5M53A

Nek2 bound to arylaminopurine inhibitor 11
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
272
structure length
255
Chain Sequence
DYEVLYTIGTGSYGRCQKIRRGKILVWKELDYGSMTEAEKQMLVSEVNLLRELKHPNIVRYYDRIIDRTNTTLYIVMEYCEGGDLASVITKGTKERQYLDEEFVLRVMTQLTLALKECHRRSDGGHTVLHRDLKPANVFLDGKQNVKLGDFGLVGTPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFRRIPYRYSDELNEIITRMLNLKDYHRPSVEEILENPLILEHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine-protein kinase Nek2
publication title Structure-guided design of purine-based probes for selective Nek2 inhibition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/inhibitor
total genus 90
structure length 255
sequence length 272
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2016-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5m53A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5m53A01
4I41A 4O2ZA 1WBTA 5HNBA 3MB6A 5EK7A 3ZSGA 4QP1A 2J5FA 2HIWA 2UW7A 2GFSA 4FV2A 4AGCA 4ZOGA 4AZVA 2PMOX 4QP2A 4DGGA 1J7LA 5CU0A 1YRPA 2F7EE 2QO9A 4YTFA 1ATPE 2E9UA 4DCAA 4NJDA 3DLZA 1NVSA 3F3TA 4EOQA 2C3JA 2J2IB 4O7RA 5CSVA 3W32A 3SXRA 2WAJA 4BCGA 3DXPA 3BRBA 4HJOA 4L6QA 4C61A 4AW5A 3VAPA 3P7AA 4JIAA 2HWOA 3OP5A 4FX3A 2RIOA 3FLWA 5FXSA 2FH9A 4TT7A 3HX4A 5EH0A 3PIXA 5IISA 1W82A 3OTVA 1H00A 3QRUA 4K1BA 3BE9A 3BU3A 3U4UA 4DFZE 3TUBA 3ATTA 5CT0A 1BL7A 3IKAA 2BZHB 1JOWB 5CF6A 3KULA 3I79A 4PY1A 3PVWA 4I5CA 3FI8A 4FNXA 3ANRA 3FLQA 5A6OA 1W7HA 4R7HA 5ETFA 2ITYA 3QF9A 4F7JA 2PU8A 3R1QA 3TT0A 1OL2A 1I09A 2JKMA 3QD0A 5D7VA 3Q96A 4WNPA 1BKXA 3DXQA 4B7TA 3DNEA 3UIUA 4AE9A 4TY1A 1JKKA 4L44A 5EW9A 1ZXEA 4JXFA 4TTHB 3OWLA 3G6HA 4EZ5A 1VYZA 3LXKA 3E62A 3W2OA 1OL5A 4JL9A 5C01A 5JSMA 4G3DA 4XOYA 2EXEA 1UNHA 3IQ7A 5AP5A 4BB4A 2XA4A 2RF9A 2Y6MA 3P1AA 3I1AA 3E8DA 3N9XA 3QKLA 4JDJA 4IWDA 4RT7A 2ERKA 4XRLA 4QMNA 1VYWA 2BDJA 2PE0A 4RSSA 4EH2A 4EH3A 5E8ZA 1R39A 3Q5IA 4MHAA 1MRYA 3KF7A 3KQ7A 5DT3A 5JFSA 4EJ7A 5D7AA 3CKWA 2IZSA 2A0CX 3S2PA 2VTAA 3DAJA 2GHMA 3L8SA 4TPTA 3D7TA 4TXCA 3TEIA 4WG3A 5FD2A 3NVKI 3BGPA 4FSMA 1BX6A 3CCNA 4KSQA 4RWLA 5CSXA 5DVRA 3PUPA 2GQRA 4NYEA 2UW8A 3AGMA 4QP6A 4TYHB 2XKCA 3AMAA 3FAAA 3Q6WA 4FT5A 2QOKA 1JKTA 2H34A 4IB5A 4IX3A 4LFIA 4QD6A 4YC8A 5HOAA 4C57A 5TKDA 4E7WA 5IA3A 3RAHA 4FMQA 3CPBA 3MWUA 3L9LA 1PMVA 4H3PA 3MBLA 3UZPA 2X81A 2WMQA 2PL0A 4FEXA 1S9JA 2X6EA 4Y85A 3QWJA 3IONA 4AFEA 3KMWA 1KSWA 2Y7JA 4QP8A 4XG2A 3TNHA 3DKCA 3Q6UA 5CAQA 3VC4A 4XG6A 4D9UA 4YBKA 4NUSA 1V0OA 5HTCA 1OKWA 3PE1A 2ITOA 3FXZA 4H05A 5JH6A 2YM3A 3LE6A 4D1XA 3LJ2A 5FG8A 3I81A 1CSNA 4PTGA 5J95A 2LAVA 5L3AA 3JYAA 1W83A 4JAJA 4QT1A 2XRWA 2SRCA 4GK3A 5DEYA 4B8LA 5GZ9A 2YABA 3EHAA 1PXMA 5H3QA 2WEVA 1TQPA 2XIXA 3AD4A 5BNJA 3D0EA 2FVDA 2CNUA 2HWPA 3KCFA 2QOHA 3L9NA 4BZDA 5M06A 5FXQA 2WNTA 2XIZA 4FKUA 5AP1A 2C5XA 3SD0A 5DHJA 4ENYA 4BCQA 2PVNA 4Q5HA 1OB3A 5BVDA 4F6WA 3DA6A 2XNPA 3CC6A 4EK8A 3FMHA 4LOPA 1H27A 3EQIA 5CSPA 1OL6A 1CKIA 4NIFB 4CMOA 4QP9A 2IW8A 5JQ8A 5HO8A 2XEYA 3Q2JA 3Q53A 4DT9A 3TDWA 2C68A 2W7XA 3ODYX 4P7EA 5L6WL 3WF8A 4E4MA 3VBTA 5T68A 3C1XA 3NS9A 4D4SA 5LVPA 3VUTA 4TYEA 1Z5MA 4I4EA 1FMKA 2C5NA 2VWUA 3WF9A 1M14A 3DPKA 4RFMA 3WF6A 5CVGA 4Y5HA 3F61A 3FJQE 3H9OA 5EHLA 2HY0A 1Q99A 5CWZA 4IZAA 4H58A 4IX6A 4QMWA 5H9BA 4MBIA 4AWIA 5IU2A 1UA2A 3M11A 3PG3A 4QPAA 1KE7A 1G5SA 2YDIA 3F3ZA 3WZUA 3AC1A 1U46A 4MEDA 2OFVA 2YDKA 4QMZA 4RRVA 4O0RA 2EUFB 5I9WA 4C38A 4LGGA 2F2UA 4NFNA 5HBJA 2ERZE 2NPQA 5HE2A 3ZFXA 3E7VA 2DQ7X 5FWKK 5J87A 5IF1A 3BYSA 3LAUA 4LRKA 2PVKA 3PY0A 2VGOA 3U51A 3C51A 4KKEA 5H8GA 3BHYA 4FZFB 1YKRA 3ZBXA 3GGFA 3GQLA 4PL4A 3GVUA 4W4WA 4RA5A 1FVTA 5HTBA 5BUIA 4FIEA 4RZWA 3R8VA 3WF7A 1Q4LA 4TRLA 3L8VA 3ZH8A 4EBVA 4EOPA 5JEBA 2W4JA 1FQ1B 3WBLA 4U41A 3AC8A 2OJIA 3DK7A 4U80A 3GU7A 5JZNA 2WQBA 3WE8A 5E92A 5A4TA 1PXLA 3MPAA 3QBNA 4M3QA 3RWQA 4UYNA 4OGRA 5FBNC 4YNOA 3UODA 4FSTA 3CQEA 3I60A 1H1RA 5HVKA 2QONA 4ZZNA 3OBJA 4W9WA 2EB3A 5LMKA 1ZYLA 4UWYA 3V5QA 3OZ6A 4CVAA 3VUIA 5KX8A 4FK6A 3Q04A 3EWHA 1MQ4A 4IZ5A 3TUCA 4F7LA 4WA9A 4E6DA 4YPSA 3EJ1A 3MSSA 5D1JA 2R9SA 3AD6A 5L2SA 4C2VA 4G2FA 3IDCA 3HUBA 3NNVA 3NUUA 5LVOA 3LFBA 4TYIA 3RM7A 2W9FB 3QRTA 2ITXA 3R8PA 2ZDUA 4G1WA 2FO0A 5EW8A 4DFNA 2UV2A 5IA4A 3Q9WA 3A7JA 2OJ9A 5HIDA 3ZOSA 3NAXA 2OXXA 3G0FA 3LLAA 2BHHA 5IQFA 4BDBA 4LUDA 4XUFA 4N70A 3VS6A 4YJUA 3LZBA 2QURA 4DH1A 5BPYA 4IM3A 4RJ4A 4BWXA 3EN7A 2QKWB 2WMAA 3GU4A 4FKWA 1XH4A 2W0JA 3MFSA 4JJRA 4EYMA 4QMVA 3PXFA 2E9PA 4MNEA 2BROA 1Y91A 1PY5A 3O17A 3ET7A 2XK3A 2X7OA 2QLQA 4NIFA 5LMBA 1IAHA 3HV6A 4TWOA 4I22A 4AQCA 4BTKA 2VX3A 5CASA 2A4LA 1H0VA 4IB0A 1O6LA 4ASDA 2VV9A 3H0YA 1Q8WA 4DFUA 2B9IA 4JQ8A 4BDKA 5HBHA 5CEOA 3HV4A 3NUPA 4O7ZA 4I21A 4F70A 3D5WA 2R0UA 5BVKA 4CD0A 5CY3A 2VAGA 2UZDA 2EWAA 2I6LA 4A4LA 4D5KA 3MVJA 4KINA 5HICA 3SAYA 3QCXA 3KREA 4O7VA 3OUKA 4GG7A 3MVMA 5AR8A 4FICA 4FTIA 2HZ0A 3QLGA 3UYSA 2XCKA 1P14A 2EB2A 4M12A 3ZC5A 4F64A 3TZ8A 4CQGA 3IDBA 4CG8A 5E8WA 4F1TA 4ZLOA 4KA3A 2PZRA 3HV3A 1UKHA 3TV7A 1PXKA 3FEGA 4R7IA 4XLVA 1UU9A 3UOJA 4AZEA 1JKSA 3O51A 4D9TA 4LV8A 5K3YA 4HZRA 2XYNA 3DTWA 3LLTA 3DOGA 1I44A 5IKWA 4EOLA 3FSFA 4FSNA 4M66A 4FKLA 4PDSA 