 4BCJA 4TXCA 4V01A 2QG7A 2ITQA 2YACA 3GCSA 3R04A 2X39A 3BIZA 5EKNA 1FQ1B 3DZOA 5I3RA 4C3FA 4PPCA 4ZK5A 4JS8A 3OCTA 3UC4A 3MYGA 4IAYA 4BDAA 4C4FA 2JKOA 2C3KA 3W32A 4RIXA 3DB6A 1JSVA 3R8PA 4YU2A 3RVGA 3LCOA 5DG5A 3ULIA 5EYKA 2XRUA 2FGIA 4PTEA 4CLJA 3AMBA 1UNLA 4PPBA 2KULA 2Z8CA 5IKWA 3OW3A 5CAVA 1PMEA 5EKOA 3IW6A 3FZRA 1TQIA 3NYOA 2IVVA 4TTHB 4ERWA 4YJRA 3WIGA 2WD1A 5E8TA 4UXQA 3UYSA 5D7AA 1A06A 4B6LA 3DQXA 2OGVA 3KMMA 5AV0A 5I9WA 4RJ8A 2X7OA 3A8WA 3I7CA 4UALA 3SKCA 4QPMA 1ZOHA 3KXHA 1XBBA 3UZPA 3MJ2A 3HKOA 5CAPA 4DAWA 5K4JA 2FSMX 4TYIA 1SZMA 3D7TA 5DRDA 2C1BA 5BMSA 4PUZA 2C5NA 4P5ZA 4AZEA 4FL2A 4UV0A 1BI8A 2OF4A 3OBGA 1KWPA 4YUQA 3D5XA 3P7AA 4NW6A 5CZHA 3NUAA 4G6NA 4J52A 5FXRA 3MPTA 4C3PA 1YWVA 3DXNA 5M51A 3R83A 3GCUA 4QP4A 1JVPP 4G3FA 3BELA 2C68A 2KTYA 3FLSA 4KKHA 3FLZA 4G3EA 4IZ5A 1OECA 4W4WA 3CQEA 3TV4A 1KV2A 3BBWA 5FTQA 3PIYA 1PXNA 3FE3A 3AOXA 4JBPA 2YISA 5HEZA 5C8MA 3EOCA 3MPMA 4E93A 3E87A 2VWVA 2XK3A 3KF7A 3UQGA 4U41A 3I79A 4IVCA 4EH9A 4BICA 5GNKA 3LXKA 4C35A 5KKRC 3S4QA 4D2VA 4RVTA 2IWIA 3LQ8A 3MY1A 3HZTA 3HEGA 4YZ9A 4O81A 4BCKA 5AP0A 4BCMA 3IW4A 2R5TA 4B8LA 2VTMA 3QHRA 5L4QA 4K0YA 5AUZA 3OY1A 5CEMA 1XH4A 5BUIA 2V62A 2WIHA 5J79A 4BTKA 2XK7A 3BYSA 2O64A 2X2MA 3EIDA 4YZDA 4ZZOA 3DXQA 1PXIA 4GS6A 4YZMA 5ANJA 2F7ZE 4FTKA 4BCFA 5K5XA 3FLWA 3BE9A 1EH4A 4LQMA 4NK9A 4JLCA 3R7VA 3V6RA 4ANLA 3ODYX 4BTMA 4DITA 4AOJA 3FYJX 4CCBA 4MX9A 4MCVA 1H1WA 3BGZA 1MP8A 1W8CA 3C1XA 3OCBA 4MNFA 3QHWA 3UC3A 3ZONA 4CTBA 5ITAA 4ANBA 5CAUA 2HXQA 4XOYA 2C30A 3QCQA 4ANSA 4ZJJA 4RIWA 3TNIA 3UG1A 4EK4A 4K77A 4F7LA 3QKLA 3U6IA 4L01A 4JG8A 3C4WA 2XIYA 4E20A 4O0RA 3IDBA 3QUEA 5CS6A 3WF5A 1PW2A 2YAKA 2C6OA 3FMJA 4AOIA 2OIDA 3OT3A 2ZV7A 4E4NA 4I0RA 3MFUA 1KE7A 3NYNA 4YJQA 5CVFA 4U9AA 1R78A 4IANA 4FIJA 4RLKA 3EMGA 5CXZA 3ELJA 3EFLA 4RFYA 1WVYA 3I0OA 4CT1A 3HMOA 3ZYAA 3QGYA 3SHEA 5AM6A 3TI1A 3WE8A 5HU3A 2I40A 2R3RA 4TYHA 3QC9A 5EYDA 1H1SA 1M2PA 2JIIA 3VC4A 2J50A 3BPRA 3V5TA 1XJDA 3OXTA 3VS6A 4Z3VA 2PVNA 4RZWA 3KCFA 1IR3A 4KS7A 2GTNA 3IDPA 2IW6A 4HCVA 5HBJA 2BROA 3FJQE 3K3IA 1YI6A 3EH9A 2YIWA 5KMNA 2R7BA 3AXWA 5IUIA 2YZLA 4WA9A 5M44A 5AMNA 3NIZA 3ZCLA 3F3VA 5KMOA 2V7OA 2WTKC 3G9LX 4I5PA 4ANOA 2W1CA 3DTWA 5BVFA 4ORKA 3UNJA 2ZMDA 4UXLA 3UZRA 4A4LA 4NIFB 3MVLA 1LEZA 1OPJA 4O0WA 2GNGA 2OXXA 5BYZA 2YDKA 2EUFB 5AA8A 4FG7A 4UZDA 2J0IA 2H8HA 4EOQA 1PRYA 1YHWA 3FV8A 3KU2A 3PPKA 3TXOA 4I5CA 3DNDA 3TM0A 5IISA 4GK4A 1IASA 4ZSJA 3N4UA 1YI4A 3R7OA 5BUJA 4Y5HA 3ZZWA 1ZRZA 4XG3A 3KB7A 4CCUA 4D9UA 2W05A 2BKKA 2PUIA 4OTPA 3DY7A 5EG3A 4E4XA 2CGUA 1Q24A 5F9EA 4MVFA 2QOFA 2C3IB 3ZXZA 4F63A 2ZJWA 1JKSA 3ERKA 4DYMA 4DH5A 2X0GA 3LPBA 4O6LA 1M17A 3UOLA 4ZOGA 4NTTA 3MH3A 2V22A 3TTIA 3V51A 3L8VA 2GHGA 4ITIA 2ZDUA 3BQRA 4EOOA 5LVNA 2GFCA 3T9IA 4FEUA 5DI1A 2YJSA 5T3QA 3F61A 1KOBA 1Q62A 3L8PA 1YOMA 4PL3A 4FT7A 2BFYA 