5M53A

Nek2 bound to arylaminopurine inhibitor 11
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
272
structure length
255
Chain Sequence
DYEVLYTIGTGSYGRCQKIRRGKILVWKELDYGSMTEAEKQMLVSEVNLLRELKHPNIVRYYDRIIDRTNTTLYIVMEYCEGGDLASVITKGTKERQYLDEEFVLRVMTQLTLALKECHRRSDGGHTVLHRDLKPANVFLDGKQNVKLGDFGLVGTPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFRRIPYRYSDELNEIITRMLNLKDYHRPSVEEILENPLILEHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/inhibitor
molecule keywords Serine/threonine-protein kinase Nek2
publication title Structure-guided design of purine-based probes for selective Nek2 inhibition.
pubmed doi rcsb
source organism Homo sapiens
total genus 90
structure length 255
sequence length 272
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2016-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5m53A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5m53A01
3E8CA 2F4JA 2ITWA 3MS9A 3PZHA 5A6OA 4X6QC 4WO5A 1CKJA 4QMXA 4BCNA 3HX4A 3MB7A 3C4ZA 3EQCA 2O2UA 5GZAA 4U7ZA 3L8SA 3OZ6A 4K1BA 3C4XA 5IQFA 2VNWA 4AP7A 4FBXA 4E6QA 4ANQA 3D5UA 4J1RA 4PP9A 4HOKA 4U45A 4D2TA 4BDAA 4R3RA 3WF5A 3Q96A 1BI7A 1H0WA 3GQIA 5HG5A 2UZUE 3NWWA 2Z7LA 4FIHA 3V04A 3HRFA 4EK5A 1G8AA 1FVRA 1L3RE 4C33A 3SLSA 2P55A 4ID7A 2Q0BA 3V51A 2HW6A 5FBOA 5HCZA 3B2WA 2ERZE 1YKRA 3KF7A 4IE9A 1H4LA 2GQRA 3ENHA 2B4SB 4YJSA 5EG3A 4AZSA 5DT3A 5C9CA 2OXDA 3PPJA 4O2PA 2VUWA 5ANGA 3U54A 4WBOA 3UMXA 3NYOA 4V04A 4BRXA 2BUJA 2YM4A 2QKWB 4IAIA 3I60A 1Y8GA 2YLEA 4Z7HA 3EFWA 4YJQA 2A19B 4QYGA 3RNIA 4O7TA 5L8LA 4G1WA 1GJOA 2CGXA 2PVFA 3NUYA 2OU7A 4CCBA 4XX9A 5E92A 1UKIA 1JBPE 3QFVA 5CS6A 4RRVA 4JG6A 5J95A 3SXRA 1XBBA 3KN5A 1IAJA 4NFNA 2FGIA 2R3JA 3QYZA 1B6CB 4JDKA 3VNTA 3SGCA 2JLDA 1H07A 3ITZA 1V0OA 1YQJA 4F7NA 3DS6A 4MD7E 4DE4A 3L9MA 3DOGA 2OLCA 3CKWA 1QPEA 5CEMA 4RVKA 2BAJA 3ZC5A 1KOAA 2R3OA 4OT5A 4AT5A 1YXXA 1NW1A 5AR3A 4TKSA 3DAJA 4IZ5A 3DB8A 4H1MA 2DYLA 2IO6A 4BDIA 4FKVA 3DV3A 5L6PA 2XKFA 2PL0A 3BEGA 3DLSA 4FSNA 3ANRA 3BGZA 4FZ7A 2FH9A 2BVAA 5LARA 2C47A 4CFMA 2BDFA 1JSVA 2X81A 2VO7A 4N0SA 2YABA 5CI6A 2GQGA 2X4FA 3FLZA 4YLJA 2F7ZE 3AC5A 1Q8ZA 4JBVA 3QBNA 4TNDA 4E6CA 2I7QA 3ID6C 4YTFA 5IKWA 2XBAA 4QQCA 1G3NA 3CC6A 5HG9A 2OJ9A 5T3QA 1RQQA 3R7UA 4F65A 4KUJA 4OTHA 1X8BA 3KEXA 3MH1A 1QPJA 3TG1A 1ATPE 4CMTA 3O2MA 3DKCA 2PUIA 3BGQA 3OWKA 4IAZA 4ITIA 4R1VA 4EI4A 4F7LA 4R7BA 1Q8TA 4N6ZA 5LMBA 1H1RA 2UZNA 2IWIA 3QCSA 5E7RA 4LI5A 3W2CA 3PA3A 4YMJA 3LFFA 5M09A 1PMVA 2W9FB 3LMIA 3FI4A 3Q4UA 2BRBA 4UMTA 2W1IA 4P5ZA 5IA5A 4XBUA 5KX8A 1TQIA 1H08A 4KS7A 4TRLA 4DGOA 3V8WA 3SDJA 3C9WA 2PU8A 3VUMA 3PIZA 4RJ6A 4UWYA 3PDTA 3SXSA 4KIPA 2QG7A 3ORLA 3LCOA 4YHTA 4W4VA 5IUHA 1FMKA 1JKTA 3G9LX 4FYOA 3VS6A 2CLQA 2QOFA 4X6RA 4WG4A 3MH2A 4IJ9A 4QD6A 2W06A 2OZAB 5FXRA 2YERA 4MQ2A 4FG7A 5HKMA 1ZY4A 3KULA 4FTUA 4DTKA 1Q8YA 1W82A 3W2SA 3UPXA 3FC2A 2WTCA 3TIYA 3UGCA 4UBAA 3FY2A 4O83A 4AE9A 3QGYA 3QQUA 4FTNA 3ZHPC 5IH5A 5T68A 3Q3BA 3PPZA 4IVAA 3PG1A 4NWMA 4YHFA 3UQCA 4M13A 4G16A 4YZNA 2VWVA 4I94A 4Z7GA 4M0YA 3FHIA 3FV8A 2VX3A 2PYWA 4ALVA 4CG8A 4IAKA 2BHEA 3PTGA 2VZ6A 4N70A 4RWLA 4PDYA 4FR4A 3SG9A 4WOVA 2QODA 4EQUA 3HAMA 4FZAB 5TE0A 4IZYA 3UNZA 2B55A 4FTCA 3UVQA 4EZ5A 2R0IA 1M2PA 4FV1A 1WCCA 1YI3A 2E9NA 3LFCA 4S34A 3FI3A 4FTRA 2P33A 3QQHA 5L2QA 4BGHA 5IPJA 2WIHA 2QURA 5C8NA 3GP0A 1R3CA 3ZC6A 5CNOA 4PP7A 5HX8A 4EORA 3Q5ZA 1BLXA 3UP7A 1OVEA 2BRMA 3LMGA 4RWIA 1YOJA 3BU3A 3JXWA 4FK6A 5AV1A 4DG0E 4DEBA 3ULZA 4LRKA 1YDTE 3CTHA 3LIJA 1SVGA 4M84A 4NM7A 4QTAA 1EH4A 4HZRA 2GHLA 5K4JA 4ITJA 1M14A 4RIWB 3MA6A 5M4UA 5CSWA 3DTCA 4DC2A 1YVJA 4U81A 1QPDA 3EQIA 4RIOA 5IQEA 5DA3A 3F9NA 2JAVA 1NY3A 2R3RA 3QTZA 5IQGA 1WMKA 4GMYA 2O5KA 2WU7A 4OLIA 2BHHA 3MI9A 4FF8A 2FSTX 2IW6A 4RX9A 4CFNA 4LMNA 1NA7A 2B1PA 3V8SA 4EH9A 2OW3A 2QHMA 3A99A 3R9RA 2AC5A 2VTSA 2Y6OA 2FYSA 5F9EA 4TWCA 2C30A 2E9OA 1FQ1B 3NRMA 1P4FA 4RPVA 3AD4A 4WUNA 3B2TA 5CI7A 4EH5A 3R8LA 2C6TA 1J91A 2ZV2A 1PMEA 3ORIA 4C7TA 4J8MA 3LXPA 3R8UA 4PPCA 1SVEA 3ZFMA 2B9IA 2X8DA 5IA2A 3TJDA 4XS2A 5LCJA 4PMTA 2AUHA 2A27A 4BL1A 1PXKA 1K9AA 4BCKA 4NK9A 4EZ3A 4FG9A 3OTVA 1MQBA 3CY3A 3NCZA 3FKNA 3FZPA 2EVAA 1Y8YA 2UZOA 2XIRA 4DEEA 3P5KA 4BWKA 1KE6A 4PF4A 4PX6A 4ZY6A 5HO6A 2Z7SA 3DZOA 2UVXA 2JBPA 2O3PA 3HA8A 1PYXA 1YDRE 5TF9A 2X39A 4JOAA 3LCKA 4S33A 5CXHA 3MSSA 5AV4A 5F4NA 4XG3A 1LEZA 2VGOA 4D5HA 1FPUA 4KIKA 5EFQA 2OICA 1XQZA 3AD6A 1DAYA 4RFYA 3RM6A 3C50A 3UPZA 2PVJA 4DINA 4HGTA 4OTIA 5D10A 1ZAOA 2UZDA 3LW0A 3ZBFA 2W9ZB 2QG5A 2BALA 3GOPA 4JQ7A 4MK0A 4DYMA 4EH2A 4CKIA 2YIRA 4EH3A 1JVPP 3WBLA 2O0UA 4Y83A 5EYCA 4DG2E 3KRXA 2P2HA 3OWPA 1UU8A 3NYNA 5CAPA 2RKUA 3BRBA 3N51A 3OTUA 4FVRA 3TZMA 4DLJA 3T3UA 1AD5A 1VYZA 4PL3A 3RCDA 2R3MA 3A2CA 4QP6A 4BICA 3TNQB 2J0MB 2AYPA 1IASA 2VTNA 4HYIA 4R7HA 3E8DA 3V6SA 3MVHA 2C5YA 3S1HA 4LUDA 4C61A 2GPHA 2XKDA 4AXAA 3S2PA 4BDHA 2YCSA 5HVJA 5C03A 4EOMA 3KY2A 4HCUA 3KU2A 2XK9A 3QX4A 3IG7A 2H8HA 3NW5A 3GC9A 3E8EA 4JQEA 4LMUA 4XP3A 5I5ZA 3E87A 3ULIA 1OKYA 3H9RA 3JS2A 3PWDA 3W8QA 3UTOA 2X7GA 2NPQA 4TYHB 5J9YA 3FQSA 4F9CA 2C1AA 3BE2A 3IDBA 4M12A 1ZWSA 2BROA 3D83A 3MESA 3D7TB 4D4YA 3UQGA 4MTAA 2ZYBA 