4AGUA 1V0PA 4H1JA 1UU8A 4PX6A 3C4WA 4F6SA 4MBLA 5C9CA 5AV4A 4L3JA 4KAOA 4AE6A 5EI8A 2XM9A 1HCLA 3W2RA 3GENA 4ANOA 1YI6A 3ORPA 3FYJX 1LR4A 4HNFA 2JBOA 2C30A 4BTMA 2X8DA 1YHVA 4JDIA 5M4IA 1H07A 2JFLA 3I7CA 4NM7A 4OLIA 4CFWA 2QG5A 4TWCA 5A3XA 4UZHA 2X39A 4GT4A 1W84A 3DK6A 3OCBA 3KRXA 3OC1A 4EUTA 4MXOA 3UE4A 3M1SA 5AM6A 5FEDA 4LOQA 5BVWA 1JPAA 1KE5A 1DI8A 4O0WA 3LFSA 4E8AA 3OROA 4IWQA 3K54A 1B38A 2FB8A 3V5TA 4AGWA 4AN9A 4HNIA 5AADA 2YITA 4DEAA 3E5AA 4O81A 2GHGA 3B8QA 2WEIA 2J51A 3E64A 3FQSA 4I6HA 5EQEA 4DEIA 4MBJA 4JX3A 4PL3A 4C35A 3GC7A 5LCKA 4DE4A 2C6EA 3QGYA 4FIGA 4OUCA 3CSVA 2ITUA 2OZOA 3FI3A 1WFCA 2CN8A 4MQ1A 4CNHA 1YWRA 3FBVA 3ORMA 2VX0A 3IW5A 3GFEA 4L9IA 4FV1A 5M57A 5HNIX 2YHVA 1W8CA 4FOCA 5BVEA 3I6UA 2QOIA 2Y9QA 1U54A 3GCPA 4QTDA 2B9FA 2NRYA 3D83A 1H08A 2I0VA 4JQEA 4ZSGA 3I0QA 5CF4A 2HYYA 2B54A 1YDSE 5C8KA 3EKKA 4BCMA 4BCPA 2J50A 1OIQA 4LUEA 3UO4A 3DKOA 4E93A 4L67A 4FTTA 4FR4A 3RM6A 3HMNA 3K5UA 5HLPA 2PE1A 2HAKA 1MUOA 5CENA 4KS7A 5CEQA 4F1MA 4HVGA 3GXLA 5J79A 5B2KA 3M2WA 4IVCA 4C3PA 4FKPA 4KBKA 4U7ZA 3VUMA 2XF0A 3U6JA 1XJDA 2VWBA 3S0OA 4ANBA 4RJ3A 4UMQA 1H25A 3A4PA 3VF9A 1Q8TA 4J97A 3BX5A 4GG5A 1SYKA 3GOKA 3LQ3A 1FBNA 4PV0A 2CLXA 2C3KA 3TIZA 5DIAA 3ORTA 2IZUA 4X3FC 2NP8A 2IWIA 3R73A 4R3RA 4XH6A 5DEWA 4BDJA 4AZSA 4K33A 3OWPA 4OT5A 2ETRA 4ZXTA 3CS9A 5GZAA 4IB3A 3PYYA 4QOXA 1FVRA 1PRYA 4G3GA 4CZYB 2BPMA 2OWBA 3OCGA 3PSBA 5IG1A 3R1YA 5LMAA 5KBQA 4X2GA 5CXZA 3QZIA 3VS5A 2OSCA 2B9JA 5CAPA 3MA6A 4BYJA 4PQNA 3DAKA 4QO9A 3QQFA 3MFRA 4GU6A 4ASZA 4DINA 2C6LA 5IQCA 4K77A 4DH3A 5DN3A 3V5PA 3ENHA 4C4JA 3CLYA 5L2QA 3S3IA 3NUSA 4BIEA 3NGAA 5HU3A 3FI4A 2OG8A 5CZHA 4AZFA 2C5VA 3R01A 4FZ6A 1M2RA 4LRMA 1Z57A 4OT6A 2IN6A 5EYDA 4AW1A 4DFLA 5AEPA 3U55A 4MTAA 2AC5A 1YXVA 2XRUA 1E1VA 4EOIA 2YIYA 4OTDA 3O23A 4GT5A 1H0WA 4ERWA 4XP3A 5FRIA 3ULZA 5LXMA 5JQ5A 2ZM3A 3CBLA 1NA7A 3V6RA 2PVRA 2OIDA 4YJVA 3DFCB 2UZVA 5ANKA 3NYOA 2R0IA 5F95A 1PYXA 3UG2A 4C33A 2WHBA 2XJ2A 3MJ1A 3R28A 4TNDA 4O7SA 1AQ1A 2JDRA 3PE2A 2JEDA 5HE0A 4FI1A 4TZRA 1IA9A 5ANEA 2CJMA 2VTNA 3I0OA 3CY2A 4ZSEA 3NUAA 1REKA 3F2NA 4O0TA 2BRHA 3SXSA 4D1SA 5IEXA 4XG8A 1J1BA 4AA0A 3B8RA 4HYSA 4ORKA 5E1SA 1V1KA 4E5BA 3V8WA 3BBWA 3RAIA 5F94A 4R77A 3ZSIA 4R1VA 3L8PA 4L53A 4NKAA 4ANQA 1Q61A 4FG9A 1FMOE 3NYXA 2C1BA 2RG5A 3DJ6A 4P5QA 5HKMA 3MVHA 2BILB 3LKMA 3DXNA 3R8UA 2FSOX 3NLBA 2OBJA 2Z7QA 4FV7A 3TDVA 3GEQA 1FVVA 2PY3A 4FKJA 4XV3A 4RQKA 5D10A 5IPJA 3GC9A 3VO3A 5KMNA 3U54A 4C3FA 4BIDA 3CQUA 4OTPA 3WIKA 4EH6A 3R04A 2J0LA 4F9YA 4QTEA 4Z3VA 5JGBA 4ANMA 3RALA 1K9AA 1MQBA 4DH7A 3O50A 5JGAA 3RTPA 3ZONA 4WKQA 2C47A 3UJGA 3QA8A 2FUMA 3MH1A 4KABA 2J7TA 3CIKA 4F9AA 4C4HA 4GIIA 3UNKA 3SA0A 1R0PA 3NSZA 1M2PA 3EQGA 4FL3A 4U6RA 2WMBA 3E8CA 4YZ9A 4GKIA 4DF3A 4JBVA 1E1XA 1Q97A 4M13A 4PMTA 3C5IA 2PMNX 1JLUE 4K6ZA 2WPAA 4NWMA 5KZ0A 1YWNA 3BGZA 4HPTE 2R2PA 4HYHA 2G2FA 4MXXA 2XIKA 3F3UA 1XO2B 2WGJA 3R7YA 1OECA 2CHLA 4O6LA 4AS0A 3ZO3A 4NEUA 2VTJA 4USDA 1DAWA 2BZIB 3FE3A 4EC8A 3EQBA 4D1ZA 5CX9A 1JSVA 2GS7A 3WZKA 4CZTA 4O86A 3RVGA 4IXPA 3CJFA 1STCE 3OCSA 4QMYA 3U8WA 1Q62A 2X9FA 5B2LA 3TM0A 2Y4PA 2JKOA 3AMYA 3NZ0A 3DZOA 3GFWA 2BMCA 3QTRA 4FEQA 3GUBA 4QMPA 4IVDA 4RGJA 2FYSA 4K0YA 5J9YA 3RK5A 1YI4A 1LEZA 3TZ9A 2FA2A 2X7FA 3W1FA 3KXHA 5BVNA 3G15A 1OBDA 3QX4A 4U9AA 3ZLSA 3LMIA 4H36A 4I0SA 3HGKA 4GSBA 1G8SA 4Y8DA 3BLRA 5IQDA 3HV5A 3QHRA 3DCVA 1F3MC 3SXFA 1XH5A 2JITA 4B6LA 4EI4A 5LVMA 2IPXA 4FTLA 4U0IA 3UMWA 2HELA 2WMSA 4OTHA 3UQCA 4CT2A 4LL5A 1KE9A 4G6LA 4BDEA 4LI5A 3N4TA 3LFQA 5HG5A 5TF9A 2WTKC 1WZYA 2XH5A 2Y8OA 3IGOA 2QVSE 5CI6A 3NR9A 3ZDIA 5I9UA 2O64A 1YHSA 2C3LA 3LQ8A 4QQTA 4JOAA 2PUIA 2E9VA 3POZA 3UGCA 4DYMA 4R5YA 1OBGA 2PVYA 3BYMA 2ZMDA 1ND4A 3CTQA 3C4ZA 1Q8YA 3DS6A 2OIQA 4CV8A 3ORIA 3HA8A 3VF8A 5AP3A 1WVXA 5HG8A 3I4BA 3H3CA 5DOSA 4GUBA 1OIRA 5CI7A 4ASXA 2W06A 5CSWA 3MV5A 3EQCA 4E20A 4EH5A 5CU4A 3MTLA 2R3GA 5JK3A 4IDVA 3OT8A 2R3MA 5G1XA 4CV9A 5KE0A 4H1MA 4KUJA 3SV0A 4FC0A 2ITNA 4EH4A 2BKKA 3C4CA 3EB0A 3UP7A 3U87A 2YCRA 3B2TA 4GCJA 3ZUUA 4DLJA 4IZYA 2Z2WA 5BMSA 2ZV9A 2PVJA 1JQHA 4KWPA 3HMPA 2JKKA 4FGBA 4JDKA 4DFBA 1CKJA 3E63A 2BALA 4E4XA 2VWVA 3DLSA 5EFQA 2VX1A 4ZZMA 5C03A 4BCFA 4BF2A 4CEGA 4WSQA 5HGIA 4IAFA 4C34A 1JKLA 3AXWA 2HCKA 4W4YA 4GYGA 4Z16A 4XEYA 5K4JA 1P4FA 4MD8E 3RK9A 3H4JA 5EM5A 1OGUA 2P2IA 3T3VA 3ULIA 4MXAA 4WNOA 5EKNA 4HGSA 4C02A 3QX2A 4CKJA 5IQGA 3QXPA 3RPRA 1AD5A 2B1PA 2XZSA 4DFXE 4YURA 1P4OA 4YP8A 5L8LA 4ZZOA 4AZTA 5E9EA 2H8HA 3V5WA 3CTJA 5HCXA 2ZDTA 3FC2A 4WUAA 4ANNA 3KN5A 2YERA 4DG0E 2VTTA 5EDRA 4D2RA 2GCDA 3EIDA 2C6MA 3VJNA 1PXOA 3QAME 4I0TA 2W1GA 2X8EA 3N4VA 5ANDA 3UDBA 3EZVA 4CTCA 4NW6A 4PDYA 2YIXA 3E8EA 4FVQA 1APME 3MTFA 4D2WA 3IO7A 4AGDA 1ZZLA 3JY0A 3TNIA 5KKRC 3AC4A 4XP0A 4I1ZA 2CCHA 1XH8A 2DWBA 4AFJA 1U5RA 3R63A 3ZCLA 2FSMX 3OHTA 4EQMA 4ZIMA 5IH5A 2B53A 2C6OA 2JBPA 3HL7A 5L6OA 5KMJA 3RPSA 3UC3A 5AFVA 4PMPA 5I3RA 2YWVA 3WIGA 3P86A 4GVJA 5I3OA 2X2LA 2BFXA 2ITTA 2H96A 2Z02A 1T45A 3UVPA 4EC9A 4F6UA 5B0XA 3ZUVA 3PWYA 4QNYA 4FVRA 2QG7A 3GNIB 2CPKE 2QCSA 4XG4A 3TV4A 4HVDA 4UMUA 4U8ZA 4I6FA 4XG9A 4MX9A 3TTJA 3VN9A 4ACDA 3FC1X 4WBOA 2XIYA 2YIRA 3FL4A 