3KA0A 3R8UA 4BKJA 3U54A 2UW8A 5IH5A 4DHFA 3ORMA 1R0PA 2C5XA 2PZRA 3ZEWA 4RT7A 3AQVA 5AJQA 3NUUA 4IX4A 4LOOA 2YM7A 4C62A 2J5FA 4YJVA 3MESA 4WRSA 5AM7A 3KK8A 4D4YA 5G1XA 3W2SA 4O84A 1WBOA 3WF9A 2FB8A 1CSNA 4FIIA 4LV5A 2BALA 3PIXA 3ORNA 4M15A 4QP8A 5BPYA 2IG7A 1GY3A 2YA9A 5AUTA 3GXLA 3LAUA 2OH4A 4JI9A 5HOAA 5HG8A 3FZOA 4JL9A 3Q5ZA 2YJRA 1TKIA 3FWQA 4IEBA 4B0GA 4R3CA 2Z7LA 2OLCA 3W33A 3PUPA 2W5BA 2VX3A 2YFXA 3R8VA 3VS4A 3B8RA 4HCUA 2HZIA 4R8QA 4V0GA 4D4VA 1JLUE 2WMQA 3OFMA 3OEFX 3OCSA 2HW7A 3ZEPA 3ZOSA 5IEYA 1Q3WA 4GJ3A 3R2BA 1OITA 4TY1A 2V0DA 4L9IA 2WELA 4ASDA 3OUKA 4C33A 3RBWA 4F64A 2HAKA 2JDRA 4EC8A 4O7RA 4OGRA 3ZUUA 1RE8A 1Y91A 5CT0A 5HI2A 4MK0A 2GSFA 2PMLX 3E3BX 3LOKA 3P4KA 4DH3A 4FV5A 3TN8A 4GYGA 1ZMVA 2PK9A 3DKOA 4OLIA 3UPXA 3UTOA 3G0EA 4XOZA 5AAFA 4LV8A 3R9NA 4BN1A 3HDNA 4DEHA 4HVHA 3DJ7A 4K18A 2VTPA 2CLXA 4ANNA 4C4GA 3NUNA 4BWXA 4YTFA 3L9NA 4IFCA 2V7AA 3EN9A 4U43A 4ZTQA 4R3RA 1IAJA 2W1DA 2PUPA 4CMUA 2OSCA 2B55A 2Z60A 3F3ZA 4H1JA 4QMMA 4BZOA 2WOUA 5JGBA 1OBGA 3H0YA 4EJ7A 2WQMA 5HNBA 4HYSA 2YCQA 5KUPA 4RX8A 3FY0A 2C6IA 3LFCA 4G1WA 3GOKA 4G3DA 5DPVA 3PSBA 4FVRA 4EOIA 2VTSA 4XCUA 5CF5A 5KBQA 4A4XA 3Q4CA 2C6DA 2ZM3A 2PVHA 1YXUA 3OWKA 1R0EA 3I0QA 4DEAA 1G3NA 2VX1A 4E1ZA 4UZHA 2ETMA 3VUHA 4P4CA 4K33A 3WYYA 3IW8A 4BI2A 2VWXA 4MXZA 4E3CA 2PUUA 4O7VA 3R2YA 3E8CA 5E9EA 3NIEA 2HOGA 2WQOA 4ACDA 5IQHA 3QTSA 4F65A 5CALA 1UU8A 1XH8A 3GENA 4OTDA 3PDTA 4RQKA 2YN8A 2J5EA 2R3HA 2EVAA 3HP5A 4GMYA 4I6HA 3R7IA 3LHJA 3ZH8A 4XBRA 1UKIA 2X4ZA 4IXPA 4ZSLA 3BLRA 2HELA 4TYGA 3LFQA 4XG6A 5DLSA 4L68A 4IFGA 4M13A 4BTFA 1OIUA 4JJRA 3KRLA 4BI1A 2VV9A 3QZGA 3UMWA 4EEVA 5J9YA 4LGDA 2BPMA 4RX5A 3G15A 4L52A 1GOLA 2XIRA 2JBPA 3QU0A 3R7EA 3QA0A 4B4LA 2ITPA 3LIJA 3AC3A 2XMYA 4QMPA 4Y5QA 4O0TA 4X2FA 3F2NA 4WIHA 3H30A 4XNEA 5AWMA 2XB7A 2F4JA 3POZA 3DK6A 5HCXA 3MN3A 2UV2A 2W7XA 4BCHA 3H9FA 4HZSA 4XG9A 3W2RA 3GU4A 2B53A 5IA5A 3U8WA 4A4OA 4EBWA 2UW4A 3VHKA 3PJ2A 5HCYA 3TJDA 3G33A 4NU1A 3ACJA 4OAUC 4G5JA 4B99A 3TZ9A 1R3CA 3DBCA 2W9FB 1YHSA 2PMOX 2JKQA 3MB6A 5BYLA 1H08A 2VX0A 4F9BA 2XJ2A 4H1MA 3THBA 4N0SA 4FSMA 5KMJA 3ANRA 4GSBA 4BDJA 3FMDA 4J97A 2X4FA 3HP2A 5DNRA 5HORA 2CPKE 3M42A 4FSYA 5CVGA 4FOBA 3S3IA 3LFFA 3UP2A 3ZS5A 4E6CA 5TF9A 2SRCA 3NYVA 4EK8A 2QVSE 3DBQA 3Q4UA 5FTOA 4O7ZA 4JRVA 5BVKA 5HTCA 4KAOA 3VS3A 4YTIA 4OT6A 3NEWA 4N70A 4XUFA 2GCDA 4PMSA 2YDJA 3O7LD 3QRJA 5JH6A 4Z7HA 4DGMA 2JDVA 3FI8A 5EM6A 4FTOA 3ZMMA 3PLAE 2BRGA 3D2KA 3R1NA 4IX3A 5IDPA 3SA0A 3TUDA 5A4EA 2Y8OA 4F6SA 3QALE 2HW6A 4FTIA 4KIPA 2OU7A 5A4QA 2PVYA 5CANA 4A9YA 4IWPA 1FGIA 3EFKA 5J8IA 1E1VA 2OWBA 3ORPA 2G1TA 3U9CA 1OGUA 4ALUA 3C13A 1YDSE 3R1YA 3CC6A 3ZM4A 2ZV2A 4GFGA 4Y46A 2QO9A 1XKKA 3ZFYA 1OM1A 4FZ6A 4XMOA 3Q53A 3PYYA 1QPDA 2IVTA 4G9CA 4GRBA 3R8LA 4CLIA 4HVGA 3TTJA 2IZRA 1OB3A 1H00A 4YZCA 3VRYA 3VS2A 4AOTA 5AP2A 1H0WA 