3MH3A

Mutagenesis of p38 map kinase establishes key roles of phe169 in function and structural dynamics and reveals a novel dfg-out state
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
348
structure length
334
Chain Sequence
RPTFYRQELNKTIWEVPERYQNLSPVGSYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDRGLATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Mitogen-activated protein kinase 14
publication title Mutagenesis of p38alpha MAP kinase establishes key roles of Phe169 in function and structural dynamics and reveals a novel DFG-OUT state.
pubmed doi rcsb
source organism Homo sapiens
total genus 103
structure length 334
sequence length 348
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2010-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3mh3A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3mh3A01
4DINA 2Y4IC 4IJ9A 2YM5A 5EW9A 3QTIA 4EJNA 2LGCA 4YPDA 2HOGA 3R1NA 4ANLA 2BFYA 2OH4A 3EIDA 3OY3A 5AV0A 2R3PA 4ITIA 2Q83A 1OPKA 2PUUA 2V62A 4PMMA 5CZHA 5AP0A 3ZO1A 4H3BA 4CMUA 4F6WA 5I9ZA 5L2TA 2LAVA 3BELA 3NYVA 3CY2A 5FXSA 2ITPA 4F1OA 4ZTNA 3IW7A 5LWNA 4FZDB 3V01A 2GU8A 3F2NA 3WZUA 2RKUA 2PVNA 4QPSA 3G51A 3QTSA 3EFLA 4QPMA 5AEPA 4R78A 2GFCA 2W05A 3KXNA 5CSVA 3FPQA 4HVDA 1W8CA 1YXUA 3FXWA 4BY9E 3NCGA 3LCSA 3P78A 4KIKA 4L01A 4IAYA 2VWWA 4PUZA 3BGQA 1FVRA 3ORPA 1JQHA 4TPTA 3NYOA 1M2PA 2OZAB 5AUTA 1WMKA 5M07A 3AT3A 4CFWA 4JBVA 1E1VA 3C0IA 3SC1A 3KRXA 5FEEA 1XO2B 4GUBA 2QONA 1G3NA 4HZSA 4MXOA 3PXZA 2G2FA 2ITXA 4RSSA 3I79A 2WPAA 1R39A 1XH9A 5KZ0A 1PXMA 2YM8A 2WTDA 3HDNA 3R9RA 1VYZA 5B2MA 3QCYA 3WOWA 5J9ZA 2XIKA 2CGWA 3TV7A 4BGQA 3C13A 4PP9A 4EH7A 3L9PA 4EUUA 5HCYA 4NKSA 4EH6A 3OW4A 1OBDA 4NWMA 3ERKA 3FL4A 3NAYA 4PDSA 4AXAA 3GCVA 4NKAA 3VF9A 5AV2A 2H96A 5JFWA 2J90A 1OGUA 3QTXA 4QYFA 1RDQE 4BIDA 4FIJA 2VWZA 3CLYA 4W8EA 1OIRA 4XLIA 3WF8A 4DH8A 2O64A 3MGYA 5BUJA 1JWHA 2CKPA 3NMUF 3AC3A 5CANA 1HCLA 2Q0NA 1V0BA 4M0YA 4Y85A 3JY0A 4R8QA 1OI9A 1YI4A 3W32A 4FEXA 5E4HA 2FYSA 2HIWA 2O63A 4MAOA 3KRWA 4KRCA 4N6ZA 3E7VA 3QD0A 4RGJA 2X81A 4JVGA 3UO5A 4FI1A 4DEBA 4E6AA 2ZM1A 4FKSA 1UU8A 1T45A 4I22A 4FKIA 4NM5A 4KNBA 1WBWA 4M68A 1YHSA 1J1BA 3T3VA 5EKOA 3VBTA 3VUTA 2CGUA 2PE1A 4C2WA 3T3UA 3VIDA 3ZLXA 3PVUA 4UMTA 4ZEGA 4O96A 3NW6A 3R8MA 4A4OA 3CTHA 2VO6A 3HV4A 4FSYA 3OT3A 2A19B 2EXCX 3CEKA 4WSQA 3UGCA 4UMPA 3D0EA 1P4FA 1XKKA 4FV0A 4UYAA 3QALE 4QNAA 3UO4A 2BAQA 4FEUA 4EWQA 1CKJA 3VS4A 3UZPA 4YHFA 3UTOA 3QD4A 4EC8A 1YOJA 4FSMA 2GNHA 3IO7A 4IJPA 3Q96A 3PLAE 3R7OA 3U6JA 4LUDA 2BRMA 1DAYA 4J99A 4PPAA 3WF9A 4Z7HA 1UKIA 4HPUE 4PY1A 3ORIA 2NPQA 3QX4A 2HZNA 4C34A 4YZBA 2GQGA 4I5MA 4YJRA 4YJSA 5KHWA 4WBOA 4O22A 4X6QC 2W1HA 2XK3A 4C62A 4HVHA 4U8ZA 5JRQA 4KIPA 3CSVA 5I3OA 5JQ5A 4EH8A 3ZEPA 3DCVA 4F0GA 2QG5A 2C0TA 4E4NA 4WG4A 5K4JA 4MQ1A 3DGKA 2OW3A 5EW3A 2VTLA 2X8IA 5IEYA 4ZSLA 5I9XA 4TN6A 4O7SA 4AN9A 1S9JA 5ANIA 2VWUA 4GK3A 3DB6A 2KULA 5FGKA 4X3FC 2R3MA 4AACA 3RPOA 4LI5A 5E8YA 4HGLA 4JG8A 3KCKA 4O0RA 3PP0A 3G15A 2EU9A 4MEDA 3VN9A 1ZYDA 4ERKA 4JS8A 4OTDA 4IX6A 2QLQA 1TKIA 1GZ8A 4XV3A 4PP7A 1NY3A 4D9UA 4YURA 5CAOA 2QOKA 2CSNA 2YLEA 4GK2A 5IQAA 5EQEA 4J98A 3IS5A 2BRGA 1BUHA 4EH3A 4QMPA 3K5UA 2WMAA 4F1TA 4CG8A 4F7SA 1UU3A 3VS7A 3RALA 3W2OA 5AUZA 2CGXA 1YDTE 4JL9A 2JGZA 3PVBA 4ZJVA 4XG4A 5BNJA 2ZV2A 5CT0A 3PE2A 5AP6A 3FZOA 3DZOA 4TKSA 5L8JA 2B7AA 3V5WA 4FSRA 2OLCA 1YHWA 4IB5A 4RT7A 3RZFA 5IISA 3GQIA 4HNIA 4I21A 4KRDA 4V0GA 4E7WA 4H36A 4RIYA 5M53A 2ERZE 3RM7A 3FEGA 1VR2A 4FT7A 3IECA 4FSQA 3WYYA 3R02A 3H4JA 4QMOA 4AGWA 4J95A 1IAHA 3ALNA 1E1XA 3PTGA 1Z5MA 4EOJA 3W55A 4R3RA 4QP9A 1F0QA 1Q41A 5LCJA 2PYWA 1H1SA 4AUAA 2GDOA 3DJ5A 3I1AA 4BCOA 1M14A 4YLJA 1DI8A 4AFJA 2RG5A 2CKEA 2HXLA 1UV5A 4HPTE 4NIFB 3NYXA 2FH9A 3F3ZA 3Q5ZA 1ZOGA 4RC3A 5IA3A 1W7HA 2IZTA 2R64A 4XG7A 3TACA 1V0PA 4IWPA 4M13A 4TYHB 3O7LB 2XJ0A 5EI6A 4AS0A 3PYYA 1JSUA 5L4QA 4W9XA 5LQFA 4YZ9A 3UDBA 2BUJA 3AD4A 4FVRA 2HZIA 1OKVA 2W5AA 4WA9A 3L9MA 4M0ZA 5IDPA 3ZFXA 5CF6A 2P2IA 3BZ3A 3KK8A 2C5XA 1S9IA 4JR7A 4C02A 2JIVA 4FV9A 4OTRA 4IACA 1DI9A 2VWIA 3Q52A 4ZIMA 1DS5A 3GI3A 1OL2A 1WBTA 4D58A 2XJ1A 1KE6A 3E63A 4I93A 4OW8A 5D7VA 1QCFA 3OF0A 4BCGA 2Z7RA 4WNPA 2PMNX 3BU6A 2WU6A 3VC4A 2V5QA 2FA2A 4FNYA 4CSVA 5CAPA 4FMQA 5IH6A 4I6FA 3UVPA 1IR3A 3GFEA 2QKRA 2RGPA 2YITA 4ANBA 3GEQA 1JKSA 3QC9A 3ZRMA 5KCVA 4U40A 2IJMA 3CCNA 1W83A 4BKYA 2OIBA 3NEWA 4CV9A 4F0IA 2W5BA 4OAUC 2OJGA 4W9WA 3BE9A 3BHUA 5DHJA 4PPCA 3GU8A 3GFWA 3A4OX 4GRBA 2HW6A 3FLZA 4EKKA 4FICA 3UQCA 4XBUA 5CNNA 5JFSA 3LFDA 2WAJA 5AUWA 5LJJA 4IAIA 3SXSA 4DN5A 4FV8A 3SG9A 4AZVA 3VAPA 3HRCA 5FBOA 3E8EA 3L9NA 5L6WL 2OJIA 2WNTA 3S2PA 3O71A 4ANOA 4BVUA 3ATTA 3LJ1A 3KEXA 2ZYBA 3AXWA 3ELJA 4V05A 5J5SA 4U43A 5KZIA 4IQ6A 3CQWA 3QKMA 3NIZA 2XM8A 1WVYA 2HY0A 4KD1A 4R6VA 4Y5HA 5C26A 4GT3A 5TKDA 1JOWB 3FLQA 4RVKA 3ZO2A 4EOKA 1CKIA 3POZA 4YSJA 2BAJA 3F5PA 3OC1A 1H1QA 3QUEA 4QTAA 3CKWA 3FYJX 3A99A 4UEUA 3UMWA 4EOPA 4F9AA 3MPAA 5LMBA 2UW8A 1BX6A 4WRGA 4D1ZA 4IADA 5HU9A 3ETAA 2H9VA 5B0XA 3UIMA 2XKFA 4M69B 3C4ZA 4YSMA 2R9SA 4FKGA 2VWVA 2UW5A 3QC4A 3EMGA 2BMCA 3MVLA 3HX4A 3AC4A 3DFAA 2R3RA 1WFCA 