4Y46A 4ZS0A 3MW1A 2QNJA 3IG7A 3R00A 4N4SA 3GCSA 4PPBA 1P2AA 2RFSA 5AR3A 2VN9A 1ZLTA 2C0IA 4KNBA 2PSQA 2IW9A 4ZTMA 3TCPA 2YWPA 3G51A 1H1PA 3FQEA 3HRBA 3DQWA 4ANSA 5BYLA 3UPZA 4KBAA 3G0EA 4M0ZA 4YZNA 4BDFA 1PXNA 5E8VA 3HMIA 4FKIA 5ETCA 4UMRA 4G34A 2VWWA 4K11A 4ZTHA 2UZNA 4Z7HA 4BCJA 4GRBA 1XHAA 1H1WA 3OW4A 3FI2A 1NY3A 2PHKA 5E7RA 4BGHA 1E9HA 3II5A 2BRGA 4LRJA 3ELJA 3R83A 2EXCX 3UIXA 4FKSA 5DBXA 2P4IA 3OXTA 3BE2A 2YCSA 3P7BA 2GQSA 5EM8A 1SVGA 5K5XA 3ERKA 4F7SA 5E1EA 3ZC6A 2WMTA 4BGGA 2B4SB 4FE2A 4O0UA 4QMOA 3KXGA 5JMSA 4U40A 1H8FA 2ETKA 2W99B 4FYOA 3RGFA 4X3FB 2VWZA 1VR2A 3ZSHA 1KE6A 4FEWA 4EEVA 5AUWA 5HNGA 4CCUA 3W18A 4I5PA 3NNWA 4F0FA 5M09A 4XYFA 3R9NA 1UU3A 2IZRA 2UZWE 3AC3A 2VNWA 2Y6OA 3PJ3A 4A9SA 4FODA 2C5OA 5JZJA 4FIHA 4V04A 3EMGA 2R3IA 5IUHA 3TXOA 4FSUA 4FVPA 1M2QA 1L8TA 4ITJA 5ICPA 4IAZA 3NUXA 3BWJA 4BL1A 2AYPA 4FTMA 1ZOGA 2E9NA 2QLUA 3QRKA 3N51A 4BBFA 3S1HA 3FMLA 4BWPA 5GZ8A 4KIQA 5CEPA 4I5HA 1M52A 3SDJA 4MVFA 2V0DA 3COMA 3VWAA 3UVQA 4I92A 3BZ3A 4EYJA 5IQBA 4D2VA 4FOBA 1DI9A 3MPTA 4M84A 4KIKB 2YEXA 4RLLA 2REIA 5E8TA 2YM4A 3CD3A 3PFQA 4PNKA 4BCHA 2XNMA 3FMKA 3C0GA 5AP6A 3HP5A 3F69A 4YJPA 2OFUA 3CKXA 3ZLWA 5LWMA 3PSCA 3VS3A 3HMMA 3W8QA 2X6DA 3PXQA 1Y6BA 4IAAA 4QQ5A 2B55A 3MH3A 3SW7A 5JKGA 2ZJWA 1CM8A 2OKRA 2R5TA 3U4WA 4O7NA 4ZS4A 4AF3A 4DH5A 5FXRA 2W4OA 3KRJA 3KXMA 5CAOA 2NNWB 2XNNA 4FL2A 1A48A 3V04A 4EUUA 2HXQA 2ZVAA 4BKJA 3KB7A 4NCTC 1JSUA 3WZEA 4WD5A 3KN6A 2O65A 5F4NA 5FDPA 3HNGA 4KKHA 2BIYA 3W33A 3E93A 3F66A 5F20A 5CLPA 4FT9A 4D4RA 4AW0A 5EW3A 4O7TA 5E4HA 4C7TA 2XKEA 3NRMA 2QOCA 4F9WA 3EN6A 2VZ6A 5L2IA 3HUCA 4EH8A 4J8MA 1T46A 3CY3A 3QCSA 4II5A 5B2MA 4I6QA 4Q2AA 3OWJA 4HYIA 3QWKA 4FKQA 5ETAA 4IM0A 5T6KA 5A54A 2W05A 4UXLA 2KTYA 2GMXA 2C0OA 4IAKA 5AR7A 5ITAA 2CMWA 1OI9A 3H9RA 1CKPA 4FK3A 3QC9A 4IB1A 4O27B 4RWJA 3R8ZA 5EQYA 3ALOA 3DDPA 3I7BA 2OH0E 4E6AA 3EQHA 5AP7A 4X7QA 3FPQA 3TL8A 4UMPA 5A14A 3LQ5A 2UW0A 4QP3A 4X2FA 2OXDA 2DUVA 4U81A 4L68A 4RJ5A 5HE3A 2WMWA 4JAIA 4FV8A 4TYHA 4BHZA 3JVRA 2QR7A 2W1DA 3TNWA 3HLLA 4I3ZA 2XBAA 4BY9E 2WELA 3MESA 3NX8A 4G17A 4OTIA 3A60A 1A06A 2NRUA 3C4FA 4FT3A 4RPVA 3RZFA 3Q32A 4BHNA 4D28A 4CKRA 1LPUA 4GIHA 2P0CA 4CGAA 5HD7A 1OITA 3SC1A 3BBTB 4C4IA 2GTNA 2J5EA 3P5KA 3ORKA 4JR3A 2WTCA 1EH4A 2GHLA 3F2AA 4A9RA 4E1ZA 5C26A 4G3EA 3ZZEA 2PK9A 4O1OA 4S31A 2YM6A 5AIRA 5DA3A 4YJSA 4NM5A 5KMKA 4ANLA 4XX9A 1KOAA 3OOMA 5TR6A 3UMXA 3G2FA 3BQCA 3C4EA 3KMMA 1J7IA 4ZY4A 4HGTA 4X2JA 1J91A 4YSJA 4KSPA 1PMEA 4EJNA 1Y8GA 3RMFA 4M0YA 3GI3A 3O8UA 4X2NA 3NAYA 4XP2A 4A06A 2CNVA 4IDTA 2BIKB 2WTIA 2BDFA 2QOOA 1OPKA 3C7QA 4DTKA 4EOJA 4C37A 2E9OA 1OIUA 2F7ZE 2WTKB 3ZBFA 1OZ1A 1PXPA 1CMKE 1R78A 4A9UA 4F1OA 1PKGA 3JPVA 3LFAA 4RJ7A 4W9XA 5G6VA 4XBRA 2F7XE 4XOZA 3KRLA 3RAKA 5CEKA 4YR8A 1ZY5A 4QMMA 3IPHA 4EHZA 2YM5A 5EI6A 1K2PA 4IX5A 3Q60A 5FM3A 4RIYB 2RL5A 4YTIA 5IMEA 4YLLA 1KV2A 4NTTA 3W2QA 4R1YA 3FMEA 2OF2A 4QTCA 4FKGA 4WIHA 3RPYA 2IW6A 1U5QA 3RNYA 4IVBA 3EH9A 4B99A 1HCKA 4XG7A 1H01A 4CFXA 3GU8A 4KS8A 3F7ZA 2GPHA 3A7HA 1Y6AA 4ZJVA 2YM7A 4J96A 3VJOA 4EZ3A 3FLYA 4U42A 4AU8A 2PZ5A 3FXWA 4O0YA 1RW8A 1SMHA 4A4OA 2F4JA 3IW6A 3PA4A 3FLNC 3R02A 2ZAZA 3OG7A 4Z7GA 4ZY5A 1GOLA 4P5ZA 4Y83A 4ITIA 5CTPA 4NJ3A 1J7UA 3W2CA 3OXZA 4OTRA 2QHNA 3OEZA 2R3QA 2W96B 3LXPA 4PMMA 3BIZA 4TYJA 5JRSA 3WOWA 5EI2A 4DFYA 4UB7A 5DH3A 4FA2A 3MFUA 1TVOA 3FKLA 5KNJA 3R7UA 5AV1A 3BELA 2UZEA 3C0IA 3QQKA 3E88A 3F5PA 4MWHA 1NVRA 3UNJA 2GTMA 5FDXA 2YZAA 4B9DA 5L8KA 3FDNA 4NU1A 4UN0C 2VWXA 3RI1A 1R1WA 4GYIA 5HVYA 4JR7A 4AA5A 4ZMEA 4DBXA 3WYYA 3KFAA 4IVAA 3VBWA 3PIYA 5IA5A 3KEXA 5L2TA 3BGQA 1ZMWA 5EHYA 4V0GB 3UG1A 1RJBA 3LCSA 3UZTA 3K2LA 5D41A 2O8YA 2PMIA 4C4FA 3ACJA 4GEOA 5CYIA 5AUYA 2WD1A 5EYKA 3OXIA 2ZYBA 2W1CA 3DTCA 4WSYA 5IQAA 3F6XA 4ZTLA 2W1ZA 3EQDA 1XH6A 3ZHPC 2XNEA 3E87A 4QP7A 4BI1A 5EHOA 3SQQA 4LL0A 4GFGA 2UZTA 4ARKA 4UXQA 2XNBA 4RMZA 3ZEWA 3TIYA 3WZDA 4PL5A 4QMLA 4L3LA 4BI2A 4CXAA 4FZ7A 5JGDA 5LCJA 5DE2A 5KKRB 5LVNA 2X4ZA 2VO6A 2JDOA 4FG8A 1Q8UA 4ENXA 3R9DA 2QO2A 3AT4A 1KV1A 3A61A 5E8UA 3H30A 1URWA 3HV7A 2WTDA 3LFCA 4U79A 3R8MA 2I0HA 5M07A 3OY3A 3Q3BA 3V8TA 4P4CA 5F9EA 2CCIA 2X2MA 4TYGA 3U6HA 1H28A 5IEVA 2ONLA 3QKMA 2ZOQA 3JVSA 4ZLZA 4IWOA 4NFMA 1GZNA 5GIPE 4DGLC 4FEVA 3VUDA 4M68A 5DWRA 3NUNA 3D7ZA 1H4LA 3DFAA 2QD9A 2R3HA 3KC3A 4ZJJA 2RFEA 2R64A 3MDYA 3AMBA 5CF5A 3NUYA 3PXYA 4OBOA 2WQOA 3SW4A 2XS0A 4TNBA 4JG8A 4Q9ZA 2RFDA 3R1SA 3G6GA 4W8DA 3PY1A 4K2RA 3KCKA 4EK3A 2GS6A 3EKNA 4RIYA 3O8TA 3MPMA 3LXLA 4BBMA 3V3VA 3F2RA 4O82A 1BL6A 4C58A 2DYLA 5CVHA 2CLQA 3SRVB 2HENA 3PTGA 3P23A 3IDPA 3AT3A 3MH2A 4EK6A 2QU5A 4O1PA 4ACGA 1KE8A 4TL0A 4MF0A 5M08A 2XUUA 4NW5A 2GU8A 4QRCA 3SOAA 3IW7A 1AGWA 3ORNA 4C62A 2Z8CA 3P7CA 5CU3A 4FUYA 4HCVA 1YOLA 3FMNA 4L42A 2IVTA 3VS2A 2FGIA 4UEUA 4DH8A 1WBNA 1BMKA 1Y57A 5HLWA 2R3NA 3PLSA 5EYCA 4R5SA 2XVDA 2YCQA 4ZTQA 2R3PA 2XYUA 3LFEA 4WUNA 1P5EA 4RIXB 2OI4X 2H9VA 3QA0A 2FSLX 5K0XA 4FNYA 2PVFA 4EOMA 5KHWA 3PXKA 2PTKA 1HOWA 5HO7A 3A7GA 4GVAA 4NK9A 2WKMA 5AUZA 2XIRA 3H9FA 3BWFA 4BFMA 1PKDA 1GIHA 5LARA 2JDVA 2F57A 1F0QA 1OKZA 2OICA 5DPVA 4EOKA 4AOTA 3W55A 4S34A 4EOSA 3BKBA 2JIVA 