3FEGA 3DS6A 4FV7A 2XH5A 1OKZA 2PSQA 1URWA 3PJCA 3ZRKA 3GFEA 3ZSGA 1G8SA 1XBCA 2QURA 3CGOA 3PXYA 4RZVA 4PX6A 2A2AA 3AG9A 3RI1A 3Q2JA 5JSMA 1OL2A 3FMKA 3KY2A 4AQCA 3ORIA 4EH4A 2JLDA 3ANQA 4I23A 1WBVA 4D28A 5IA0A 1U4DA 3R6XA 1TVOA 4MF0A 4C57A 4NM5A 3AMAA 3P7BA 3QD0A 3HMIA 4E7WA 1JAMA 1AQ1A 4YR8A 1Q99A 4JQ8A 4BHNA 1ZYLA 3HA8A 2ZB0A 3SXFA 5L2WA 5EHOA 4EBVA 3DGKA 2LGCA 5DT4A 5C03A 1H1QA 2XKEA 4PWNA 5CVHA 2WHBA 4R1VA 1F3MC 4RWJA 4U7ZA 4BDIA 5A4CA 1H01A 4QP9A 4IW0A 1W7HA 1GJOA 3FMMA 4YC6A 5L6OA 2PYWA 4YSMA 2VTNA 3C5UA 3EQDA 5JMSA 3NMUF 1L3RE 2WIPA 2ITWA 4TYHB 3T3UA 3CKWA 4PL4A 3VO3A 3KVWA 3FMHA 1DI8A 3C7QA 4ZJIA 4ZXTA 1M2RA 2F49A 2IW9A 4DEBA 1JWHA 4FNWA 3CGFA 4IAZA 4KS8A 4QP2A 5FM3A 2J0MB 4NZWB 4O6EA 4TNDA 5DR9A 2UVZA 1BL7A 3SG8A 3WF6A 1OBDA 3BEAA 4WUAA 3FMLA 5DHJA 2I0EA 4F0IA 3Q2MA 2VGOA 4EOLA 2PL0A 5DH3A 3W8LA 5E91A 4Z7GA 4GFMA 1P5EA 5TOZA 1JKKA 1IA8A 4N4SA 5IA1A 3GUBA 3OT8A 4EOJA 4C4JA 3PP0A 5IG1A 4RC3A 5CENA 5EM8A 2BZIB 3JVRA 1CDKA 2ETRA 4HNFA 3PA3A 3QLFA 2WMAA 2ZDTA 2C0TA 4BBMA 2Q0BA 3DB8A 1XBAA 4DCAA 3ORTA 1Q8TA 3DKGA 4GW8A 2IVSA 1YRPA 3QTUA 4BDBA 4F9WA 5AAGA 5FD2A 4O86A 3FXWA 4BCNA 1URCA 3EQGA 1CKPA 4M84A 4U42A 5ETIA 5HBHA 4ZSAA 2QOLA 4IAFA 4QNAA 3FPQA 3ZUTA 4DGOA 3QZHA 4GVAA 2WMXA 4WG4A 4UYAA 4BDFA 4DEGA 5JT2A 5DYJA 4ZZNA 4I94A 2C47A 4JBQA 3V04A 3ATTA 3A60A 3OS3A 5CU2A 5E8YA 1VZOA 2B9FA 2W9ZB 3OEZA 3G6HA 4RFZA 2E9UA 2QOHA 3NWWA 4I4FA 4WNMA 3IQ7A 3RAIA 4HVDA 4GT3A 1BMKA 2QODA 4BTJA 5F4NA 3U4UA 4EC9A 4EHEA 5LJJA 4EOPA 4IC8A 4ITJA 2RFEA 3FSFA 4O27B 4C36A 2BIKB 1SYKA 4ZY4A 5M09A 3EQCA 4O0YA 5HG9A 1A48A 3QTRA 4AGCA 5H8GA 5EW9A 3LCKA 3BKBA 3WOWA 4AE6A 3UQCA 1PF8A 3QTXA 3R0TA 3VS1A 4BCOA 3UDBA 4FV3A 4FSQA 3R9OA 3D9VA 4YHFA 4BDHA 2XP2A 2R2PA 4C58A 5M4CA 4XG2A 3PFQA 5AR3A 1KUTA 3R73A 3UPZA 1IG1A 2XF0A 4E73A 2ERZE 3IOKA 4FKQA 4WRGA 4Q9ZA 1BX6A 4FKUA 3IONA 3UP7A 3RTPA 4YMJA 2GS7A 2QOCA 1T45A 2YCRA 4DBXA 3TKIA 3LFEA 3BU3A 3LMHA 3O96A 3EQRA 1Q4LA 2UZWE 2YDIA 4OBPA 3OD6X 4X2NA 3V5WA 3SXSA 4DFUA 4LOQA 4AZVA 1QPJA 4GG7A 3LE6A 2W1ZA 4S2ZA 3HVCA 3NR9A 2PZ5A 2W0JA 4IWDA 4QO9A 4EQCA 3OXIA 4BGGA 4TL0A 4NFMA 3WZUA 3QYWA 3S1HA 3SC1A 5JFSA 3G5DA 3VNTA 3HRBA 2JIUA 4FKRA 3AD6A 1H07A 3BCEA 3GCQA 3P78A 3BGPA 4HGSA 4HYHA 4JAIA 1DAWA 4AN3A 2VO0A 1OKWA 2VD5A 3DV3A 4HOKA 3EQPA 3LXNA 3R7GA 4IH8A 4YSJA 3UO5A 3HV3A 5FXSA 2FH9A 4C3RA 4BWKA 5FXQA 4MD8E 5LMKA 4E5WA 4DEIA 4CZTA 3ITZA 3QCSA 4MNEB 3LW0A 4OTFA 3CXWA 2C4GA 2X8IA 4H3BA 1YWRA 4S31A 3FQEA 4NUSA 5GJFA 3NW6A 2C5OA 4G6LA 3GVUA 2PVJA 4D2SA 5A6NA 4FKOA 2BUJA 2EXEA 2RFNA 2VTJA 3M11A 4FIHA 2CGXA 2YWVA 4IWOA 4FEQA 4PV0A 4CZYB 4F70A 2HCKA 4QMUA 3V01A 2HIWA 3IGOA 4Z9LA 5EI8A 3W2QA 3QX4A 5I0BA 5H3QA 5DFPA 4GYIA 2YHVA 3U9NA 3GT8A 4YJTA 4FTTA 4CV8A 2IZUA 3QQJA 2W1IA 5ETCA 3MSSA 3OTVA 4FL1A 4FIEA 3IOPA 3LXPA 4C34A 4W9WA 4UEUA 2W1FA 3IKAA 3FL5A 