1ERKA

Structure of signal-regulated kinase
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
357
structure length
357
Chain Sequence
AAAAAAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords EXTRACELLULAR REGULATED KINASE 2
publication title Atomic structure of the MAP kinase ERK2 at 2.3 A resolution.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 110
structure length 357
sequence length 357
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 1996-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1erkA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1erkA01
4EORA 5DHJA 5HU3A 1UKHA 5CI6A 2JBPA 4HZRA 3IW6A 5AIKA 2B0QA 5BMMA 4M66A 1R39A 3LFNA 4M67A 1XBBA 4F9WA 2BHHA 1OM1A 4FGBA 5J5SA 4WSQA 2ZMDA 3Q2JA 3ZDUA 3EQRA 5CVFA 2Z7QA 4B99A 2VGOA 4IX6A 2Z7SA 3EYHA 3DJ5A 3NR9A 4NJ3A 3LM0A 5B2KA 1Q24A 2X7GA 3Q5ZA 2BZHB 3IO7A 3OP5A 5KBQA 3U55A 4YPDA 4O2ZA 3PXRA 3IGOA 1M2RA 2JKMA 3NUPA 3V5TA 2VWUA 4AA0A 3ZEPA 1UV5A 3LXKA 5L3AA 3KCKA 2WTIA 3CKWA 4I3ZA 4I5MA 4BWKA 3WF8A 2HXQA 2WMRA 2X9FA 3TIYA 2UW6A 4X2FA 4B7TA 5AP4A 3PXYA 4KRCA 4CT1A 3EH9A 1Z5MA 1SZMA 4IX3A 3V5LA 3POZA 4TL0A 4GKIA 4J52A 1R3CA 3QC4A 3P4KA 2XKCA 4IHPA 4ANQA 5IQFA 5LARA 2WEIA 1YI3A 3NPCA 4G5JA 3PSDA 4GFMA 3F88A 4DCAA 4RLLA 1OPKA 3TTIA 1OL6A 4BFMA 4RJ8A 5DIAA 5EI8A 3L9MA 2LGCA 3FBVA 2R7BA 2IZUA 4WHZA 4JOAA 2WOUA 2C0TA 3G2FA 4IAAA 4R3PA 4B8MA 2DUVA 4IM2A 2Y7JA 4CNHA 2O2UA 5FGKA 4QMVA 4BZDA 4YLLA 4PP7A 4L68A 4C4FA 4FV5A 3EQGA 4FTNA 2C6IA 4H1JA 2W17A 4PMPA 3NNXA 2ITVA 3UC4A 3LQ8A 4O7VA 3MYGA 3PVWA 4RIWA 4BDEA 1V0PA 3DV3A 5A54A 3UMWA 1ZY5A 2ZAZA 2IW6A 5HKMA 4AZSA 2XCHA 2HZNA 3HZTA 4IB0A 1QMZA 4EOOA 2CNUA 3BWFA 1M52A 3B2WA 4YZBA 3IDCA 4AW2A 4XG2A 1P4FA 5EQEA 1KE5A 2XH5A 3IW4A 3HMPA 3CBLA 4Q9SA 2PVYA 4USFA 5KE0A 3F2RA 4ANMA 3QRIA 1ZRZA 1DI8A 4EOSA 1W8CA 1GZNA 1ZARA 3IECA 4U9AA 4FK3A 4ZEGA 3QUDA 4IFGA 2BZKB 3OY1A 2EB2A 3CCNA 3OUNB 2C1AA 3NYVA 4DEDA 5DRBA 1PMVA 4IMYA 1W0XC 4XJ0A 2XIZA 3H9FA 3LCDA 4F7SA 1H0WA 3WF5A 3QHRA 4QTBA 4D5KA 4QP4A 3CQWA 3R7OA 2XB7A 4FKQA 3LXLA 4PPBA 2G2IA 5IQIA 3QZFA 3QUEA 3HUCA 4QP3A 4BIBA 2P2IA 5A4QA 1CKIA 3UYTA 1DS5A 3HVCA 4X6RA 4FC0A 4MHAA 4F7LA 5AAFA 2R3LA 2WQOA 1H1QA 3OEZA 5CT7A 