4A07A 2VTOA 2PWLA 4O38A 2J0IA 1PJKA 4UYAA 3DBCA 3ZUTA 4V0GA 4BDIA 1FOTA 4WNKA 3QL8A 2UW3A 3FZTA 1Q24A 3HDNA 4N6YA 3BI6A 2WFYA 4JG6A 4M69B 4FEUA 5DNRA 5IUIA 4OTGA 3F88A 5FP6A 4DN5A 2CKOA 4DEBA 2ITWA 3COHA 3OT3A 3QTQA 4ZSJA 3PVBA 4IIRA 2BVAA 4KD1A 4OW8A 1QCFA 2B9HA 3Q4CA 3LIJA 4M67A 3JXWA 1GZOA 3FSKA 1XBCA 3TI1A 3A7IA 2XK7A 4YJRA 4FTCA 1BUHA 2YIQA 3FMDA 3TZMA 2JGZA 2WMVA 3RK7A 1IR3A 3R8LA 3LHJA 4LM5A 1XH9A 2BCJA 5A9UA 1LP4A 4U97A 4QNAA 3UOKA 5M4CA 4QP4A 2R3FA 5FQDC 4IH8A 4MNFA 1ERKA 4CFMA 4FL1A 1H26A 4S33A 3ZXTA 4U3ZA 2W5AA 4DTBA 3EFWA 2VWYA 1X8BA 3FL5A 4C2WA 5HZNA 1WVWA 2GSFA 1O6YA 3R2YA 2A19B 3PXZA 1SNXA 3G9LX 3QQGA 1WAKA 2J6MA 2JD5A 4X6QC 3LFDA 5ANJA 5C27A 2HXLA 3AGLA 2UZUE 2WMUA 3LCTA 4YBJA 2ITQA 4LGDA 3VW6A 5CAUA 5L4QA 4QTAA 2Z7LA 1OPLA 1WBPA 2CKEA 3EN4A 4AAAA 2PPQA 3NVMB 2VO3A 4IJPA 2WIPA 3KA0A 3QC4A 4LV5A 4EQUA 1OM1A 2BTRA 3R1NA 4YUQA 3Q2MA 5FTGA 3BV2A 3G5DA 4DEEA 2UZOA 4JDHA 5AA9A 4JBOA 5BVOA 5KMOA 2WQNA 4FSQA 4ZP5A 4FTAA 2QKRA 1GJOA 3VW8A 5HIBA 3AG9A 4DCEA 3MFTA 4BI0A 4MXYA 4EWHA 4V01A 3D5VA 1UNLA 3SOCA 3QGWA 4EZ7A 2AUHA 3FZ1A 2OK1A 4CMTA 5BUJA 3QZHA 4BDGA 3OW3A 4YU2A 3TN8A 3PVGA 5HU9A 5HX6A 1QMZA 4FBXA 2OGVA 4TKSA 2I40A 2YZLA 5IH4A 2ZMCA 4IFCA 3EL8A 4QMSA 1R0EA 2HZ4A 2P33A 2ITPA 4R8QA 3COIA 3QD4A 3QTIA 3MB7A 4FF8A 5AIKA 3KF4A 3RPVA 5JT2A 4Z9LA 1UU7A 2PUNA 4OBPA 3R7GA 4RIXA 5B7VA 1ZZ2A 3NWWA 4GT3A 3CP9A 4YZDA 4ZK5A 3R9HA 2CGUA 4YLKA 1URCA 2HY81 1M7QA 4ERKA 3D5UA 5LJJA 3FZRA 3QUDA 5AA8A 5IQEA 4JBQA 3GC8A 2Q0NA 2VU3A 4CRLA 4H3BA 1ZMUA 2C6DA 5A46A 3K3IA 2B7AA 3R2BA 5TO8A 2GFCA 4ACCA 4IBMA 2W4KA 4PUZA 3VNTA 4HVHA 4BZNA 1BI7A 3KY2A 5M4FA 2WTVA 5KHXA 4C36A 5GINE 4MD9E 2B52A 5CEIA 3HVCA 3UC4A 5BUEA 2CKPA 3AC5A 3D15A 4M69A 4PMSA 2ETMA 3DB8A 3RWPA 3T3UA 4YJOA 4S30A 2XMYA 4M14A 3E3PA 3QD2B 1JSTA 3PA3A 4QPMA 2NO3A 4K8AA 4YTCA 4JQ7A 2WU6A 5J5TA 2UW5A 3HP2A 4GJ2A 3FHRA 5AR5A 4TWNA 3EN5A 4FKVA 3HYHA 4GJ3A 4F99A 1JVPP 4MQ2A 1H1SA 1YXXA 4O91A 3PXRA 2YACA 3GCQA 3TV6A 1Q41A 1UVRA 3C0HA 3A8WA 1XKKA 3BHUA 4BCNA 3BYVA 5J7BA 3U6IA 4AG8A 2W5BA 2UVXA 4WG4A 5DR6A 3D2KA 3S95A 3EFKA 2UUEA 2V22A 5BX0A 4RWIA 2W1IA 4FSRA 3FKNA 4UV0A 1SM2A 3NYNA 3TJDA 4B8MA 1XBAA 4HPUE 3FZSA 4BKZA 2QOLA 5H8EA 4USFA 3DBDA 4P2KA 4L01A 4BR3A 2O5KA 5IEYA 2OO8X 1ZY4A 3EOCA 4BDAA 1OUYA 3QLFA 3EFJA 4X3JA 3WYXA 1WVYA 2BHEA 3HECA 1OUKA 2WIHA 2WOTA 4LMUA 5FBOA 4UY9A 5I4NA 2YAAA 1RDQE 2PVMA 5AUVA 2R7BA 4PTEA 3VRZA 2J0MB 3ZMMA 4OBQA 4BRXA 4PP7A 3DU8A 3HKOA 4HGEA 5HBEA 3L1SA 4C59A 4J52A 1GIIA 3V51A 3ZYAA 3E8NA 4W4XA 3OTUA 5LOHA 4D55A 5HE1A 3QZFA 2R3OA 4UX9A 2VRXA 4RX5A 2UW4A 3BU5A 4G3FA 1UNGA 1GY3A 2R3RA 3ZFMA 5BVFA 1FGKA 3DDQA 3FY2A 3UBDA 1UV5A 4ZEGA 3NW6A 4CZUA 3SG9A 2C69A 5CAVA 1FGIA 3ALNA 4RJ8A 2V7AA 3ETAA 4L8MA 4USEA 3E7OA 3OY1A 3GOPA 4J99A 4RVTA 5HG7A 2C6IA 3LCDA 1ZYCA 5ACBC 2V55A 3VHKA 1PMUA 3R6XA 4E6CA 4GK4A 5K9IA 1R3CA 2CSNA 4YMJA 3LPBA 4U44A 2WXVA 1YDTE 5IQHA 3UPXA 1CDKA 3AD5A 4IC8A 4EORA 5AR2A 4QTBA 3NMUF 3EL7A 3H0ZA 3DJ7A 2YISA 4FV5A 1FINA 3PJ1A 5K5NA 4BWKA 1WBSA 2P2HA 3R7OA 4FNWA 2JKQA 4J7BA 3R30A 3ITZA 3OBGA 2CGWA 4NM0A 4E26A 1U4DA 4DGOA 4YSMA 2R4BA 3ATSA 5CALA 5IA1A 4YZMA 4F08A 2ACXA 4J8NA 4MK0A 4OAUC 2UVZA 5A6NA 3E3BX 3FYKX 3VS0A 3EYHA 2OLCA 1QPJA 2YIWA 4FTRA 4RBLA 4CLJA 5LVLA 4K9YA 3UO6A 4EK5A 4QYEA 3R7VA 3BLHA 3R71A 5FGKA 5AV3A 3AOXA 4OAVB 5JFVA 4YJQA 1NXKA 3D94A 3WZJA 5KMLA 2YAKA 1TQIA 2BZJA 4Q5EA 2Y4IC 1F5QA 4KRCA 2GNIA 2OW3A 3QD3A 2PVHA 3QQLA 3CGFA 4YLJA 5CNOA 4YPDA 1FPUA 4ITHA 4MXCA 4RFZA 5A4QA 2Q83A 4G3CA 4J53A 4QMXA 4RX9A 4XHKB 4Z55A 4ZTRA 5I9YA 3Q9ZA 4CSVA 2FSTX 4KKGA 3HZTA 3L8XA 2KULA 4XV1A 5BYYA 2UVYA 4C0TA 3HMOA 3P0MA 3RJCA 3Q4UA 5AWMA 4BDDA 3V5JA 4WT6A 4G6NA 4MD7E 5CEMA 5K4IA 2J4ZA 4I6BA 4M15A 3PLAE 3O7LB 2G15A 2R3KA 2X4FA 4JIKA 2WQMA 3GU6A 4PPCA 2GNGA 2WZJA 2ITZA 1NT2A 3PSDA 3NCZA 3RCDA 2J9MA 5I9VA 2G01A 4IMYA 3OD6X 3ZZWA 4JG7A 3RCJA 3MI9A 3CJGA 3BU6A 4KIPA 4FGRA 4RVLA 1RE8A 4FG7A 3QXOA 4OR5A 3ZLYA 1U59A 3DY7A 4S2ZA 4X6RA 3EQPA 5EM6A 4K18A 1DS5A 4MKCA 4FTKA 3UVRA 3WI6A 3VUHA 4EQCA 3PG1A 3WE4A 1OMWA 1BI8A 3I6WA 5EM7A 4C4GA 1G8AA 4N57A 5FTQA 3LJ1A 2UW6A 1PXIA 3QZGA 3PWDA 4YHFA 4PDPA 1XWSA 4ZAUA 5CANA 3GCUA 2JAMA 3R22A 3MGYA 5CU6A 4FT0A 1ZMVA 2VTPA 4Y95A 4J71A 2HK5A 3PPKA 3P9JA 5I5ZA 2I7QA 5DMZA 3PJCA 4GL9A 4IAYA 3L9PA 4A9TA 3UOHA 4D58A 4UWBA 3K5VA 3QHWA 4RVKA 2W1FA 2ZV7A 4AN2A 2HZNA 5H2UA 5T3QA 5M56A 4NTSA 5IZFA 5E8SA 2OJJA 2IVUA 4CYJA 4DC2A 2ZM4A 4APCA 1IRKA 1IEPA 3DGKA 4HVSA 4J1RA 5KCVA 4F0IA 1YQJA 4RIOA 3ZRLA 5HD4A 3PIZA 3FHIA 2JAVA 4L43A 5JRQA 1JBPE 2P3GX 4F09A 1QL6A 5L2WA 3O0GA 5HLNA 4GMYA 3MY5A 4FTQA 3GCVA 3UP2A 4AT5A 3SGCA 5EG3A 2O2UA 1YWVA 2BRMA 3ZU7A 4CFFA 3PPZA 3VBXA 1WBOA 4PRJA 4DT8A 4XS2A 5AM7A 2OH4A 5AP2A 4V05A 4CTBA 3CXWA 4WBBB 3D4QA 4IACA 1Q3DA 2ZM1A 3T8OA 5C4KA 3REPA 5HIEA 3TKIA 5ACKA 1S9IA 3EN9A 5E8YA 2XJ0A 5KO1A 2QODA 5GHVA 4CT1A 5DI1A 5BYZA 3N4UA 1OL7A 2F9GA 4O21A 4MNEB 5DGZA 5EDQA 3AC2A 3DK3A 3DZQA 4FSZA 4J98A 4AXAA 4EH9A 4QMTA 5CF8A 5DYJA 4RVMA 3ORXA 4YZBA 3V8SA 3VULA 4CYIA 4QPSA 1NVQA 4TN6A 2IJMA 2OF4A 2A2AA 2W1EA 2VTSA 1TKIA 4G5JA 4I4FA 5HCYA 4A7CA 1MRVA 4G6OA 4B0GA 