1JWHA 3PSCA 3SXFA 4OBQA 1REJA 5F94A 5A4TA 4WBBB 1A9UA 5I9VA 4FV2A 2GNGA 2OH4A 3LFSA 2WMXA 3E88A 4FL2A 4RX8A 5I9ZA 2C3JA 2J5FA 2WQOA 5B0XA 3SW4A 3TV4A 2QVSE 3D94A 2E2BA 2R3NA 4J99A 4AW5A 5CAVA 2ERKA 2P2IA 2VV9A 3AC4A 4Q5EA 1OECA 3COMA 2XM8A 2CCHA 1KE9A 4Z3VA 3E5AA 3NCGA 5KHXA 3DQXA 3RZBA 3PUPA 4FTKA 3OFMA 3LKMA 4IB5A 3OT3A 4G6NA 4DCEA 2WU6A 2B54A 4X3FC 4EL9A 2Y0AA 3NUPA 3QZFA 3W1FA 2OO8X 3ZSIA 4BDFA 4FNZA 2RG5A 4AZVA 5AUTA 2BRGA 3BPRA 4U0IA 2R3LA 3BWFA 5BPYA 3NSZA 4NTSA 5I0BA 4EOLA 1W83A 2G2HA 4QQTA 2UW6A 4QP1A 2OJJA 2IG7A 3MIYA 3ZO2A 1K2PA 5HZNA 4PDPA 4FA2A 3NDMA 2WMTA 5E8SA 3RVGA 5EH0A 4I4EA 3ATSA 2QR7A 4FSZA 3N4TA 4BDKA 4EQMA 3OVVA 1JOWB 2F7EE 2JAMA 3ODZX 3MDYA 4A9UA 3JY9A 3LMHA 4LV5A 3CE3A 4W4XA 5DT0A 4YSJA 3UVRA 3IOKA 2W1ZA 3P4KA 3QA8A 4ZSJA 4JBOA 3FPMA 1J7LA 4G31A 3TN8A 4BCJA 4HYUA 2X0GA 3KCFA 1GZ8A 3TNHA 1GZNA 3ANQA 3IGGA 4JI9A 4AT3A 4D0XA 3ET7A 5HU3A 5A9UA 4NL0A 4DGMA 3PIYA 4OAUC 3MTLA 1UU3A 3EQDA 4JBPA 5BVEA 3UIUA 1H26A 4XBRA 4BCPA 1OITA 2EXMA 2V7OA 2QOQA 4RWJA 5HX6A 1MUOA 2BZHB 4PPAA 4XCUA 2WO6A 2XIZA 5IA3A 3BKBA 1P4OA 3C4FA 4UWCA 3VQHA 3ZTXA 4FEXA 3JPVA 2AC3A 2VWIA 4GT5A 1ZYCA 4Y46A 3VWAA 4D4VA 3ZO1A 3UP2A 2OH0E 2X8EA 3LQ3A 3EMGA 3PXQA 4P5QA 2O8YA 3VBQA 2C1BA 5CSXA 4L52A 4AGUA 3Q2JA 1OUYA 4G5JA 4NCTC 5GJFA 1ZMWA 2NRYA 3G15A 1GIHA 4IADA 4U9AA 4GJ3A 3EN5A 4L67A 5K5XA 4E26A 2UW7A 3QXOA 4KBAA 4EONA 5JGDA 1SVHA 4NIFA 4W8EA 5LMKC 2HZ0A 4FEWA 5AP6A 1SNXA 3MPTA 4EH4A 3QUEA 4YZDA 5F20A 1B39A 2A4LA 2GSFA 4XV3A 4YPDA 5E4HA 1NVQA 3WZJA 1LP4A 4FSQA 5AP4A 4QT1A 5DOSA 1WVWA 4L53A 1H27A 3MFTA 3MV5A 3F7WA 3OUNB 4DAWA 4RFMA 1NVRA 4XG8A 1Q61A 5FM3A 3VO3A 3VS4A 3CJGA 1QMZA 2QQ7A 4MX9A 2PUNA 4I20A 2XS0A 5JGAA 3RHKA 4EUTA 4DH7A 4I93A 4CQEA 4FKLA 4GUBA 4I5CA 5E8ZA 1CSNA 2ITQA 3CP9A 1ND4A 4YNOA 4O0VA 3TJCA 3UYSA 2RIOA 4ZJIA 1V1KA 3ZONA 2IN6A 3OY3A 3TKUA 4QMYA 2WEVA 3H9OA 4MVFA 2GCDA 3Q5IA 3PWYA 2CHLA 3KULB 1OKVA 2XK7A 4ZLYA 3FHRA 3ZCLA 3SHEA 4JX7A 4DH1A 5M4FA 3LXNA 3R73A 4YJVA 4L7SA 3BYOA 2YAKA 3R8PA 4HPTE 4V0GA 3WI6A 3ZXTA 3V5WA 2YM8A 3IW4A 3KQ7A 5HCXA 1ZYDA 4B9DA 2X1NA 4XV9A 5L8JA 3VW8A 2X7OA 3FQEA 4D58A 5DHJA 4L44A 5JFWA 4Y95A 4RJ5A 3D4QA 3I5ZA 4U5JA 1FINA 5AP0A 3QUDA 3KB7A 4A4OA 3BQCA 2XNEA 4I24A 4J71A 2Z2WA 4DLIA 4TZRA 3NS9A 1PRYA 3VBVA 5EW9A 4DEIA 3FL5A 2OGVA 4U43A 3ZDUA 2XP2A 4ONAA 4A9TA 3BV2A 2JDRA 4DGGA 3CS9A 1APME 4EJ7A 2Y9QA 2I6LA 5IEXA 5CALA 3KRWA 3IW7A 4K18A 4O0RA 3ZDIA 1M2RA 1GIIA 5AR5A 1DM2A 5FTQA 1F0QA 2X7FA 3R1QA 4N4SA 2XRUA 2KTYA 3NMUF 2X2LA 5AR8A 3V01A 3A62A 5H3QA 3CPBA 1OIQA 3K5VA 4B7TA 3BLQA 3I6UA 2PTKA 1BMKA 3P23A 5D1JA 4E4MA 2PUPA 2E9UA 1PMNA 2EB2A 3QTXA 4TYGA 1T45A 2C5XA 3IOPA 4AQCA 4F1TA 4TNBA 1GY3A 3VS0A 2JKMA 4GFGA 3QTUA 5EM7A 1ZY5A 1WZYA 2XF0A 4YC3A 3TACA 3WF8A 4R1YA 3R83A 3R8MA 3HV6A 3WYXA 3LZBA 3HGKA 5HTBA 2YISA 2UVYA 2V22A 3OROA 4KKHA 5GJDA 4GYGA 5HTCA 4IW0A 3HMPA 4C2WA 2PHKA 1SZMA 3DDQA 3HZTA 4UWBA 3OWLA 2BFYA 5ACBC 3WF6A 3AGMA 3RCJA 4DCAA 4TWNA 1XJDA 1YRPA 3DDPA 4RVLA 4FV5A 4A4XA 4PNKA 2YDKA 5TT7A 4N6YA 2IW8A 4UN0C 3EFLA 3FWQA 2ZOQA 1OIYA 4QTEA 3COIA 4L45A 4YJTA 5BYYA 3QYWA 2R3HA 3JVRA 3PYYA 1G5SA 4F70A 4PL5A 3GNIB 4QYYA 5J5SA 2QOOA 1R0EA 2YDIA 4HVIA 3RMFA 2GNIA 5H8EA 5M06A 5E8XA 1MRYA 5LOHA 3WE4A 5CTPA 3RZFA 3A8WA 3PY1A 5EHOA 3HDMA 2QOIA 4IM2A 2A2AA 3ZMMA 4CFUA 1GNGA 4YNEA 1PXIA 3GUBA 3QF9A 2ONLC 2PULA 1P2AA 1QCFA 2JEDA 2W1DA 1FVTA 2BR1A 3OOGA 5G6VA 3U9CA 2C0OA 4DEHA 4QTDA 3Q32A 3CY2A 5J8IA 2DQ7X 3BLRA 3OUKA 5M07A 4APCA 5AUZA 4BCQA 4G6LA 4HW7A 4C37A 3VVHA 3ALOA 4WNPA 3FQHA 4ZTNA 5FP6A 4FTOA 3RP9A 2WTWA 1WBNA 3F3WA 2VNYA 3NNVA 4QPAA 4I21A 3L8VA 4JRNA 3HV3A 3MTFA 5EI2A 3MYGA 4ZJJA 3U6IA 2BAQA 4KIKB 2ITVA 4IVCA 4WSYA 5JKGA 2X9FA 4YLKA 4X7QA 3SKCA 1XH9A 3NYXA 1F3MC 2IVSA 5AP3A 3DNEA 3BLHA 3F66A 3E63A 2E9PA 3O7LB 1ZMUA 1O6LA 4QMUA 5GZ9A 2VAGA 5IEVA 5J79A 5L6OA 3FMJA 3ZRLA 3H30A 3K5UA 3ZLYA 4GK2A 2QCSA 5KUPA 2GS7A 5AMNA 3EWHA 3IPHA 5EI8A 3LVPA 5K3YA 4BDBA 3ZUTA 4D0WA 3NNWA 2IPXA 3DAEA 3QQKA 3QHWA 3BE9A 3ORPA 4R7IA 1J7UA 5CX9A 3C5UA 3OXIA 4DH5A 3QGWA 4FIGA 1IR3A 2J90A 4CKJA 2XKEA 2YIQA 3U51A 2Y4PA 1XBAA 2VTTA 5D9HA 5HBJA 4DGLC 2V62A 3EIDA 3LQ8A 1OPJA 4QMOA 4AZEA 4C4GA 3NUXA 2VTQA 3DK3A 4KD1A 4ZMFA 3NVKI 2H9VA 2DUVA 3T3VA 4AS0A 2ZV8A 3ORZA 4RJ4A 4BDEA 1I09A 4EWHA 4KWPA 2WOTA 4F7SA 1V0PA 2YEXA 3R9DA 4O7YA 2XZSA 5HNIX 3DPKA 4M97A 4AFEA 3PZEA 5KMNA 4QPSA 5DR9A 4CGAA 4IB3A 3BHUA 4ALUA 3R8VA 5JT2A 5IQIA 2B52A 4TN6A 4QMSA 3G5DA 4M15A 3ZFXA 4YR8A 4R3PA 2RF9A 4N57A 3ETAA 3ACJA 3O96A 4TY1A 4NZWB 5JZJA 1E1XA 4CZYB 1PXOA 2HYYA 4JJRA 2O63A 3TNPC 3E3PA 2XEZA 4MQ1A 5DH3A 2R0UA 4D2PA 3DXQA 3C0GA 4UZHA 3TV6A 3GCSA 5FEDA 5BX0A 3PXKA 3P7CA 4CV8A 1WVYA 5AV0A 3EZRA 1Y91A 4O27B 3QQFA 4DGNA 3ZM9A 3R1SA 2XRWA 1WVXA 4Z16A 4UZDA 3RKBA 3MVJA 5CVFA 3AT4A 4FSTA 2JD5A 4EWQA 5AA9A 4XG4A 3F5UA 3BZ3A 4FTQA 5FUTA 5IQDA 1ZLTA 2XJ2A 2C6OA 2QKRA 3BX5A 4YJUA 2PMLX 2O64A 3GCPA 4ZTHA 2ETRA 4QNYA 5CYIA 3DGKA 3NUNA 4I4FA 2W1HA 3KXNA 4LGGA 2IJMA 3V6RA 4A9RA 4ENXA 2PE0A 4BB4A 1KE7A 4AA5A 3LQ5A 2BPMA 4GU6A 3U4UA 2CKOA 2PVKA 1WFCA 3LJ2A 5C4KA 5FBNC 5CENA 4TYIA 1Q8UA 2P0CA 3MIAA 2G2IA 2PWLA 5JQ5A 