5FXSA 2ZV2A 3C0IA 3PZHA 1FINA 3EQIA 3C13A 4LGGA 3H9OA 2Y6OA 5DR9A 3VHEA 3IDPA 3ROCA 3VRYA 2XS0A 5CYIA 4FVPA 1U46A 4N57A 5CAQA 1XBCA 2YAKA 2QOIA 4JT3A 4ZY6A 4F6UA 4ID7A 5D1JA 4F99A 4JBPA 4OT6A 4R6VA 4YJRA 3LVPA 4NUSA 4AS0A 3QZIA 2HW7A 4GV1A 3ORKA 4QQTA 4XP2A 2QQ7A 3C1XA 2NP8A 3NAXA 4K1BA 1YOLA 5EQYA 4JR7A 3AC1A 2CLQA 3LJ0A 5JGDA 1Q4LA 3W2PA 1BKXA 2PVMA 3HP2A 3LFAA 4OBPA 5HIEA 4AT5A 3DBQA 4E4MA 3GCUA 4HZSA 4TWNA 4XG8A 5B2LA 3SA0A 4TYIA 4F09A 3TUCA 4FKGA 4I92A 3F5UA 4NM5A 3VUTA 3CTQA 4GVAA 3EHAA 2EWAA 3QQFA 4O86A 3CY3A 4EQUA 5L8KA 2PVJA 3TV6A 2VTLA 4WG3A 5KX8A 5HTIA 1GIHA 4CFVA 5IH5A 3COKA 2OFUA 2B54A 3D5VA 1SVHA 4L43A 4R3RA 1JOWB 1PXIA 1ZMUA 4D2TA 1G8AA 5ANJA 4KWPA 4EQMA 3N4VA 5A14A 2I1MA 3LMHA 4FL2A 1CM8A 5HESA 4AOJA 4K8AA 4DN5A 3W10A 2PPQA 2WMUA 5A4LA 4JG8A 3FL5A 5C01A 3ETAA 2YACA 5C8KA 2JD5A 3COIA 4KD1A 3CGFA 3U6HA 4HNFA 3W2OA 3I60A 5IQGA 1FGKA 3HDNA 4NTTA 2IW9A 3TZ8A 3NAYA 3WZUA 5CI7A 5EH0A 2R64A 5ACBC 4DBNA 4F64A 5M57A 4O83A 3PP0A 4YNOA 4RIWB 1T45A 5DPVA 4BB4A 4WSYA 2BRNA 2ZB0A 2F7EE 2HZ0A 3PA5A 3AT2A 1WVXA 3P9JA 4B9DA 2OFVA 1LUFA 2YERA 2C0OA 3ORNA 4MH7A 4X0MA 5FBNC 1Q8YA 3COMA 3LLAA 4BDDA 2CLXA 4ZP5A 4PDOA 5HBEA 3W18A 4DFXE 1G5SA 3CGOA 3CJFA 5GIOE 1YXTA 4QT1A 2G01A 4MXZA 3ORTA 3T8OA 3DBCA 4I94A 4L9IA 1WBPA 4AOIA 4CLJA 4GUBA 5DEYA 1REKA 3DZOA 2BILB 3E62A 4JBVA 2VWYA 4AG8A 3LFEA 4CFFA 5J95A 1GJOA 4YTHA 3NZ0A 4FSTA 4N70A 5AP1A 3ZZEA 5AAEA 5AP5A 5KMLA 2W1IA 4BHNA 2C6MA 4JQ8A 2W1GA 1UKIA 1QPEA 2O0UA 3N51A 4G3GA 5E8TA 5HG7A 4NCTC 2RFSA 2WTVA 5DYJA 4NH1A 1O6LA 3WZEA 4O6LA 4S33A 4O0RA 4MX9A 3A8XA 3ORZA 2PU8A 3AC5A 3Q4TA 3UZRA 4EKKA 2QOHA 2ZB1A 4BCJA 1REJA 4ZSLA 4I41A 5DMZA 3QBNA 3ORPA 1BL7A 3POOA 5M51A 3VS1A 1RE8A 3PG1A 4S31A 4CMOA 5HEZA 3A2CA 4H05A 1I44A 2V62A 2B9FA 5C27A 3G90X 4AE6A 4MEDA 4G2FA 4CLIA 2A4LA 4EC9A 4QP8A 2QO9A 4IWPA 4FSZA 5CQUA 3OXTA 4LGDA 2GNJA 2PVLA 4LV5A 4UMUA 4FG7A 5DH3A 1B38A 3R73A 3H0YA 4MBLA 5JSMA 4K0YA 5FG8A 3GCVA 3GCPA 3HEGA 3PJ2A 5CLPA 3VBVA 4EYMA 2JDTA 2WEVA 3MDYA 4LMNA 3BHTA 3W2SA 3ZSHA 5K0XA 3QLGA 3UBDA 3WIKA 3ZOSA 4ERKA 4IJPA 2OF2A 3UPXA 4F70A 3NIEA 2XNBA 3FC1X 2Z02A 1PXKA 3G51A 3OS3A 5IISA 2EU9A 2B4SB 4O0SA 3F69A 4PPCA 1CDKA 3LM5A 3R22A 