3JR1A 3HRCA 2C1AA 2Z7RA 4AW2A 1IAJA 5J1VA 5CSHA 4DTAA 3LCKA 3GC0A 5JFXA 4FIFA 4RWKA 3HAVA 4E6QA 4O83A 1GNGA 5L6PA 2BAJA 4RZVA 4OTQA 3ZTXA 1YVJA 5AP4A 3VS7A 4G9CA 5D11A 3AQVA 2OZAB 1ZOHA 1UWHA 3A8XA 1DM2A 3PA5A 3TG1A 3O7LD 4Q9SA 5FTOA 3DKFA 4GW8A 2XK6A 2JIIA 4EONA 4FNZA 3RBWA 1OL1A 2W5HA 3W10A 4AN3A 4FSYA 1KOBA 3UOLA 2Z60A 4D2TA 3VBQA 2G2IA 4L3PA 3ORLA 4WRGA 2X7GA 3K3JA 4BTFA 3MY0A 3ZRKA 4BC6A 3QRIA 1YDRE 4EHGA 4MAOA 2V5QA 4LMNA 3U9CA 4U5JA 5IQIA 5DR2A 4IEBA 2WO6A 3GBZA 2GNFA 1VEBA 3JUHA 3VHEA 1JNKA 2W17A 3BPRA 3OWKA 4MCVA 1G3NA 3PPJA 4X3FA 4DG2E 5AAGA 5JFWA 3ZO4A 2YLEA 2CNQA 2G1TA 4L00A 4EKKA 4C3RA 3GP0A 5I9XA 4AX8A 4F4PA 4YC6A 4D0WA 5HTIA 3PDTA 4G16A 1WBVA 2O63A 1GAGA 2X0GA 2QQ7A 5IMXA 3UNZA 4UMTA 5FEQA 5HQ0A 3HRFA 5F1ZA 3ROYA 3W2PA 3S4QA 4M7IA 3ROCA 2BRBA 3LFNA 4OTFA 2VTQA 3LM0A 3C13A 2IVVA 5IH6A 4DAWA 3WF5A 4XV2A 4P90A 2HOGA 3OS3A 4FV3A 4QQCA 2X8IA 2ZB0A 4XG3A 3KXNA 2W1HA 2EU9A 3NPCA 4ACHA 3F3VA 3UQGA 4DITA 1YOJA 2ITVA 4YTHA 3W2SA 3MH0A 3NEWA 4GV1A 3BYOA 3PZHA 1GZKA 3IK3A 1BLXA 1YI3A 3DNDA 4JLCA 3FZPA 5DLSA 3TACA 4BCKA 5KBRA 3GT8A 5AUXA 4HZSA 1SNUA 3QTWA 5AAFA 5ANIA 5A4LA 3TKHA 4EWQA 4YJNA 2BZKB 5CZIA 4KIKA 3BHHA 4A4XA 3QTSA 5DR9A 2WTWA 3VUKA 5TE0A 4NZWB 1A9UA 1XR1A 4I24A 4MXZA 4O0SA 4FTUA 4FZAB 4R3PA 5CS6A 4O6EA 2I0EA 3C5UA 3C9WA 5CU2A 3D14A 2HW7A 5HCZA 4ZJIA 3RPOA 3THBA 4DBNA 5A4EA 2YJSA 4RC4A 3T9TA 4BGQA 3DKGA 5HX8A 4IC7A 4NH1A 1U54B 4FKRA 2OXYA 4JVGA 1PHKA 3RNIA 2B0QA 3W16A 1GZ8A 4C4EA 3FY0A 5E91A 3O96A 3RINA 1PF8A 4R6VA 5IDPA 3FV8A 3OOGA 3FZOA 4XBUA 3KVWA 4FT7A 5HESA 4RA4A 3P79A 4AACA 2ZV2A 4ZTNA 3VRYA 5TOZA 2YFXA 3DBEA 3UO5A 2O3PA 2A27A 5I9ZA 4I23A 2DS1A 4BICA 3BLQA 4PWNA 2XNOA 4NL0A 2G2HA 3QUEA 3ZFYA 4BVUA 3F5UA 3MS9A 5AJQA 3BV3A 3SKCA 3F7WA 4AP7A 4E4LA 4E73A 3Q4TA 1UKIA 3TTIA 4WOVA 2UZLA 2XK4A 2QR8A 3GU5A 1IG1A 1ZRZA 4ASEA 5J9ZA 4U45A 2BAKA 2OZAA 2EVAA 1ZYJA 3ZLXA 4CG9A 3TJCA 2UZBA 3VUGA 3ZDUA 3VQHA 4DEDA 1ZAOA 2YCFA 1ZWSA 3IOKA 3OMVA 4JNWA 4WRSA 4D4VA 4DLIA 4PNIA 5IDNA 4JRNA 3NW7A 2QC6A 5EYMA 4AOIA 3QTZA 5AAEA 4A9YA 4O7WA 1BYGA 4UALA 1ZYDA 4C8BA 4YJTA 5BQ0A 3MYGA 3UIMA 4KRDA 3I5ZA 2XK8A 4CRSA 3VIDA 1IASA 3CPCA 3ZRMA 2PULA 1QPDA 4NT4A 3S00A 3QCQA 2Q0BA 2BFYA 2JLDA 4IADA 3KKVA 4U3YA 4GFOA 4ZSAA 3NIEA 4N0SA 1YXSA 2BR1A 3ZO1A 4BDCA 3DBFA 4RC2A 4Y73A 5CQUA 2XM8A 5EKOA 3F5GA 3DB6A 3QYZA 4RG0A 4IHPA 3HA6A 5C1QB 3PRIA 3V01A 2CDZA 3JY9A 5KMIA 2QU6A 3NDMA 1OKVA 3ORZA 4O0VA 4LQMA 2GNLA 3TWJA 3ZM9A 4I5MA 2VTHA 5K0KA 4RX8A 4L45A 3FMMA 4E5WA 4JBPA 2LGCA 5ANOA 4AT3A 4H39A 2C3IB 1YXUA 2C4GA 1Q3WA 5CNNA 1W0XC 1KUTA 1JWHA 4HYUA 4O7LA 2CGVA 3SVVA 4NM3A 2RSVA 3QQUA 3QFVA 3VS4A 1M17A 4DHFA 4JS8A 5J9LA 4MYGA 3DBQA 4F7NA 3ENMA 3ANQA 2J0KA 3IOPA 3UQFA 1OVEA 3R9OA 4F9CA 4O84A 2GQGA 5LWNA 3O71A 3OF0A 2XBJA 4R78A 2OIBA 3FMJA 2VD5A 4IFGA 4RLKA 5L8JA 3KU2A 5JN2A 5ANGA 3D2IA 4CMUA 1YOMA 4JRVA 4HGLA 2WB8A 3TZ7A 1O9UA 2Y4IB 4CQEA 3DV3A 1XH7A 3CGOA 2WMRA 4TWPA 5CVFA 3V5LA 3ZO2A 4DEHA 4D4YA 4ZLYA 2CKQA 4M97A 4O22A 3Q9XA 4FTOA 3DQXA 4AT4A 3RKBA 4F63A 4XLIA 3VBVA 1PXJA 5D12A 3GQIA 4E4NA 4JT3A 3HAMA 5J1WA 2GNHA 2J0JA 3EYGA 3R7IA 3FLSA 4AA4A 2YN8A 5IA0A 4IX4A 4X0MA 4BN1A 5DRDA 4HW7A 5BMMA 5J5SA 3FUPA 2PZIA 1VZOA 4EHVA 4IWPA 3UYTA 2PYWA 3BCEA 4W4VA 2X2KA 3IW8A 4FSWA 3LOKA 2V7OA 1H1QA 1WBWA 5E8XA 5GJGA 2C5YA 4QQJA 3PRFA 4I20A 3OUNB 3VVHA 4BDHA 4D0XA 4B4LA 4BKYA 3QU0A 3RHKA 4YO4A 5EOLA 3RZBA 3HEGA 3SLSA 1ZOEA 1LUFA 3NYVA 3EFLA 3BHTA 2GNJA 4IANA 1Q5KA 3R0TA 1ZARA 4NKSA 2C6KA 5TT7A 4BBEA 1SVEA 4GS6A 3F5XA 3NIZA 4GUEA 3I5NA 4EK4A 4U43A 3A62A 2IO6A 4QYFA 5J8IA 5HORA 4BTJA 2RG6A 2VTRA 4NSTA 3TNPC 1K3AA 1J3HA 3U9NA 2EXMA 3KK9A 3KXXA 4IAIA 4CFUA 3BEAA 3MA3A 2UW9A 3IGGA 4BCIA 2VGPA 2YLFA 1VJYA 4BYIA 2YM8A 1W98A 4ZMFA 2C0TA 4N6ZA 4FV6A 4IW0A 5H8BA 4IM2A 4RC3A 2XP2A 4ONAA 4QMUA 3LW0A 3AT2A 5CT7A 5M44A 2XJ1A 5FUTA 5LMKC 3A99A 4WG5A 4G5PA 1WMKA 3EQFA 4RIWB 3ACKA 1CTPE 5E90A 2IG7A 3R9RA 3L9MA 3PJ2A 4ZTSA 2OU7A 5AMNA 3ZS5A 5KMMA 3O2MA 3PZEA 3IS5A 5DRBA 5HG9A 4ID7A 3MVLA 4D2PA 4X21A 5KUPA 4KIOA 3A7FA 4CFVA 2R3LA 5M53A 4XV9A 2JC6A 3P08A 2WMXA 2X9EA 2PUPA 4IZ7A 2VO0A 4S32A 4QYGA 2YDJA 4XMOA 4L7SA 4APPA 3C50A 2WU7A 5EQPA 5EDPA 1GIJA 3EQRA 4YGAA 4R7BA 2I0YA 5C4LA 1V0BA 4PDOA 4E5AX 3GB2A 2VTMA 2GS2A 3MJ2A 4XJ0A 4GU9A 1NW1A 3KRRA 4EL9A 3KVXA 4XNEA 2QOQA 3COKA 5C8NA 5M4UA 1QPCA 3E92A 5DFPA 3RP9A 2XNGA 3NCGA 2V62A 3PJ8A 2Y0AA 5AUUA 2XEZA 3FWQA 3C4XA 3IW4A 5I0BA 4HCUA 2JDSA 4UWCA 3T9IA 2J90A 3CD8A 3A4OX 4M8TA 5HO6A 4O2PA 4X2KA 3SX9A 4FTJA 3MY1A 3FXXA 4EOOA 1L3RE 3R21A 1OPJA 2BUJA 3QTUA 5A4CA 2QHMA 3Q5ZA 5D9HA 3BHVA 3Q9YA 3RHXA 3FLZA 4F65A 4DA5A 3OEFX 3QKKA 1YXTA 3NNXA 4Y72A 5J7HA 2HW6A 2QI8A 3DAEA 2ESMA 2Z7SA 4PTCA 5EOBA 3VS1A 4RFYA 4I0RA 2JDTA 2OJFE 1M7NA 4OTWA 3SRVA 3CQWA 4PPAA 5FP5A 2O0UA 2IVSA 2WQEA 4LGHA 4LYNA 3PP0A 4KBCA 2PMLX 2YJRA 3CTHA 4IQ6A 2X1NA 4DG3E 4ZY6A 4ALUA 4DGNA 1RQQA 2BAQA 5FEEA 1REJA 2VTIA 3F9NA 4YO6A 5IUGA 2AC3A 3G90X 4CCBA 1ZYSA 5AX3A 5M55A 2JIUA 1H24A 2W9ZB 2PZYA 3TKUA 2XK9A 5C8MA 2QOBA 3KL8A 4FYNA 3FPMA 4YHTA 5IA2A 4FUXA 4AUAA 3G33A 2CGXA 5DT0A 4E3CA 4IJ9A 4FIJA 4DGMA 4HOKA 3NW5A 1MRUA 4IE9A 