4H39A 4RJ4A 1OL7A 2OO8X 1ZOEA 4ZSEA 3HLLA 3MTLA 2QOIA 4M0ZA 2DQ7X 2OIBA 3KF4A 3A4PA 3VVHA 1O6YA 2W1HA 2WAJA 4F6WA 3DPKA 4DFLA 5IQIA 1T46A 3O0GA 3S00A 1BYGA 2C3JA 2RKUA 3PSDA 3M2WA 3ORKA 5E1SA 3R02A 1OVEA 3LCTA 4L6QA 4WO5A 4A07A 2G2FA 3MA6A 2UW9A 2XNEA 3VUGA 1Q97A 5CAQA 1JPAA 5AUWA 4UX9A 2W17A 3FQSA 4Q5EA 4EI4A 4ZJVA 1UWHA 4FTCA 1I44A 2JFMA 4PNIA 2BFXA 3FZTA 1P4OA 3KRXA 4YTHA 5CY3A 3DLZA 4O96A 1RDQE 4TYJA 4PMTA 4FZ7A 2WO6A 4DGLC 4Z55A 4MXYA 4EH7A 4FV4A 2G15A 3VF9A 3BE2A 4XRLA 4QTEA 2ZOQA 4KIQA
chains in the Genus database with same CATH superfamily
3UDSA 4DLIA 3VQHA 3DJ5A 4X2GA 2UZNA 3F66A 2VO6A 4O4BB 5CXHA 4ZY6A 5C8KA 2R3GA 3AD5A 3CTQA 2ZB1A 3F5GA 3ZBFA 3BLAA 4AX8A 4IVAA 3SQQA 5LMBA 3IGGA 3OOGA 3QTWA 4UWYA 1OZ1A 4UN0C 5HX8A 5AADA 5TR6A 4DG3E 5LVPA 4M0YA 3KVXA 2O65A 5IA2A 1Y57A 4FC0A 3ALNA 5D7VA 1STCE 2UZVA 5I9YA 3PVBA 2FSTX 3TG1A 5DR6A 2ITNA 3D2IA 4JMQA 3W2PA 2DUVA 3KXXA 4APPA 5L6PA 2R3FA 2X7GA 2QOKA 3E93A 4L3PA 4DTBA 2QOBA 5FM2A 2AYPA 5EHYA 1LPUA 2H34A 4X3FA 5CLPA 5IPJA 1YVJA 4QQCA 3COKA 4JDKA 1NVSA 2R9SA 3DKCA 4QTAA 5FTGA 4PDSA 5J9LA 3QLGA 4OTHA 3NNXA 3NW7A 1S9JA 2J51A 2GS2A 2X2LA 2XEYA 3O8PA 4BF2A 5HHWA 5AV1A 3QA8A 3K5VA 3O8UA 4O2PA 3LZBA 3B2WA 3OBJA 4G3CA 4FKPA 5M55A 4YTCA 4ANMA 5AP5A 4FE2A 4YHTA 1FINA 1ZYSA 2ITTA 3OC1A 2JEDA 3RPRA 2VUWA 3TEIA 4FNYA 3VS5A 4ENXA 3FXXA 1ZZLA 2X7FA 4DHJA 3FLNC 2CDZA 3NAXA 5KNJA 3HL7A 1YXSA 3ORLA 3O2MA 4II5A 1OIRA 4L3LA 4MTAA 3ZM9A 5B7VA 2NRYA 3DAKA 5BVDA 1J7UA 4O4EA 3Q96A 2VTHA 2WOTA 4AG8A 2AC5A 3A99A 3OWJA 4P5QA 4A9UA 5IQDA 4RQVA 4TKSA 4XRJA 4MXAA 4U5JA 3TZ8A 1GIIA 1U54A 2XCKA 3UYTA 2YIRA 5D10A 3R63A 3JUHA 5E1EA 3R9DA 4L3JA 4QP3A 4U3ZA 3OROA 2UZUE 3IECA 5L8KA 4R7HA 3DBDA 3FQHA 1JSTA 1U5RA 3PXFA 5CF4A 3RCDA 3G2FA 2JDTA 2XEZA 4BBFA 2R3MA 3HYHA 4RJ6A 1GNGA 3TJCA 4QP6A 4N57A 4IB0A 5IQCA 1CKIA 2W96B 3OF0A 2QLUA 4J8NA 5HO7A 1Q8WA 1OUYA 1PXLA 1ZAOA 1ZYCA 2CGWA 3EL7A 3F88A 3NW5A 2WTVA 3G0FA 3HRFA 4GU6A 4EKKA 5KKRB 4AXDA 4IACA 4EOKA 2UW6A 4H3QA 4I5MA 4RGJA 1PKGA 2GNIA 4FEVA 3L8SA 4ZP5A 3OXZA 3AD4A 4OBQA 2PZIA 3E62A 3I6WA 3PVWA 4Y85A 4IB1A 2OBJA 2W4OA 3EWHA 3JYAA 3QX2A 2BRNA 2H9VA 4RA4A 4RIOA 4X6RA 5G6VA 4GUBA 4C02A 2O5KA 4G5PA 4PMPA 4X6QC 5E90A 3FZSA 1OUKA 4YJOA 4J53A 3G90X 4D55A 3EJ1A 2IVUA 1M52A 2IZSA 3EQFA 3FBVA 4RFMA 3BWJA 2PHKA 4KRDA 4ZTLA 4Q9SA 5C4KA 1UU9A 1JKTA 3ODZX 4XJ0A 5J9ZA 2GQGA 3PPJA 2BRMA 2ZM4A 3LJ2A 4P2KA 4YJPA 5DGZA 5BVWA 2RF9A 4MBJA 3RM7A 3NGAA 5DT0A 3RM6A 3WI6A 5K9IA 4GEOA 4AW2A 4I5HA 4J1RA 2B9IA 3A61A 4XG7A 1YQJA 3KFAA 4UMTA 3P7CA 4G6OA 5CQUA 4ZTNA 5AX9A 2JAMA 3EFJA 3LFBA 1WBNA 1S9IA 3I6UA 2FSOX 3NYXA 4FA2A 3BHTA 3ULZA 4G31A 3NCZA 3KRJA 4F09A 5IU2A 1PKDA 4EOMA 3Q9YA 2O3PA 4AFJA 3DLSA 3QRKA 5IQGA 2BILB 3A7IA 1PY5A 3EYGA 4LI5A 1OIYA 2OG8A 4LM5A 4TWNA 5JRSA 3RAKA 4FYNA 4A9RA 4C2WA 4BVUA 4KB8A 2WMRA 2RSVA 4CQEA 