3HV3A 4EOIA 4YTIA 4FIJA 2PVRA 4QMWA 2QR8A 4NEUA 4QPAA 1YVJA 3QUPA 4PL4A 5M4CA 3BI6A 3TXOA 4GCJA 3BLHA 1WBSA 2XZSA 3FKOA 3BKBA 4LRKA 1A48A 3LFCA 1SVEA 3NUNA 4JIAA 2C3KA 5I5ZA 3ITZA 4HOKA 2BUJA 4I5HA 4IX5A 4K11A 5BYYA 4FSRA 4U42A 4G9CA 5AA9A 2VX0A 2YIYA 2OJ9A 3PFQA 4IZAA 2VO3A 3Q4CA 4QYHA 3ZLXA 4E8AA 3EYGA 3K3IA 5CEMA 5KHWA 2OIDA 3UYSA 4O0YA 4BGGA 1H00A 2Z7LA 3AC8A 3RNIA 3DQXA 4FODA 2HOGA 4A9SA 3R28A 2YJRA 2PUNA 4DH3A 4HGLA 4TW9A 5M08A 3FPMA 1KE6A 3L9NA 1UWJA 3BX5A 3NSZA 1ZY4A 3VBWA 5A6NA 4OTQA 3MI9A 4D1SA 4CEGA 4FL1A 1HCKA 3R1NA 5A46A 3SX9A 3FC2A 4CFUA 3T3UA 3JPVA 3KMUA 1LR4A 4E5WA 3A4OX 3SW7A 2CNQA 2ZM3A 3MB7A 4MKCA 3P7BA 4HVDA 4YUQA 4PRJA 3UG1A 5A9UA 2OI4X 2YAAA 4GT4A 5CU4A 3M1SA 5AV1A 2RFNA 1JNKA 3GNIB 3RAKA 3OW4A 4UN0C 5TR6A 4DEEA 3SDJA 3ALOA 4B8LA 4CKIA 3IW5A 3IDBA 3O7LD 3BCEA 3PLSA 4ANOA 2PK9A 3CS9A 3C4ZA 3VULA 3Q53A 4AFEA 4XCUA 2ZJWA 2IVTA 3LE6A 3GU6A 4IXPA 2XF0A 3PSBA 3COHA 5HORA 3UQGA 2B1PA 1OIYA 2W05A 3W8LA 1PMUA 2E9PA 3L8SA 4L3LA 2G9XA 4RRVA 3O17A 2ZOQA 4RVMA 5CWZA 4O0TA 1LPUA 5AADA 3VQHA 2VX1A 3SRVA 3TV7A 4BBEA 2Y6MA 4YHTA 1FBNA 4CG9A 3QCYA 2XM9A 4FKIA 4JR3A 2UW8A 4V05A 3KXGA 2HW6A 4H3QA 3WOWA 1Q3WA 3BHVA 5IQCA 4UWYA 3RPVA 2ACXA 3CY2A 4BTJA 2B9JA 2H96A 4BY9E 4D1XA 4AXAA 3GC9A 3V3VA 3SG9A 1H1WA 3ZZWA 4EK3A 2B9HA 2YCRA 4H39A 4TYHA 4ZSJA 5BYLA 5FTQA 2UVXA 3E87A 3GGFA 3FV8A 3RPRA 4D2WA 4F7JA 3F6XA 4R1VA 4C4HA 4KRDA 2F7ZE 3H30A 2QOCA 3KL8A 4QRCA 3IW8A 4WUAA 1U5QA 3PDTA 2GDOA 3QALE 3UDBA 2YFXA 3CQUA 2ITUA 3VQUA 4WBOA 5EOBA 2UZOA 3R83A 4IW0A 5EKNA 5BNJA 1H28A 4J99A 5CU6A 2UZNA 3S4QA 3QRKA 4IFCA 4WG4A 4GL9A 3OFMA 4NM7A 3CLYA 3D7ZA 4ENXA 2E9OA 3RALA 1AD5A 2R3NA 4XS2A 4C37A 4YGAA 3QKMA 4IJ9A 4A4XA 4NM0A 3FMDA 4AA5A 2JITA 2P33A 4EQCA 4EUUA 3QA0A 4C3RA 5JN2A 5EDQA 3R9RA 3P23A 3QLFA 2QNJA 3AXWA 2RFEA 3KK9A 3P0MA 2W96B 5DT0A 4QMOA 5IA5A 4L44A 5CEIA 5CAPA 3SVVA 3UVRA 3P08A 3VJNA 1F5QA 4JI9A 1ZWSA 4TYEA 3H9RA 2VTMA 3NNWA 2QURA 3BZ3A 3R8VA 2YLFA 2EB3A 3O8PA 3IOKA 4EZ7A 3ATSA 5DN3A 3V8SA 2J0JA 3H4JA 5IDNA 3QRUA 4OTHA 1FGIA 4TT7A 4BWPA 1JSVA 4TWOA 5CF5A 4Q2AA 3W2QA 2VU3A 2WU7A 2DQ7X 4O7YA 1YXSA 1Q61A 4DINA 3UQFA 2C3IB 1LEZA 4R77A 3KF7A 2GQSA 5EM8A 3EN9A 4DEGA 3HAMA 2XNPA 3RPSA 