4AZWA 4L46A 4GKHA 5DG5A 1PYEA 3BEGA 4QMQA 2G9XA 2ZV8A 3QQJA 2BKZA 4WHZA 4D2SA 3G9NA 3OFMA 4F9BA 1Z9XA 3QYWA 5KZIA 3LVPA 4MF1A 5AX9A 3UTOA 3QUPA 2P55A 1YHWA 2CN5A 3DJ5A 3NNUA 4XCUA 1SVHA 4YNEA 4I93A 2VNYA 4UBAA 4TW9A 3DT1A 1MP8A 3D9VA 3MN3A 3QQHA 3ID6C 3KXZA 3P4KA 4HCTA 3LMHA 3LXNA 5GJDA 5FLFA 3KGAA 4UZDA 2VO7A 5HI2A 4F0GA 4RIWA 4CFNA 1OIYA 3UZRA 2GDOA 4FTNA 3B2WA 3F3WA 4G9RA 2IZTA 4H3QA 1LEWA 3ZM4A 2BTSA 3PP1A 4HVIA 1WCCA 4I94A 4O96A 3R7EA 3RAWA 4YHJA 5LQFA 3KULB 2RGPA 3JS2A 4MH7A 2OJGA 2I1MA 5HHWA 3D5XA 3P78A 3KK8A 4CKIA 4KB8A 5GJFA 3W8LA 2ZB1A 4BCOA 3TUDA 2BRNA 3SHEA 1B6CB 3CR0A 3UIBA 4GK2A 4PP9A 3VQUA 4AOJA 4BZOA 4EBWA 3VBYA 5ETIA 2ONLC 3KMUA 4FV0A 2PUUA 5HEZA 3SG8A 2F2CB 1OKYA 3HDMA 4ZSLA 2BDWA 2JFMA 2VUWA 4EH7A 5GIOE 2QOFA 2QO7A 2R3JA 4LG4A 3BYUA 2PE2A 5AV2A 3LCOA 3V6SA 2HZIA 5M51A 3QRJA 4O7YA 2PVLA 5FM2A 4RX7A 4ACMA 4FKTA 1SZMA 4QYHA 4RQVA 5AV0A 3QTXA 5DT4A 2RFNA 3ODZX 5CQWA 2XKDA 4JI9A 3BQRA 3FQHA 2A1AB 3CEKA 4O0XA 2XKFA 3CE3A 1XQZA 2E2BA 3QCYA 3LM5A 2XCHA 4G31A 4NCTA 4WNMA 3KRWA 5CXHA 3ZXZA 4QYYA 4WO5A 2C6TA 4XRJA 1IA8A 1UWJA 1B39A 1PW2A 3PVUA 1TQMA 3ZEPA 4CLIA 5AUTA 4L7FA 3MIAA 3Q52A 4FKOA 1KWPA 1Y8YA 3F82A 4FV9A 3FKOA 5GNKA 4ALWA 2YA9A 1J1CA 4FV4A 2XB7A 3LFFA 1Q8ZA 3D7TB 4RJ6A 3POOA 3TNQB 2R7IA 4DEGA 4L52A 5AP0A 4YC3A 4EKLA 2PZPA 3O8PA 4J95A 5AR4A 1O6KA 3EZRA 3MIYA 4FZDB 1JAMA 1PMNA 4YZCA 3A2CA 4PF4A 4ALVA 4JX7A 5HVJA 4EHEA 3LMGA 4LOOA 3WARA 3PY3A 3WILA 4GH2A 4R3CA 4BIBA 1QPEA 2VWIA 3LJ0A 3H10A 1DAYA 1YW2A 3Q4ZA 3IECA 3OCTA 4MWIA 4D5HA 4Y5QA 2RKUA 2WOUA 1XBBA 2VTLA 3QALE 4FIIA 2WTJA 3M42A 2F49A 2H6DA 4GFMA 4W8EA 3OVVA
chains in the Genus database with same CATH superfamily
4I41A 4O2ZA 1WBTA 5HNBA 3MB6A 5EK7A 3ZSGA 4QP1A 2J5FA 2HIWA 2UW7A 2GFSA 4FV2A 4AGCA 4ZOGA 4AZVA 2PMOX 4QP2A 3O5AA 4DGGA 1J7LA 5CU0A 1YRPA 2F7EE 2QO9A 4YTFA 1ATPE 2E9UA 4DCAA 4NJDA 3DLZA 1NVSA 3F3TA 4EOQA 2C3JA 2J2IB 4O7RA 5CSVA 3W32A 3SXRA 2WAJA 4BCGA 3DXPA 4BJJB 3BRBA 4HJOA 4L6QA 4C61A 4AW5A 3VAPA 3VONA 3P7AA 4JIAA 2HWOA 3OP5A 4FX3A 2RIOA 3FLWA 5FXSA 2FH9A 4TT7A 3HX4A 5EH0A 3PIXA 5IISA 1W82A 3OTVA 1H00A 3QRUA 4K1BA 3BE9A 3BU3A 3U4UA 4DFZE 3TUBA 3ATTA 5CT0A 1BL7A 3IKAA 2BZHB 1JOWB 5CF6A 3KULA 3I79A 4PY1A 3PVWA 4I5CA 3FI8A 4FNXA 3ANRA 3FLQA 5A6OA 1W7HA 4R7HA 5ETFA 2ITYA 3QF9A 4F7JA 2PU8A 3R1QA 3TT0A 1OL2A 1I09A 2JKMA 3QD0A 5D7VA 3Q96A 4WNPA 1BKXA 3DXQA 4B7TA 3DNEA 3UIUA 4AE9A 4TY1A 1JKKA 4L44A 5EW9A 1ZXEA 4JXFA 4TTHB 3OWLA 3G6HA 4EZ5A 1VYZA 3LXKA 3E62A 4I6LA 3W2OA 1OL5A 4JL9A 3W0RA 5C01A 5JSMA 4G3DA 4XOYA 2EXEA 1UNHA 3IQ7A 5AP5A 4BB4A 2XA4A 2RF9A 2Y6MA 3P1AA 3I1AA 3E8DA 3N9XA 3QKLA 4JDJA 4IWDA 4RT7A 2ERKA 4XRLA 4QMNA 1VYWA 2BDJA 2PE0A 4RSSA 4EH2A 4EH3A 5E8ZA 1R39A 3Q5IA 4MHAA 1MRYA 3KF7A 3KQ7A 5DT3A 5JFSA 4EJ7A 5D7AA 3CKWA 2IZSA 2A0CX 3S2PA 2VTAA 3DAJA 2GHMA 3L8SA 4TPTA 3D7TA 4TXCA 3TEIA 4WG3A 5FD2A 3NVKI 3BGPA 4FSMA 1BX6A 3CCNA 4KSQA 4RWLA 5CSXA 5DVRA 3PUPA 2GQRA 4NYEA 2UW8A 3AGMA 4QP6A 4TYHB 2XKCA 3AMAA 3FAAA 3Q6WA 4FT5A 2QOKA 1JKTA 2H34A 4IB5A 4IX3A 4LFIA 4QD6A 4YC8A 5HOAA 4C57A 5TKDA 4E7WA 5IA3A 3RAHA 4FMQA 3CPBA 3MWUA 3L9LA 1PMVA 4H3PA 3MBLA 3UZPA 2X81A 2WMQA 2PL0A 3PFYA 1S9JA 2X6EA 4Y85A 4FEXA 3QWJA 3IONA 4AFEA 3KMWA 1KSWA 2Y7JA 4QP8A 4XG2A 3TNHA 3DKCA 3Q6UA 5CAQA 3VC4A 4XG6A 4D9UA 1G8JA 4YBKA 4NUSA 1V0OA 5HTCA 1OKWA 4AXFA 3PE1A 2ITOA 3FXZA 4H05A 5JH6A 2YM3A 3LE6A 4D1XA 3LJ2A 5FG8A 3I81A 1CSNA 4PTGA 5J95A 2LAVA 5L3AA 3JYAA 1W83A 4JAJA 4QT1A 2XRWA 2SRCA 4GK3A 5DEYA 4B8LA 5GZ9A 2YABA 3EHAA 1PXMA 5H3QA 2WEVA 1TQPA 2XIXA 3AD4A 5BNJA 3D0EA 2FVDA 2CNUA 2HWPA 3KCFA 2QOHA 3L9NA 4BZDA 5M06A 5FXQA 2WNTA 2XIZA 4BJJA 4FKUA 5AP1A 2C5XA 3SD0A 5DHJA 4ENYA 4BCQA 2PVNA 4Q5HA 1OB3A 5BVDA 4F6WA 3DA6A 2XNPA 3CC6A 4EK8A 3FMHA 4LOPA 1H27A 3EQIA 5CSPA 1OL6A 1CKIA 4NIFB 4CMOA 4QP9A 2IW8A 5JQ8A 5HO8A 2XEYA 3Q2JA 3Q53A 4DT9A 3TDWA 2C68A 2W7XA 3ODYX 4P7EA 5L6WL 3WF8A 4E4MA 3VBTA 5T68A 3C1XA 3NS9A 4D4SA 5LVPA 3VUTA 4TYEA 1Z5MA 4I4EA 1FMKA 2C5NA 2VWUA 3WF9A 1M14A 3DPKA 4RFMA 3WF6A 5CVGA 4Y5HA 3F61A 3FJQE 3H9OA 5EHLA 2HY0A 1Q99A 5CWZA 4IZAA 4H58A 4IX6A 4QMWA 5H9BA 4MBIA 4AWIA 5IU2A 1UA2A 3M11A 3PG3A 4QPAA 1KE7A 1G5SA 2YDIA 3F3ZA 3WZUA 3AC1A 1U46A 4MEDA 2OFVA 2YDKA 4QMZA 4RRVA 4O0RA 2EUFB 5I9WA 4C38A 4LGGA 2F2UA 4NFNA 5HBJA 2ERZE 2NPQA 5HE2A 3ZFXA 3E7VA 2DQ7X 1VLRA 5FWKK 5J87A 5IF1A 3BYSA 3LAUA 4LRKA 2PVKA 4AXCA 3PY0A 2VGOA 3U51A 3C51A 4KKEA 5H8GA 3BHYA 4FZFB 1YKRA 3ZBXA 3GGFA 3GQLA 4PL4A 3GVUA 4W4WA 4RA5A 1FVTA 5HTBA 5BUIA 4FIEA 4RZWA 3R8VA 3WF7A 1Q4LA 4TRLA 3L8VA 3ZH8A 4EBVA 4EOPA 5JEBA 2W4JA 1FQ1B 3WBLA 4U41A 3AC8A 2OJIA 3DK7A 4U80A 3GU7A 5JZNA 2WQBA 3WE8A 5E92A 5A4TA 1PXLA 3MPAA 3QBNA 4M3QA 3RWQA 4UYNA 4OGRA 5FBNC 4YNOA 3UODA 4FSTA 3CQEA 3I60A 1H1RA 5HVKA 2QONA 4ZZNA 3OBJA 4W9WA 2EB3A 5LMKA 1ZYLA 4UWYA 4JMQA 3V5QA 3OZ6A 4CVAA 3VUIA 5KX8A 4FK6A 3Q04A 3EWHA 3BL7A 1MQ4A 4IZ5A 3TUCA 4F7LA 4WA9A 4E6DA 4YPSA 3EJ1A 3MSSA 5D1JA 2R9SA 3AD6A 5L2SA 4C2VA 4G2FA 3IDCA 3HUBA 3NNVA 3NUUA 5LVOA 3LFBA 4TYIA 3RM7A 2W9FB 3QRTA 2ITXA 3R8PA 2ZDUA 4G1WA 2FO0A 5EW8A 4DFNA 2UV2A 5IA4A 3Q9WA 3A7JA 2OJ9A 5HIDA 3ZOSA 3NAXA 2OXXA 3G0FA 