4OBPA 1Q99A 3JVSA 3NUNA 4J53A 4FTCA 4RC4A 4YLKA 3EHAA 3UOHA 1OIUA 2QO7A 5JZJA 2VWYA 2R0IA 4IZAA 3DK6A 3II5A 4JQEA 5CLPA 2W17A 5E1SA 5EK7A 1XBCA 3OOMA 4JG7A 4AZSA 4BHNA 4JBPA 4V01A 4E20A 4ZJIA 3DK3A 3SDJA 3DAEA 1R3CA 3OUNB 4OUCA 3O7LD 5HNIX 4BDJA 3U9CA 4N57A 2QHMA 4FSNA 5DR9A 3HMIA 4BR3A 2F57A 3MH0A 5DT4A 5LVLA 4O7WA 4IW0A 3IW8A 4RIOA 4NH1A 5AM6A 4FZ6A 3ACKA 4G3GA 3HV5A 2E9UA 1PXKA 3QUDA 5E8XA 5GJGA 5GNKA 5BVWA 4G2FA 5CF5A 1GZNA 1OPJA 2ACXA 3N4UA 4B9DA 3C50A 3IPHA 3DLZA 4FVQA 4CEGA 5KMLA 4DEGA 5DGZA 1YRPA 2ETMA 3QBNA 3E5AA 4LMUA 4EBVA 3V04A 2OJFE 2JAMA 3QHWA 4TYGA 5HG9A 4CYIA 4EK5A 2GFSA 4XCUA 5HD7A 4ORKA 4MKCA 5I3RA 3NUSA 4E73A 4RWIA 4QMVA 4I6QA 1IG1A 4R3CA 3ZMMA 2ZM4A 3NLBA 2YJSA 4PMTA 5HD4A 3D94A 3QKKA 4DTAA 1APME 5AX9A 2GMXA 4IZYA 2ZV9A 3EZVA 4ZY4A 1UNLA 3BE2A 4FKOA 3SOAA 2VO3A 5DRDA 3U51A 2OXXA 4QTDA 4NYEA 4BC6A 3MFRA 4XP3A 1JKKA 4I0TA 4JDKA 3FI2A 3OOGA 4WRSA 3VHKA 3I7CA 3P23A 5IF1A 3TEIA 2ZV7A 2HK5A 4L53A 2WMRA 3O96A 4GG5A 4BDEA 1U5RA 2XMYA 5HE2A 5AR3A 4FT3A 4O0TA 1RE8A 1KOAA 4FZ7A 4PRJA 4Z9LA 4ASEA 4YC3A 4UY9A 5EDQA 5A4LA 3I60A 3VRYA 2J0LA 3BEAA 3BCEA 4NFMA 5DPVA 5BMMA 3AQVA 2XJ2A 1Q62A 3ET7A 4KIQA 3FQEA 4OTIA 3SW7A 4GK4A 4R1VA 1YW2A 2C0IA 5FXRA 2WOTA 3CD3A 2B9HA 3MB7A 4BWPA 5M4IA 4WNOA 3E92A 3AMYA 3R7EA 3TM0A 3DKCA 4CCBA 4RX5A 4X3FA 5BVKA 5EI2A 2F7EE 4I5CA 2W4JA 4ASDA 3NS9A 1QL6A 2QO2A 3ZXZA 5CU3A 4C3PA 3FMDA 2QU6A 5A3XA 1R1WA 3RK5A 4ACDA 4D1XA 2YZLA 3OHTA 2UZWE 4QQCA 5EHYA 1F5QA 2ITZA 3NVMB 3GC8A 2DWBA 4XP0A 3ZOSA 2BHHA 3DBFA 3TKIA 4FBXA 3H0YA 2H8HA 2R2PA 3HYHA 5M4FA 3D5XA 4QPAA 5I9YA 4DF3A 4FTUA 1BL6A 4IM2A 5HEZA 2QOIA 2QVSE 4OTHA 5IEVA 4P5ZA 4AOJA 4EK4A 1NVSA 4O1PA 2JKMA 5JKGA 2WEIA 4RX9A 3DT1A 4FGBA 4MXYA 3UOKA 4D1SA 3U8WA 1ZYCA 1PXOA 5EYDA 5F4NA 4UMUA 3DU8A 4RFMA 4P7EA 3LM0A 4ZLZA 4JR3A 3D4QA 1P2AA 5DG5A 4BCFA 5AR4A 3TWJA 2PVHA 1ZXEA 2UZBA 3QKLA 3JY9A 4I5HA 4M12A 2X2MA 5J1WA 3MY0A 3NX8A 4FYOA 1OIQA 1W98A 3C7QA 5AP4A 2XK7A 5AR2A 3D9VA 1JPAA 5HIBA 1U54A 3UVRA 1A9UA 3OZ6A 4C4HA 3PXFA 2ONLA 4I23A 4QD6A 4C4GA 2GNJA 2UVXA 4TWNA 2A0CX 4W4YA 4YLLA 5HE1A 3WI6A 5HO7A 2O2UA 5ACKA 3O8TA 4EHGA 5J79A 1OKWA 3V5LA 3HA6A 4BZNA 4EK3A 3HZTA 4MNFA 3MBLA 4JQ7A 5D9HA 1U46A 2Y4PA 4IAZA 3VUKA 4GUEA 5EQPA 2REIA 4O83A 4BB4A 4C2VA 4NIFA 4QNYA 3TTJA 3BI6A 2XBJA 3A7GA 5F95A 2QOCA 4RQVA 1U5QA 3T9TA 3QZFA 1Q3DA 3OXZA 3GCPA 5HORA 4U41A 4XLVA 2BIYA 4QMYA 2V0DA 4A7CA 1LP4A 2JLDA 3HV6A 4DFBA 4OR5A 2F4JA 4XH6A 5AMNA 1PMVA 4BKJA 5CZIA 4RZWA 4AF3A 3BWFA 1ZMVA 3AD6A 3EN5A 2O65A 3FJQE 4LMNA 4M15A 1O6KA 4LUEA 2GS7A 3DTCA 4F9CA 3QQFA 3MH1A 3GCSA 3PXYA 4JNWA 1H25A 3EN4A 3ATSA 4ANQA 4BBEA 1OUKA 3ORKA 1YVJA 3KXMA 4XJ0A 4XOYA 1GIIA 1XH5A 3V5PA 4LGHA 5A54A 4NW5A 2XK9A 2XK4A 2YA9A 3LCDA 4FKRA 2NP8A 3CTJA 2EVAA 2XNGA 3H30A 3P0MA 4G9RA 1SNXA 3R71A 4AT4A 3B2WA 2YN8A 4L46A 3FI8A 1REJA 2XRWA 1H1PA 2R3IA 2JDOA 5ANDA 4DFNA 3O0GA 3QRKA 4BCJA 4I20A 2OZOA 3C4FA 1RQQA 3G33A 3R01A 3KA0A 5AA9A 3HLLA 1JKTA 3LXNA 3TCPA 4K2RA 3Q9WA 2YHVA 4R1YA 3F7ZA 4ACHA 1J1CA 3ITZA 1OZ1A 3FSKA 3GP0A 3LE6A 3M11A 4K11A 3TG1A 4B6LA 3C4EA 4DTKA 5I9VA 4ZTRA 4R3PA 4C8BA 3VNTA 4NM7A 3EN9A 4R5SA 3U6IA 1YXSA 1U59A 3FWQA 3EN6A 2O8YA 4AGUA 4O2PA 1PYXA 4I0RA 3D5VA 4C4EA 2PK9A 3C4XA 3LW0A 1H0VA 3IW5A 2J5EA 3HDMA 4AN2A 5AR8A 4KKGA 4CRSA 5KMNA 2XVDA 5CY3A 1FMKA 5FLFA 4GJ2A 5BVEA 2W4OA 2QU5A 3UYTA 4O6EA 3EB0A 2VD5A 2YM6A 5AIKA 3PJ2A 5T6KA 3UPXA 2XKCA 2WHBA 1XR1A 3GU6A 1M2QA 2XIRA 4RLKA 4UYNA 4E3CA 2XRUA 1LEWA 2GHLA 2YCQA 3GUBA 1XH4A 3A7FA 4LGGA 2VTOA 4WG3A 3UE4A 2ETKA 4S33A 4YJUA 4BZOA 4DITA 5L6OA 3R2YA 5AP3A 4ASXA 4YJVA 5IG1A 4IVDA 3REPA 5HX8A 3S4QA 3BQRA 4ERWA 3TL8A 3LQ3A 4DG3E 2EWAA 4O27B 3WYXA 3G6GA 4W4XA 1LUFA 4MHAA 3F3TA 3NPCA 5FQDC 3C4CA 4MCVA 2G2HA 3MIYA 2VTNA 3WBLA 5BVFA 3S00A 2Y7JA 3A7JA 4JIKA 4E26A 4Y46A 4QMWA 4JIAA 5HG7A 2JDTA 2YAKA 4YBKA 4DAWA 4ONAA 4RQKA 2ZDTA 4YC8A 3CE3A 3OBJA 4BBFA 2VTSA 5JMSA 5HKMA 3KXXA 3T9IA 4JBQA 3FY0A 4QQ5A 3OP5A 1YQJA 5HX6A 4IB0A 3BX5A 3TNHA 2C0OA 2PVMA 3R9DA 1RW8A 4GH2A 2O0UA 4QTEA 5H2UA 4RFYA 4GKHA 3E3BX 3DOGA 2XK6A 3FLYA 5CTPA 3F2AA 5FEQA 3EQPA 3BYSA 2FVDA 2R0UA 4FL3A 3ZRKA 3QWKA 1KV2A 3OEFX 2PZYA 3IGOA 4GW8A 3MY1A 5HCZA 5ETAA 4AA0A 5FG8A 3EQBA 2V55A 2EUFB 2YIRA 5IDNA 4GV1A 4F9WA 2FGIA 3KMMA 3Q5IA 4GIIA 5CEQA 2C3LA 3CPBA 4FODA 4RIXB 3BYVA 3I7BA 2JAVA 3UMXA 5CS6A 2PTKA 2YIYA 4BKZA 4R7HA 2CNVA 2WMWA 3BV3A 4F0FA 2C69A 2UW7A 3LMHA 4L42A 2J5FA 4AU8A 3D7TA 4LOQA 3Q04A 3P7AA 3R04A 5J9YA 2ZV8A 1JBPE 3G9LX 4FKPA 1MUOA 4FGRA 4BBMA 3C4WA 3LFSA 3W2CA 4MD7E 3MN3A 3QCSA 4NJ3A 5HVYA 3PPJA 4ZJJA 5FTQA 5KHXA 3UOLA 2X9EA 3OMVA 2VAGA 4L7FA 4R77A 2ZDUA 3OXIA 1Y8YA 2VTMA 4U42A 2WQBA 2WMBA 2UZEA 1WBNA 5L6PA 3DY7A 4ZTSA 2GNFA 3SGCA 4O86A 4XG2A 4XEYA 2XIZA 5AP5A 4EI4A 4DEHA 2PU8A 3BLQA 5CU0A 4X7QA 3SG8A 3BYMA 2BZHB 4O91A 4FL2A 4FG7A 5EYKA 3PXKA 3SXFA 3QRJA 4YNEA 4DBXA 4CMOA 2HXQA 5IH4A 2I0EA 3IGGA 3C1XA 5FEDA 3SLSA 4B0GA 3MPTA 3MDYA 3PXRA 4A9SA 2W1GA 3L8XA 3PRIA 1K9AA 4U81A 1KE5A 2W96B 2YDJA 1PXIA 4FK3A 3UOJA 2OI4X 2NO3A 3MSSA 3VQHA 5AADA 1QMZA 1Y57A 1ZZ2A 4CG9A 3P79A 2EB2A 2BZKB 3FMKA 3VUDA 3DV3A 3OWPA 4NTTA 3W1FA 4O7TA 4JX7A 