5JGBA 3U87A 3CR0A 3BU3A 2QOLA 3MIAA 2BMCA 2J50A 3AT3A 4O22A 3WF9A 4XHKB 2XK9A 4O0UA 5KZ0A 1KUTA 3BGZA 4RA4A 1W82A 2RIOA 4QD6A 4R7HA 4F9CA 2E2BA 4CYIA 3UP2A 5ANGA 4YMJA 5LQFA 2E9VA 1IA9A 3Q9WA 4FSYA 4OAVB 2ZV8A 4I0TA 2F7XE 4D2VA 4J7BA 2C4GA 5DR2A 4U41A 4EBVA 3BWJA 5ACKA 2CGWA 3TV4A 5I0BA 2EXMA 3LXPA 4TNBA 5CT0A 1KWPA 3BEAA 1S9JA 2OK1A 2PVHA 3EIDA 5EK7A 4O0VA 4UY9A 4HVIA 3QD0A 1M7QA 5FP5A 4I6QA 3MSSA 5CU0A 3E5AA 4PDSA 3LCKA 4P90A 3FXWA 1YRPA 1OKYA 2UZBA 1U59A 3W32A 5LVPA 3F3VA 4D2SA 4FTUA 4AW0A 2UW7A 3HV4A 4U3ZA 1YI6A 4U79A 5C9CA 1V0OA 3GT8A 2YIQA 4PTGA 2VO0A 5ANIA 5I9ZA 3DJ7A 5AUUA 2W4KA 2C47A 2CKEA 5TO8A 3PPJA 4CZUA 4YLKA 3SRVB 3F5XA 5CEQA 1GOLA 1W7HA 2PZIA 3I7CA 3Q6WA 4GW8A 2YIRA 4O6EA 3DZQA 5EKOA 2WKMA 3QKLA 4S34A 4YZMA 3R7EA 3JVRA 4PPAA 5LJJA 3UO4A 2BTRA 4ANNA 5C8NA 4Y85A 3FMJA 5DFPA 3SLSA 2JDVA 2QO2A 1Q8TA 2G1TA 4XV1A 4QQJA 4TYHB 3RAHA 3VF9A 2YM7A 4D5HA 3ZEWA 2WZJA 3K3JA 4Y95A 3P78A 4M0ZA 4G16A 3HV6A 3VIDA 2ZV7A 1O6YA 3FLNC 3FZ1A 2BAQA 2QG5A 5GINE 2QD9A 4KA3A 2IZTA 1ZOGA 4YHJA 4BCKA 5IA0A 4BCQA 2PZ5A 4D2RA 1HOWA 2FYSA 5BUEA 3QYZA 4G6OA 5AUZA 3SC1A 4BDAA 3D5WA 1H26A 5JZNA 2JAMA 1JKSA 5JFVA 1PXPA 2HK5A 4DGLC 4U45A 3ZLSA 3ZO3A 3WYYA 4FV6A 3TDWA 3BBWA 5IH4A 5JFXA 3NUXA 5K5XA 2XM8A 3HUBA 3E8NA 2QODA 4MYGA 4NTSA 4FTQA 5HGIA 3PY1A 3VO3A 4CYJA 5M4UA 2R3JA 4U44A 4PY1A 2V5QA 4BGHA 5H2UA 3LCOA 3KGAA 1NVSA 3TNIA 2IW8A 4C4EA 5DE2A 4D0XA 3GBZA 1Y8YA 4DTKA 5HVYA 4A4LA 4BGQA 4PWNA 5L2QA 2ITPA 3OBGA 3RK7A 1PXJA 3OD6X 5GJDA 4BIDA 3BV3A 2PL0A 4UB7A 4TYJA 2X1NA 1CKPA 2WPAA 2VTOA 5I3RA 1BI7A 2O5KA 3WZKA 3OCGA 5CF4A 3V5WA 3AMBA 2BCJA 3O51A 3QA8A 4Q9ZA 4TZRA 5AP0A 5FDPA 4BCFA 4JVGA 3C4WA 3QCXA 4X21A 4WNMA 4ASZA 3PWYA 4LRJA 3NUUA 3SHEA 4EK6A 3FL4A 4QQ5A 3A8WA 2UVZA 3UIBA 2C6DA 4MCVA 4RPVA 5CSHA 3C0GA 4NCTA 2JDOA 5AEPA 4MQ2A 1ZZ2A 4FTOA 4ERWA 2E9NA 5KMMA 3VUKA 4WNKA 3FXZA 2C5XA 4BCOA 5KO1A 2J0MB 4RIYA 4ZJIA 4MF0A 3D5XA 2FSMX 4GJ2A 4DF3A 4AF3A 2B53A 2FH9A 4O1OA 3JYAA 3ZYAA 4IIRA 1PJKA 5DWRA 2IPXA 2QHMA 3O96A 3MH2A 3BQRA 1Q97A 4TWPA 4FZ7A 4X2JA 4CQGA 3PYYA 4UYNA 5HIDA 1GIJA 5BVWA 3R9NA 3UG2A 3V5QA 3HMOA 4G3EA 3ATTA 2B7AA 5E9EA 3PJ3A 4DH7A 3F9NA 4QYFA 3F2NA 1YW2A 3R7YA 4RX5A 2AC3A 2JGZA 3QCSA 