4FEXA 5IQBA 3MA3A 5IZFA 2W1EA 1X8BA 4C61A 1NW1A 5EDQA 5A9UA 4WG3A 4O22A 2ACXA 1GZNA 5FEQA 4IDTA 2UZEA 3E7OA 4EK5A 5D9HA 5AUVA 3AT3A 3CQUA 5EI2A 3QQFA 2CJMA 1WBPA 4AFEA 3I5NA 4O21A 4R1YA 5A46A 4KABA 3FHRA 4KWPA 3MWUA 4D1SA 4FTJA 1UKHA 1OL6A 2YIQA 5LMKC 3DXPA 3RJCA 3LM5A 3RPVA 3KRRA 4KINA 1OMWA 4G16A 2O63A 4CFXA 3HV7A 4IIRA 5DOSA 3ZLXA 1GIJA 3BHYA 3G9NA 1WCCA 2CN8A 5EQYA 5EYMA 4IM2A 2UVYA 3PWDA 2C5VA 2WTKB 2W5HA 4AW1A 3DBEA 3NZ0A 4AF3A 2ZV8A 4ALVA 3A7FA 2OFVA 2WMUA 1QPEA 3AC1A 1SNUA 4C38A 3QTQA 2PVKA 3RCJA 3FUPA 3VBTA 4ENYA 5M57A 4GH2A 2OJGA 3Q60A 4DEEA 4IB3A 3UIUA 2R3OA 4BDDA 3E63A 3F2RA 1O9UA 2J6MA 3PY0A 2VTQA 1PHKA 4FYOA 3GFWA 2B4SB 1GAGA 3ZFMA 4QP7A 4PDYA 4LFIA 5EFQA 3W2CA 4F78A 3OCGA 4B8MA 4RWKA 4JDIA 2PMIA 3G51A 2EB2A 4FSZA 3VUIA 4IX5A 4EQUA 3ZHPC 5CI7A 2RGPA 4YJUA 3QRUA 3DFAA 5ANDA 2ZVAA 3BHHA 4MYGA 4AT5A 3ZBXA 1JKLA 4AXAA 4C8BA 5EH0A 1XH9A 3KGAA 4KIKA 5B2KA 4YHJA 4IE9A 5EHLA 4EWQA 2OZAB 2WTCA 3VIDA 3KULA 5HBEA 1WBSA 4B9DA 4K2RA 4CEGA 4MEDA 4AP7A 5IEVA 4BJJA 4U81A 3V3VA 3SRVA 4GT4A 5L8LA 4ZIMA 3B2TA 5IQAA 4CKRA 3U6JA 4OBOA 1H1RA 3H9OA 3SDJA 5EDPA 2P4IA 3V6SA 4KKEA 5I9XA 4FV2A 4BYIA 4KA3A 3EQIA 5L2TA 4KUJA 2QI8A 2V5QA 3ZLSA 3KIOC 3O51A 3KKVA 5I4NA 2UZTA 1IEPA 1OKVA 3OWLA 2Y4IC 2CCIA 4E26A 5CTPA 3C4EA 1LR4A 2R3LA 4K8AA 3NUSA 5J95A 1QMZA 2ZV9A 3MY5A 4O38A 2XNGA 4XLVA 4BC6A 1W0XC 4KRCA 3AGLA 2CHLA 1JQHA 3D0EA 5EDRA 3R1QA 3SOAA 3BU6A 4WG5A 4D58A 4QYEA 4EORA 1UU3A 4M69A 4OTRA 3RNYA 1U46A 1KE6A 3Q52A 5FRIA 1WVXA 2WTJA 5EQPA 2CN5A 2WQNA 3W0NA 3NS9A 2Y4PA 3NUYA 4NSTA 3PXZA 1ZARA 5CSHA 4C4HA 4PY1A 4XV1A 4IHPA 1H4LA 2OKRA 4M66A 3WZEA 3DNEA 4EUUA 2JC6A 3HV5A 4BIEA 3ML1A 2CNQA 3QKKA 3I5ZA 4QEBA 4MD9E 3FMEA 2VAGA 3TNWA 5I9ZA 3BGQA 2RFDA 5CSPA 2X8EA 3KMWA 3FI2A 4DHIB 3PRIA 4X3FC 4RWLA 3FXZA 4DGGA 4RIYA 4UB7A 4GVJA 3UOHA 2C69A 4YO4A 4BDEA 2RG5A 3I7BA 3CQWA 4RIXB 4HW7A 3HMMA 4JBVA 4FKJA 3PY1A 5TE0A 4L46A 5J7HA 4KSPA 4E6QA 3LFAA 1H24A 3TKUA 1SMHA 1QPCA 3NSZA 3LFNA 4NJ3A 5ETFA 5DRBA 4AGUA 2CKOA 3FI4A 3DK3A 3W16A 2X81A 3LKMA 3PP1A 4QOXA 5AFVA 3ZO4A 2FA2A 2VWIA 5ANOA 5HQ0A 3N4VA 4GK3A 3KK9A 4DGNA 3EQHA 3LMGA 4AT3A 3UE4A 5A6OA 3W8QA 4EH2A 5M4FA 2PVMA 3K54A 2JITA 4M7IA 5CYIA 2IPXA 3FZPA 2VGPA 3NX8A 1MUOA 3HGKA 2BTRA 4BI0A 1O6KA 4FR4A 3ZDUA 2RG6A 3F82A 4I0SA 5E8WA 3UIXA 4F9AA 4G9RA 4I6QA 5BQ0A 3D7TB 4WNKA 4OAVB 4DT9A 5FUTA 5EQEA 3F3WA 2ITZA 4NM0A 3QAME 4YJSA 2B9JA 3QL8A 4ZLYA 3MH2A 4FV9A 3WYXA 4W4YA 3TDWA 3P0MA 5CZIA 2WMTA 3L8XA 4FK3A 3RINA 5ACKA 2QD9A 3EN7A 4Y8DA 1PMNA 5K5NA 5K3YA 2ESMA 2E9PA 3PE1A 1FPUA 5LCJA 2QU6A 3RK9A 3RWPA 3Q9ZA 5GIPE 4D5KA 4RX9A 2P3GX 4K1BA 4OT5A 4DDGA 3NNUA 4E6DA 4PDOA 4QYFA 2V55A 1Y8YA 5KCVA 3ZRMA 3FMNA 2QR8A 4NEUA 4PTGA 2RIOA 3F7ZA 3P1AA 3EYHA 4IZ7A 3T9TA 2A19B 3PG1A 3TNQB 4IMYA 4UMUA 3IK3A 3EN5A 3KXMA 2BMCA 3IG7A 2R4BA 2GNJA 4C0TA 4O7SA 1FMOE 