3E8NA 1PXLA 3SOCA 4EQMA 4E4LA 4FV3A 5I4NA 3FUPA 2KTYA 2NRYA 3CJGA 1PYEA 2FUMA 2RF9A 4O38A 4O6LA 1Y91A 4OTPA 1ZYSA 4BWXA 4YO4A 4YU2A 5IZFA 4FTNA 2UW4A 3DQXA 5HVKA 3RAWA 3GXLA 3OG7A 1OKYA 4TTHB 5H3QA 1Q24A 3O8UA 1H28A 1UU9A 3QTWA 2E2BA 3I6WA 4NFNA 3OVVA 4QYYA 4C61A 5TR6A 3SRVA 1UU7A 5LVPA 1ZY4A 5EHOA 2CN5A 4FIFA 1H24A 4RIWB 2B0QA 1P14A 4IVAA 4S34A 3VS1A 2EXMA 3DJ6A 4D2TA 5C03A 4APPA 3WZJA 4RMZA 4BRXA 3LLTA 4K1BA 5AP1A 3D2IA 2J0KA 2P4IA 1NW1A 4NK9A 3MW1A 3W2QA 3ZONA 3H3CA 1XWSA 3D7ZA 3PZEA 3R22A 5KKRB 2GS6A 4K77A 5J8IA 3RHKA 3KXGA 3EYGA 4ZTHA 4P90A 3TZ9A 2RL5A 4IFCA 5DT3A 3RPYA 3S95A 1YWRA 3PY1A 2VX0A 4I94A 5CXZA 2WTKB 2YFXA 3KN6A 2Q0BA 5A4EA 4GS6A 4YJNA 5CVFA 4YZCA 5IQCA 3POOA 3AG9A 3QQLA 3HAVA 1M17A 4C36A 4C7TA 2VGPA 5BYZA 3COHA 1G5SA 2F9GA 4FIIA 3HECA 4FUXA 4USEA 4X6RA 1URWA 3KXHA 4J96A 2GNIA 4WHZA 4WUNA 5FM2A 3C51A 4FTMA 1SZMA 4JG6A 1I44A 4MD9E 5E1EA 2YACA 3RJCA 5M56A 5IQBA 4D55A 2WMQA 3ORNA 3R73A 4AZFA 3PIXA 2C4GA 4I6BA 4F65A 1AD5A 1TVOA 4M3QA 1LPUA 2JD5A 3A60A 4QMSA 3NNXA 4FKTA 3EN7A 4F7JA 4NL0A 2J50A 5HIEA 2XZSA 3JXWA 4YP8A 2UZOA 2ZAZA 4NUSA 3W10A 4X2FA 5CSHA 3OWJA 3UYSA 3W33A 5CT7A 5AUVA 4DG2E 1IA8A 2YM4A 1PF8A 3A7HA 1TQPA 3R1SA 2PZPA 4MNEA 5CQWA 4BFMA 5J87A 1JSVA 3UNZA 5DIAA 1L3RE 2QO9A 4LM5A 1V0OA 2PWLA 5C9CA 1BYGA 4WBBB 3V5QA 4BTMA 3L8SA 2DYLA 4UZHA 4AGDA 2W4KA 4YZMA 2W7XA 2UW0A 2IPXA 3CC6A 5A4QA 2C68A 4ZP5A 4MBLA 4FK6A 3RNYA 4OT5A 4M66A 5M4UA 4ALUA 5A6NA 1YOMA 1OITA 4ZTQA 3KRLA 3UQFA 2UUEA 2XIYA 4O7VA 2JEDA 5DT0A 1IA9A 2XNNA 3KCFA 4O84A 5HG8A 3FXZA 3G5DA 4AAAA 3IK3A 2Z7SA 4AA4A 3C0HA 5CEOA 3O50A 3MYGA 4Z7GA 5HE3A 5IQHA 4PV0A 3ZFMA 4IHPA 4YMJA 4NTSA 4KKHA 3G0FA 3ZC6A 2UV2A 3R7UA 1ZLTA 2F7XE 3F9NA 2C1AA 1BLXA 3R2BA 3NR9A 2C3JA 4AX8A 5FRIA 4JLCA 3QXPA 4BCPA 1GOLA 3Q2MA 2BTRA 3ROYA 4QQJA 1O9UA 5EFQA 3UO6A 2PUPA 5L2QA 3M42A 5HIDA 5BYYA 3SA0A 2C6LA 2XBAA 4BI1A 2UW3A 4USFA 5D12A 2PZIA 4MD8E 2SRCA 4ZY6A 1A06A 2QI8A 1Q4LA 2BKZA 4BYIA 2XCKA 5EDRA 3K3JA 4RWKA 4NM3A 2YIWA 3L1SA 4KSQA 4EUTA 3LFBA 3H9FA 3BKBA 3QUPA 3UIBA 3VUHA 4BCKA 4CFVA 5JGDA 2RSVA 2W06A 3NW7A 3FXXA 2C30A 3FHIA 3ZCLA 4PWNA 4YTCA 5A14A 3OS3A 5EW8A 2A1AB 3E8DA 2VX1A 4U97A 2X0GA 2IW6A 2VTQA 4I0SA 5HNBA 5IA5A 3BHVA 3W2RA 4QMUA 4L9IA 4GVAA 1YKRA 2B54A 3F7WA 3MA6A 5AP7A 1QPCA 4IZ7A 4BDFA 2XNPA 3Q32A 4YC6A 4G5PA 5M08A 3FLNC 4IWDA 4E8AA 4DG0E 2B1PA 3IOPA 3P86A 3AGMA 1J91A 2O5KA 4RA5A 3KB7A 3NUAA 5FP6A 4RJ7A 3MJ1A 4AW5A 4BDCA 2JDRA 1DM2A 3QTUA 4B8MA 4GYIA 4KABA 3UIUA 4GJ3A 1R78A 4CRLA 3NNUA 1Q97A 3KC3A 2B4SB 3LFQA 3UG2A 5C27A 4QP3A 4FSZA 3ZO3A 3KVWA 1FGKA 2QC6A 3K5VA 4ZSJA 4UZDA 5KMMA 4D5HA 4BGHA 5AFVA 2WXVA 4F63A 3LOKA 4GT4A 4FZFB 5FM3A 3A62A 3PE1A 2CPKE 4CNHA 5KO1A 2JIUA 1NXKA 3E8CA 2OK1A 2OKRA 3EWHA 3QCQA 1SM2A 3GC9A 2YIXA 4UALA 2XUUA 5GHVA 2GQRA 2Y8OA 5BVNA 3KK9A 3QL8A 3W2SA 4CZYB 2P55A 4U45A 4U5JA 3VUMA 3GOKA 4FKWA 3EJ1A 5KUPA 5JGBA 1J7LA 2YJRA 1XBAA 4OTGA 3FI3A 3MA3A 1PW2A 4U7ZA 3WF7A 1OB3A 4QP2A 2YIQA 3DZQA 3PJ3A 3GC7A 2VTAA 4FV4A 2R4BA 3LQ5A 3DBQA 4FEWA 3R00A 3R83A 4G5JA 1A48A 3BHTA 2J51A 4OTFA 5E7RA 4B7TA 4FG9A 3ZTXA 3OT8A 3ANQA 3R7VA 4Z55A 4DH1A 4FV5A 4ITJA 4YUQA 5L2IA 4KUJA 3QZIA 4E6CA 3TNQB 2W9ZB 1G8SA 4JXFA 3F69A 2W1FA 3LFNA 2RFSA 3WZKA 4H1MA 2HCKA 2C47A 5A46A 2ITWA 2W9FB 4FT9A 4TRLA 4FTAA 3CKXA 4CLJA 5JEBA 3TI1A 5BMSA 3LXLA 5M55A 2R3LA 3TZMA 1GNGA 5IQIA 1GJOA 2EB3A 3CD8A 1XH7A 5GIOE 4QMMA 5E8SA 3RP9A 3Q3BA 4FYNA 3OY1A 4H3QA 4R5YA 3F61A 4X2JA 1ATPE 3VHEA 3RAIA 2OZAA 2YWPA 4MK0A 4L6QA 3W8LA 3N4TA 3ZRLA 2F2UA 4YTFA 2CKOA 4JRNA 4N0SA 4O7NA 4CQEA 1WBOA 3UQGA 4L68A 4E4XA 5H9BA 4AGCA 4WNKA 4K9YA 2CKQA 4DCAA 2OICA 3UVQA 4IM0A 3Q6UA 5FTOA 4E5BA 2OGVA 3L8PA 2PSQA 4QP1A 5EYCA 2X7GA 4FX3A 2ITYA 3BLHA 3U87A 5BVOA 2WOUA 2Y6MA 4O0UA 4ZSAA 5CI7A 4QRCA 4FIHA 4PDYA 3WARA 3EL8A 3QFVA 3RMFA 4O82A 1BI8A 1GY3A 4KS8A 2FO0A 4GFOA 4EOQA 3ZM9A 2IVUA 4U44A 2BVAA 3AGLA 5LMKC 4BF2A 3PA4A 2XEYA 3EKKA 3PA3A 4BDKA 4CMTA 1GAGA 4IBMA 4GIHA 5G6VA 4BDAA 2XS0A 4W4WA 3VBQA 4P4CA 5ANGA 3VW6A 3PA5A 4FZAB 4D0WA 3AT2A 4LYNA 4MWHA 4PMSA 4F64A 3IKAA 1WVWA 5M44A 2ITNA 4KKEA 3DB8A 4XMOA 5LVOA 1OVEA 2WQEA 4DEEA 1YHVA 4EOMA 2WGJA 2JDVA 5B2KA 2XH5A 3EYHA 3P7BA 4RA4A 2GNGA 5AP2A 5BYLA 5AAEA 1EH4A 4HNFA 4ZZOA 3V6RA 2IW8A 2B52A 3ORTA 3ZH8A 3DXPA 1P4OA 3KMWA 4BYJA 4X3JA 1PMUA 3ZUVA 2WTIA 3BHHA 2PZRA 3BWJA 5J95A 3NUUA 4EQCA 3BPRA 3O2MA 3R7GA 4PDPA 4I41A 5AWMA 5EOLA 1PMEA 4ZTLA 4Q5HA 4YGAA 4Q5EA 4HOKA 5T68A 5LARA 3I5NA 5D1JA 4NM0A 2CCIA 4WO5A 1ZRZA 3SVVA 2QOOA 2FSTX 5IA2A 5T3QA 2F49A 2VN9A 3E7OA 2WFYA 3FC2A 4A06A 5C4KA 4YJTA 5EYMA 4BWKA 4YHTA 4A9UA 5I5ZA 4IWOA 3CJFA 4F09A 2BTSA 4QMLA 4BDHA 4PL5A 4TT7A 1ZYJA 1KE8A 3FHRA 1SVEA 3E93A 5CEMA 1T46A 4NSTA 3BLRA 2XEZA 1M7QA 4C37A 3OTUA 4AN3A 4WOVA 3TV6A 4CQGA 4Q9ZA 3FAAA 4FKUA 2BKKA 1XH8A 4WKQA 1VEBA 3R6XA 5H8BA 3QRIA 3P9JA 4EYMA 2C1BA 3HV7A 3IDCA 2QD9A 4WSYA 4CKRA 1ERKA 1PJKA 4BICA 5EKNA 3GOPA 3B8RA 3ZSGA 3S0OA 2C5NA 2DUVA 1V1KA 1ZYLA 3FE3A 4ID7A 2WTVA 3G6HA 1ZOEA 3NAXA 1H1WA 5K3YA 4G1WA 3SX9A 3G0EA 4HVIA 1YDSE 3Q9XA 5G1XA 2HAKA 5KMJA 4G16A 4Q2AA 4KIKB 3I81A 4D2SA 2X2LA 2HZ0A 3MTLA 2R7IA 3HMMA 1Y6AA 