3TUBA 3ZO3A 4O7WA 1UA2A 3F6XA 3Q52A 5IZFA 3R1NA 1KWPA 2FB8A 2ZM4A 3OXTA 3AD5A 4F0FA 4B99A 3EKNA 1DI9A 4B8MA 5HI2A 4BBMA 2YFXA 2I0EA 3FJQE 3D2KA 4EKKA 4HNFA 3DBQA 4RFZA 4GUEA 2R3IA 1UVRA 2XK4A 3G2FA 4FNYA 4J53A 1B38A 5TO8A 2JITA 3RPSA 2HCKA 2W5HA 1XO2B 3KVWA 4IX3A 4DT8A 3Q2MA 4KA3A 1VEBA 5HNGA 3C4WA 3KF4A 3R7YA 4OTQA 3S4QA 4BI1A 3TWJA 4AAAA 5GJGA 3N4UA 2XNBA 3KCKA 4I0SA 3UO4A 4YZCA 3BHHA 3EJ1A 4I0TA 2YN8A 3AMYA 3MY5A 4CFVA 2C68A 4FL3A 5I4NA 3LFDA 3QTSA 4LL0A 5CEQA 4YBKA 3IKAA 4QO9A 2ITYA 2WTDA 5HCYA 3PY3A 4IZAA 3O8UA 5C4LA 1XH5A 4BZOA 2YIWA 4JRVA 2FSMX 4JG8A 3TUCA 4WHZA 4F9AA 3TXOA 3IK3A 3FMMA 2WMBA 4ARKA 3P9JA 3EOCA 1BL7A 5JFXA 4FTTA 3MN3A 4OAVB 2C0TA 4FIIA 3IONA 4QMLA 5ANKA 5EW8A 4FI1A 4ASZA 3D14A 4BKYA 1OBGA 2B9JA 4MWIA 2J51A 4WSQA 4CFXA 4F6WA 3KXZA 5AEPA 4NIFB 4EHZA 4GV1A 4L9IA 3W16A 1U46A 4RJ3A 4FIJA 4FUYA 4CVAA 1BKXA 3FYJX 2OJFE 4WUAA 2YLFA 3VW6A 3CTQA 5JEBA 4OBOA 1NVSA 3MJ2A 1Y57A 4GSBA 4PRJA 4RG0A 4CQGA 3AC1A 4G3CA 2WPAA 3DLZA 3EZVA 4ZTQA 5LVPA 5DRBA 4CMUA 4CTCA 3ORMA 4PDOA 3THBA 3R28A 3VUGA 1UV5A 4ZIMA 4R77A 3A7JA 5DWRA 4QP2A 2QOLA 3VIDA 3ZS5A 4F9BA 5AP5A 3C13A 4MD9E 3GCVA 3WARA 3ZYAA 4QQJA 5KBQA 5HGIA 4P4CA 5L3AA 1J7IA 2BCJA 1JNKA 1LUFA 3ZLWA 4C2VA 4C4JA 3HUCA 4XG9A 4K0YA 5CT7A 3VS2A 2YZLA 4GYIA 4IXPA 1U54A 2ZJWA 4OT6A 4IVBA 1KSWA 3QQLA 4F9WA 4DEAA 3QZIA 4NW6A 5DEWA 3QTQA 4V0GB 4CLJA 3AT3A 5KKRC 2EUFB 5KMLA 3OCSA 3UO6A 2HXQA 4MXYA 5AWMA 4D1ZA 3QTIA 3HECA 5EKOA 3LCTA 4AE6A 3TM0A 3G0FA 4K33A 1KE5A 5M57A 4OTDA 3FKOA 2J50A 4M7IA 3EQPA 5CU6A 2WMWA 3M42A 2OWBA 4OGRA 2YCQA 4W8DA 3S00A 2WKMA 3HVCA 1ZOHA 5IU2A 3NIEA 5AM7A 4JAJA 4F1MA 1OPLA 3LM5A 4XYFA 3C4CA 3RGFA 4QYEA 3DZQA 3LXKA 1H25A 1HCKA 2YWPA 2OG8A 2VX0A 4NJDA 4QP3A 3W8LA 4RIXA 4ZJVA 4LG4A 3PIXA 5A4QA 5E90A 1Q24A 4NTTA 2PY3A 1PF8A 3F88A 2XCKA 5IH6A 5LVMA 3ERKA 3FPQA 4DFBA 2J9MA 5FP5A 4MCVA 2R3GA 3FLWA 3QZGA 2YDJA 4GU9A 3LPBA 5FWKK 3QU0A 5I9XA 2BTRA 4Y5HA 5IEYA 4AW1A 5JRSA 4BCIA 2BIKB 5E8YA 4IWOA 4E6AA 3GB2A 4MNEB 3WILA 3FZ1A 4CZTA 1XKKA 5IQCA 5FG8A 4JR3A 2G2FA 4O1OA 1Q97A 4BHNA 4TPTA 3SRVA 4BWPA 5C26A 1L8TA 2GNHA 4XP2A 3RAIA 1YXTA 2OIBA 1CM8A 2FSOX 3AOXA 4GKIA 2BTSA 4DH8A 3DFCB 4NW5A 3WIGA 4M14A 3MA3A 2H96A 4FV7A 4XG2A 5LVNA 1H00A 4BC6A 3W55A 2BILB 2ITXA 5BYZA 1RW8A 4D1XA 3PJ1A 1OL7A 1R39A 2WGJA 4NKAA 3RALA 4ANSA 5IDNA 1URCA 5GIOE 4DFZE 3LFQA 3CGFA 3JUHA 5CU4A 4O0WA 4TT7A 4L00A 2I0HA 3QC4A 4MH7A 4ZLZA 4JIAA 2GFSA 4G3DA 2G1TA 4CCUA 4DEGA 2RG6A 3QTRA 4XLIA 4MXOA 4YTHA 5JH6A 1OIRA 3MY0A 1W98A 3KVXA 4UMPA 2R3KA 2CN8A 3HMMA 5IMEA 2Y4IB 5ACKA 3R00A 2WIPA 4H3PA 4WNOA 5AP7A 1PKDA 5HD7A 2YIYA 4DF3A 3MWUA 4FKOA 4KRCA 4NUSA 4O1PA 4EOOA 1QPCA 4RA5A 2YAAA 3C5IA 2PVNA 3D5WA 4RVTA 4OTGA 2QHNA 5H8BA 3HMIA 4MXZA 2OXXA 3OEZA 4E3CA 3ODYX 4LOQA 2J0LA 4YP8A 4YZ9A 5FXSA 2ZMDA 1R1WA 4WNKA 3D5XA 3AXWA 3CGOA 3KA0A 3NPCA 4ZAUA 1KV1A 1MQ4A 2Q83A 4UYNA 2BAKA 3BHTA 4TWOA 2W0JA 5HG8A 1BI8A 2XJ0A 5IF1A 4M66A 3FE3A 4DFYA 4B4LA 4EOIA 2BDWA 4D55A 3NGAA 2B53A 2IVTA 4IJPA 5E8WA 3RWQA 5AUYA 3DA6A 1ZOEA 2GNLA 5DIAA 4CEGA 2J0JA 3DBFA 4DFNA 2Z8CA 3QHRA 4BDDA 5DEYA 4ANNA 3ZZEA 4ERWA 2YJSA 3CJFA 3ZLSA 3VS3A 5FTOA 1WBSA 3BU6A 3O23A 3D2IA 1CKPA 2WAJA 1PY5A 5L2WA 5CEOA 3BELA 3RNYA 1ZYSA 3F2NA 5HO7A 4GG5A 4IWPA 3I81A 2CGUA 4QP9A 3RAHA 4I3ZA 1Q8WA 4FMQA 1OL5A 1YHVA 3R8ZA 3DXNA 5CSHA 2WTJA 5BNJA 4JL9A 3ORXA 4G3GA 4EK8A 4QTBA 2W99B 2WMAA 5DBXA 3RI1A 4ANOA 3PA4A 3B8QA 3A60A 4I6QA 3TZ8A 4IDTA 3N9XA 1CKIA 2HZ4A 3QC9A 3ZFYA 3TUDA 2QO9A 1JLUE 1HOWA 3A4PA 4MD8E 4USFA 3CQUA 5K5NA 1H1WA 5A6NA 2V0DA 2J0IA 3BHYA 3PY0A 3SG8A 4CSVA 2WXVA 3UOKA 2NP8A 4O2ZA 1REKA 2GQSA 3TKHA 5BVKA 5CVHA 4EJNA 2QOBA 3EL8A 3EQRA 4O0XA 4R8QA 3NW7A 5CU3A 2ETMA 2WELA 2XK3A 3GT8A 2PZYA 4FNXA 4K8AA 2QOKA 5ANDA 4I6HA 4FVPA 4KKEA 5CEIA 3KMUA 1JAMA 2JIUA 2Y8OA 4IAFA 2QU6A 5AAFA 3E3BX 4NSTA 3VS1A 4FSYA 3VN9A 4CG9A 2JDOA 4IB1A 4H3QA 4UX9A 2XNGA 3OMVA 4BCHA 4D2SA 5CAQA 1PW2A 1Z5MA 4NM0A 3WYYA 5HORA 3NVMB 4RZWA 4YLLA 2Z60A 5J9LA 1TKIA 3P08A 3QAME 3EN4A 4MNFA 4E4XA 4ZS0A 4YZMA 3RWPA 5E9EA 1H0VA 1I44A 2OFVA 5L4QA 4BYJA 2W1EA 4XG7A 3DCVA 3MFRA 4E5AX 1XH8A 2ITTA 4FZFB 2GTNA 4IC8A 2F57A 4IMYA 4RVMA 5F95A 1UU7A 5M55A 5D12A 4J7BA 5BVNA 3UE4A 2XUUA 3RHXA 1UWJA 4EH7A 4BKJA 4C34A 3QLFA 3OXZA 2W5BA 3NW6A 4CT1A 4KSQA 3MFUA 2NO3A 2V5QA 5DI1A 4NM5A 4EHGA 3GBZA 4IAAA 5F1ZA 2WFYA 3GFEA 3U87A 4C35A 3R7EA 2E9VA 4ZTSA 2PZRA 5IQAA 3BYSA 4ACGA 4M3QA 2ZB0A 3R02A 4FV4A 4BN1A 3FEGA 1IG1A 3G0EA 4GEOA 1RE8A 3C7QA 5KZIA 4C8BA 5JSMA 5A4EA 4WT6A 3UDBA 3T8OA 4G9RA 1E9HA 3BQRA 4FG8A 4X2KA 1ERKA 4DH3A 5A46A 2JDVA 5BVDA 3FLYA 3FLNC 4KNBA 3CTJA 3HRCA 5ETIA 4AN9A 2OZOA 4C3RA 3K3IA 4X2GA 5ANIA 4O0TA 3SQQA 5HE2A 3EKKA 4W4YA 4G9CA 3TI1A 3ZZWA 5L2TA 3CSVA 1PKGA 2X4ZA 5FRIA 3KRLA 3T9IA 3BI6A 3R7GA 1JPAA 4IM3A 3GXLA 2UZWE 3D0EA 5IUIA 3COKA 4RZVA 5FGKA 2VTIA 1OUKA 3F3ZA 3PP1A 2C4GA 3II5A 2WMVA 4O6EA 2YM3A 3DBCA 5GNKA 5C1QB 3PSDA 3QX2A 5KKRB 3UNKA 1U5QA 4E20A 2PVMA 3HP5A 3HL7A 4FKRA 2RSVA 4LYNA 3VHEA 3VBXA 2B7AA 4YC6A 4V05A 4TWPA 4EK4A 2X6DA 4CFFA 4EC9A 3V5TA 5EM6A 1XH4A 5IH4A 2OJGA 4BGGA 3I4BA 3VAPA 5DLSA 3ZXZA 3DKGA 4R6VA 5DNRA 4ZSAA 2C6IA 2VTMA 