2O64A 4G6LA 4CV9A 2PZPA 2PHKA 2CPKE 1KE9A 3BE2A 3OHTA 4BDGA 1X8BA 2C5OA 2JIIA 5AAGA 2WOTA 4G17A 4XRLA 3VW8A 2J2IB 3MVLA 4RZWA 2GHGA 3R8MA 5FDXA 5JFWA 5KMKA 3PSCA 4EH3A 4TKSA 3IGGA 1P14A 4OUCA 3QWJA 1KOBA 1PMEA 3RZBA 4C33A 4KBKA 3MFRA 3W16A 4CCBA 5HTBA 1OPJA 3AMAA 4GYGA 4L7SA 1QCFA 2HZ4A 4HJOA 3EN6A 1SNXA 4RX7A 2YISA 4J8NA 1GIIA 3KF4A 3GOPA 4JLCA 4L6QA 5HCXA 4YURA 2YCFA 2UZUE 4CZTA 2P2HA 1JSUA 4FIFA 2BPMA 4EH8A 3ZFMA 2X6EA 4GKHA 5I4NA 1URWA 2CDZA 1DAWA 1EH4A 3C4CA 1H25A 2X4ZA 2QONA 1Y8GA 1R1WA 2ITXA 1OITA 2YCSA 2ZM4A 4W4YA 4EONA 3R7VA 4AZEA 2CGVA 3W55A 5LWNA 2OZOA 3BHUA 2ERZE 3SXFA 4E5BA 3LFBA 4F0GA 3A62A 4UYAA 4BKYA 3DXPA 3O0GA 3U4UA 3EKNA 3OC1A 4A4OA 4ALUA 2X7OA 3EMGA 4XG3A 4BF2A 2J4ZA 4GT3A 5M07A 5AX9A 3UNZA 4ZS4A 3UIXA 3P79A 1IAHA 3R6XA 1XH9A 5AR5A 3QGWA 4PMTA 2H8HA 3BU5A 3FMLA 4RZVA 4U3YA 1E1VA 3S2PA 4DC2A 2W9ZB 4GFOA 2VWWA 4QTAA 1XH6A 5IQHA 4NSTA 3DFAA 4KINA 3Q32A 3MPTA 4F0FA 3O2MA 4YJNA 3DXQA 4RIXA 5DG5A 2C6KA 1KE7A 4L3JA 4Y8DA 4IACA 3QQGA 3ZFXA 4ZZOA 2FGIA 4FT0A 3UVQA 2VTRA 3OZ6A 2GMXA 5IKWA 5HOAA 4YJSA 4U8ZA 4BC6A 3ZFYA 4P7EA 3DKFA 3JVSA 4FEUA 4O7SA 3GC8A 4EOLA 2C6TA 1BX6A 2VWXA 3TZ9A 4TYGA 3GEQA 4LOPA 4RVLA 4MQ1A 3MA3A 2WIHA 4FT7A 1STCE 4HYHA 1VYWA 2VUWA 2BIYA 4GEOA 4I4FA 4MNFA 3KA0A 1NXKA 4JIKA 5BMSA 5L2IA 2C6LA 2HWPA 2J0IA 3KXMA 5L6WL 4ACGA 4DFYA 4D4RA 1OIRA 5EI6A 4L01A 4W9XA 4CFMA 4LOOA 4CKRA 2BRBA 4RIYB 3OXIA 4ENYA 2NNWB 3TG1A 1M7NA 5EYCA 4EJNA 2Q83A 3AGLA 3KRLA 3PXKA 3UNKA 5DNRA 5EG3A 3N4TA 3GQLA 4BBMA 5JKGA 2IG7A 5LXMA 4L8MA 3QKKA 4OTIA 2O63A 2VTTA 2WTJA 1XKKA 5F95A 2R3IA 2YDKA 2VTJA 3MA6A 4BR3A 1Q99A 5IQEA 5HO8A 3FQHA 3R02A 2WMWA 4BRXA 3CPBA 2IVUA 2QLUA 2BKZA 2OLCA 5AV0A 4W8EA 1YQJA 4XBRA 1JKLA 3LJ1A 3OY3A 3TI1A 4YZCA 4IANA 2XNEA 4AFJA 5IF1A 2QR7A 2J51A 2OJIA 4EBWA 4EOJA 4FIEA 4OGRA 4ORKA 4CG8A 2VX3A 4R78A 2WTKC 2PSQA 3PRIA 1JVPP 2WFYA 4FZDB 2GU8A 1H1PA 4UZHA 2FA2A 1XH7A 3GU4A 3VJOA 2XKFA 4EH9A 5KCVA 3FMMA 2IVVA 5IH6A 4QTEA 4IADA 2JDSA 3QRJA 2UW0A 4NJDA 5IZFA 3TKHA 1KV1A 5A3XA 4BKJA 3ACKA 3DT1A 1YXXA 5AP6A 5B2MA 3UO6A 1UU7A 4BDBA 5HD4A 4YSMA 3NIZA 5JH6A 2C1BA 4FA2A 2JBOA 3HGKA 5DR6A 2W06A 2W1CA 1P2AA 2C3JA 2YDJA 5CAVA 3ZS5A 5EQPA 3F3TA 5J7HA 4YC8A 4E4LA 