2UZDA 4YNOA 1CSNA 5GZ9A 4IZ5A 1J3HA 3DA6A 1M2RA 3FV8A 4L45A 4LGDA 4L00A 4W8DA 3ZLWA 5C8KA 2PUNA 2YLFA 5CAVA 2PVJA 4ACCA 4IM3A 2F2CB 4FEQA 3DDPA 3PG3A 4FTJA 2JBPA 3HMNA 4EHEA 5CX9A 4ZTMA 1PKGA 4O0XA 5LXMA 2GNLA 3EL7A 5M4CA 2ESMA 3THBA 3R0TA 2WIHA 4J52A 5DR2A 3UC4A 2RFEA 4UXQA 5EM6A 5HTIA 4YTIA 3OW3A 2FB8A 3QWJA 3F5XA 2JKQA 3TKHA 4XOZA 4MF0A 1FQ1B 1FVVA 2G2IA 1ZAOA 2I40A 3NYNA 2JKKA 1W0XC 3ACJA 4TWOA 3VS0A 4AZEA 4IB1A 5HU3A 4A9TA 5ITAA 2YISA 1CM8A 2JFMA 4DYMA 5JT2A 2BAKA 4BDBA 3PFQA 4RJ8A 4Z3VA 4LQMA 2YERA 2XCHA 4AT3A 2V7AA 4B4LA 1B39A 2BILB 2GTMA 4BL1A 4D0XA 3RM6A 3ZDIA 4RX7A 5EM8A 1CMKE 3RKBA 2C3IB 3Q4TA 5DN3A 3TV4A 2CGVA 3MESA 5FUTA 1KE9A 5HBHA 3QGWA 2C6MA 3OXTA 1YWVA 3OFMA 4HGEA 3V51A 3ZC5A 2I0HA 4DCEA 4FKQA 3ZDUA 4O0WA 1O6YA 4GFGA 2UVYA 4TYJA 3ULIA 4CTBA 3DJ7A 1Y6BA 1Q8TA 2J7TA 2W1CA 5TO8A 2Z02A 3M2WA 3RI1A 4D4YA 3W18A 2VO0A 4ANSA 3KRJA 5LWMA 3H0ZA 3QXOA 4ASZA 4QP6A 2X4ZA 5GJFA 3VBWA 5ANKA 4ACGA 1H8FA 4L44A 3QQUA 4O21A 3UODA 3ZBXA 3R28A 3WF5A 4TYHA 3GBZA 5KNJA 5AUUA 3U9NA 4USDA 3L8VA 3A4PA 4EEVA 4OGRA 1XJDA 2IZSA 3FLWA 2C6KA 3Q60A 5I0BA 5JFVA 2ERKA 3TZ8A 2ITQA 4O0VA 4FV1A 2BALA 2A2AA 2CN8A 3EQRA 4EC9A 5LVMA 3F3WA 2OIQA 3BHYA 1H1RA 4TYIA 4S31A 4RZVA 5DE2A 2XK8A 3LFCA 1Z9XA 4ZLYA 5JSMA 3F6XA 2G01A 1YWNA 4JDJA 3UZTA 3C9WA 3HMPA 2PPQA 4Y73A 4H05A 4FEVA 3FZRA 1IRKA 4Y95A 3CS9A 3U4WA 4ZAUA 1JLUE 3PJ1A 4TY1A 3D2KA 4C57A 2C5YA 5JQ8A 4AWIA 4ZXTA 1SVHA 5M06A 4TWPA 1ZZLA 4OLIA 4YO6A 2BIKB 3MH2A 1KWPA 3CR0A 4LOPA 2I1MA 2VUWA 1H00A 3CIKA 1O6LA 2HWOA 5AR5A 4HVSA 2ETRA 1MRUA 5KMIA 1Q8WA 5EG3A 3LFEA 5F94A 4B8LA 5DRBA 5E90A 5BUEA 3R8VA 3KL8A 4BCQA 4PQNA 3IW6A 3DQWA 3LQ8A 1JKLA 4XRLA 4MX9A 2UW6A 1GIHA 2JFLA 1KSWA 3HV3A 3UJGA 5AA8A 3FMMA 1FGIA 4AQCA 3VQUA 4F9BA 3PJCA 5CU4A 5DVRA 3NNWA 3ZS5A 2PMLX 3ENMA 4WT6A 4AW0A 4EYJA 1UKHA 3ZLYA 2IWIA 2ZVAA 4XX9A 3AMBA 2VTHA 4RJ6A 3FZTA 1TQIA 3VO3A 3EKNA 5E8ZA 3QHRA 3ZM4A 3R30A 4TWCA 5IEXA 3TNWA 4RC2A 3MVHA 4FNWA 3ODYX 4N6YA 2OH0E 4O7RA 2R3KA 4QTBA 3ANRA 4QO9A 3G9NA 2RFDA 3KU2A 2G15A 4LRKA 5DEYA 3MV5A 2OSCA 5IU2A 4I4FA 2AC3A 4QYEA 4C3FA 4M69A 2BRNA 3QU0A 5TF9A 3R9NA 4ACMA 4AT5A 4FOBA 4FC0A 1IEPA 4MYGA 4CGAA 4H39A 2DS1A 2GHMA 2XA4A 2VU3A 2Z8CA 5BVDA 4V0GB 4BN1A 3CGFA 1FOTA 4RIYB 5LMKA 5EM7A 4BI0A 4AW2A 4JAJA 4FIGA 1OPLA 3DK7A 4HYHA 3NUPA 1SMHA 4D2RA 4CXAA 3Q6WA 2X8DA 3R8UA 1SYKA 4GL9A 3TUBA 2J0MB 3ZHPC 3ZLSA 4F7LA 1AGWA 2GQSA 4CTCA 1UA2A 4A07A 3PZHA 4DFXE 2OU7A 4UMQA 4I3ZA 4BCHA 2VO7A 1UVRA 2CJMA 3FQSA 2QR7A 3FY2A 4MQ2A 3RCJA 3WILA 4C4IA 5JFXA 3GNIB 5AV4A 4L52A 4FA2A 1BMKA 4HCTA 4GFMA 4ZS4A 2QOHA 5JZNA 3TUCA 3SAYA 4BDDA 2QOBA 3TT0A 4IVCA 3CPCA 3R8LA 3DTWA 3RPSA 5HESA 2AC5A 2WMXA 4MWIA 2QOLA 5HI2A 2P2HA 2I7QA 5HHWA 3NSZA 4Q9SA 1R0EA 4MBIA 4CT1A 3DKGA 5HLWA 3D15A 1OMWA 4QYGA 5BPYA 2PMIA 1J7IA 1DAWA 5CF4A 4JRVA 3BGZA 4CZUA 4M67A 5KX8A 2PMOX 4FTTA 3F3VA 4F7NA 4JDIA 3MTFA 3TZ7A 4J8MA 3GT8A 4K8AA 3I5ZA 4G3FA 2BDJA 4LL0A 5E8VA 3PUPA 5HZNA 5IA0A 5DBXA 5AX3A 1Y8GA 2ZM3A 2Y4IB 3LMIA 3ROCA 3PP1A 2OXDA 2YCRA 4IFGA 3FI4A 3BYOA 2WQNA 2PULA 2VNWA 4IEBA 4QYHA 5EQYA 4CT2A 2C3KA 1MQBA 3ZZEA 4F1MA 3ZU7A 3CXWA 1M52A 5CNOA 4BDGA 3HMOA 5AAFA 5AUYA 4JQ8A 3B2TA 4AG8A 4XG6A 1KUTA 3D14A 1BI7A 3IOKA 1B38A 3MFSA 3VJOA 2WMUA 3Q4UA 5CENA 4FVPA 5CWZA 4FTKA 2PVRA 4CFNA 2C5OA 4CKIA 1FPUA 2R3GA 3WZDA 3V5TA 3K2LA 2AYPA 4MH7A 3GC0A 4DC2A 2I0VA 2X1NA 2OF2A 3VUGA 5E8WA 4DGMA 3G90X 4MVFA 3PIZA 3A8XA 3QQGA 4KINA 5J9LA 4UB7A 4I5PA 5DR6A 5KMOA 2HY81 4EKLA 4F6UA 3RK7A 4DEIA 2YM3A 2YDIA 3DBDA 3GVUA 5LCKA 4HVGA 4DTBA 3DBCA 4JDHA 4EHZA 3BYUA 4P5QA 3D83A 1OECA 4O2ZA 4ALWA 5FBNC 3R8ZA 4ENXA 4DT9A 1GIJA 3DAKA 3IW4A 2I6LA 2PE2A 4FNXA 4U9AA 4OAVB 5DLSA 5H8EA 2BCJA 3H10A 5AUXA 3UNJA 1PMNA 2PUIA 4KBKA 1NVRA 4E1ZA 2OJJA 3FPMA 4JX3A 1YXXA 3PSBA 3TN8A 4OTWA 4FL1A 3KGAA 3EQFA 5E92A 4KBAA 1UWJA 4FT5A 3VULA 4AW1A 3FSFA 4DA5A 5CXHA 4EJ7A 1KV1A 3TNIA 1FMOE 3P7CA 4I6HA 4U79A 2WB8A 4BTKA 3U55A 2HELA 2IW9A 2PZ5A 3CBLA 4PNIA 4QMXA 4EZ7A 4L7SA 5M51A 3F2RA 2IZRA 2W0JA 4E6QA 5IA4A 1B6CB 4EORA 2CCHA 3DDQA 3ZSIA 4F99A 4JJRA 1ZY5A 3BU5A 4UV0A 3FLSA 3ZEWA 3HA8A 2OF4A 2OO8X 3UBDA 3A61A 3BRBA 3OEZA 3LXPA 2CNUA 5FP5A 2VX3A 2WO6A 3ZO4A 5TE0A 4HYIA 3VF8A 3RTPA 4CVAA 4XV9A 4GU9A 3QTRA 3TNPC 2J9MA 4AP7A 3C5IA 4DFZE 4GEOA 3B8QA 4MXXA 3FKLA 5ETFA 3OBGA 3N4VA 3FYKX 2V22A 5B7VA 1WBVA 3UC3A 4DFYA 2HENA 3S1HA 1OL5A 2C6OA 5HBEA 4RBLA 1H0WA 3EQIA 3QA0A 4X21A 4G3CA 5DOSA 2OXYA 4I92A 5KKRC 4XP2A 4MTAA 4IWQA 4C3RA 1WZYA 2R3FA 3NUYA 3MJ2A 4M14A 3UG1A 5AR7A 4C38A 4S2ZA 5DH3A 3VS5A 2WTKC 4PMPA 3KRRA 4I4EA 3MVJA 3FMEA 2RG6A 3MFTA 4OBOA 4II5A 5L3AA 4ZMEA 4Y83A 4RVTA 5J5TA 4EONA 3HP2A 5DYJA 5M09A 1WBPA 4HZRA 4D4SA 1L8TA 3DPKA 3VBXA 3ZYAA 2XF0A 4FOCA 4C0TA 4HCVA 4BCNA 4XYFA 2WELA 2C6IA 1PXPA 4FKJA 3LKMA 3PSDA 2B9IA 2J0IA 4AFEA 3DNEA 5D11A 3FZSA 3Q9YA 3TJCA 2PY3A 2WTJA 5C01A 2VTPA 3BU3A 4YHJA 2P33A 4X2KA 5ACBC 3WE8A 3WIGA 4AOIA 4J8NA 4HW7A 3ORLA 3JVRA 1JNKA 3ZXTA 4CFUA 2WIPA 3V6SA 3KY2A 4DGLC 1E9HA 5CF8A 1Q8YA 3ID6C 3VS2A 4PL4A 3ORMA 4QQTA 1CTPE 3F88A 3RPVA 3GU5A 2YCFA 3WZEA 1OBGA 1HCKA 4RJ3A 3R9OA 4BIBA 5E9EA 2BRHA 4PL3A 4XHKB 5L2WA 3QYWA 