3IO7A 4E5WA 2PMNX 2I1MA 3F7ZA 4FUXA 3TNIA 2ESMA 3ZUVA 3F2RA 2OZAA 5EYDA 3FYKX 5AAGA 3LLAA 3OBGA 5L2IA 2W1CA 3O51A 2UW9A 4LV8A 4I5HA 1W7HA 5A14A 5GIPE 4F0IA 5LJJA 4CZUA 2R5TA 3Q9YA 5HE3A 3DFAA 3H0YA 2PVYA 4LL5A 1J1CA 5FEEA 2OK1A 4L3PA 3Q53A 3FBVA 3RM7A 1QL6A 3VUHA 4TL0A 2ZVAA 3I0OA 2W96B 3Q04A 4ACDA 5DE2A 3UIMA 4FTAA 2R9SA 4D9TA 2P3GX 2ZDUA 3FMDA 3Q4TA 1BL6A 3NR9A 4PWNA 4QP7A 4UB7A 4BI0A 3RBWA 2PE2A 3KXGA 4D4RA 4XP0A 2WMUA 3B8RA 3DBDA 5LMAA 3F3VA 2CDZA 3L9PA 5J7HA 2GS6A 4UMUA 2GNFA 2VWXA 4HPUE 5AA8A 3HUBA 5KNJA 4NYEA 2HZNA 5HQ0A 5B2KA 3L9NA 4J97A 5EDRA 2C3IB 1LR4A 5M4CA 2NNWB 1FMOE 1YWNA 2V7AA 1JKKA 4MBJA 3WF7A 2VTHA 2WNTA 1JSTA 2BZKB 3BGPA 2GNJA 3FXWA 5DRDA 1H01A 4DFUA 2OI4X 4EH8A 5EW3A 4FV6A 3PLAE 4W4WA 4E4NA 4MXAA 3KKVA 3SOCA 4ACMA 4O84A 3LCSA 4JBQA 5IQBA 3QD0A 3A4OX 3FAAA 2HXLA 5M53A 4GT4A 4FEQA 4UALA 1HCLA 3CBLA 3AC2A 2HWPA 3F5XA 5HG7A 3EN6A 3VUDA 5D41A 3ZSHA 5KBRA 4V01A 1H1SA 4RIWA 3C0HA 1PYEA 2HWOA 2H34A 2UUEA 4BIEA 4EEVA 4EOJA 3H10A 3OHTA 4O7ZA 4H36A 1WAKA 4C62A 5GZ8A 3BYMA 4GFOA 4LM5A 2QLUA 4FODA 1OPKA 3FLSA 4RIXB 4FL1A 3V5QA 2OJIA 3FZRA 4PY1A 3AT2A 2RL5A 3P79A 2XIYA 4QYFA 4UMRA 5CQUA 3VRYA 4C02A 3E7VA 5IUGA 4QMZA 1YXUA 2R4BA 3QLGA 2WMSA 4QMWA 3UOJA 3A8XA 3TV7A 4XLVA 3F2AA 3KXXA 2HENA 1UWHA 4YJNA 5A3XA 2PVHA 3K54A 1S9IA 2CCIA 1YOLA 2UZLA 4MF1A 5CU0A 3V5JA 3R22A 4Y72A 4NT4A 4KKGA 3SRVB 1Q3DA 1PXJA 3QALE 4FSUA 2PZIA 4DTBA 3A7HA 1RDQE 2F2UA 3F5GA 2RFSA 4PPBA 4GIHA 4IIRA 5HEZA 4MBLA 4K77A 1ZYLA 5EQYA 4EQCA 2XJ1A 3QRUA 2JKKA 1GIJA 3H9FA 1JQHA 2A1AB 2R7IA 1WBWA 3FMNA 4JXFA 5IMXA 3VUTA 4A4LA 2WB8A 2XCHA 3A61A 3OCBA 5M4IA 3U6HA 2GFCA 2B9FA 3E64A 3R0TA 1TQPA 2VGPA 5TOZA 3HAVA 3KXHA 1STCE 3HMOA 4FGRA 4O21A 5H9BA 5CASA 3NEWA 2QNJA 1RJBA 4F7JA 3ZM4A 4M69A 4HGSA 4ZZOA 4ZZMA 5C27A 4ZSGA 3N4VA 5B2MA 2LAVA 4MBIA 3RK7A 3UC3A 3DBEA 3WIKA 4EOSA 2CNUA 2G15A 5M56A 5HLNA 5JFSA 2RFEA 3OG7A 5LVLA 4ERKA 3VF9A 2VWWA 4L01A 3ZSGA 5IISA 3VJNA 4ZOGA 1SNUA 3PJ2A 5GHVA 4PQNA 1OL1A 2R64A 3POOA 5EI6A 2XA4A 4I22A 4EUUA 2OBJA 3W10A 4EYMA 5CAUA 2UW4A 5EYMA 1MP8A 4FKIA 5AP1A 4ZTLA 4BVUA 5BVFA 4XEYA 4HVGA 4RBLA 4I92A 4FT5A 1XH7A 3EHAA 5H2UA 3P86A 1SM2A 3H3CA 2GHMA 4U3ZA 4AOIA 4L46A 5LWNA 4O81A 4FT9A 1JSUA 2UW3A 3VRZA 4X2JA 4Q9ZA 3VHKA 3GCUA 4WG5A 3IECA 4HVDA 3Q9ZA 1FGKA 5CWZA 5IG1A 5LWMA 2PE1A 4FSRA 2XBJA 2WOUA 2YJRA 4HYHA 4LQMA 2HIWA 4GJ2A 2XVDA 3LXLA 4RGJA 4OTWA 2BFXA 5CVGA 5D7AA 5HLPA 4UMQA 3TL8A 2PVLA 4ZY5A 5AR2A 1XR1A 2VTAA 1ZZ2A 2I40A 2VTJA 4BWXA 4IDVA 3KRRA 2Y4IC 4XV2A 3ELJA 3DAKA 4Y8DA 1ZXEA 3QUPA 3GU4A 2BZIB 2FA2A 5HE0A 5ITAA 3ZRKA 1H1QA 4FTIA 4LGDA 2R3QA 2ZAZA 4F64A 3HMNA 5E8TA 3KXMA 3SW7A 3LLTA 4FKPA 4BTJA 3QRKA 4IB0A 3DXPA 3OEFX 2FVDA 3EH9A 4HCTA 5FDXA 3WZDA 1KE8A 2ITNA 4YTIA 2OIDA 5LQFA 1OMWA 4YJOA 4E8AA 3V3VA 4QPMA 5CAOA 4I1ZA 3U55A 2EU9A 3OW3A 4C4FA 3FLQA 4L3JA 4C36A 4D2WA 3R7IA 4E6DA 3QRTA 4U8ZA 4FC0A 1VYWA 4BFMA 3FMLA 3VS7A 3PE2A 4H3BA 2HOGA 2QC6A 4IX5A 2G9XA 3D9VA 3O8TA 5FQDC 5HVYA 3RAKA 2UVZA 5CEKA 4HCVA 3CQEA 5CU2A 3P0MA 3DTWA 2F49A 4C0TA 3EQHA 4YBJA 5DG5A 5ETCA 5DPVA 1PXPA 3HEGA 4BHZA 2UW5A 3I79A 4P90A 3BBWA 2DWBA 4FSWA 4HNIA 4L43A 3R7VA 4UV0A 4O86A 3ZH8A 1BX6A 3ROYA 4L8MA 4D4SA 3NAXA 4Z9LA 4PDSA 2CPKE 2UW8A 3EN7A 4FV3A 4LOOA 2GMXA 3P7AA 3QZHA 4A07A 4ACHA 2WQBA 3NNUA 3UBDA 4EHEA 3NX8A 2WHBA 3U8WA 4BGQA 3PG3A 3W2OA 4FV0A 4DFLA 3DJ5A 1F5QA 4MYGA 3REPA 2XNOA 3GU6A 3FC1X 4LFIA 4A7CA 4JS8A 4AX8A 5KMJA 2QR8A 1OKZA 4XG6A 5I3RA 3QCXA 4KIQA 3VBYA 3LJ1A 4IQ6A 2B0QA 1JKLA 3NLBA 2C69A 4CLIA 5AX9A 5HOAA 4UXLA 1YXVA 3P7BA 1PHKA 4JQ8A 4CNHA 4FTLA 5CZHA 5AFVA 1OGUA 1VR2A 2SRCA 5AJQA 4E4LA 5BMSA 4U40A 3JR1A 2XB7A 3RPRA 2C6MA 3S3IA 5FXQA 3VQUA 4CKRA 3QTWA 5ICPA 1PJKA 1PXNA 3H0ZA 4MAOA 5IA1A 2QD9A 3W2QA 4L68A 4OTPA 1J1BA 4BIDA 2JDSA 5HBEA 4XNEA 3UMWA 1XH6A 3NYVA 4C4EA 3UO5A 4Q9SA 4YURA 5E91A 1YDSE 4MF0A 5AR7A 5CF6A 2WTIA 3PRFA 5FTGA 4BI2A 3HLLA 3BHVA 2ZB1A 3D5VA 1H28A 3FKLA 3AMAA 3PXZA 3UQFA 4QRCA 4FE2A 4IZ7A 3I0QA 1H8FA 5E8UA 3BYVA 4GCJA 5A54A 3FXXA 3CEKA 3Q60A 3GC8A 4PTEA 4EOQA 3COHA 4ASXA 1ZARA 4OW8A 4KAOA 2W7XA 4F99A 3FSFA 2CKEA 3R9NA 5J87A 5BYLA 3PVBA 4YZBA 2CKPA 3PJCA 4JVGA 4AGDA 4G5PA 5I9YA 4O0SA 3IW6A 2BRNA 4QMTA 2XNNA 3LHJA 4EHVA 5KZ0A 2IVUA 4AZTA 4XV1A 3M1SA 4Z55A 1O6KA 5EM8A 2OSCA 4XH6A 5KCVA 3W2RA 4CD0A 5AP2A 4UEUA 4ZTMA 3DT1A 2ZV9A 1W84A 2YCRA 4IBMA 3KC3A 1T46A 4K9YA 1UU9A 4XOZA 1OB3A 4PL4A 4F9YA 5BVOA 1J3HA 2PPQA 2W17A 4B8LA 4BDJA 2CNVA 4RX7A 4ENYA 4YU2A 3ZU7A 2QU5A 1MRVA 3IQ7A 3NIZA 4IX4A 5CY3A 2VU3A 3KMMA 2FSLX 1Z9XA 5D7VA 3QKMA 3PSBA 2A0CX 4IACA 4ZSLA 2UZEA 4XUFA 4QTCA 3G6HA 4ZY4A 1PXLA 4GVAA 4JR7A 4QMPA 4FVQA 5DR6A 4O91A 3V8TA 4U79A 4CT2A 4IX6A 5FD2A 4GS6A 5EQEA 4FTMA 2DS1A 4IC7A 4EC8A 3RK5A 4K11A 2ZM3A 3G6GA 3GC0A 2YM6A 4XJ0A 5AV2A 5LCKA 4BCOA 4C57A 4DFXE 3OWJA 4EBWA 3AMBA 4F4PA 2J7TA 4O96A 4FV9A 4C3FA 2W1GA 2XNPA 1WBPA 3DKFA 4I5MA 5L2SA 3KK8A 3A7FA 3DY7A 2W4KA 2VRXA 2QLQA 2J5EA 3R01A 4FKTA 2C6DA 4I6BA 5K0KA 4CYIA 3SV0A 3QD4A 5J7BA 1XHAA 4BCGA 3DJ6A 4FZDB 2Z7QA 2QO2A 2C5VA 2HK5A 2YM5A 3HV5A 3OY1A 3F3UA 4FKSA 4K2RA 5CQWA 3UOLA 4E7WA 5K0XA 4ZEGA 3EYHA 4J95A 3QD3A 5CF4A 4JT3A 3AGLA 