4HVHA 2I7QA 1CTPE 1PXNA 1R0EA 1OECA 3ENMA 4PMMA 5CZHA 4CFXA 4DFUA 4FSQA 3TZMA 3PE1A 4RWJA 4DBXA 2GFCA 4FKTA 1XH4A 4YZNA 3T9TA 5FWKK 5C03A 3ZBXA 3OWLA 2HAKA 3Q4UA 2JKQA 4Y83A 4DGOA 5M06A 4PTCA 4MAOA 3NLBA 3VS4A 4NYEA 4IWQA 3K2LA 3JXWA 5E8YA 5HI2A 4AX8A 4G31A 4JQ7A 4EHEA 4FT3A 4M7IA 5J9ZA 2W5BA 3Q9XA 3I0OA 1OIUA 5IG1A 1Y57A 4H3PA 2XIRA 4LUDA 4EOKA 3DOGA 5D12A 3HMIA 3T9IA 3GFWA 2QCSA 4NIFA 5JEBA 2VN9A 3FLZA 5M55A 1XR1A 4RIXB 3TEIA 5EW8A 4NKAA 2UW3A 3R7IA 3GP0A 3PE2A 4FYOA 3Q04A 3MVHA 1FVRA 2HIWA 4IAKA 4TY1A 3WYXA 5IPJA 3EQHA 4FICA 3DK6A 4IM0A 4BHZA 4E3CA 2W4JA 2BFYA 3ODYX 3DXNA 3UZTA 3RP9A 5KHXA 3BYVA 1APME 3KK8A 2WMAA 2YIWA 4FYNA 3C4FA 4FG8A 4BDJA 4EC8A 5FEQA 1GAGA 3EQFA 1WAKA 2EXEA 1OKVA 1WBNA 3R8UA 3PVUA 3UOLA 4C57A 3C4EA 1OL5A 2ZYBA 4A7CA 1BI8A 4ZS0A 4ZIMA 2PMNX 2JDRA 4EH5A 4J8MA 3HYHA 1FMKA 3QTUA 4K77A 2BRMA 5LVMA 2Z7RA 3EL8A 3WE4A 1W84A 5DEWA 5T6KA 5TKDA 3WE8A 4B4LA 4OTDA 4IB1A 1ATPE 1MRVA 4CXAA 1YKRA 3VS2A 4I5PA 4IAFA 3DPKA 4D9UA 3GQIA 4ANSA 1TQPA 2FSLX 2QOOA 5EW9A 2XNOA 3R9OA 3QRTA 1CSNA 3Q60A 4LG4A 3QAME 4IEBA 1GY3A 2YZAA 3TKIA 3DB8A 2W9FB 3G5DA 3UZPA 4DTBA 4OTGA 1OL1A 2ITQA 4PF4A 2JIVA 4NM3A 4Y73A 3V6RA 4K2RA 1XHAA 3G33A 4QP9A 3VF8A 5HCZA 4ASXA 3Q2MA 1TQMA 5L2TA 1SNUA 4F08A 5GJFA 4ZY5A 3AD6A 5E7RA 3DKCA 5JQ5A 4XV3A 2O3PA 2W0JA 4JBQA 4EZ3A 5IEVA 5JFSA 1OZ1A 2Z2WA 2V7AA 2G2HA 3GU8A 4I5CA 4I6BA 2WD1A 2XCKA 4MD7E 3W8QA 4EI4A 5ITAA 4CSVA 4ZJVA 4MBJA 2F9GA 3ROYA 2CGXA 5EM6A 5K0KA 4YU2A 3R71A 2ITYA 2RF9A 2XJ1A 3G0FA 5A6OA 3PJCA 1XWSA 2VTQA 4C7TA 1XH5A 1J91A 3ZXTA 2XP2A 3IW7A 4IZYA 4XLIA 5FRIA 4C8BA 1M14A 2XNNA 4GYIA 3LLTA 2PUIA 4FOCA 4AZVA 2FVDA 3HP5A 4ITIA 3ALNA 3ZRMA 4E6DA 4BIEA 4RG0A 2YDIA 3UODA 4UX9A 3ANRA 4O38A 3AD5A 4RJ3A 5IEXA 3A60A 2XK7A 3P5KA 2YM3A 5AP7A 3Q96A 4NFNA 3DDQA 4FBXA 3G6HA 3MW1A 3ZSGA 3F7ZA 3BYMA 4FL3A 2Z8CA 1GZKA 4J53A 5EYDA 5AM7A 3VS5A 3IPHA 1ZYCA 2X81A 2VRXA 4LM5A 4EK4A 4WD5A 4FKRA 5HLWA 4FGRA 2I0YA 5E90A 5I9UA 3QTQA 2HY0A 5AUVA 3HMNA 5FLFA 3MESA 4CQEA 4DCEA 3L9LA 5J87A 1NVRA 2J90A 3RHKA 4LMUA 3QQJA 1M2PA 4J1RA 3PP1A 4YPSA 4D4VA 3HA8A 4CVAA 5K9IA 4FIIA 2VV9A 1WVWA 1ZZLA 3W33A 5HTCA 3DLSA 4U97A 4DLIA 2GS7A 4EHGA 4DFBA 3KMWA 3OTVA 4TTHB 5E92A 4WO5A 