5BVNA 5H8BA 3COMA 4LRKA 3C4XA 4BRXA 1HOWA 1JSUA 2PVRA 4EH5A 1ZWSA 4O91A 4X3JA 3SAYA 3QQHA 3UODA 3VN9A 1MRUA 3R30A 5CX9A 4EJNA 3P9JA 3F5PA 4M14A 4L44A 2XYUA 2JGZA 3C4CA 2YWPA 1WFCA 4R5YA 3BYMA 3NLBA 4ZZMA 4G17A 5T68A 4OR5A 3I81A 4U6RA 5L3AA 4TZRA 2BHHA 3QQKA 1DAYA 3P86A 2A1AB 4RIWB 4TT7A 4EONA 4I6FA 3RKBA 4MBIA 4W9XA 4QTBA 4AGWA 4EZ7A 2Z7SA 1PYEA 3BLQA 3F3UA 4LOPA 4FUXA 4R3PA 4UMRA 1E1XA 3MVHA 2FUMA 4USFA 4JR7A 2WGJA 3C0IA 4KBCA 2GU8A 3DAJA 4YJNA 3K5UA 4CKJA 4ALWA 2VTOA 1XH7A 3TDVA 4L00A 5HNGA 4FOCA 3LVPA 5FDPA 3BBTB 2PZPA 2ZMCA 3FZ1A 2BRHA 3CCNA 5AR7A 3RPYA 5JZJA 3OG7A 4NKSA 3QYZA 5HLPA 2OFUA 5KZ0A 4BZNA 4BY9E 4QPSA 3MIYA 3JY9A 4OW8A 3ZO2A 4DLJA 3PJ8A 2CLQA 2XJ1A 2O8YA 3BWFA 4J99A 4JBOA 2YIXA 3QD4A 3PZEA 3QCXA 3R9HA 5DMZA 3KN6A 3O5AA 4DT8A 3PXKA 2J0JA 2Y6MA 3D5VA 1KV1A 5HLWA 3R7YA 3Q32A 4N6ZA 3R8ZA 2OW3A 1TQPA 3C4ZA 4M67A 1PJKA 4G3GA 5C8NA 1SNXA 4GJ2A 3WARA 5LXMA 4KSQA 2O2UA 4L45A 3C51A 4D9TA 3RZBA 2QONA 5BNJA 3BZ3A 2Z2WA 2XK6A 4EKLA 1WZYA 5CEPA 3BYVA 2EU9A 3BI6A 3ZFXA 4BGHA 3S0OA 2I0VA 3IW7A 1ZYDA 2BAKA 2RL5A 3N4TA 4APCA 4HNIA 3LQ5A 3TMOA 4FTUA 2WMWA 4YO6A 5FEDA 3HNGA 3RGFA 2CKQA 5JZNA 2B1PA 4RG0A 5H8EA 4P7EA 4D1ZA 1F0QA 4Y95A 4HPTE 2UZOA 3QWJA 5ETAA 1NVRA 1R1WA 1M7QA 3ZC6A 3COIA 4DFYA 2W99B 3QZFA 2PVFA 5GINE 4NT4A 4OTIA 3ZU7A 1GZKA 1WBWA 3QTIA 4CFVA 1P14A 3PLSA 2XRWA 1V1KA 4GG5A 3QRTA 4IJPA 4J71A 4K9YA 4XV9A 4FV8A 5CNOA 2XBAA 1CTPE 4KBAA 2R3NA 3FKNA 2OZOA 3V8SA 4F1OA 4AXFA 4WHZA 1YXXA 3NNVA 4BR3A 3ZLWA 4F7SA 4CV9A 4AUAA 4IB5A 3QBNA 3DFCB 2QHNA 2VN9A 4MF1A 4YURA 2IEWA 4WSQA 3FC2A 5CSVA 5CF8A 1APME 3PTGA 3GC8A 5J1VA 2R3QA 4MWHA 2BVAA 5EYCA 1YKRA 2GFSA 4U45A 4U44A 1YHVA 1SM2A 5KMLA 5IQFA 1ZMWA 3VBWA 3A2CA 5F95A 5H9BA 5FWKK 2JIVA 2XA4A 3TNPC 2BZKB 2WNTA 1ZOGA 2W06A 4JOAA 5FLFA 2J0LA 1NXKA 3EZRA 2YIYA 3GCPA 4RA5A 2WU7A 4FT0A 3U51A 4BZDA 4RC2A 1Q41A 4JT3A 2XNBA 5KBRA 4EYMA 3LCSA 4I22A 2XNPA 3KEXA 2VWUA 3NUPA 2ITUA 2FYSA 3CP9A 2YCFA 4JNWA 4U79A 4CFMA 4AT4A 3CY3A 2YM8A 2W1GA 3GBZA 5GJDA 4EQMA 5HX6A 4NJDA 3L9PA 3DT1A 4C37A 3WIKA 4WNPA 5AV4A 4KIOA 5JFXA 3H9RA 4F9CA 2GS6A 2C6MA 4WUNA 2LAVA 4D2RA 3WZKA 2R0IA 4ZTRA 1PXJA 4FSUA 4U97A 4F08A 3O8TA 3D7ZA 3QTZA 4NIFA 4V0GB 4Y73A 4CT2A 4D4SA 5LOHA 3CTJA 5A3XA 1MRYA 2FVDA 2X6EA 4I6LA 4P90A 5CAOA 1MRVA 4IJ9A 2P2IA 4RVKA 5CU4A 3CS9A 4QTCA 1M2QA 4ID7A 4O1OA 5AUYA 4CFFA 5GZAA 1QL6A 5LCKA 2DS1A 5ACBC 4W4VA 3BYUA 5HG7A 2ZFYA 2JKMA 3ORZA 2VTRA 3TZ7A 5TO8A 3DTCA 2BKZA 3CKXA 4IADA 5F1ZA 3KL8A 3UQFA 3V8TA 4H58A 4TW9A 5AA9A 2BR1A 3QFVA 4O4FA 1M14A 1W2FA 3CJGA 3HUBA 4GU9A 5HD7A 3V8WA 3EN6A 2IO6A 3LMIA 2YZAA 2BIYA 1V0PA 2HZNA 1BL6A 2WMVA 3MY0A 3HAVA 1O6LA 4H05A 1OKYA 5HE2A 5LMAA 4WKQA 3POOA 2XIZA 2XAMA 2XANA 4GIIA 3AC4A 5M4UA 4R7IA 2UUEA 2OK1A 3CR0A 4M97A 1LEWA 2P55A 3Q4ZA 4DF3A 5DE2A 5A54A 3E64A 5M06A 2CSNA 4HGEA 5JGAA 4MH7A 4FKIA 