3HYHA 1ZRZA 4RX5A 4MHAA 4U3YA 4GH2A 4X21A 4AFJA 4UY9A 4YSMA 3HNGA 3JYAA 2I0VA 1GOLA 3L1SA 2UW0A 4PMPA 4ZLOA 3ORTA 1U59A 5DFPA 4TXCA 4GK3A 3UIXA 1GZOA 4W9WA 5ANEA 3ZEWA 1YXSA 4U42A 2ITOA 5I3OA 4ITHA 2W1FA 2OIQA 5DT4A 3MH3A 4NH1A 5EK7A 2W4OA 2REIA 4C59A 2XIKA 3FMHA 4JIKA 4CXAA 5BUIA 5ANJA 1Q4LA 1UNHA 1Y6BA 4QP8A 2VO0A 2XH5A 3MPAA 5AUXA 4BCMA 3FI8A 2YA9A 5K9IA 4QQ5A 3DB6A 3R1YA 3MBLA 3F82A 1WBOA 3QRIA 3GC7A 2WTVA 3GOKA 3FMKA 2Y6MA 1IAHA 2CSNA 3DKOA 3FZTA 3ATTA 4AG8A 4E93A 3FI2A 5B7VA 2BKKA 2J2IB 3CR0A 4NEUA 5KE0A 2R3FA 3QCYA 4EYJA 3TKIA 3H4JA 4D5KA 2PUUA 3EL7A 2VO3A 4RJ7A 2CKQA 2XYNA 5E8VA 3EN9A 4FICA 4X3JA 3FUPA 4IAYA 2XK6A 4TYEA 2VWBA 4G17A 4HGLA 4IFGA 4KBCA 4MXCA 3EYGA 4O7RA 2JFMA 3EFJA 3JY0A 3PJ8A 4X2NA 4AN3A 1AGWA 1MRUA 4L42A 4NFMA 4EK6A 3G33A 4C4HA 1BUHA 1SYKA 4XHKB 5KMMA 4UXQA 5CZIA 4IVDA 2HW7A 3G90X 2VWZA 4CV9A 3A7IA 3R2BA 1R0PA 4OTRA 5AAEA 4D2VA 1ZZLA 3UZTA 1OL2A 4WKQA 3KMWA 3SC1A 4AGCA 4O7NA 2ITUA 3OT8A 4I23A 4FZ6A 5AX3A 3QXPA 3CIKA 4KS8A 2C5NA 2VTLA 3HRBA 5KMOA 3PXFA 4ALWA 4AWIA 2ETKA 2HAKA 4FT0A 4BCFA 5IA0A 1FVVA 4WRGA 2ZV7A 1W8CA 4YJRA 4E5BA 4EZ7A 3CD8A 3GQLA 4Q5HA 1YW2A 4AT4A 2WTKC 5EDPA 5EKNA 3MVLA 1LEWA 2RGPA 4G34A 4BZDA 2XMYA 3MB6A 2XEYA 3D15A 4DTAA 2R7BA 4R3CA 4IWDA 5EOLA 5HU9A 2UZVA 1P5EA 1DI8A 2KULA 3RTPA 4USDA 3MFSA 4CTBA 5HLWA 4DT9A 3GU7A 4M69B 5HBHA 4S31A 4K6ZA 2ITZA 1OI9A 2WD1A 2W5AA 4MWHA 4QMMA 4C3PA 1KV2A 3TZ9A 1H1PA 3L8XA 3DJ7A 4LGHA 4XMOA 3LFEA 1M7QA 3LCDA 4QMNA 2VO6A 3OF0A 1YWRA 2YACA 2EXCX 2PSQA 4FKWA 4S32A 5J9ZA 4IH8A 1S9JA 3CCNA 4J96A 4RLLA 2GDOA 3GFWA 3NAYA 2OFUA 2X9EA 4I5PA 4OTFA 5CF5A 4FEVA 3TDVA 4FKGA 5IDPA 4DBXA 5GINE 4EBVA 4KBKA 4Y85A 4MEDA 5FM2A 3IDPA 3PPKA 3AC3A 4FEUA 3PVGA 4P7EA 1XWSA 4TTHB 4WIHA 3E7OA 1CTPE 3Q4CA 2YWVA 4X3FA 3GU8A 1Q5KA 5DN3A 5H8GA 1WBVA 4BTMA 3VUIA 3QCQA 1G8SA 3OS3A 1U5RA 3FMEA 3BYUA 3ZRMA 2YCFA 3QQJA 4RIYA 4AA4A 5A4CA 3C0IA 4E73A 3UVPA 4C4IA 3WZEA 3D7ZA 1CDKA 1OL6A 2OXYA 2CNQA 2O65A 1LPUA 5J5TA 4O6LA 2JC6A 4O38A 1ZOGA 4AACA 3IGOA 3ACKA 4X2FA 5DR2A 1URWA 2BMCA 3UG2A 5TR6A 4A06A 4GVJA 4AN2A 4I41A 3LFNA 5K4IA 2BZJA 3O71A 5BVWA 2PZ5A 1KOBA 3RJCA 4BIBA 4S2ZA 5C8KA 2UZTA 3FDNA 3TZ7A 4BY9E 2YHVA 3FY0A 3EQGA 3BEAA 4FOCA 1BYGA 2CLXA 3ZBXA 4WNMA 5AUVA 5AM6A 4RLKA 2IVVA 5HICA 4PTCA 2F7XE 3ORKA 3R04A 5KHWA 4M68A 4G2FA 4D1SA 4JDJA 4U6RA 3KK9A 2I0YA 4U41A 4FT3A 2ZMCA 2FUMA 3KRJA 4U44A 4F09A 4U97A 3I1AA 5A4LA 2JFLA 3GGFA 3MGYA 4H1JA 3SAYA 1IRKA 1AQ1A 2WQMA 4XRJA 5KMIA 4YTCA 3UIBA 3PFQA 4Y73A 2WQNA 1O6YA 2YZAA 1M2QA 3MH0A 4RJ8A 3U6JA 4FKJA 1JKSA 2PMIA 2RFDA 4GFMA 5HD4A 4O82A 4D2RA 4XOYA 1VJYA 3OBJA 4DA5A 3VBWA 1FBNA 4C58A 4BTKA 3DK6A 3TTJA 2C6EA 2V55A 3L9LA 4EOKA 4GKHA 4AW0A 5JQ8A 4NCTA 4H05A 2XM9A 4NJ3A 2IZTA 1W0XC 4UYAA 5T6KA 5HIDA 2JKOA 2IZSA 2ZM1A 3CQWA 3CXWA 2UV2A 5B2LA 5DMZA 5LVOA 3C51A 3E8NA 3QKLA 4A9SA 1OKWA 2GHGA 2VN9A 4I6FA 5LMKA 4YO6A 4YGAA 5FLFA 3U4WA 3QWKA 4FV8A 4RWKA 4O0UA 3TCPA 4ANBA 3PRIA 4ZSEA 3LM0A 4PUZA 3QA0A 4FNWA 4BYIA 5L6WL 4FYNA 2BRHA 2IZRA 4EOPA 3O17A 2UZBA 4GT3A 5G1XA 3NZ0A 4QYHA 4AZFA 4ZZNA 1M7NA 3OOMA 3UNJA 3Q6UA 4ASDA 5BUJA 1R78A 2PVRA 2VX1A 4NU1A 4DITA 3G51A 3F69A 2QOCA 2EWAA 2EXEA 3EB0A 3SX9A 3HDNA 5DGZA 2C3KA 4L7FA 2BDJA 4RMZA 3DU8A 2VD5A 3MPMA 4WA9A 5JFVA 4IM0A 3IS5A 3O0GA 5AIRA 4BDGA 5DYJA 3CD3A 3KL8A 3ZO4A 1GAGA 2GU8A 4GRBA 3ENMA 5EM5A 4EH6A 2G01A 4PNIA 4ACCA 5M51A 2WMQA 5HHWA 3C1XA 1Q41A 1A48A 5CANA 4BKZA 2CJMA 4WG3A 2RFNA 5DVRA 3UJGA 3BIZA 3R21A 4MKCA 5EDQA 4R78A 4AF3A 3VC4A 4O7LA 2C5OA 2NRUA 3UOHA 3NUSA 1H24A 3R71A 3VBTA 4RC2A 2OF4A 3R9OA 4ZXTA 3HV7A 4D28A 1Y6AA 4S30A 3RPOA 1M52A 4FTJA 4GK4A 5KO1A 5CLPA 2JGZA 3PVWA 5FEQA 4ANMA 3C4EA 3O50A 4WRSA 3VULA 2FO0A 5JN2A 5ETAA 3HA6A 4F0GA 3I6WA 3FZOA 2QO7A 1TVOA 3QD2B 3ZUUA 1OIUA 3LFBA 4RSSA 4HVHA 3S95A 3IDCA 3WZKA 4CYJA 2XK8A 4TW9A 2CMWA 1V0BA 2F9GA 2JBOA 2OKRA 4IWQA 3VS5A 3ALNA 4GIIA 3QQGA 3MW1A 2W4JA 4G3EA 5EHYA 5HTIA 4OBPA 5JMSA 2R2PA 4P2KA 5HNBA 3GEQA 4YC8A 5J1VA 4B0GA 2BIYA 3KFAA 2P4IA 2YM7A 5HIEA 3OC1A 2QI8A 5IA4A 4CRLA 2YIXA 4USEA 1FOTA 4U80A 4J52A 3EQBA 1IEPA 2CN5A 3I5NA 2XYUA 3CPCA 5E1EA 1YI6A 3E93A 4RC3A 4XRLA 5HIBA 4ORKA 3JVSA 4H58A 3W18A 4YJPA 4BBFA 3M2WA 1ZYJA 2VWUA 4RT7A 4II5A 3LOKA 2LGCA 4AA0A 3Q9XA 5HE1A 4O7SA 5EQPA 3MJ1A 4JNWA 4Y5QA 3PJ3A 4KSPA 3DQWA 5AIKA 4CMOA 4G3FA 4AZWA 3RPYA 4LRMA 3UYTA 5IQHA 3HP2A 1UKHA 4FSMA 3BWJA 1Q99A 2EB3A 3ZLXA 1U54B 3F3TA 5CXZA 4DG3E 4FOBA 3ORNA 3POZA 4M0ZA 5KMKA 2Z02A 5C8MA 4F6UA 3V5PA 3LAUA 4M8TA 1VZOA 3O8PA 4OUCA 3HV4A 4RC4A 2YITA 4AW2A 3BCEA 2JIVA 3CKXA 4DEDA 4FKQA 1GZKA 3V5LA 4FGBA 3PE1A 1YHWA 1E1VA 3P78A 2CGWA 4G6OA 2GS2A 3OP5A 4HYSA 1P14A 4CFWA 5HO8A 2PZPA 2J6MA 3R2YA 4AOTA 5AR4A 3GENA 5AV3A 3ZOSA 4JDHA 4AUAA 5EHLA 4A9YA 5FDPA 1TQMA 3BV3A 3LFAA 3PP0A 4J8NA 3R9HA 3WE8A 3S0OA 2Y7JA 3L8PA 1Z57A 5EOBA 1IA9A 3WF9A 4PMMA 3RPVA 1WBTA 2ONLA 4M67A 3K3JA 5E1SA 3SVVA 4X0MA 3CLYA 1XBCA 4JX3A 1IA8A 2WTKB 4NKSA 3SOAA 4YUQA 4PMSA 5BUEA 5JK3A 1OBDA 4FT7A 4RQVA 2ZDTA 4I0RA 4KIOA 4AU8A 3K2LA 4YPSA 4EK3A 3ROCA 5TKDA 4JG7A 3PXYA 3VJOA 4FK3A 3Q9WA 1DAWA 5CT0A 5JRQA 2W05A 4H39A 5L8KA 4KABA 2WZJA 3KN6A 4LOPA 4LUEA 3R6XA 