5CS6A 4FV8A 2P4IA 5HNBA 4PP9A 3FLWA 3FY0A 4GS6A 1P4OA 4DFZE 5FXRA 4K18A 4W4VA 2F49A 4NIFB 3MFSA 2BDFA 2GNFA 4XUFA 3WF6A 3U54A 4XEYA 1H0VA 3BLQA 3RTPA 1TVOA 2UZLA 2WMBA 3I5ZA 1FMOE 1Q62A 2X8EA 3OW3A 3ZDIA 5KKRC 1BMKA 4DFLA 1QPCA 3EFKA 3GU5A 1WVYA 3NUSA 4HCVA 2DWBA 4LRMA 4NT4A 1Q5KA 3DB6A 5EM5A 4FX3A 3VBYA 5L6OA 2R0UA 4EOQA 4Y46A 5BQ0A 4X3FC 2XMYA 5AV4A 2QO7A 2X2LA 3RPYA 5KMNA 3E93A 4RIOA 4P2KA 2WAJA 2RG6A 3U4WA 4ZTHA 4APCA 4IM3A 3UVPA 3ZM9A 1DI9A 4JQEA 1VEBA 2Y4IC 5IQBA 3VS7A 4YR8A 3F5GA 4JX7A 2OJJA 3EQDA 4RGJA 4F1OA 4YLJA 4MXCA 1J7IA 1PKGA 2YEXA 4C35A 3TUDA 2G2FA 3FQSA 4FV0A 4MD8E 2J9MA 4YZ9A 5HIBA 1B39A 2XK6A 3PWDA 4HCTA 3LKMA 3F3WA 2GQGA 2OBJA 4FSNA 3ZSIA 5IUGA 4EH7A 2ZM1A 3OOGA 2BTSA 4WA9A 4BN1A 4C38A 5KNJA 4O0WA 5FUTA 2R3OA 4IZ5A 5HG5A 3FPQA 3U8WA 1JWHA 3CD3A 3FJQE 3RVGA 3HKOA 2F2CB 4IBMA 4YBKA 2HCKA 3R00A 4JAJA 1GZOA 3VUGA 4DGMA 4EH2A 2VWBA 3PUPA 2XYNA 1FVTA 4KAOA 4QNAA 4CMTA 3SQQA 4CMUA 5L8LA 3D2KA 4YO6A 3ZM4A 1FVVA 5LVNA 2WQEA 2OSCA 3SXRA 2ITTA 3QZHA 5CSXA 2QU5A 4FV4A 4FVRA 4U0IA 3RCDA 4HVSA 4EJ7A 3Q9ZA 5BYZA 2B9IA 4OT5A 3DKOA 4KBCA 1XH8A 3V5JA 4G6NA 4ZY4A 2V0DA 3AMYA 3M42A 3PJ1A 4Z7GA 4AUAA 4YJPA 3E3PA 3EWHA 4G9RA 3LPBA 4L42A 3ULZA 3PJ8A 3TN8A 4R7BA 3R7UA 4C0TA 3S0OA 3QX2A 1JKKA 5GIPE 3TWJA 2GS6A 4CV8A 5GNKA 1SYKA 5HQ0A 5JK3A 3FSFA 3NMUF 1Q41A 3EN4A 4DHFA 4C2WA 3VUHA 4DG0E 1G8SA 3FLQA 2OGVA 1BL6A 3D4QA 5LMKC 5FM2A 3NUAA 3NW5A 2C6EA 2I6LA 2ITNA 3RZFA 1H08A 3VHKA 4NU1A 3NEWA 1WFCA 4G34A 4OTWA 4QTDA 3WILA 1A06A 5DRDA 4BCGA 5HG9A 4JS8A 5CAOA 5BUIA 2OH4A 5JQ8A 2R3FA 5AR4A 5AWMA 3ZHPC 4IWDA 2WHBA 4BKZA 4N0SA 4FE2A 1IG1A 4QMYA 5J5TA 3FZRA 4R5SA 4HPTE 3AD4A 3KULA 5H9BA 3KVXA 4K6ZA 5CXZA 1JSTA 3PXQA 4GU9A 5HD7A 1RDQE 2I0EA 2GNHA 4DT8A 2XJ2A 3LZBA 3PVBA 2X2KA 3A4PA 4BTKA 1G3NA 3REPA 3UTOA 1MRUA 5HX6A 4FZAB 4ZSGA 4RFYA 4XG4A 2BVAA 4RWLA 5ANKA 3PIZA 5E8XA 5HX8A 1QPDA 1U4DA 2V7OA 3IS5A 4O2PA 4C59A 3MJ2A 4D1ZA 3FSKA 5E1EA 4G1WA 4RBLA 1SVGA 4L53A 5DOSA 4QO9A 2DS1A 1OKWA 3PPKA 3FZTA 2EXCX 2PUPA 3BRBA 4NZWB 4PNIA 4L52A 4X2GA 4FKLA 2PY3A 4EK8A 2OW3A 2WMTA 4RFMA 2UV2A 2YM8A 3L8XA 3LXNA 1Y6BA 4NL0A 1H1SA 4FTIA 4JNWA 4OR5A 1VZOA 3TDVA 5C4LA 2BIKB 1UVRA 3NVKI 2QHNA 3EFLA 2C5VA 5IQAA 