3LLAA 2BHHA 5IQFA 4BDBA 4LUDA 4XUFA 4N70A 3VS6A 4YJUA 3LZBA 2QURA 4DH1A 5BPYA 4IM3A 4RJ4A 4BWXA 3EN7A 2QKWB 2WMAA 3GU4A 4FKWA 4QDVA 1XH4A 2W0JA 3MFSA 4JJRA 4EYMA 4QMVA 3PXFA 2E9PA 4MNEA 1ST0A 2BROA 1Y91A 1PY5A 3O17A 3ET7A 2XK3A 2X7OA 2QLQA 4NIFA 5LMBA 1IAHA 3HV6A 4TWOA 4I22A 4AQCA 4BTKA 2VX3A 5CASA 2A4LA 1H0VA 4IB0A 1O6LA 4ASDA 2VV9A 3H0YA 1Q8WA 4DFUA 2B9IA 4JQ8A 4BDKA 5HBHA 5CEOA 3HV4A 3NUPA 3NFGB 4O7ZA 4I21A 4F70A 3D5WA 2R0UA 5BVKA 4CD0A 5CY3A 2VAGA 2UZDA 2EWAA 2I6LA 4A4LA 4D5KA 3MVJA 4KINA 5HICA 3SAYA 3QCXA 3KREA 4O7VA 3OUKA 4GG7A 3MVMA 5AR8A 4FICA 4FTIA 2HZ0A 3QLGA 3UYSA 2XCKA 1P14A 2EB2A 4M12A 3ZC5A 4F64A 3TZ8A 4CQGA 3IDBA 4CG8A 5E8WA 4F1TA 4ZLOA 4KA3A 2PZRA 3HV3A 1UKHA 3TV7A 1PXKA 3FEGA 4R7IA 4XLVA 1UU9A 1G8KA 3UOJA 4AZEA 1JKSA 3O51A 4D9TA 4LV8A 5K3YA 4HZRA 2XYNA 3DTWA 3LLTA 3DOGA 1I44A 5IKWA 4EOLA 3FSFA 4FSNA 4M66A 4FKLA 4PDSA 4AGUA 1V0PA 4H1JA 1UU8A 4PX6A 3C4WA 4F6SA 4MBLA 5C9CA 5AV4A 4L3JA 4KAOA 4AE6A 5EI8A 2XM9A 1HCLA 3W2RA 3GENA 4ANOA 1YI6A 3ORPA 3FYJX 1LR4A 4HNFA 2JBOA 2C30A 4BTMA 2X8DA 1YHVA 4JDIA 5M4IA 1H07A 2JFLA 3I7CA 4NM7A 4OLIA 4CFWA 2QG5A 4TWCA 5A3XA 4UZHA 1XMMA 2X39A 3UDZA 4GT4A 1W84A 3DK6A 3OCBA 3KRXA 3OC1A 4EUTA 4MXOA 3UE4A 3M1SA 5AM6A 5FEDA 4LOQA 5BVWA 1JPAA 1KE5A 1DI8A 4O0WA 3LFSA 4E8AA 3OROA 4IWQA 3K54A 1B38A 2FB8A 3V5TA 4AGWA 4AN9A 4HNIA 5AADA 2YITA 4DEAA 3E5AA 4O81A 2GHGA 3B8QA 2WEIA 2J51A 3E64A 3FQSA 4I6HA 4O4BB 5EQEA 4DEIA 4MBJA 4JX3A 4PL3A 4C35A 3GC7A 5LCKA 2X0PA 4DE4A 2C6EA 3QGYA 4FIGA 4OUCA 3CSVA 2ITUA 2OZOA 3FI3A 1WFCA 2CN8A 4MQ1A 4CNHA 1YWRA 3FBVA 3ORMA 2VX0A 3IW5A 3GFEA 4F78A 4L9IA 4FV1A 5M57A 5HNIX 2YHVA 1W8CA 4FOCA 5BVEA 3I6UA 2QOIA 2Y9QA 1U54A 3GCPA 4QTDA 2B9FA 2NRYA 3D83A 1H08A 2I0VA 4JQEA 4ZSGA 3I0QA 5CF4A 2HYYA 2B54A 1YDSE 5C8KA 3EKKA 4BCMA 4BCPA 2J50A 1OIQA 4LUEA 3UO4A 3DKOA 4E93A 4L67A 4FTTA 4FR4A 3RM6A 3HMNA 3K5UA 5HLPA 2PE1A 2HAKA 4LV7A 1MUOA 5CENA 4KS7A 5CEQA 4F1MA 4HVGA 3GXLA 5J79A 5B2KA 3M2WA 4IVCA 4C3PA 4FKPA 4KBKA 4U7ZA 3VUMA 2XF0A 3U6JA 1XJDA 2VWBA 3S0OA 4ANBA 4RJ3A 4UMQA 1H25A 3A4PA 3VF9A 1Q8TA 4J97A 3BX5A 4GG5A 1SYKA 3GOKA 3LQ3A 1FBNA 4PV0A 2CLXA 2C3KA 3TIZA 4AXDA 5DIAA 3ORTA 2IZUA 4X3FC 2NP8A 2IWIA 3R73A 4R3RA 4XH6A 5DEWA 4BDJA 4AZSA 4K33A 3OWPA 4OT5A 2ETRA 4ZXTA 4DDGA 4FRFA 3CS9A 5GZAA 2XARA 4IB3A 3PYYA 4QOXA 1FVRA 1PRYA 4G3GA 4CZYB 2BPMA 2OWBA 3OCGA 3PSBA 5IG1A 3R1YA 5LMAA 5KBQA 4X2GA 5CXZA 3QZIA 3VS5A 2OSCA 2B9JA 2XAOA 5CAPA 3MA6A 4BYJA 4PQNA 3DAKA 4QO9A 3QQFA 3MFRA 4GU6A 4ASZA 4DINA 2C6LA 5IQCA 4K77A 4DH3A 5DN3A 3V5PA 3ENHA 3BLAA 4C4JA 3CLYA 5L2QA 3S3IA 3NUSA 4BIEA 3NGAA 5HU3A 3FI4A 2OG8A 5CZHA 4AZFA 2C5VA 4LDTA 3R01A 4FZ6A 1M2RA 4LRMA 1Z57A 4OT6A 2IN6A 5EYDA 4AW1A 4DFLA 5AEPA 3U55A 4MTAA 2AC5A 1YXVA 2XRUA 1E1VA 4EOIA 2YIYA 4OTDA 3O23A 4GT5A 1H0WA 4ERWA 4XP3A 5FRIA 3ULZA 5LXMA 5JQ5A 2ZM3A 3CBLA 1NA7A 3V6RA 2PVRA 2OIDA 4YJVA 3DFCB 2UZVA 5ANKA 3NYOA 2R0IA 4O4CA 5F95A 1PYXA 3UG2A 4C33A 2WHBA 2XJ2A 3MJ1A 3R28A 4TNDA 4O7SA 1AQ1A 2JDRA 3PE2A 2JEDA 5HE0A 4FI1A 4TZRA 1IA9A 5ANEA 2CJMA 2VTNA 3I0OA 3CY2A 4ZSEA 3NUAA 1REKA 3F2NA 4O0TA 2BRHA 3SXSA 4D1SA 5IEXA 4XG8A 1J1BA 4AA0A 3B8RA 4HYSA 4ORKA 5E1SA 1V1KA 4E5BA 3V8WA 3BBWA 3RAIA 5F94A 4R77A 3ZSIA 4R1VA 3L8PA 4L53A 4NKAA 4ANQA 1Q61A 4FG9A 1FMOE 3NYXA 2C1BA 2RG5A 3DJ6A 4P5QA 5HKMA 3MVHA 2BILB 3LKMA 3DXNA 3R8UA 2FSOX 3NLBA 2OBJA 2Z7QA 4FV7A 3TDVA 3GEQA 1FVVA 2PY3A 4FKJA 4XV3A 4RQKA 5D10A 5IPJA 3GC9A 3VO3A 5KMNA 3U54A 4C3FA 4BIDA 3CQUA 4OTPA 3WIKA 4EH6A 3R04A 2J0LA 4F9YA 4QTEA 4Z3VA 5JGBA 4ANMA 3RALA 1K9AA 1MQBA 4DH7A 3O50A 5JGAA 3RTPA 3ZONA 4WKQA 2C47A 3UJGA 3QA8A 2FUMA 3MH1A 1W2FA 4KABA 2J7TA 3CIKA 4F9AA 4C4HA 4GIIA 3UNKA 3SA0A 1R0PA 3NSZA 1M2PA 3EQGA 4FL3A 4U6RA 2WMBA 3E8CA 4YZ9A 4GKIA 4DF3A 4JBVA 1E1XA 1Q97A 4M13A 4PMTA 3C5IA 2PMNX 1JLUE 4K6ZA 2WPAA 4NWMA 5KZ0A 1YWNA 3BGZA 4HPTE 2R2PA 4HYHA 2G2FA 4MXXA 2XIKA 3F3UA 1XO2B 2WGJA 3R7YA 1OECA 2CHLA 4O6LA 4AS0A 3ZO3A 4NEUA 2VTJA 4USDA 1DAWA 2BZIB 3FE3A 4EC8A 3EQBA 4D1ZA 5CX9A 1JSVA 2GS7A 3WZKA 4CZTA 4O86A 3RVGA 4IXPA 3CJFA 1STCE 3OCSA 4QMYA 3U8WA 1Q62A 2X9FA 5B2LA 3TM0A 2Y4PA 2JKOA 3AMYA 3NZ0A 3DZOA 3GFWA 2BMCA 3QTRA 4FEQA 3GUBA 4QMPA 4IVDA 4RGJA 2FYSA 4K0YA 5J9YA 3RK5A 1YI4A 1LEZA 3TZ9A 2FA2A 2X7FA 3W1FA 3KXHA 5BVNA 3G15A 1OBDA 3QX4A 4U9AA 3ZLSA 3LMIA 4H36A 4I0SA 3HGKA 2XANA 4GSBA 1G8SA 4Y8DA 3BLRA 5IQDA 3HV5A 3QHRA 3DCVA 1F3MC 3SXFA 1XH5A 2JITA 4B6LA 4EI4A 5LVMA 2IPXA 4FTLA 4U0IA 3UMWA 2HELA 2WMSA 4OTHA 3UQCA 4CT2A 4LL5A 1KE9A 4G6LA 4BDEA 4LI5A 3N4TA 3LFQA 5HG5A 5TF9A 2WTKC 1WZYA 2XH5A 2Y8OA 3IGOA 2QVSE 5CI6A 3NR9A 3ZDIA 5I9UA 2O64A 1YHSA 2C3LA 3LQ8A 4QQTA 4JOAA 2PUIA 2E9VA 3POZA 3UGCA 4DYMA 4R5YA 1OBGA 2PVYA 3BYMA 2ZMDA 1ND4A 3CTQA 3C4ZA 1Q8YA 3DS6A 2OIQA 4CV8A 3ORIA 3HA8A 3VF8A 5AP3A 1WVXA 5HG8A 3I4BA 3H3CA 5DOSA 4GUBA 1OIRA 5CI7A 4ASXA 2W06A 5CSWA 3MV5A 3EQCA 4E20A 4EH5A 5CU4A 3MTLA 2R3GA 5JK3A 4IDVA 3OT8A 2R3MA 5G1XA 4CV9A 5KE0A 4H1MA 4KUJA 3SV0A 4FC0A 2ITNA 4EH4A 2BKKA 3C4CA 3EB0A 3UP7A 3U87A 2YCRA 3B2TA 4GCJA 3ZUUA 4DLJA 4IZYA 2Z2WA 5BMSA 2ZV9A 2PVJA 1JQHA 4KWPA 3HMPA 2JKKA 4FGBA 4JDKA 4DFBA 1CKJA 3E63A 2BALA 4E4XA 2VWVA 