4IEBA 5AUUA 4MNEA 4BZNA 4GW8A 1PXMA 3BU5A 2Q0NA 3GU5A 5BMMA 3FXZA 5I9WA 3I7CA 4FX3A 2H6DA 4NM3A 3AG9A 3SA0A 3W32A 1O9UA 3TIZA 2XIXA 1OZ1A 3KGAA 4QOXA 2BKZA 3DK7A 4F1OA 4QMVA 4IFCA 1UNGA 3ZEPA 3NUAA 5EYKA 5M08A 1NT2A 1KUTA 2QOHA 3PXRA 4KB8A 3VF8A 1YI4A 3PLSA 3OCTA 3R7OA 2VTOA 2X6EA 4BBEA 2C6KA 3UC4A 3SD0A 3UZPA 4CRSA 2XNMA 3GI3A 3NNXA 4WD5A 4BTFA 2HY81 2J0KA 3GCQA 3IW5A 4QNAA 2X2KA 3TT0A 4APPA 4O7VA 2VWYA 4ZK5A 2WQEA 4GL9A 4F08A 3I7BA 5C01A 4HVSA 1YHSA 3FL4A 5ANOA 5AADA 2F2CB 3EQFA 4GG7A 4O0YA 2VTPA 5CNNA 2B9HA 3GVUA 3A7GA 4R5SA 4HGEA 2PK9A 3UG1A 3F5PA 2C6LA 2X2MA 5LXMA 1ZMVA 3PVUA 3M11A 2IW9A 4KRDA 4B6LA 4C38A 4FIEA 3F61A 4W9XA 3TNWA 2PMOX 2IZUA 2X8IA 4HZSA 5AUWA 3R63A 3U9NA 1Q62A 2WMRA 4YO4A 1NXKA 3EFKA 3FZSA 5BQ0A 4D9UA 4E1ZA 4ZTRA 1UNLA 1CMKE 2ACXA 3E92A 5HESA 3LJ0A 5I9UA 3RK9A 4QP4A 4ZS4A 2ITPA 3OW4A 4DHFA 1DS5A 3P1AA 2C0IA 3WOWA 4L3LA 1K3AA 4LRJA 5CSPA 3BBTB 5JZNA 4JLCA 3AC8A 4TYJA 2OF2A 3QWJA 4QMQA 4FKUA 3FSKA 4IHPA 2C3LA 2VTRA 2XKCA 5M44A 4HJOA 3LE6A 4RA4A 3Q6WA 3VUKA 3T9TA 4PV0A 4L6QA 3UODA 3E62A 5CSVA 3AQVA 3RINA 3KREA 1FGIA 2QONA 4F63A 3OCGA 1SMHA 4BF2A 5HVKA 3HKOA 3TTIA 3R30A 4O22A 3TDWA 2Z7RA 4ANLA 4DN5A 4BDCA 3UZRA 4AOJA 3PA5A 3NUUA 5ETFA 3Q4ZA 5CF8A 3OD6X 3QKKA 3WZUA 4FIFA 2HELA 1A06A 3G9NA 3O7LD 4J98A 5JGBA 5D11A 4ZP5A 4JAIA 1Q3WA 1YOMA 4X3FB 4ZMEA 3IW8A 4MXXA 4YHJA 4IANA 4BR3A 4OR5A 2JIIA 3MY1A 4F6SA 3DNDA 4RIYB 2HZIA 4TYHA 5J1WA 3W33A 3QRJA 4AGWA 3W2PA 2HY0A 4R5YA 2WEIA 1OM1A 2J4ZA 4Q2AA 4KINA 3D7TA 5CEPA 4JDIA 4ASEA 2JKQA 4RQKA 3TEIA 4PTGA 2JDTA 3MVMA 4EKLA 1YWVA 2GTMA 1M17A 2R3PA 4DBNA 3RAWA 1PMUA 3QL8A 1U4DA 2CGVA
chains in the Genus database with same CATH superfamily
3E8CA 2F4JA 2ITWA 3MS9A 3PZHA 5A6OA 4X6QC 4WO5A 1CKJA 4QMXA 4BCNA 3HX4A 3MB7A 3C4ZA 3EQCA 2O2UA 5GZAA 4U7ZA 3L8SA 3OZ6A 4K1BA 3C4XA 5IQFA 2VNWA 4AP7A 4FBXA 4E6QA 4ANQA 3D5UA 4J1RA 4PP9A 4HOKA 4U45A 4D2TA 4BDAA 4R3RA 3WF5A 3Q96A 1BI7A 1H0WA 3GQIA 5HG5A 2UZUE 3NWWA 2Z7LA 4FIHA 3V04A 3HRFA 4EK5A 1G8AA 1FVRA 1L3RE 4C33A 3SLSA 2P55A 4ID7A 2Q0BA 3V51A 2HW6A 5FBOA 5HCZA 3B2WA 2ERZE 1YKRA 3KF7A 4IE9A 1H4LA 2GQRA 3ENHA 2B4SB 4YJSA 5EG3A 4AZSA 5DT3A 5C9CA 2OXDA 3PPJA 4O2PA 2VUWA 5ANGA 3U54A 4WBOA 3UMXA 3NYOA 4V04A 4BRXA 2BUJA 2YM4A 2QKWB 4IAIA 3I60A 1Y8GA 2YLEA 4Z7HA 3EFWA 4YJQA 2A19B 4QYGA 3RNIA 4O7TA 5L8LA 4G1WA 1GJOA 2CGXA 2PVFA 3NUYA 2OU7A 4CCBA 4XX9A 5E92A 1UKIA 1JBPE 3QFVA 5CS6A 4RRVA 4JG6A 5J95A 3SXRA 1XBBA 3KN5A 1IAJA 4NFNA 2FGIA 2R3JA 3QYZA 1B6CB 4JDKA 3VNTA 3SGCA 2JLDA 1H07A 3ITZA 1V0OA 1YQJA 4F7NA 3DS6A 4MD7E 4DE4A 3L9MA 3DOGA 2OLCA 3CKWA 1QPEA 5CEMA 4RVKA 2BAJA 3ZC5A 1KOAA 2R3OA 4OT5A 4AT5A 1YXXA 1NW1A 5AR3A 4TKSA 3DAJA 4DDIA 4IZ5A 3DB8A 4H1MA 2DYLA 2IO6A 4BDIA 4FKVA 3DV3A 5L6PA 3BEGA 2PL0A 2XKFA 3DLSA 4FSNA 3ANRA 1TZDA 3BGZA 2FH9A 4FZ7A 2BVAA 5LARA 1OGYA 2C47A 4CFMA 2BDFA 1JSVA 2X81A 2VO7A 4N0SA 2YABA 5CI6A 2GQGA 2X4FA 3FLZA 4YLJA 2F7ZE 3AC5A 1Q8ZA 4JBVA 3QBNA 4TNDA 4E6CA 2I7QA 3ID6C 4YTFA 5IKWA 2XBAA 4QQCA 1G3NA 3CC6A 5HG9A 2OJ9A 5T3QA 1RQQA 3R7UA 4F65A 4KUJA 4OTHA 1X8BA 3KEXA 3MH1A 1QPJA 3TG1A 1ATPE 4CMTA 3O2MA 3DKCA 2PUIA 3BGQA 3OWKA 4IAZA 4ITIA 4R1VA 4EI4A 4F7LA 4R7BA 1Q8TA 4N6ZA 1ST0A 5LMBA 1H1RA 2UZNA 2IWIA 3QCSA 5E7RA 4LI5A 3W2CA 3PA3A 4YMJA 3LFFA 5M09A 1PMVA 2W9FB 3LMIA 3FI4A 3Q4UA 2BRBA 4UMTA 2W1IA 4P5ZA 5IA5A 4XBUA 5KX8A 1TQIA 1H08A 4KS7A 4TRLA 4DGOA 3V8WA 3SDJA 3C9WA 2PU8A 3VUMA 3PIZA 4RJ6A 4UWYA 3PDTA 3SXSA 4KIPA 2QG7A 3ORLA 3LCOA 4YHTA 4W4VA 5IUHA 1FMKA 1JKTA 3G9LX 4FYOA 1G8JA 3VS6A 2CLQA 2QOFA 4X6RA 4WG4A 3MH2A 4IJ9A 4QD6A 2W06A 2OZAB 5FXRA 2YERA 4MQ2A 4FG7A 5HKMA 1ZY4A 3KULA 4FTUA 4DTKA 1Q8YA 1W82A 3W2SA 3UPXA 3FC2A 2WTCA 3TIYA 3UGCA 4UBAA 3FY2A 4O83A 4AE9A 3QGYA 3QQUA 4FTNA 3ZHPC 5IH5A 5T68A 3Q3BA 3PPZA 4IVAA 3PG1A 4NWMA 4YHFA 3UQCA 4M13A 4G16A 4YZNA 2VWVA 4I94A 4Z7GA 4M0YA 3FHIA 3FV8A 2VX3A 2PYWA 4ALVA 4CG8A 4IAKA 2BHEA 3PTGA 2VZ6A 4N70A 4RWLA 4PDYA 4FR4A 3SG9A 4WOVA 2QODA 4EQUA 3HAMA 4FZAB 5TE0A 4IZYA 3UNZA 2B55A 4FTCA 3UVQA 4EZ5A 2R0IA 1M2PA 4FV1A 1WCCA 1YI3A 2E9NA 3LFCA 4S34A 3FI3A 4FTRA 2P33A 3QQHA 5L2QA 4BGHA 5IPJA 2WIHA 2QURA 5C8NA 3GP0A 1R3CA 3ZC6A 5CNOA 4PP7A 5HX8A 4EORA 3Q5ZA 1BLXA 3UP7A 1OVEA 2BRMA 3LMGA 2AQXA 4RWIA 1YOJA 3BU3A 3JXWA 4FK6A 5AV1A 4DG0E 4DEBA 3ULZA 4LRKA 1YDTE 3CTHA 3LIJA 1SVGA 4M84A 4NM7A 4QTAA 4BJJB 1EH4A 4HZRA 2GHLA 5K4JA 4DHZA 1XMLA 4ITJA 1M14A 4RIWB 3MA6A 5M4UA 5CSWA 4DHJA 3DTCA 4DC2A 1YVJA 4U81A 1QPDA 3EQIA 4RIOA 5IQEA 5DA3A 3F9NA 2JAVA 1NY3A 3O5AA 2R3RA 3QTZA 5IQGA 1WMKA 4GMYA 2O5KA 2WU7A 4OLIA 2BHHA 3MI9A 4FF8A 2FSTX 2IW6A 4RX9A 4CFNA 4LMNA 1NA7A 2B1PA 3V8SA 4EH9A 2OW3A 2QHMA 3A99A 3R9RA 2AC5A 3W0OA 2VTSA 2Y6OA 2FYSA 5F9EA 4TWCA 2C30A 2E9OA 1FQ1B 3NRMA 1P4FA 4RPVA 3AD4A 4WUNA 3B2TA 5CI7A 4EH5A 3R8LA 2C6TA 1J91A 2ZV2A 1PMEA 3ORIA 4C7TA 4J8MA 3LXPA 3R8UA 4PPCA 1SVEA 3ZFMA 2B9IA 2X8DA 5IA2A 3TJDA 4XS2A 5LCJA 4PMTA 2AUHA 2A27A 4BL1A 1PXKA 1K9AA 4BCKA 4NK9A 4EZ3A 4FG9A 3OTVA 1MQBA 3CY3A 3NCZA 3FKNA 3FZPA 2EVAA 3W0QA 1Y8YA 2UZOA 2XIRA 4DEEA 3P5KA 4BWKA 1KE6A 4PF4A 4PX6A 4ZY6A 5HO6A 2Z7SA 3DZOA 2UVXA 2JBPA 2O3PA 3HA8A 1PYXA 1YDRE 5TF9A 