2ZJWA 3OWKA 4GG7A 4MF1A 3KFAA 1VYWA 4FT0A 4UX9A 3KVXA 4YJOA 3QTQA 4QMTA 4BCMA 4X3FB 3AC5A 4L3LA 4G3DA 4J97A 5CYIA 4C58A 3V3VA 1NA7A 1WBSA 2OFUA 4FR4A 3SD0A 4IX3A 3DNDA 4IAKA 3QZGA 4KWPA 4DH5A 5KBRA 1GZKA 3JR1A 4KBCA 4ZZMA 4TZRA 2ZMDA 4ENYA 5FD2A 2OIDA 2BROA 4HJOA 3EFJA 3PVWA 4FTRA 1SVGA 4QP7A 4EOSA 3VWAA 5HQ0A 4GT5A 4R7BA 3L9LA 3MY5A 3NNVA 3QD3A 2WKMA 4EQUA 4FV7A 3PG1A 4YR8A 4F08A 2YAAA 3MFUA 2XKDA 3EFWA 4CFMA 4QTCA 3U54A 3BEGA 4M84A 2XIXA 3VJNA 5J1VA 4EHVA 2IVTA 4NU1A 4DLJA 1ZMWA 4M97A 4ZK5A 3RVGA 5CSPA 5IMXA 5J7HA 4RRVA 4Z16A 4C35A 2XYUA 3OWLA 5E91A 2BDFA 3NVKI 2W1DA 1YXVA 2HWPA 2WTWA 4LG4A 4O1OA 3LCTA 5BQ0A 4TW9A 1FINA 3HNGA 4FSTA 4E6DA 4ZY5A 1ND4A 2QODA 5EI8A 4BDIA 3VVHA 4DEAA 2IZUA 3KREA 4BHZA 3AMAA 4L8MA 5DWRA 3N9XA 1HOWA 4GVJA 4S32A 3ZUTA 3A2CA 4EWHA 2W1ZA 2C6DA 1U54B 2VGOA 4PX6A 4RPVA 4A9YA 2Z7QA 4JOAA 4QMNA 3BBWA 3GCUA 3R63A 5CVHA 3TDVA 3I0OA 2YABA 2BZIB 3LFAA 4U6RA 2YCSA 3FL5A 2YEXA 2BZJA 3QX2A 3QGYA 3BV2A 4S30A 3SQQA 3UP2A 4D4RA 5IUGA 5EM5A 4GSBA 2ONLC 4TYEA 2W99B 5DEWA 2IVVA 2X6EA 2ITVA 3KULB 4FTOA 3O8PA 4XRJA 2QKWB 4CZTA 5HCXA 4TL0A 4G34A 4HGSA 1VZOA 5K9IA 5D7AA 2NNWB 3KN5A 4IVBA 2CMWA 3C0GA 1KE7A 3RPRA 5FXQA 3JS2A 4LFIA 3R7YA 3O17A 3PWYA 3S3IA 3VUIA 3OROA 5L2SA 4HGTA 5AV1A 1REKA 3RAKA 2B9JA 5ANEA 3QAME 4DGGA 4UMRA 5JK3A 1PHKA 4RWLA 1Z57A 4AZWA 2R3HA 3RWPA 3V5JA 4GU6A 4RIXA 3N51A 3R8PA 3PPKA 5ETCA 4CCUA 3RAHA 1UWHA 2WMVA 3R1QA 3E62A 4LV5A 3HP5A 3UP7A 4CV8A 1IASA 1H07A 2GPHA 2FSMX 4X2GA 3PXQA 4NEUA 3TUDA 1U4DA 4O7LA 4F6SA 3K54A 2JBOA 4DH3A 5I9UA 4EK8A 3RINA 2YZAA 3DKOA 5D41A 4IX4A 5CEPA 3ZSHA 4EBWA 2GSFA 4O0YA 3IQ7A 5TOZA 3IDPA 5A6OA 5K5NA 4YZDA 5HOAA 2PHKA 1K3AA 2J6MA 5CSWA 4UWYA 5FWKK 4AOTA 1QPEA 5F20A 1OL1A 4KIOA 2F7ZE 1Q3WA 5ANJA 2C5VA 3FMHA 2B53A 2I0YA 4GCJA 1SNUA 5LMAA 3AC2A 5CU2A 5HLNA 3CP9A 3LJ2A 3O23A 5EDPA 4L3JA 4XG8A 3SKCA 3R9HA 4APCA 4GKIA 4QOXA 2PE0A 4FTQA 3PRFA 5E8UA 2HW7A 2EXEA 4J7BA 1YXTA 2XNEA 1STCE 3P1AA 3PY0A 2R7BA 4JAIA 3ORXA 4XS2A 5DMZA 3BBTB 2OG8A 4CFXA 4DHFA 3KF4A 2UZLA 4H58A 5D10A 2V7OA 4N4SA 2WZJA 5EOBA 2BHEA 4ALVA 4LRJA 2OFVA 5HTCA 4FV2A 4IB3A 2WU7A 4X2NA 3CQUA 4NZWB 4C4FA 4CLIA 3PJ8A 3PLSA 2R3NA 4HYSA 1OKZA 3CGOA 1W82A 1Q8ZA 2VTRA 3LFFA 5J7BA 3CQEA 4L43A 3FC1X 4QMZA 4ZOGA 4FE2A 2Z60A 2XNOA 1I09A 4DFUA 4W4VA 3NIEA 4XNEA 3QRTA 3RWQA 3LCOA 4LV8A 3TDWA 3UIXA 2WQOA 4KAOA 3D5UA 3RK9A 4EH2A 4EH4A 3DKFA 5A4TA 2X39A 4RVLA 3QQKA 4MXZA 4RIWA 2X2KA 3V8TA 3VRZA 3ODZX 2IN6A 3DAJA 3BGPA 4K18A 4KS7A 5CEKA 1ZARA 4YJPA 5JH6A 4RFZA 2YM7A 5HE0A 3CTQA 4ARKA 3PDTA 3HKOA 3PY3A 3ZFYA 4DGNA 3H9RA 4R7IA 4FIEA 3C5UA 3TIYA 3EQDA 2X6DA 3G2FA 1H27A 2W1IA 3NCZA 2CDZA 4D2VA 3PWDA 3JPVA 3MI9A 2IO6A 1PRYA 4D4VA 2WTCA 4G6LA 3LLAA 2JC6A 1URCA 3PVGA 1OM1A 3BIZA 2J0JA 5C8NA 4IMYA 1BL7A 3FMJA 2XB7A 4EH9A 5EH0A 4IDTA 1X8BA 3RNIA 4BGGA 5A9UA 1GZOA 3FKNA 4FTIA 3I4BA 4KB8A 4V04A 4BCIA 3TTIA 2FSOX 2VTIA 2AUHA 4OTQA 3ZZWA 2RFNA 1FVTA 5IA1A 4WD5A 2WMSA 4FSWA 3GU7A 1WCCA 3F5GA 1LEZA 3QQHA 1ZWSA 5CASA 5AM7A 4A9RA 1PKDA 3OTVA 3QRUA 5IQDA 5HICA 4GMYA 2VRXA 2OJ9A 4NCTC 5CSXA 1QPJA 4TNBA 1NVQA 4D2PA 3KKVA 2R3JA 4D28A 4IH8A 2YWVA 3D5WA 1CKPA 4NW6A 1PXNA 4ITHA 1OL7A 1UNHA 3W16A 4D5KA 3D7TB 4AE9A 2PVLA 4U3ZA 4WUAA 3M1SA 4O0SA 4A4LA 2JKOA 1OL6A 3DS6A 3LPBA 4G6OA 1JAMA 5AIRA 1Q61A 3W8QA 1Q8UA 2VTJA 3NRMA 4LRMA 3F82A 4Y5QA 1BKXA 5FDXA 1NT2A 3COMA 4HCUA 1YOLA 4EOIA 3A8WA 2X7FA 2QG7A 3QA8A 4RVMA 3HEGA 3F3UA 4B99A 4MBJA 3H9OA 3EH9A 3KXZA 1AQ1A 2WQMA 4OT6A 4P2KA 3EZRA 3TJDA 2BDWA 4MXCA 2ZB0A 2QLUA 1XQZA 3LM5A 3RBWA 5GZAA 4EOOA 3P5KA 4D9TA 5F9EA 2IVSA 3QTZA 3ZUUA 3CY3A 4LL5A 3JUHA 2XNMA 4XG9A 4QMQA 4TNDA 4C4JA 1RJBA 2G1TA 4L67A 3VBYA 1IAJA 3VBVA 3PIYA 5JGAA 1YI6A 2ZMCA 3IG7A 3LZBA 5EHLA 4U3YA 5IKWA 5IMEA 3UPZA 5GIPE 4E5WA 1W84A 3QZHA 3E64A 5CEIA 5HG5A 3E87A 2B9FA 3LHJA 4K6ZA 2CHLA 3HVCA 3GQLA 2C6TA 4EH5A 3AT4A 3I0QA 4UN0C 2QOFA 2J2IB 3ALOA 3EFKA 2ZOQA 4CYJA 5HTBA 3KMUA 4Y8DA 2X7OA 3V8SA 4G17A 4TXCA 4YPSA 5K0KA 4DFLA 1UNGA 4LOOA 3UNKA 1PXJA 4IX5A 4QT1A 4FNZA 1MRVA 2G9XA 5IH5A 2Z7LA 4UWBA 3KQ7A 3DBEA 4I1ZA 5LVNA 5M57A 3MVMA 3EQHA 5IQFA 3ZBFA 2ITTA 4E5AX 5CAQA 4EZ3A 5KBQA 4AE6A 1QPDA 5BUIA 1JSTA 4ZMFA 2GHGA 3NGAA 3R21A 3K3IA 3SRVB 3SXRA 4A4XA 4BTFA 4U0IA 2E9NA 4XV1A 3F5UA 4FTLA 4OBQA 2Y6OA 2WD1A 1G8AA 5DA3A 5IQEA 4IAAA 3AC8A 1FBNA 1H4LA 4JT3A 3LVPA 4D2WA 3OCBA 4PNKA 2QHNA 4QP8A 4FKLA 2UZNA 2UZTA 3AC1A 1MP8A 1CDKA 4UWCA 3P08A 5CALA 5IQGA 3OCSA 5CU6A 3NWWA 5HNGA 5BX0A 3A7IA 4NT4A 4XUFA 5CAUA 5KMKA 3AOXA 1LR4A 2H6DA 3VS3A 2W5HA 4IE9A 5GZ8A 3UZRA 1XHAA 1J7UA 2VNYA 5B2LA 4KA3A 4H3PA 4XBRA 4DLIA 3OCGA 4E93A 1YDRE 2E9VA 5ETIA 2HYYA 3RHXA 3KULA 4ANNA 1ZMUA 3NW5A 3U6HA 4KSPA 2CLXA 1F3MC 4ZSEA 4BI2A 2ITUA 2NRUA 5DI1A 4F9YA 3QYZA 2P0CA 3E88A 2RIOA 3QQJA 4RLLA 4O81A 3HUBA 4F70A 2QURA 3LAUA 4XG3A 1K2PA 2OBJA 5A4CA 3OD6X 3Q2JA 3TKUA 2JITA 2QOQA 3FQHA 3R7IA 3ENHA 1H08A 5CI6A 3Q4CA 2A4LA 5FDPA 2QQ7A 3QF9A 2PVFA 5LOHA 4E4MA 2Z2WA 3F66A 4H1JA 4WNMA 4FSUA 5IUIA 5JRSA 5L8LA 2XYNA 4IIRA 4MNEB 3FMNA 5HO8A 3RZBA 3LJ0A 4G31A 5H8GA 1M7NA 4JBOA 3FKOA 4BZDA 5FTGA 2PL0A 5ICPA 3FBVA 4Y72A 4YBJA 5IUHA 3NUXA 3VS6A 4NJDA 