4IVDA 4FZAB 3BEGA 4I4EA 2G2IA 4JIAA 2P2HA 3BQCA 3TT0A 5KMIA 4IQ6A 1BLXA 2WXVA 2XBJA 1E9HA 2W5AA 5CASA 4DG2E 1PXMA 4MKCA 5EM7A 4LGHA 5BVOA 2QG5A 3CSVA 2C0OA 2VWBA 5F94A 2IN6A 5EW8A 4O0SA 4NCTA 1RJBA 1REJA 3Q04A 4ZTMA 4FV0A 3FY2A 4AU8A 3G6GA 3C5IA 1DI9A 3TUCA 4FTQA 4UWCA 4X7QA 1W98A 3R00A 5HESA 1FOTA 4TYEA 3COHA 3QD2B 3R8MA 4FL3A 3WF7A 3QKMA 3HV6A 1J7IA 3AC8A 3MW1A 1CM8A 3UO6A 4AAYA 4BL1A 5IQEA 4IAIA 5BYYA 4GK2A 2GTMA 1B38A 4HYUA 3SX9A 4ZTSA 2X6DA 3RHKA 4S32A 4I3ZA 5KZIA 3ROCA 4O7TA 3H10A 4FODA 4BCPA 4AZFA 2UZLA 5AIKA 4BYJA 1R39A 1BKXA 2XVDA 5KE0A 3FKLA 2VNWA 2R0UA 4EH3A 5AAEA 4XBUA 4FGRA 4LUEA 3H3CA 1FGKA 4FG9A 4M12A 3VF8A 3VUMA 5KHXA 3E3PA 2GHMA 2C1AA 3T8OA 3S95A 4C2VA 4BIBA 2XALA 4DTAA 3Q9WA 5J5TA 5DA3A 4FKGA 5CT7A 2BAJA 1J3HA 1RQQA 1Z9XA 2YERA 4IX6A 3TWJA 5AR2A 4HVIA 2P33A 4FK6A 3MB7A 4QYHA 4ZMEA 4FT3A 4MD7E 5BV3A 3R9RA 2JKKA 4XP0A 5M4IA 3V5LA 4B7TA 3SW4A 1W83A 4CFWA 4I21A 3HMPA 3F2AA 4QMTA 2PTKA 4IAAA 5AUUA 3OWPA 3PA4A 4JXFA 3D15A 3EKNA 3NPCA 3QRIA 5FBNC 1WAKA 2JDOA 3II5A 4FVQA 4D2WA 3MTFA 3P23A 3DAEA 5JFVA 1OIQA 3FPMA 4M8TA 3PIZA 3A7HA 3BV3A 4LGGA 4BFMA 4D2PA 3CD3A 1ZZ2A 2PU8A 4FZFB 2YITA 3RHXA 3QUDA 5K0XA 3ZSIA 2XNOA 4F4PA 4WD5A 1P4FA 4FIGA 1YDTE 2X1NA 4FVPA 4CXAA 4FKLA 4AE9A 3ZSHA 2G2HA 4HGLA 4L42A 2XK4A 4QMNA 3BLHA 4QMLA 4D2TA 3SLSA 3NFGB 4DFBA 3UG2A 3NNWA 5L2SA 4L53A 4UWBA 4YPSA 5LVLA 5E92A 5HE1A 2YM4A 2B9HA 4D0WA 5GHVA 2GQRA 2G9XA 4PTCA 3A62A 3JR1A 2VZ6A 2R3KA 3VJNA 3MDYA 2C5YA 3D5UA 3W2OA 4EHZA 5IF1A 3SVVA 2BAQA 4AN2A 4O7YA 2XM9A 1PYXA 4F1TA 2E2BA 3Q6UA 4ACMA 4YBJA 1L8TA 3OUNB 4BCGA 3O50A 1VYWA 4MWIA 5DVRA 4D5HA 4YLJA 3A8XA 4TWPA 4CMOA 2XK8A 4QMQA 1XMLA 4I1ZA 4FTMA 3UBDA 3FLYA 2ZM1A 1Y6AA 3MIAA 5L6WL 3CE3A 4R7BA 3UVQA 2VTTA 3MVJA 4USEA 2OJIA 3NDMA 4BGQA 1KE5A 4LL5A 3QCYA 4LMNA 5C27A 1FMKA 2QHMA 5KMMA 4LV7A 5DBXA 4PRJA 4DH8A 2B7AA 1ST0A 2QNJA 3E7VA 2W4KA 3VHEA 4DEDA 5AP7A 4CTCA 3HDMA 3R1SA 4GKIA 2C3LA 4PP7A 3W1FA 3MPAA 3OZ6A 4ZEGA 2Q0NA 4GIHA 4QMXA 5BVEA 4AGDA 4I93A 5IEXA 4FTLA 1UNHA 4CKIA 1YWNA 1XWSA 3UGCA 4E6AA 1Q5KA 4WNOA 5E8SA 5ANGA 2HZ0A 4XV2A 4J7BA 1YOLA 4HYIA 5JEBA 3KREA 2QOQA 3KRWA 3FC1X 4O1PA 5K0KA 3GQIA 5HVKA 2IJMA 3FI3A 4S34A 5GZ9A 4BCQA 3DQWA 1W84A 3RMFA 3MJ1A 2ONLA 4QMYA 4DC2A 2Y0AA 2YAAA 3MFRA 3P08A 3CLYA 4MQ1A 2BZJA 2R3IA 4QMVA 5CU0A 2GNFA 3VRZA 4CGAA 1H28A 4G34A 3MH0A 3R22A 2PE0A 3PXRA 2WEVA 1ERKA 3A7JA 4JX7A 5J5SA 3CJFA 4UMQA 3ET7A 3NCGA 4YBKA 2C6TA 1W82A 4FKWA 5HIEA 2QLQA 3IDCA 4QMOA 3R01A 4WSYA 3SOCA 4YNOA 2BHEA 4DFNA 1B39A 2ITXA 2ETKA 2UW0A 4E5AX 3PXQA 5CSWA 3QUPA 4EK3A 1H27A 5HO8A 4XYFA 2NP8A 2CGVA 3NUXA 2ITYA 1H26A 4QRCA 5DR2A 2XNNA 5FDXA 4L8MA 1NA7A 3JPVA 5EOBA 4CRLA 5KMKA 4JG7A 2I0YA 2I6LA 3E5AA 2JAVA 3I60A 3PVGA 4XG4A 4BKZA 2UVXA 4F1MA 2X9FA 3RP9A 4EZ3A 5IMEA 3ENMA 4IM3A 3N9XA 3ZDIA 4N6YA 3TACA 2CKPA 5EW3A 1DM2A 2OICA 4QMWA 