2X39A 4JOAA 3LCKA 4S33A 5CXHA 3MSSA 5AV4A 5F4NA 4XG3A 1LEZA 2VGOA 4D5HA 1FPUA 2IEWA 4KIKA 5EFQA 2OICA 1XQZA 3AD6A 1DAYA 4RFYA 3RM6A 3C50A 3UPZA 2PVJA 4DINA 4HGTA 4OTIA 5D10A 1ZAOA 2UZDA 3LW0A 3ZBFA 2W9ZB 2QG5A 2BALA 3GOPA 4JQ7A 4MK0A 4DYMA 4EH2A 4CKIA 2YIRA 4EH3A 1JVPP 3WBLA 2O0UA 4Y83A 5EYCA 4DG2E 3KRXA 2P2HA 3OWPA 1UU8A 3NYNA 5CAPA 2RKUA 3BRBA 3N51A 3OTUA 4FVRA 3TZMA 4DLJA 3T3UA 1AD5A 1VYZA 4PL3A 3RCDA 2R3MA 3A2CA 4QP6A 4BICA 3TNQB 2J0MB 2AYPA 1IASA 2VTNA 4HYIA 4R7HA 3E8DA 3V6SA 3MVHA 2C5YA 3S1HA 4LUDA 4C61A 2GPHA 2XKDA 4AXAA 3S2PA 4BDHA 2YCSA 5HVJA 5C03A 4EOMA 3KY2A 4HCUA 3KU2A 2XK9A 3QX4A 3IG7A 2H8HA 3NW5A 3GC9A 3E8EA 4JQEA 4LMUA 4F78A 4XP3A 5I5ZA 3E87A 3ULIA 1OKYA 3H9RA 3JS2A 3PWDA 3W8QA 3UTOA 2X7GA 2NPQA 4TYHB 5J9YA 3FQSA 4F9CA 2C1AA 3BE2A 3IDBA 4M12A 1ZWSA 2BROA 3D83A 3MESA 3D7TB 4D4YA 4O4CA 3UQGA 4MTAA 2ZYBA 1JWHA 3PSCA 3SXFA 4OBQA 1REJA 5F94A 5A4TA 4WBBB 1A9UA 5I9VA 4FV2A 2GNGA 2OH4A 3LFSA 2WMXA 3E88A 4FL2A 4RX8A 5I9ZA 2C3JA 2J5FA 2WQOA 5B0XA 3SW4A 3TV4A 2QVSE 3D94A 2E2BA 2R3NA 4J99A 4AW5A 5CAVA 4QDVA 2ERKA 2P2IA 2VV9A 3AC4A 4Q5EA 1OECA 3COMA 2XM8A 2CCHA 1KE9A 4Z3VA 3E5AA 3NCGA 5KHXA 5BV3A 3DQXA 3RZBA 3PUPA 4FTKA 3OFMA 3LKMA 4IB5A 3OT3A 4G6NA 4DCEA 2WU6A 2B54A 4X3FC 4EL9A 2Y0AA 3NUPA 3QZFA 3W1FA 2OO8X 3ZSIA 4BDFA 4FNZA 2RG5A 4AZVA 5AUTA 2BRGA 3BPRA 4U0IA 2R3LA 3BWFA 5BPYA 3NSZA 4NTSA 5I0BA 4EOLA 1W83A 2G2HA 4QQTA 2UW6A 4QP1A 2OJJA 2IG7A 3MIYA 3ZO2A 2XALA 1K2PA 5HZNA 4PDPA 4FA2A 3NDMA 2WMTA 5E8SA 3RVGA 5EH0A 4I4EA 3ATSA 2QR7A 4FSZA 3N4TA 4BDKA 4EQMA 3OVVA 1JOWB 2F7EE 2JAMA 3ODZX 3MDYA 4A9UA 3JY9A 3LMHA 1VLRA 4LV5A 3CE3A 4W4XA 5DT0A 4YSJA 3UVRA 3IOKA 2W1ZA 3P4KA 3QA8A 4ZSJA 4JBOA 3FPMA 1J7LA 4G31A 3TN8A 4BCJA 4HYUA 2X0GA 3KCFA 1GZ8A 3TNHA 1GZNA 3ANQA 3IGGA 4JI9A 4AT3A 4D0XA 3ET7A 5HU3A 5A9UA 4NL0A 4DGMA 3PIYA 4OAUC 3MTLA 1UU3A 3EQDA 4JBPA 5BVEA 3UIUA 1H26A 4XBRA 4BCPA 1OITA 2EXMA 2V7OA 2QOQA 4RWJA 5HX6A 1MUOA 2BZHB 4PPAA 4XCUA 2WO6A 2XIZA 5IA3A 3BKBA 1P4OA 3C4FA 4UWCA 4QDEA 3VQHA 3ZTXA 4FEXA 3JPVA 2AC3A 2VWIA 4GT5A 1ZYCA 4Y46A 3VWAA 4D4VA 3ZO1A 3UP2A 2OH0E 2X8EA 3LQ3A 3EMGA 3PXQA 4P5QA 2O8YA 3VBQA 2C1BA 5CSXA 4L52A 4AGUA 3Q2JA 1OUYA 4G5JA 4NCTC 5GJFA 1ZMWA 2NRYA 3G15A 1GIHA 4IADA 4U9AA 4GJ3A 3EN5A 4L67A 5K5XA 4E26A 2UW7A 3QXOA 4KBAA 4EONA 5JGDA 1SVHA 4NIFA 4W8EA 5LMKC 2HZ0A 3KIOC 4FEWA 5AP6A 1SNXA 3MPTA 4EH4A 3QUEA 4YZDA 2IF8A 5F20A 1B39A 2A4LA 2GSFA 4AXEA 4FRFA 4XV3A 4YPDA 5E4HA 1NVQA 3WZJA 1LP4A 4FSQA 5AP4A 4QT1A 5DOSA 1WVWA 4L53A 1H27A 3MFTA 3MV5A 3F7WA 3OUNB 4DAWA 4RFMA 1NVRA 4XG8A 1Q61A 5FM3A 3VO3A 3VS4A 3CJGA 1QMZA 2QQ7A 4MX9A 2PUNA 4I20A 2XS0A 5JGAA 3RHKA 4EUTA 4DH7A 4I93A 4CQEA 4FKLA 4GUBA 4I5CA 5E8ZA 1CSNA 2ITQA 3CP9A 1ND4A 4YNOA 4O0VA 3TJCA 3UYSA 2RIOA 4ZJIA 1V1KA 3ZONA 2IN6A 3OY3A 3TKUA 4O4FA 2WEVA 3H9OA 4QMYA 4MVFA 2XARA 2GCDA 3Q5IA 3PWYA 2CHLA 3KULB 1OKVA 2XK7A 4ZLYA 3FHRA 3ZCLA 3SHEA 4JX7A 4DH1A 5M4FA 3NFGB 3LXNA 3R73A 4YJVA 4L7SA 3BYOA 2YAKA 3R8PA 4HPTE 4V0GA 3WI6A 3ZXTA 3V5WA 2YM8A 3IW4A 3KQ7A 5HCXA 1ZYDA 4B9DA 2X1NA 4XV9A 5L8JA 3VW8A 2X7OA 3FQEA 4D58A 5DHJA 4L44A 5JFWA 4Y95A 4RJ5A 3D4QA 3I5ZA 4U5JA 1FINA 5AP0A 3QUDA 3KB7A 4A4OA 3BQCA 2XNEA 4I24A 4J71A 2Z2WA 4DLIA 4TZRA 3NS9A 1PRYA 3VBVA 5EW9A 4DEIA 3FL5A 2OGVA 4U43A 3ZDUA 2XP2A 4ONAA 4A9TA 3BV2A 2JDRA 4DGGA 3CS9A 1APME 4EJ7A 2Y9QA 2I6LA 5IEXA 3ML1A 5CALA 3KRWA 3IW7A 4K18A 4O0RA 3ZDIA 3P5JC 1M2RA 1GIIA 5AR5A 1DM2A 5FTQA 1F0QA 2X7FA 3R1QA 4N4SA 2XRUA 2KTYA 3NMUF 2X2LA 5AR8A 3V01A 3A62A 5H3QA 3CPBA 1OIQA 3K5VA 4B7TA 3BLQA 3I6UA 2PTKA 1BMKA 3P23A 5D1JA 4E4MA 2PUPA 2E9UA 1PMNA 2EB2A 3QTXA 4TYGA 1T45A 2C5XA 3IOPA 4AQCA 4F1TA 4TNBA 1GY3A 3VS0A 2JKMA 4GFGA 3QTUA 5EM7A 1ZY5A 1WZYA 2XF0A 4YC3A 3TACA 3WF8A 4R1YA 3R83A 3R8MA 3HV6A 3WYXA 3LZBA 3HGKA 5HTBA 2YISA 2UVYA 2V22A 3OROA 4KKHA 5GJDA 4GYGA 5HTCA 4IW0A 3HMPA 4C2WA 3UDTA 2PHKA 1SZMA 3DDQA 3HZTA 4UWBA 3OWLA 2BFYA 5ACBC 3WF6A 3AGMA 3RCJA 4DCAA 4TWNA 1XJDA 1YRPA 3DDPA 4RVLA 1TFFA 4FV5A 4A4XA 4PNKA 2YDKA 5TT7A 4N6YA 2IW8A 4UN0C 3EFLA 3FWQA 2ZOQA 1OIYA 4QTEA 2XAOA 3COIA 4L45A 4YJTA 5BYYA 3QYWA 2R3HA 3JVRA 3PYYA 1G5SA 4F70A 4PL5A 4LV7A 3GNIB 4QYYA 5J5SA 2QOOA 1R0EA 2YDIA 4HVIA 3RMFA 2GNIA 5H8EA 5M06A 5E8XA 1MRYA 5LOHA 3WE4A 5CTPA 3RZFA 3A8WA 3PY1A 5EHOA 3HDMA 2QOIA 4IM2A 2A2AA 3ZMMA 4CFUA 1GNGA 4YNEA 1PXIA 3GUBA 3QF9A 2ONLC 2PULA 1P2AA 1QCFA 2JEDA 2W1DA 1FVTA 2BR1A 3OOGA 5G6VA 3U9CA 2C0OA 4DEHA 4QTDA 3Q32A 3CY2A 5J8IA 2DQ7X 3BLRA 4AXCA 3OUKA 5M07A 4APCA 5AUZA 4BCQA 4G6LA 4HW7A 4C37A 3VVHA 3ALOA 4WNPA 3FQHA 4ZTNA 5FP6A 4FTOA 3RP9A 2WTWA 1WBNA 3F3WA 2VNYA 3NNVA 4QPAA 4I21A 3L8VA 4JRNA 3HV3A 3MTFA 5EI2A 3MYGA 4ZJJA 3U6IA 2BAQA 4KIKB 2ITVA 4IVCA 4WSYA 5JKGA 2X9FA 4YLKA 4X7QA 3SKCA 1XH9A 3NYXA 1F3MC 2IVSA 5AP3A 3DNEA 3BLHA 3F66A 3E63A 2E9PA 3O7LB 1ZMUA 1O6LA 4QMUA 5GZ9A 2VAGA 5IEVA 5J79A 5L6OA 3FMJA 3ZRLA 3H30A 3K5UA 3ZLYA 4GK2A 2QCSA 5KUPA 2GS7A 5AMNA 3EWHA 3IPHA 5EI8A 3LVPA 5K3YA 4BDBA 3ZUTA 4D0WA 3NNWA 2IPXA 3DAEA 3QQKA 3QHWA 3BE9A 3ORPA 4R7IA 1J7UA 5CX9A 3C5UA 3OXIA 4DH5A 3QGWA 4FIGA 1IR3A 2J90A 4CKJA 2XKEA 2YIQA 3U51A 2Y4PA 1XBAA 2VTTA 5D9HA 5HBJA 4DGLC 2V62A 