4IC7A 4BIEA 5E8TA 1MRYA 4DEDA 4DH7A 5GINE 1WVXA 2QCSA 3MWUA 4WIHA 4IXPA 2R3OA 2ZB1A 3OUKA 3LIJA 1JVPP 1XBBA 4CD0A 4EK6A 1OUYA 4AZTA 4G6NA 5K4IA 4PDOA 4U80A 4C33A 5AV3A 4ZSGA 5TT7A 4O7ZA 2W1EA 4FV6A 5IPJA 4FF8A 5AJQA 5F1ZA 5C8MA 1TQMA 5GJDA 3T8OA 4GYGA 3RGFA 4AA5A 3LMGA 4EOLA 1WAKA 2VV9A 3EQGA 4F4PA 3QLFA 2XKEA 1H26A 1R0PA 4HYUA 3FZPA 2UVZA 1OIYA 3EQCA 2B55A 2YDKA 2P3GX 3COIA 3PPZA 2E9PA 4DGOA 3HL7A 5C4LA 2A27A 4L3PA 5HO6A 3QLGA 4DBNA 1VJYA 4G3EA 4ZLOA 2H34A 3O51A 2X9FA 2Y0AA 4RJ4A 4MXAA 4PTEA 3I6UA 4QP4A 5CVGA 4RWJA 3MPMA 1YI3A 2C6EA 3OCTA 4M7IA 2XNBA 3IONA 4IAFA 3MH3A 3SW4A 3VW8A 4EL9A 1PY5A 1ZOHA 5ANOA 4N70A 4UBAA 3GENA 2QNJA 4PTGA 5HLPA 5K0XA 3GU4A 4XV2A 1KOBA 1Q5KA 2BR1A 4ANMA 4EZ5A 3U4UA 4O7YA 4IC8A 2O3PA 2UZUE 2VWBA 2XP2A 3Q9ZA 5HVJA 3Q4ZA 3DXQA 2R5TA 3QD2B 1P5EA 3HRFA 2VTTA 3Q53A 4FUYA 4RJ5A 3RCDA 3R1YA 4IANA 3WF6A 2BPMA 3LCKA 3E3PA 3GB2A 2QR8A 4ZZNA 5KE0A 3DXNA 1H01A 2UZVA 4DE4A 3HRBA 3GGFA 3EOCA 4CKJA 1XH6A 2J4ZA 3DFCB 5L8KA 2X4FA 2VWXA 2R3QA 2WMTA 4FG8A 2X8EA 3ULZA 2CNQA 5JN2A 4I24A 2UW9A 2OWBA 3MS9A 3SHEA 2Y9QA 4CFFA 5DFPA 3QCXA 5CQUA 3WE4A 4UXLA 4JI9A 3MIAA 5C1QB 3GCQA 4J1RA 3WIKA 2GTNA 3V8WA 2JIIA 2BRBA 4RX8A 4C59A 3MB6A 2HZ4A 4IDVA 3COKA 3P4KA 3NDMA 2FSLX 1MQ4A 3HGKA 2VZ6A 4K33A 3FMLA 3TIZA 2BFXA 4ZS0A 2PVYA 3KF7A 4WG5A 4G9CA 2IG7A 5DNRA 4PPBA 4BTJA 2DQ7X 4DT8A 5HBJA 2ITOA 3LXKA 2PVKA 3ORZA 3W2PA 4RG0A 4M8TA 3FDNA 5HGIA 3HAMA 4PF4A 3DLSA 4X0MA 2E9OA 4FKVA 4PTCA 4YJQA 2JDSA 3NZ0A 3BQCA 2GS2A 3AD5A 3HUCA 4YZNA 2CLQA 4YTHA 5K5XA 4K0YA 2GCDA 3FZ1A 3IDBA 3JYAA 4J71A 4NCTA 2WEVA 3SV0A 3PSCA 5AAGA 5I9WA 3TXOA 2XM9A
chains in the Genus database with same CATH superfamily
4DINA 2Y4IC 4IJ9A 2YM5A 5EW9A 3QTIA 4EJNA 2LGCA 4YPDA 2HOGA 3R1NA 4ANLA 2BFYA 2OH4A 3EIDA 3OY3A 5AV0A 2R3PA 4ITIA 2Q83A 1OPKA 2PUUA 2V62A 4PMMA 5CZHA 5AP0A 3ZO1A 4H3BA 4CMUA 4F6WA 5I9ZA 5L2TA 2LAVA 3BELA 3NYVA 4LDTA 3CY2A 5FXSA 2ITPA 4F1OA 4ZTNA 3IW7A 5LWNA 4FZDB 3V01A 2GU8A 3F2NA 3WZUA 2RKUA 2PVNA 3W0RA 4QPSA 3G51A 3QTSA 3EFLA 4QPMA 5AEPA 4R78A 2GFCA 2W05A 3KXNA 5CSVA 3FPQA 4HVDA 1W8CA 1YXUA 3FXWA 4BY9E 3NCGA 3LCSA 3P78A 4KIKA 4L01A 4IAYA 2VWWA 4PUZA 3BGQA 1FVRA 3ORPA 1JQHA 4TPTA 3NYOA 1M2PA 2OZAB 5AUTA 1WMKA 5M07A 3AT3A 4CFWA 4JBVA 1E1VA 3C0IA 3SC1A 3KRXA 5FEEA 1XO2B 4GUBA 2QONA 1G3NA 4HZSA 4MXOA 3PXZA 2G2FA 2ITXA 4RSSA 3I79A 2WPAA 1R39A 1XH9A 5KZ0A 1PXMA 2YM8A 2WTDA 3HDNA 3R9RA 1VYZA 5B2MA 3QCYA 3WOWA 5J9ZA 2XIKA 2CGWA 3TV7A 4BGQA 3C13A 4PP9A 4EH7A 3L9PA 4EUUA 5HCYA 4NKSA 4EH6A 3OW4A 1OBDA 4NWMA 3ERKA 3FL4A 3NAYA 4PDSA 4AXAA 3GCVA 4NKAA 3VF9A 5AV2A 2H96A 5JFWA 2J90A 1OGUA 3QTXA 4QYFA 1RDQE 4BIDA 4FIJA 2VWZA 3CLYA 4W8EA 1OIRA 4XLIA 3WF8A 4DH8A 2O64A 3MGYA 5BUJA 1JWHA 2X0OA 2CKPA 4I6LA 3AC3A 5CANA 1HCLA 2Q0NA 1V0BA 4M0YA 4Y85A 3JY0A 4R8QA 1OI9A 1YI4A 3W32A 4FEXA 5E4HA 2FYSA 2HIWA 2O63A 4MAOA 3KRWA 4KRCA 4N6ZA 3E7VA 3QD0A 4RGJA 2X81A 4JVGA 3UO5A 4FI1A 4DEBA 4E6AA 2ZM1A 4FKSA 1UU8A 1T45A 4I22A 4FKIA 4NM5A 1W2DA 4KNBA 1WBWA 4M68A 1YHSA 1J1BA 3T3VA 5EKOA 3VBTA 3VUTA 2CGUA 2PE1A 4C2WA 3T3UA 3VIDA 3ZLXA 3PVUA 4UMTA 4ZEGA 4O96A 3NW6A 3R8MA 4A4OA 3CTHA 2VO6A 3HV4A 4FSYA 3OT3A 2A19B 2EXCX 3CEKA 4WSQA 3UGCA 4UMPA 3D0EA 1P4FA 1XKKA 4FV0A 4UYAA 3QALE 4QNAA 3UO4A 2BAQA 4FEUA 4EWQA 1CKJA 3VS4A 3UZPA 4YHFA 3UTOA 3QD4A 4EC8A 1ST4A 1YOJA 4FSMA 2GNHA 3IO7A 4IJPA 3Q96A 3PLAE 3R7OA 3U6JA 4LUDA 2BRMA 1DAYA 4J99A 4PPAA 3WF9A 4Z7HA 1UKIA 4HPUE 4PY1A 3ORIA 2NPQA 3QX4A 2HZNA 4C34A 4YZBA 2GQGA 4I5MA 4YJRA 4YJSA 5KHWA 4WBOA 4O22A 4X6QC 2W1HA 2XK3A 4C62A 4HVHA 4U8ZA 5JRQA 4KIPA 3CSVA 5I3OA 5JQ5A 4EH8A 3ZEPA 3DCVA 4F0GA 2QG5A 2C0TA 4E4NA 4WG4A 5K4JA 4MQ1A 3DGKA 2OW3A 5EW3A 2VTLA 2X8IA 5IEYA 4ZSLA 5I9XA 4TN6A 4O7SA 4AN9A 1S9JA 5ANIA 2VWUA 4GK3A 3DB6A 2KULA 5FGKA 4X3FC 2R3MA 4AACA 2XANA 3RPOA 4LI5A 5E8YA 4HGLA 4JG8A 3KCKA 4O0RA 3PP0A 3G15A 2EU9A 4MEDA 3VN9A 1ZYDA 4ERKA 4JS8A 4OTDA 4IX6A 2QLQA 1TKIA 1GZ8A 4XV3A 4PP7A 1NY3A 4D9UA 4YURA 5CAOA 2QOKA 2CSNA 2YLEA 4GK2A 2ZFYA 5IQAA 5EQEA 4J98A 3IS5A 2BRGA 1BUHA 4EH3A 4QMPA 3K5UA 2WMAA 4F1TA 4CG8A 4F7SA 1UU3A 3VS7A 3RALA 3W2OA 5AUZA 2CGXA 1YDTE 4JL9A 2JGZA 3PVBA 4ZJVA 4XG4A 5BNJA 2ZV2A 5CT0A 3PE2A 5AP6A 3FZOA 3DZOA 4TKSA 5L8JA 2B7AA 3V5WA 4FSRA 2OLCA 1YHWA 4IB5A 4RT7A 3RZFA 5IISA 3GQIA 4HNIA 4I21A 4KRDA 4V0GA 4E7WA 4H36A 4RIYA 5M53A 2ERZE 3RM7A 3FEGA 1VR2A 4FT7A 3W0SA 3IECA 4FSQA 3WYYA 3R02A 3H4JA 4QMOA 4AGWA 4J95A 1IAHA 3ALNA 1E1XA 3PTGA 1Z5MA 4EOJA 3W55A 4R3RA 4QP9A 1F0QA 1Q41A 5LCJA 2PYWA 1H1SA 4AUAA 2GDOA 3DJ5A 3I1AA 4BCOA 1M14A 4YLJA 1DI8A 4AFJA 2RG5A 2CKEA 2HXLA 1UV5A 4HPTE 4NIFB 3NYXA 2FH9A 3F3ZA 3Q5ZA 1ZOGA 4RC3A 5IA3A 1W7HA 2IZTA 2R64A 4XG7A 3TACA 1V0PA 4IWPA 4M13A 4TYHB 3O7LB 2XJ0A 5EI6A 4AS0A 3PYYA 1JSUA 5L4QA 4W9XA 5LQFA 4YZ9A 3UDBA 2BUJA 3AD4A 4FVRA 2HZIA 1OKVA 2W5AA 4WA9A 3L9MA 4M0ZA 5IDPA 3ZFXA 5CF6A 2P2IA 3BZ3A 3KK8A 2C5XA 1S9IA 4JR7A 4C02A 2JIVA 4DDIA 4FV9A 4OTRA 4IACA 1DI9A 2VWIA 3Q52A 4ZIMA 1DS5A 3GI3A 1OL2A 1WBTA 4D58A 2XJ1A 1KE6A 3E63A 4I93A 4OW8A 5D7VA 1QCFA 3OF0A 4BCGA 2Z7RA 4WNPA 2PMNX 3BU6A 2WU6A 3VC4A 2V5QA 2FA2A 4FNYA 4CSVA 5CAPA 4FMQA 5IH6A 4I6FA 