3DLSA 5EFQA 2VX1A 4ZZMA 5C03A 4BCFA 4BF2A 4CEGA 4WSQA 5HGIA 4IAFA 4C34A 2IEWA 1JKLA 3AXWA 2HCKA 4W4YA 4GYGA 4Z16A 4XEYA 5K4JA 1P4FA 4MD8E 4O4FA 3RK9A 3H4JA 5EM5A 1OGUA 2P2IA 3T3VA 3ULIA 4MXAA 4WNOA 5EKNA 4HGSA 4C02A 3QX2A 4CKJA 5IQGA 3QXPA 3RPRA 1AD5A 1W2DA 2B1PA 2XZSA 4DFXE 4YURA 1P4OA 4YP8A 5L8LA 4ZZOA 4AZTA 5E9EA 2H8HA 3V5WA 3CTJA 5HCXA 2ZDTA 3FC2A 4WUAA 4ANNA 3KN5A 2YERA 4DG0E 2VTTA 5EDRA 4D2RA 2GCDA 3EIDA 2C6MA 3VJNA 1PXOA 3QAME 4I0TA 2W1GA 2X8EA 3N4VA 5ANDA 3UDBA 3EZVA 4CTCA 4NW6A 4PDYA 3W0NA 2YIXA 3E8EA 4FVQA 1APME 3MTFA 4D2WA 3IO7A 4AGDA 1ZZLA 3JY0A 3TNIA 5KKRC 3AC4A 4XP0A 4I1ZA 2CCHA 1XH8A 2NYAA 2DWBA 4AFJA 1U5RA 3R63A 3ZCLA 2FSMX 3OHTA 4EQMA 4ZIMA 5IH5A 2B53A 2C6OA 2JBPA 3HL7A 5L6OA 5KMJA 3RPSA 3UC3A 5AFVA 4PMPA 5I3RA 2YWVA 3WIGA 2X0OA 3P86A 4GVJA 5I3OA 2X2LA 2BFXA 2ITTA 2H96A 2Z02A 1T45A 3UVPA 4EC9A 4F6UA 5B0XA 3ZUVA 3PWYA 4QNYA 4FVRA 2QG7A 3GNIB 2CPKE 2QCSA 4XG4A 3TV4A 4HVDA 4UMUA 4U8ZA 4I6FA 4XG9A 4MX9A 3TTJA 3VN9A 4ACDA 3FC1X 4WBOA 2XIYA 2YIRA 3FL4A 4Y46A 4ZS0A 3MW1A 2QNJA 3IG7A 3R00A 4N4SA 3GCSA 4PPBA 1P2AA 2RFSA 5AR3A 2VN9A 1ZLTA 2C0IA 4KNBA 2PSQA 2IW9A 4ZTMA 3TCPA 2YWPA 3G51A 1H1PA 3FQEA 3HRBA 3DQWA 4ANSA 5BYLA 3UPZA 4KBAA 3G0EA 4M0ZA 4YZNA 4BDFA 1PXNA 5E8VA 3HMIA 4FKIA 5ETCA 4UMRA 4G34A 2VWWA 4K11A 4ZTHA 2UZNA 4Z7HA 4BCJA 4GRBA 1XHAA 1H1WA 3OW4A 3FI2A 1NY3A 2PHKA 5E7RA 4BGHA 1E9HA 3II5A 2BRGA 4LRJA 3ELJA 3R83A 2EXCX 3UIXA 4FKSA 5DBXA 2P4IA 3OXTA 3BE2A 2YCSA 3P7BA 2GQSA 5EM8A 1SVGA 5K5XA 3ERKA 4F7SA 5E1EA 3ZC6A 2WMTA 4BGGA 2B4SB 4FE2A 4O0UA 4QMOA 3KXGA 5JMSA 4U40A 1H8FA 2ETKA 2W99B 4FYOA 3RGFA 4X3FB 2VWZA 1VR2A 3ZSHA 1KE6A 4FEWA 4EEVA 5AUWA 5HNGA 4CCUA 3W18A 4I5PA 3NNWA 4F0FA 5M09A 4XYFA 3R9NA 1UU3A 2IZRA 2UZWE 3AC3A 2VNWA 2Y6OA 3PJ3A 4A9SA 4FODA 2C5OA 5JZJA 4FIHA 4V04A 3EMGA 2R3IA 5IUHA 3TXOA 4FSUA 4FVPA 1M2QA 1L8TA 4ITJA 5ICPA 4IAZA 3NUXA 3W0MA 3BWJA 4BL1A 2AYPA 4FTMA 1ZOGA 2E9NA 2QLUA 3QRKA 3N51A 4BBFA 3S1HA 3FMLA 4BWPA 5GZ8A 4KIQA 5CEPA 4I5HA 1M52A 3SDJA 4MVFA 2V0DA 3COMA 3VWAA 3UVQA 4I92A 3BZ3A 4EYJA 5IQBA 4D2VA 4FOBA 1DI9A 3MPTA 4M84A 4KIKB 2ZFYA 2YEXA 4RLLA 2REIA 5E8TA 2YM4A 3CD3A 3PFQA 4PNKA 4BCHA 2XNMA 3FMKA 3C0GA 5AP6A 3HP5A 3F69A 4YJPA 2OFUA 3CKXA 3ZLWA 5LWMA 3PSCA 3VS3A 3HMMA 3W8QA 2X6DA 3PXQA 1Y6BA 4IAAA 4QQ5A 2B55A 3MH3A 3SW7A 5JKGA 2ZJWA 1CM8A 3UDSA 2OKRA 2R5TA 3U4WA 4O7NA 4ZS4A 4AF3A 4DH5A 5FXRA 2W4OA 3KRJA 3KXMA 5CAOA 2NNWB 2XNNA 4FL2A 1A48A 4QDEA 3V04A 4EUUA 2HXQA 2ZVAA 4BKJA 1TZDA 3KB7A 4NCTC 1JSUA 3WZEA 4WD5A 3KN6A 4O4EA 2O65A 5F4NA 5FDPA 3HNGA 4KKHA 2BIYA 3W33A 3E93A 3F66A 5F20A 5CLPA 4FT9A 4D4RA 4AW0A 5EW3A 4O7TA 5E4HA 4C7TA 2XKEA 3NRMA 2QOCA 4F9WA 3EN6A 2VZ6A 5L2IA 3HUCA 4EH8A 4J8MA 1T46A 3CY3A 3QCSA 4II5A 5B2MA 4I6QA 4Q2AA 3OWJA 4HYIA 3QWKA 4FKQA 5ETAA 4IM0A 5T6KA 5A54A 2W05A 4UXLA 2KTYA 2GMXA 2C0OA 4IAKA 5AR7A 5ITAA 2CMWA 1OI9A 3H9RA 1CKPA 4FK3A 3QC9A 4IB1A 4O27B 4RWJA 3R8ZA 5EQYA 3ALOA 3DDPA 3I7BA 2OH0E 4E6AA 3EQHA 5AP7A 4X7QA 3FPQA 3TL8A 4UMPA 5A14A 3LQ5A 2UW0A 4QP3A 4X2FA 2OXDA 2DUVA 4U81A 4L68A 4RJ5A 5HE3A 2WMWA 4JAIA 4FV8A 4TYHA 4BHZA 3JVRA 2QR7A 2W1DA 3TNWA 3HLLA 4I3ZA 2XBAA 4BY9E 2WELA 3MESA 3NX8A 4G17A 4OTIA 3A60A 1A06A 2NRUA 3C4FA 4FT3A 4RPVA 3RZFA 3Q32A 4BHNA 4D28A 4CKRA 1LPUA 4GIHA 2P0CA 3AKKA 4CGAA 5HD7A 1OITA 3SC1A 3BBTB 4C4IA 2GTNA 2J5EA 3P5KA 3ORKA 4JR3A 2WTCA 1EH4A 2GHLA 3F2AA 4A9RA 4E1ZA 5C26A 3BL9A 4G3EA 3ZZEA 2PK9A 4O1OA 4S31A 2YM6A 5AIRA 5DA3A 4YJSA 4NM5A 5KMKA 4ANLA 4XX9A 1KOAA 3OOMA 5TR6A 3UMXA 3G2FA 3BQCA 3C4EA 3KMMA 1J7IA 4ZY4A 4HGTA 4X2JA 1J91A 4YSJA 4KSPA 1PMEA 4EJNA 1Y8GA 3RMFA 4M0YA 3GI3A 3O8UA 4X2NA 3NAYA 4XP2A 4A06A 2CNVA 4IDTA 2BIKB 2WTIA 2BDFA 2QOOA 1OPKA 3C7QA 4DTKA 4EOJA 4C37A 2E9OA 1OIUA 2F7ZE 2WTKB 3ZBFA 1OZ1A 1PXPA 1CMKE 1R78A 4A9UA 4F1OA 1PKGA 3JPVA 3LFAA 4RJ7A 4W9XA 5G6VA 4XBRA 2F7XE 4XOZA 3KRLA 3RAKA 5CEKA 4YR8A 1ZY5A 4QMMA 3IPHA 4EHZA 2YM5A 5EI6A 1K2PA 4IX5A 2XALA 3Q60A 5FM3A 4RIYB 2RL5A 4YTIA 5IMEA 4YLLA 1KV2A 4NTTA 3W2QA 4R1YA 3FMEA 2OF2A 4QTCA 4FKGA 4WIHA 3RPYA 2IW6A 1U5QA 3RNYA 4IVBA 3EH9A 4B99A 1HCKA 4XG7A 1H01A 4CFXA 3GU8A 4KS8A 3F7ZA 2GPHA 3A7HA 1Y6AA 4ZJVA 2YM7A 4J96A 3VJOA 4EZ3A 3FLYA 4U42A 4AU8A 2PZ5A 3FXWA 4O0YA 1RW8A 1SMHA 4A4OA 2F4JA 3IW6A 3P5JC 3PA4A 3FLNC 3R02A 2ZAZA 3OG7A 4Z7GA 4ZY5A 1GOLA 4P5ZA 4Y83A 4ITIA 5CTPA 4NJ3A 1J7UA 3W2CA 3OXZA 4OTRA 2QHNA 3OEZA 2R3QA 2W96B 3LXPA 4PMMA 3BIZA 4TYJA 5JRSA 3WOWA 5EI2A 4DFYA 4UB7A 4FJVA 5DH3A 4FA2A 3MFUA 1TVOA 3FKLA 5KNJA 3R7UA 5AV1A 3BELA 2UZEA 3C0IA 3QQKA 3E88A 3F5PA 4MWHA 1NVRA 3UNJA 2GTMA 5FDXA 2YZAA 4B9DA 5L8KA 3FDNA 4NU1A 4UN0C 2VWXA 3RI1A 1R1WA 4GYIA 5HVYA 4JR7A 4AA5A 4ZMEA 4DBXA 3WYYA 3KFAA 4IVAA 3VBWA 3PIYA 5IA5A 3KEXA 5L2TA 3BGQA 1ZMWA 5EHYA 4V0GB 3UG1A 1RJBA 3LCSA 3UZTA 3K2LA 5D41A 2O8YA 2PMIA 4C4FA 3ACJA 4GEOA 5CYIA 5AUYA 2WD1A 5EYKA 3OXIA 2ZYBA 2W1CA 3DTCA 4WSYA 5IQAA 3F6XA 4ZTLA 2W1ZA 3EQDA 1XH6A 3ZHPC 2XNEA 3E87A 4QP7A 4BI1A 5EHOA 3SQQA 4LL0A 4GFGA 2UZTA 4ARKA 4UXQA 2XNBA 4RMZA 3ZEWA 3TIYA 4MUQA 3WZDA 4PL5A 4QMLA 4L3LA 4BI2A 4CXAA 4FZ7A 5JGDA 5LCJA 5DE2A 5KKRB 5LVNA 2X4ZA 2VO6A 2JDOA 4FG8A 1Q8UA 1OGYA 4ENXA 3R9DA