3EIDA 3LQ8A 1OPJA 4QMOA 4AZEA 4C4GA 3NUXA 2VTQA 3DK3A 4KD1A 4ZMFA 3NVKI 2H9VA 2DUVA 3T3VA 4AS0A 2ZV8A 3ORZA 4RJ4A 4BDEA 1I09A 4EWHA 4KWPA 2WOTA 4F7SA 1V0PA 2YEXA 3R9DA 4O7YA 2XZSA 5HNIX 3DPKA 4M97A 4AFEA 3PZEA 5KMNA 4QPSA 5DR9A 4CGAA 4IB3A 3BHUA 4ALUA 3R8VA 5JT2A 5IQIA 2B52A 4TN6A 4QMSA 3G5DA 4M15A 3ZFXA 4YR8A 4R3PA 2RF9A 4N57A 3ETAA 3ACJA 3O96A 4TY1A 4NZWB 5JZJA 1E1XA 4CZYB 1PXOA 2HYYA 4JJRA 2O63A 3TNPC 3E3PA 2XEZA 4MQ1A 5DH3A 2R0UA 4D2PA 3DXQA 3C0GA 4UZHA 3TV6A 3GCSA 5FEDA 5BX0A 3PXKA 3P7CA 4CV8A 1WVYA 5AV0A 3EZRA 1Y91A 4O27B 3QQFA 4DGNA 3ZM9A 3R1SA 2XRWA 1WVXA 4Z16A 4UZDA 3RKBA 3MVJA 5CVFA 3AT4A 4FSTA 2JD5A 4EWQA 5AA9A 4XG4A 3F5UA 3BZ3A 4FTQA 5FUTA 5IQDA 1ZLTA 2XJ2A 2C6OA 2QKRA 3BX5A 4YJUA 2PMLX 2O64A 3GCPA 4ZTHA 2ETRA 4QNYA 5CYIA 3DGKA 3NUNA 4I4FA 2W1HA 3KXNA 4LGGA 2IJMA 3V6RA 4A9RA 4ENXA 2PE0A 4BB4A 1KE7A 4AA5A 3LQ5A 2BPMA 4GU6A 3U4UA 2CKOA 2PVKA 1WFCA 3LJ2A 5C4KA 5FBNC 5CENA 4TYIA 1Q8UA 2P0CA 3MIAA 2G2IA 2PWLA 5JQ5A 3TUBA 3ZO3A 4O7WA 1UA2A 3F6XA 3Q52A 5IZFA 3R1NA 1KWPA 2FB8A 2ZM4A 3OXTA 3AD5A 4F0FA 4B99A 3EKNA 1DI9A 4B8MA 5HI2A 4BBMA 2YFXA 2I0EA 3FJQE 3D2KA 4EKKA 4HNFA 3DBQA 4RFZA 4GUEA 2R3IA 1UVRA 2XK4A 3G2FA 4FNYA 4J53A 1B38A 5TO8A 2JITA 3RPSA 2HCKA 2W5HA 1XO2B 4O4BB 3KVWA 4IX3A 4DT8A 3Q2MA 4KA3A 1VEBA 5HNGA 3C4WA 3KF4A 3R7YA 4OTQA 3S4QA 4BI1A 3TWJA 4AAAA 5GJGA 3N4UA 2XNBA 3KCKA 4I0SA 3UO4A 4YZCA 3BHHA 3EJ1A 4I0TA 2YN8A 3AMYA 3MY5A 4CFVA 2C68A 4FL3A 5I4NA 3LFDA 3QTSA 4LL0A 5CEQA 4YBKA 3IKAA 4QO9A 2ITYA 2WTDA 5HCYA 3PY3A 4IZAA 3O8UA 5C4LA 1XH5A 4BZOA 2YIWA 4JRVA 2FSMX 1G8KA 4JG8A 3TUCA 4WHZA 4F9AA 3TXOA 3IK3A 3FMMA 2WMBA 4ARKA 3P9JA 3EOCA 1BL7A 5JFXA 4FTTA 3MN3A 4OAVB 2C0TA 4FIIA 3IONA 4QMLA 5ANKA 5EW8A 4FI1A 4ASZA 3D14A 4BKYA 1OBGA 2B9JA 4MWIA 2J51A 4WSQA 4CFXA 4F6WA 3KXZA 5AEPA 1W2DA 4NIFB 4EHZA 4GV1A 4L9IA 3W16A 1U46A 4RJ3A 4FIJA 4FUYA 4CVAA 1BKXA 3FYJX 2OJFE 4WUAA 2YLFA 3VW6A 3CTQA 5JEBA 4OBOA 1NVSA 3MJ2A 1Y57A 4GSBA 4PRJA 4RG0A 4CQGA 3AC1A 4G3CA 2WPAA 3DLZA 3EZVA 4ZTQA 5LVPA 5DRBA 4CMUA 4CTCA 3ORMA 4PDOA 3THBA 3R28A 3VUGA 1UV5A 4ZIMA 3AKKA 4R77A 3A7JA 5DWRA 4QP2A 2QOLA 3VIDA 3ZS5A 4F9BA 5AP5A 3C13A 4MD9E 3GCVA 3WARA 3ZYAA 3W0PA 4QQJA 5KBQA 5HGIA 4P4CA 5L3AA 1J7IA 2BCJA 1JNKA 1LUFA 3ZLWA 4C2VA 4C4JA 3HUCA 4XG9A 4K0YA 5CT7A 3VS2A 2YZLA 4DHIB 4GYIA 4IXPA 1U54A 2ZJWA 4OT6A 4IVBA 1KSWA 3QQLA 4F9WA 4DEAA 3QZIA 4NW6A 5DEWA 3QTQA 4V0GB 4CLJA 3AT3A 5KKRC 2EUFB 5KMLA 3OCSA 3UO6A 2HXQA 4MXYA 5AWMA 4D1ZA 3QTIA 3HECA 5EKOA 3LCTA 4AE6A 3TM0A 3G0FA 4K33A 1KE5A 5M57A 4OTDA 3FKOA 2J50A 4M7IA 2ZFYA 3EQPA 5CU6A 2WMWA 3M42A 2OWBA 4OGRA 2YCQA 4W8DA 3S00A 2WKMA 3HVCA 1ZOHA 5IU2A 3NIEA 5AM7A 4JAJA 4F1MA 1OPLA 3LM5A 4XYFA 3C4CA 3RGFA 3BLAA 4QYEA 3DZQA 3LXKA 1H25A 1HCKA 2YWPA 2OG8A 2VX0A 4NJDA 4QP3A 3W8LA 4RIXA 4ZJVA 4LG4A 3PIXA 5A4QA 5E90A 1Q24A 4NTTA 2PY3A 1PF8A 3F88A 2XCKA 5IH6A 5LVMA 3ERKA 3FPQA 4DFBA 2J9MA 5FP5A 4MCVA 2R3GA 3FLWA 3QZGA 2YDJA 4GU9A 3LPBA 5FWKK 3QU0A 5I9XA 2BTRA 4Y5HA 5IEYA 4AW1A 5JRSA 4O4EA 4BCIA 2BIKB 5E8YA 4IWOA 4E6AA 3GB2A 4MNEB 3WILA 3FZ1A 4CZTA 1XKKA 5IQCA 5FG8A 4JR3A 2G2FA 4O1OA 1Q97A 4BHNA 4TPTA 3SRVA 4BWPA 5C26A 1L8TA 2GNHA 4XP2A 3RAIA 1YXTA 3AOXA 1CM8A 2FSOX 2OIBA 4GKIA 2BTSA 4DH8A 3DFCB 4NW5A 3WIGA 4M14A 3MA3A 2H96A 4FV7A 4XG2A 5LVNA 1H00A 4BC6A 3W55A 2BILB 2ITXA 5BYZA 1RW8A 4D1XA 3PJ1A 1OL7A 1R39A 2WGJA 4NKAA 3RALA 4ANSA 5IDNA 1URCA 5GIOE 4DFZE 3LFQA 3CGFA 3JUHA 5CU4A 4O0WA 4TT7A 4L00A 2I0HA 3QC4A 4MH7A 4ZLZA 4JIAA 2GFSA 4G3DA 2G1TA 4CCUA 4DEGA 2RG6A 3QTRA 4XLIA 4MXOA 4YTHA 5JH6A 1OIRA 3MY0A 1W98A 3KVXA 4UMPA 2R3KA 2CN8A 3HMMA 5IMEA 2Y4IB 5ACKA 3R00A 2WIPA 4H3PA 4WNOA 5AP7A 1PKDA 5HD7A 2YIYA 4DF3A 3MWUA 4FKOA 4KRCA 4NUSA 4O1PA 4EOOA 1QPCA 4RA5A 2YAAA 3C5IA 2PVNA 3D5WA 4RVTA 4OTGA 2QHNA 5H8BA 3HMIA 4MXZA 2OXXA 3OEZA 4E3CA 3ODYX 4LOQA 2J0LA 4YP8A 4YZ9A 5FXSA 2ZMDA 1R1WA 4WNKA 3D5XA 3AXWA 3CGOA 3KA0A 3NPCA 4ZAUA 1KV1A 1MQ4A 2Q83A 4UYNA 2BAKA 3BHTA 4TWOA 2W0JA 5HG8A 1BI8A 2XJ0A 5IF1A 4M66A 3FE3A 4DFYA 4B4LA 4EOIA 2BDWA 4D55A 3NGAA 2B53A 2IVTA 4IJPA 5E8WA 3RWQA 5AUYA 3DA6A 1ZOEA 2GNLA 5DIAA 4CEGA 2J0JA 3DBFA 4DFNA 3NFFB 2Z8CA 3QHRA 4BDDA 5DEYA 4ANNA 3ZZEA 4ERWA 2YJSA 3CJFA 3ZLSA 3VS3A 5FTOA 1WBSA 3BU6A 3O23A 3D2IA 1CKPA 2WAJA 1PY5A 5L2WA 5CEOA 3BELA 3RNYA 1ZYSA 3F2NA 5HO7A 4GG5A 4IWPA 3I81A 2CGUA 4QP9A 3RAHA 4I3ZA 1Q8WA 4FMQA 1OL5A 1YHVA 3R8ZA 3DXNA 5CSHA 2WTJA 5BNJA 4JL9A 3ORXA 4G3GA 4EK8A 4QTBA 2W99B 2WMAA 5DBXA 3RI1A 4ANOA 3PA4A 3B8QA 3A60A 4I6QA 3TZ8A 4IDTA 3N9XA 1CKIA 2HZ4A 3QC9A 3ZFYA 3TUDA 2QO9A 1JLUE 1HOWA 3A4PA 4MD8E 4USFA 3CQUA 5K5NA 1H1WA 5A6NA 2V0DA 2J0IA 3BHYA 3PY0A 3SG8A 4CSVA 2WXVA 3UOKA 2NP8A 4O2ZA 1REKA 2GQSA 3TKHA 5BVKA 5CVHA 4EJNA 2QOBA 3EL8A 3EQRA 4O0XA 4R8QA 3NW7A 5CU3A 2ETMA 2WELA 2XK3A 3GT8A 2PZYA 4FNXA 4K8AA 2QOKA 5ANDA 4I6HA 4FVPA 3W0NA 4KKEA 5CEIA 3KMUA 1JAMA 2JIUA 2Y8OA 4IAFA 2QU6A 5AAFA 3E3BX 4NSTA 3VS1A 4FSYA 3VN9A 4CG9A 2JDOA 4IB1A 4H3QA 4UX9A 2XNGA 3OMVA 4BCHA 4D2SA 5CAQA 1PW2A 1Z5MA 4NM0A 3WYYA 5HORA 3NVMB 4RZWA 4YLLA 2Z60A 5J9LA 1TKIA 3P08A 3QAME 3EN4A 4MNFA 4E4XA 4ZS0A 4YZMA 3RWPA 5E9EA 1H0VA 1I44A 2OFVA 5L4QA 4BYJA 2W1EA