3UVPA 1IR3A 3GFEA 2QKRA 2RGPA 2YITA 4QDVA 4ANBA 3GEQA 3ML1A 1JKSA 3QC9A 3ZRMA 5KCVA 4U40A 2IJMA 2XAOA 3CCNA 1W83A 4BKYA 2OIBA 3NEWA 4CV9A 4F0IA 2W5BA 4OAUC 2OJGA 4W9WA 3BE9A 3BHUA 5DHJA 4PPCA 1G8JA 3GU8A 3GFWA 3A4OX 4GRBA 2HW6A 3FLZA 4EKKA 4FICA 3UQCA 4XBUA 5CNNA 5JFSA 3LFDA 2WAJA 5AUWA 5LJJA 4IAIA 3SXSA 4DN5A 4FV8A 3SG9A 4AZVA 1W2FA 3HRCA 5FBOA 3VAPA 3E8EA 3L9NA 5L6WL 2OJIA 2WNTA 3S2PA 3O71A 4ANOA 4BVUA 3ATTA 3LJ1A 3KEXA 2ZYBA 3AXWA 3ELJA 4V05A 5J5SA 4U43A 5KZIA 4IQ6A 3CQWA 3QKMA 3NIZA 2XM8A 1WVYA 2HY0A 4KD1A 4R6VA 4Y5HA 5C26A 4GT3A 2XARA 5TKDA 1JOWB 3FLQA 4RVKA 3ZO2A 4EOKA 1CKIA 3POZA 4YSJA 2BAJA 3F5PA 3OC1A 1H1QA 3QUEA 4QTAA 3CKWA 3FYJX 3A99A 4UEUA 3UMWA 4EOPA 4F9AA 3MPAA 5LMBA 2UW8A 1BX6A 4WRGA 4D1ZA 4IADA 5HU9A 3ETAA 2H9VA 5B0XA 3UIMA 2XKFA 4M69B 3C4ZA 4YSMA 2R9SA 4FKGA 2VWVA 4DDGA 2UW5A 3QC4A 3EMGA 2BMCA 3MVLA 3HX4A 3AC4A 3DFAA 2R3RA 1WFCA 4OBPA 1Q99A 3JVSA 3NUNA 4J53A 4FTCA 4RC4A 4YLKA 3EHAA 3UOHA 1OIUA 2QO7A 5JZJA 2VWYA 2R0IA 4IZAA 3DK6A 3II5A 4JQEA 5CLPA 2W17A 5E1SA 5EK7A 1XBCA 3OOMA 4JG7A 4AZSA 4BHNA 4JBPA 4V01A 4E20A 4ZJIA 3DK3A 3SDJA 3DAEA 1R3CA 3OUNB 4OUCA 3O7LD 5HNIX 4BDJA 3U9CA 4N57A 2QHMA 4FSNA 5DR9A 3HMIA 4BR3A 2F57A 3MH0A 5DT4A 5LVLA 4O7WA 4IW0A 3IW8A 4RIOA 4NH1A 5AM6A 4FZ6A 3ACKA 4G3GA 3HV5A 2E9UA 1PXKA 3QUDA 5E8XA 5GJGA 5GNKA 5BVWA 4G2FA 5CF5A 1GZNA 1OPJA 2ACXA 3N4UA 4B9DA 3C50A 3IPHA 3DLZA 4FVQA 4CEGA 5KMLA 4DEGA 5DGZA 1YRPA 2ETMA 3QBNA 3E5AA 4LMUA 4EBVA 3V04A 2OJFE 2JAMA 3QHWA 4TYGA 5HG9A 4CYIA 4EK5A 2GFSA 4XCUA 5HD7A 4ORKA 4MKCA 5I3RA 3NUSA 4E73A 4RWIA 4QMVA 4I6QA 1IG1A 4R3CA 3ZMMA 2ZM4A 3NLBA 2YJSA 4PMTA 5HD4A 1TFFA 3D94A 3QKKA 4DTAA 1APME 5AX9A 2GMXA 4IZYA 2ZV9A 3EZVA 4ZY4A 1UNLA 3BE2A 4FKOA 3SOAA 2VO3A 5DRDA 3U51A 2OXXA 4QTDA 4NYEA 4BC6A 3MFRA 4XP3A 1JKKA 4I0TA 4JDKA 3FI2A 3OOGA 4WRSA 3VHKA 3I7CA 3P23A 5IF1A 3TEIA 2ZV7A 2HK5A 4L53A 2WMRA 3O96A 4GG5A 4BDEA 1U5RA 2XMYA 5HE2A 5AR3A 4FT3A 4O0TA 1RE8A 1KOAA 4FZ7A 4PRJA 4Z9LA 4ASEA 3W0MA 4YC3A 4UY9A 5EDQA 5A4LA 3I60A 3VRYA 2J0LA 3BEAA 3BCEA 4NFMA 5DPVA 5BMMA 3AQVA 2XJ2A 1Q62A 3ET7A 4KIQA 3FQEA 4OTIA 3SW7A 4GK4A 4DHIB 4R1VA 1YW2A 2C0IA 5FXRA 2WOTA 3CD3A 2B9HA 3MB7A 4BWPA 5M4IA 4WNOA 3E92A 3AMYA 3R7EA 3TM0A 3DKCA 4CCBA 4RX5A 4X3FA 5BVKA 5EI2A 2F7EE 4I5CA 2W4JA 4ASDA 3NS9A 1QL6A 2QO2A 3W0NA 3ZXZA 5CU3A 4C3PA 3FMDA 2QU6A 5A3XA 1R1WA 3RK5A 4ACDA 4D1XA 2YZLA 3OHTA 2UZWE 4QQCA 5EHYA 1F5QA 2ITZA 3NVMB 3GC8A 2DWBA 4XP0A 3ZOSA 2BHHA 3DBFA 3TKIA 4FBXA 3H0YA 2H8HA 2R2PA 3HYHA 5M4FA 3D5XA 4QPAA 5I9YA 4DF3A 4FTUA 1BL6A 4IM2A 5HEZA 2QOIA 2QVSE 4OTHA 5IEVA 3NFFB 4P5ZA 4AOJA 4EK4A 1NVSA 4O1PA 2JKMA 5JKGA 2WEIA 4RX9A 3DT1A 4FGBA 4MXYA 3UOKA 4D1SA 3U8WA 1ZYCA 1PXOA 5EYDA 5F4NA 4UMUA 3DU8A 4RFMA 4P7EA 3LM0A 4ZLZA 4JR3A 3D4QA 1P2AA 5DG5A 4BCFA 5AR4A 3TWJA 2PVHA 4JMQA 1ZXEA 2UZBA 3QKLA 3JY9A 4I5HA 4M12A 2X2MA 5J1WA 3MY0A 3NX8A 4FYOA 1OIQA 1W98A 3C7QA 5AP4A 2XK7A 5AR2A 3D9VA 1JPAA 5HIBA 1U54A 3UVRA 1A9UA 3OZ6A 4C4HA 3PXFA 2ONLA 4I23A 4QD6A 2AEGA 4C4GA 2GNJA 2UVXA 4TWNA 2A0CX 4W4YA 4YLLA 5HE1A 3WI6A 5HO7A 2O2UA 5ACKA 3O8TA 4EHGA 5J79A 1OKWA 3V5LA 1XMLA 3HA6A 4BZNA 4EK3A 3HZTA 4MNFA 3MBLA 4JQ7A 5D9HA 1U46A 2Y4PA 4IAZA 3VUKA 4GUEA 5EQPA 4BJJA 2REIA 4O83A 4BB4A 4C2VA 4NIFA 4QNYA 3TTJA 3BI6A 2XBJA 3A7GA 5F95A 2QOCA 4RQVA 1U5QA 3T9TA 3QZFA 1Q3DA 3OXZA 3GCPA 5HORA 4U41A 4XLVA 2BIYA 4QMYA 2V0DA 4A7CA 1LP4A 2JLDA 3HV6A 4DFBA 4OR5A 2F4JA 4XH6A 5AMNA 1PMVA 4BKJA 5CZIA 4RZWA 4AF3A 3BWFA 1ZMVA 3AD6A 3EN5A 2O65A 3FJQE 4LMNA 4M15A 1O6KA 4LUEA 2GS7A 3DTCA 4F9CA 3QQFA 3MH1A 3GCSA 3PXYA 4JNWA 1H25A 3EN4A 3ATSA 4ANQA 4BBEA 1OUKA 3ORKA 1YVJA 3KXMA 4XJ0A 4XOYA 1GIIA 1XH5A 3V5PA 4LGHA 5A54A 4NW5A 2XK9A 2XK4A 2YA9A 3LCDA 4FKRA 2NP8A 3CTJA 2EVAA 2XNGA 3H30A 3P0MA 4G9RA 1SNXA 3R71A 4AT4A 3B2WA 2AQXA 2YN8A 4L46A 1REJA 2XRWA 3FI8A 1H1PA 2R3IA 2JDOA 5ANDA 4DFNA 3O0GA 3QRKA 4BCJA 4I20A 2OZOA 3C4FA 1RQQA 3G33A 3R01A 3KA0A 5AA9A 3HLLA 1JKTA 3LXNA 3TCPA 4K2RA 3Q9WA 2YHVA 4R1YA 3F7ZA 4ACHA 1J1CA 3ITZA 1OZ1A 3FSKA 3GP0A 3LE6A 3M11A 4K11A 3TG1A 4B6LA 3C4EA 4DTKA 5I9VA 4ZTRA 4R3PA 4C8BA 3TMOA 3VNTA 4NM7A 3EN9A 4R5SA 3U6IA 1YXSA 1U59A 3FWQA 3EN6A 2O8YA 4AGUA 4O2PA 1PYXA 4I0RA 3D5VA 4C4EA 2PK9A 3C4XA 3LW0A 1H0VA 3IW5A 2J5EA 3HDMA 4AN2A 5AR8A 4KKGA 4CRSA 5KMNA 2XVDA 5CY3A 1FMKA 5FLFA 4GJ2A 5BVEA 2W4OA 2QU5A 3UYTA 4O6EA 3EB0A 2VD5A 2YM6A 5AIKA 3PJ2A 5T6KA 3UPXA 2XKCA 2WHBA 1XR1A 3GU6A 1M2QA 2XIRA 4RLKA 4UYNA 4E3CA 2XRUA 1LEWA 2GHLA 2YCQA 3GUBA 1XH4A 3A7FA 4LGGA 2VTOA 4WG3A 1TZDA 2ETKA 3UE4A 4S33A 4YJUA 4BZOA 4DITA 5L6OA 3R2YA 5AP3A 4ASXA 4YJVA 5IG1A 4IVDA 3REPA 5HX8A 3S4QA 3BQRA 4ERWA 3TL8A 3LQ3A 4DG3E 2EWAA 4O27B 3WYXA 3G6GA 4W4XA 1LUFA 4MHAA 3F3TA 3NPCA 5FQDC 3C4CA 4MCVA 2G2HA 3MIYA 2VTNA 3WBLA 5BVFA 3S00A 2Y7JA 3A7JA 4JIKA 4E26A 4Y46A 4QMWA 4JIAA 5HG7A 2JDTA 2YAKA 4YBKA 4DAWA 4ONAA 4RQKA 2ZDTA 4YC8A 3CE3A 3OBJA 4BBFA 2VTSA 5JMSA 5HKMA 3KXXA 3T9IA 4JBQA 3FY0A 4QQ5A 3OP5A 1YQJA 5HX6A 4IB0A 3BX5A 3TNHA 2C0OA 2PVMA 3R9DA 1RW8A 4GH2A 2O0UA 4QTEA 5H2UA 4RFYA 4GKHA 3E3BX 3DOGA 2XK6A 3FLYA 5CTPA 3F2AA 5FEQA 3EQPA 3BYSA 2FVDA 2R0UA 4FL3A 3ZRKA 3QWKA 1KV2A 3OEFX 