2XCHA 3RPOA 3KQ7A 3JY0A 4H36A 3WZDA 3NFFB 3U55A 4LMUA 4I92A 1Q61A 5EI6A 5FBOA 1PXPA 4TWOA 4AN9A 4O82A 2VWYA 2YABA 3OTUA 3C9WA 5EM5A 4HPUE 2Z02A 1BI7A 5JQ5A 1UVRA 3CPBA 4FKSA 5CNNA 1DS5A 4UMPA 2GQSA 2E9VA 1XQZA 4HVSA 4RC4A 2OJJA 4O0VA 3ACKA 4ZSGA 4YZNA 2NO3A 4ASEA 3DZQA 3REPA 3U6HA 1PXKA 2HWPA 5EK7A 2F2CB 2OJFE 2IZTA 2YEXA 3DKFA 3OHTA 3SW7A 3PWYA 5AR4A 3QD3A 1ATPE 1IAHA 3ZLYA 4TN6A 3U87A 3LM0A 1B6CB 4E5BA 4FX3A 4ERKA 1KE8A 2EWAA 1MQBA 5CQWA 2J4ZA 4X2JA 5EOLA 1K2PA 3V5PA 2A0CX 5IH6A 1MQ4A 4WT6A 1OL1A 4NL0A 1VR2A 2OF2A 3VQUA 2GPHA 2JBOA 3RNIA 1KSWA 2P0CA 5C1QB 3EFWA 4NKAA 3DJ6A 3WF8A 2WMSA 3E92A 4ANQA 5J7BA 3VBVA 4CG9A 4EK6A 3R7UA 4L7SA 2CCHA 3DU8A 4X21A 4ZAUA 4QMSA 4K11A 3C50A 3VONA 2YM3A 3UIBA 3PJ1A 2B54A 4JVGA 1FBNA 2BTSA 4NH1A 4NCTC 4IVBA 4EWHA 5HU9A 3AGMA 3KN5A 4F7JA 5KX8A 3CBLA 5CEIA 2WQEA 3AKLA 3HA6A 5E7RA 3QF9A 4TRLA 3VUTA 3PY3A 3UNKA 3PZHA 4ACGA 4L7FA 2XIXA 4Q2AA 2UZBA 2XS0A 1GIHA 4MUQA 2QU5A 2YLEA 3RPSA 5A14A 2F7XE 3CEKA 2REIA 5ANKA 2XM8A 3L9MA 5ANIA 1YW2A 3N51A 4MXOA 2Q83A 3VUKA 4O7WA 4IZYA 4NYEA 2WTIA 2VRXA 4U8ZA 3O7LB 2FO0A 3W55A 4D1XA 2C0IA 3FHIA 4BDKA 1AD5A 3TZMA 4EHVA 5B2MA 5I3OA 4IM0A 2GMXA 3B8QA 4USDA 3V5JA 1TQMA 2R3JA 4EYJA 2VTIA 5AUXA 3GGFA 3UMXA 3R71A 3UVRA 1CMKE 1XO2B 2PE1A 2WKMA 2YM5A 4RRVA 2OI4X 4FNXA 4XHKB 1VYZA 4FT9A 1QCFA 4UBAA 1NT2A 1ZMUA 2H96A 4CG8A 3TV7A 3EQBA 4GL9A 4XLIA 1VEBA 4NM7A 5DWRA 3WE4A 3O17A 4C7TA 5IUHA 4FKTA 4ONAA 3SG9A 4DH1A 4V04A 4KKGA 4J96A 3E88A 1YDRE 2OJ9A 5LQFA 2B0QA 1LP4A 2R3PA 1W2DA 2JD5A 4HZRA 4AACA 4BDGA 4DG0E 1LUFA 1UA2A 1YOJA 3HX4A 3PE2A 5C4LA 3TNHA 2VU3A 4MXCA 1UU7A 4FRFA 4BHZA 3OMVA 3PJ3A 4DBNA 4F99A 1WVWA 4OTGA 4XG8A 3ZC5A 2Y9QA 5HG5A 3VBYA 2EXCX 5ICPA 4YC8A 2HENA 4HCTA 3JS2A 1UV5A 4W4XA 4RX7A 5M53A 2XKDA 2PMNX 1F5QA 3I1AA 5HVJA 3W0MA 4S33A 3FDNA 4A7CA 3GU6A 1SVHA 3LLAA 4EH6A 5AEPA 4C4IA 3FKOA 1K3AA 3L1SA 3UZTA 3SXRA 1OPKA 3RAHA 4KNBA 5E8UA 2Y4IB 4CQGA 4O7LA 3PRFA 4MNEA 4QD6A 3VUDA 3RWQA 4A9SA 4I0TA 5JKGA 3F5UA 4FTNA 4CVAA 3D94A 3VBQA 4YNEA 3RAWA 5L2QA 3KXNA 3BYOA 4U3YA 3LXLA 3A4OX 3VW8A 4I6BA 3KC3A 2WTDA 4AZWA 3FAAA 3KMUA 3LFDA 4F0GA 5FGKA 4EH8A 2GNHA 3BU5A 2J2IB 3QQUA 4R6VA 4O7NA 5KHWA 4RSSA 4F9YA 5AV3A 3E8DA 2QC6A 5FEEA 4DFXE 3CD8A 5M56A 5BX0A 3HMNA 4FSWA 4YC3A 5HTIA 1SVEA 1PMVA 3R28A 5E8VA 5L2IA 2I0HA 3MVMA 4PPAA 2R64A 2QOOA 2Z7QA 3DOGA 4JAJA 3ROYA 3PG3A 5DN3A 4GFOA 2HWOA 4X3FB 5IA3A 2XJ0A 3EL8A 5L8JA 3EKKA 4RWIA 4DE4A 1ZYJA 1ZXEA 2XUUA 4ASXA 2B52A 5LARA 3F9NA 3GU7A 3EZVA 4FZDB 4CMTA 1HCKA 3BV2A 2WFYA 4L43A 5AX3A 4IZAA 4FIFA 5IDNA 3TV6A 4WOVA 4DINA 4LYNA 2NRUA 3EHAA 5CU6A 3BHUA 4AA4A 3VS0A 4JDHA 3RK7A 5FP5A 4GCJA 3Q5IA 3IS5A 4EZ5A 4LG4A 2UW3A 4JQEA 3MH1A 3ZO1A 1GZ8A 2ONLC 3NVMB 1Z57A 1K9AA 4OUCA 3FSKA 4RMZA 1Y6BA 4CSVA 5GIOE 5CI6A 1ST4A 4JIKA 2HYYA 3UJGA 4YLKA 2VTLA 1U59A 3CTHA 3S2PA 1H1PA 4AXCA