2PZYA 3IGOA 4GW8A 3MY1A 5HCZA 5ETAA 4AA0A 5FG8A 3EQBA 2V55A 2EUFB 2YIRA 5IDNA 4GV1A 4F9WA 2FGIA 3KMMA 3Q5IA 4GIIA 5CEQA 2C3LA 3CPBA 4FODA 4RIXB 3BYVA 3I7BA 2JAVA 3UMXA 5CS6A 2PTKA 2YIYA 4BKZA 4R7HA 2CNVA 2WMWA 3BV3A 4F0FA 2C69A 2UW7A 3LMHA 4L42A 2J5FA 4AU8A 3D7TA 4LOQA 3Q04A 3P7AA 3R04A 5J9YA 2ZV8A 1JBPE 3G9LX 4FKPA 4DHJA 1MUOA 4FGRA 4BBMA 3C4WA 3LFSA 3W2CA 4MD7E 3MN3A 3QCSA 4NJ3A 5HVYA 3PPJA 4ZJJA 5FTQA 5KHXA 3UOLA 2X9EA 3OMVA 2VAGA 4L7FA 4R77A 2ZDUA 3OXIA 1Y8YA 2VTMA 4U42A 2WQBA 2WMBA 2UZEA 1WBNA 5L6PA 3DY7A 4ZTSA 2GNFA 3SGCA 4O86A 4XG2A 4XEYA 2XIZA 5AP5A 4EI4A 4DEHA 2PU8A 3BLQA 5CU0A 4X7QA 3SG8A 3BYMA 2BZHB 4O91A 4FL2A 4FG7A 5EYKA 3PXKA 3SXFA 3QRJA 4YNEA 4DBXA 4CMOA 2HXQA 5IH4A 2I0EA 3IGGA 3C1XA 5FEDA 3SLSA 4B0GA 3MPTA 3MDYA 3PXRA 4A9SA 2W1GA 3L8XA 3PRIA 1K9AA 4U81A 1KE5A 2W96B 2YDJA 1PXIA 4FK3A 3UOJA 2OI4X 2NO3A 3MSSA 3VQHA 5AADA 1QMZA 1Y57A 1ZZ2A 4CG9A 3P79A 2EB2A 2BZKB 3FMKA 3VUDA 3DV3A 3OWPA 4NTTA 3W1FA 4O7TA 4JX7A 3E8NA 1PXLA 3SOCA 4EQMA 4E4LA 4FV3A 5I4NA 3FUPA 2KTYA 2NRYA 3CJGA 1PYEA 2FUMA 2RF9A 4O38A 4O6LA 1Y91A 4OTPA 1ZYSA 4BWXA 4YO4A 4YU2A 5IZFA 4FTNA 2UW4A 3DQXA 5HVKA 3RAWA 3BL7A 3GXLA 3OG7A 1OKYA 4TTHB 5H3QA 1Q24A 3O8UA 1H28A 1UU9A 3QTWA 2E2BA 3I6WA 4NFNA 3OVVA 4QYYA 4C61A 5TR6A 3SRVA 1UU7A 5LVPA 1ZY4A 5EHOA 2CN5A 4FIFA 1H24A 4RIWB 2B0QA 1P14A 4IVAA 4S34A 3VS1A 1ST0A 2EXMA 3DJ6A 4D2TA 5C03A 4APPA 3WZJA 4RMZA 4BRXA 3LLTA 4K1BA 5AP1A 1XMMA 3D2IA 2J0KA 2P4IA 1NW1A 4NK9A 3MW1A 3W2QA 3ZONA 3H3CA 1XWSA 3D7ZA 3PZEA 3R22A 5KKRB 2GS6A 4K77A 5J8IA 3RHKA 3KXGA 3EYGA 4ZTHA 4P90A 3TZ9A 2RL5A 4IFCA 5DT3A 3RPYA 3S95A 1YWRA 3PY1A 2VX0A 4I94A 5CXZA 2WTKB 2YFXA 3KN6A 2Q0BA 5A4EA 4GS6A 4YJNA 5CVFA 4YZCA 4AXFA 5IQCA 3POOA 3AG9A 3QQLA 3HAVA 1M17A 4C36A 4C7TA 2VGPA 5BYZA 3COHA 1G5SA 2F9GA 4FIIA 3HECA 4FUXA 4USEA 4X6RA 1URWA 3KXHA 4J96A 2GNIA 4WHZA 4WUNA 5FM2A 3C51A 4FTMA 1SZMA 4JG6A 1I44A 4MD9E 5E1EA 2YACA 3RJCA 5M56A 5IQBA 4D55A 2WMQA 3ORNA 3R73A 4AZFA 3PIXA 2C4GA 4I6BA 4F65A 1AD5A 1TVOA 4M3QA 1LPUA 2JD5A 3A60A 4QMSA 3AKJA 3NNXA 4FKTA 3EN7A 4F7JA 3KIOC 4NL0A 2J50A 5HIEA 2XZSA 3JXWA 4O4CA 2UZOA 2ZAZA 4NUSA 4YP8A 4X2FA 5CSHA 3OWJA 3UYSA 3W33A 5CT7A 5AUVA 4DG2E 1IA8A 2YM4A 1PF8A 3A7HA 1TQPA 3R1SA 2PZPA 4MNEA 5CQWA 4BFMA 5J87A 1JSVA 3UNZA 5DIAA 1L3RE 2QO9A 4LM5A 1V0OA 2PWLA 5C9CA 1BYGA 4WBBB 3V5QA 4BTMA 3L8SA 2DYLA 4UZHA 4AGDA 2W4KA 4YZMA 2W7XA 2UW0A 2IPXA 3CC6A 5A4QA 2C68A 4ZP5A 4MBLA 4FK6A 3RNYA 4OT5A 4M66A 5M4UA 4ALUA 5A6NA 3P5JC 1YOMA 1OITA 4ZTQA 3KRLA 3UQFA 2UUEA 2XIYA 4O7VA 2JEDA 5DT0A 1IA9A 2XNNA 3KCFA 4O84A 5HG8A 3FXZA 3G5DA 4AAAA 3IK3A 2Z7SA 4AA4A 3C0HA 5CEOA 3O50A 3MYGA 4Z7GA 5HE3A 5IQHA 4PV0A 3ZFMA 4IHPA 4YMJA 4NTSA 4KKHA 3G0FA 3ZC6A 2UV2A 3R7UA 1ZLTA 2F7XE 3F9NA 2C1AA 1BLXA 3R2BA 3NR9A 2C3JA 4AX8A 5FRIA 4JLCA 3QXPA 4BCPA 1GOLA 3Q2MA 2BTRA 3ROYA 4QQJA 1O9UA 5EFQA 3UO6A 2PUPA 5L2QA 3M42A 5HIDA 5BYYA 3SA0A 2C6LA 2XBAA 4BI1A 2UW3A 4USFA 5D12A 2PZIA 4MD8E 2SRCA 4ZY6A 1A06A 2QI8A 1Q4LA 2BKZA 4BYIA 2XCKA 5EDRA 3K3JA 4RWKA 4NM3A 2YIWA 3L1SA 4KSQA 4EUTA 3LFBA 3H9FA 3BKBA 3QUPA 3UIBA 3VUHA 4BCKA 4CFVA 5JGDA 2RSVA 2W06A 3NW7A 3FXXA 2C30A 3FHIA 3ZCLA 4PWNA 4YTCA 5A14A 3OS3A 5EW8A 2A1AB 3E8DA 2VX1A 4U97A 2X0GA 2IW6A 2VTQA 4I0SA 5HNBA 5IA5A 3BHVA 3W2RA 4QMUA 4L9IA 4GVAA 1YKRA 2B54A 3F7WA 3MA6A 5AP7A 1QPCA 4IZ7A 4BDFA 2XNPA 3Q32A 4YC6A 4G5PA 5M08A 3FLNC 4IWDA 4E8AA 4DG0E 2B1PA 3IOPA 3P86A 3AGMA 1J91A 2O5KA 4RA5A 3KB7A 3NUAA 5FP6A 4RJ7A 3MJ1A 4AW5A 4BDCA 2JDRA 1VLRA 1DM2A 3QTUA 4B8MA 4GYIA 4KABA 3UIUA 4GJ3A 1R78A 4CRLA 3NNUA 1Q97A 3KC3A 2B4SB 3LFQA 3UG2A 5C27A 4QP3A 4FSZA 3ZO3A 3KVWA 1FGKA 2QC6A 3K5VA 4ZSJA 4UZDA 5KMMA 4D5HA 4BGHA 5AFVA 2WXVA 4F63A 3LOKA 4GT4A 4FZFB 5FM3A 3A62A 3PE1A 2CPKE 4CNHA 5KO1A 2JIUA 1NXKA 3E8CA 2OK1A 2OKRA 3EWHA 3QCQA 1SM2A 3GC9A 2YIXA 4UALA 2XUUA 5GHVA 2GQRA 2Y8OA 5BVNA 3KK9A 3QL8A 3W2SA 4CZYB 2P55A 4U45A 4U5JA 3VUMA 3GOKA 4FKWA 3EJ1A 5KUPA 5JGBA 1J7LA 2YJRA 1XBAA 4OTGA 3FI3A 3MA3A 1PW2A 4U7ZA 3WF7A 1OB3A 4QP2A 2YIQA 3DZQA 3PJ3A 3GC7A 2VTAA 4FV4A 2R4BA 3LQ5A 3DBQA 4FEWA 3R00A 3R83A 4G5JA 1A48A 3BHTA 2J51A 4OTFA 5E7RA 4B7TA 4FG9A 3ZTXA 3OT8A 3ANQA 3R7VA 4Z55A 4DH1A 4FV5A 4ITJA 4YUQA 5L2IA 4KUJA 3QZIA 4E6CA 3TNQB 2W9ZB 1G8SA 4JXFA 3F69A 2W1FA 3LFNA 3W0PA 2RFSA 3WZKA 4H1MA 2HCKA 2C47A 5A46A 2ITWA 2W9FB 4FT9A 4TRLA 4FTAA 3CKXA 4CLJA 5JEBA 3TI1A 5BMSA 3LXLA 5M55A 2R3LA 3TZMA 1GNGA 5IQIA 1GJOA 2EB3A 3CD8A 1XH7A 5GIOE 4O4DA 4QMMA 5E8SA 3RP9A 3Q3BA 4FYNA 3OY1A 4H3QA 4R5YA 3F61A 4X2JA 1ATPE 3VHEA 3RAIA 2OZAA 2YWPA 4MK0A 4L6QA 3W8LA 3N4TA 3ZRLA 2F2UA 4YTFA 2CKOA 4JRNA 4N0SA 4O7NA 4CQEA 1WBOA 3UQGA 4L68A 4E4XA 5H9BA 4AGCA 4WNKA 4K9YA 2CKQA 4DCAA 2OICA 3UVQA 4IM0A 3Q6UA 5FTOA 4E5BA 2OGVA 2NYAA 3L8PA 2PSQA 4QP1A 5EYCA 2X7GA 4FX3A 2ITYA 3BLHA 3U87A 5BVOA 2WOUA 2Y6MA 4O0UA 4ZSAA 5CI7A 4QRCA 4FIHA 4PDYA 3WARA 4QEBA 3EL8A 3QFVA 3RMFA 4O82A 1BI8A 1GY3A 4KS8A 2FO0A 4GFOA 4EOQA 3ZM9A 2IVUA 4U44A 2BVAA 3AKKA 3AGLA 5LMKC 4BF2A 3PA4A 2XEYA 3EKKA 3PA3A 4BDKA 4CMTA 1GAGA 4IBMA 4GIHA 5G6VA 4BDAA 2XS0A 4W4WA 3VBQA 4P4CA 5ANGA 3VW6A 3PA5A 4FZAB 4D0WA 3AT2A 4LYNA 4MWHA 4PMSA 4F64A