1AQ1A 1O6KA 2A2AA 4MXXA 1XQZA 4ACDA 3PG3A 4QQCA 5ANDA 4O7WA 3NX8A 2UW5A 3MTFA 2WXVA 3UC3A 4QMZA 2LAVA 4BI1A 4FSMA 4M97A 2NRYA 2W1ZA 1IR3A 4DH5A 1OL7A 4M69A 1KOAA 2CHLA 3BYUA 3ZUTA 3UPZA 1OUKA 3A7FA 4TNDA 3PRFA 4FV3A 1WBTA 2KTYA 3QHWA 5GHVA 5M09A 4DFNA 4W4XA 5J9LA 2PVKA 2VTSA 2WMQA 3OUKA 3FI3A 4I6FA 3VAPA 3VUIA 4AP7A 2NRUA 4GT5A 5FTGA 4P5QA 3S1HA 3FZPA 4IX4A 4B0GA 4AT4A 2QOBA 3Q4ZA 4O7LA 5AV2A 4E4XA 3AC3A 3N9XA 5JGAA 3LFSA 3EZRA 3ZONA 3CSVA 3NW6A 3MVJA 4M13A 3CD8A 4M68A 4DA5A 3FYJX 5JT2A 1IAJA 4ALWA 4E93A 3F3UA 5AUYA 5L6PA 3MH3A 5EFQA 3IG7A 4EYJA 4PL3A 3AC4A 3OBJA 1QL6A 4C4JA 4FZ6A 1YWNA 5FEEA 5EYMA 3GCQA 4GK4A 2OJGA 4EHVA 2BRGA 4KIKA 3ET7A 4YJOA 4ITHA 3C7QA 4USEA 5M53A 3JY0A 4H1MA 3A7GA 4RLKA 2PVNA 3ZO2A 3MWUA 4XP3A 4QP2A 5LWMA 1YHWA 3FZOA 2WMSA 3MGYA 1F3MC 3NNUA 4ZXTA 3TUBA 2QI8A 1H24A 4ALVA 3KRJA 4AE9A 2ZV9A 4I93A 3CJGA 2JFLA 4YBJA 2R3QA 4GG7A 3V5PA 1LP4A 3I1AA 1MP8A 3MFUA 2IZRA 2YWPA 3VVHA 4EOMA 4O7TA 2GHMA 4QMNA 3FE3A 2PE0A 2WQNA 3CIKA 4FT9A 4UALA 4BL1A 2CKQA 2BDJA 3BHHA 3O23A 3Q3BA 4UMRA 2X7FA 5EDRA 5E4HA 1DM2A 3GC0A 1YDRE 3GU7A 3OTUA 3QCQA 5AFVA 3E8EA 2YABA 2CJMA 4PUZA 5HVJA 5JMSA 2Y9QA 2XRWA 2OH0E 4MXYA 4GG5A 4LOQA 3KULB 5DI1A 3D83A 4EH4A 1PKDA 3DK3A 1QPJA 3FI4A 4IVDA 4QP7A 4XG6A 3FI2A 3G9LX 4O7NA 3LW0A 1Z57A 2CKPA 2H34A 2CSNA 4BTFA 3BGQA 4QMUA 5ETCA 4FG9A 5E8VA 3NCZA 1B6CB 4TN6A 2OXXA 1UU9A 3SW4A 2HENA 3KU2A 2VWZA 5BVDA 4FKOA 4NFMA 4YJVA 1GZ8A 3R0TA 4XYFA 3D5UA 3MVMA 3ZBFA 4AZWA 1VR2A 3OG7A 2IVSA 3NGAA 2W1HA 2CMWA 3AOXA 3SV0A 3FEGA 4QPMA 2XBJA 3LAUA 3EL7A 4KABA 4ZTLA 3DK7A 3I4BA 2HELA 2XNGA 5HG8A 4AACA 2XEZA 5CY3A 3RWPA 1Q8ZA 1WBVA 1Y6AA 3KQ7A 2OG8A 4TXCA 4BI0A 5HNIX 3ZRLA 3CEKA 5L8JA 4RJ6A 3DBEA 4BDFA 1MQBA 2P3GX 3HV5A 1JKTA 2Q0BA 4HNIA 3ZO1A 2XIYA 2F4JA 1M2QA 1OUYA 4LL5A 1GNGA 4I22A 3TKUA 3UNJA 3DJ6A 3PLAE 5CZIA 4I6HA 3KRXA 2W99B 3RBWA 2WTKB 4D58A 5K4IA 4HYSA 4ZLYA 3PY0A 4AT3A 3TNHA 5CENA 5CSWA 4YZDA 3LCSA 4YSJA 2XRUA 4FTCA 4N6YA 4R3CA 1BLXA 3DTCA 4QMLA 4PTEA 4CKJA 2XUUA 3OROA 4AA4A 2BKKA 5C8MA 2GNLA 3GXLA 4C3PA 4UV0A 4TPTA 4FV1A 3P86A 4XG7A 4E1ZA 1DAYA 3R2BA 4M69B 3RAIA 3HX4A 2WGJA 5T3QA 4AWIA 3R9DA 4ACHA 3MY5A 1T46A 3QQHA 3SOAA 3DCVA 4MWHA 4WIHA 1LEWA 3IKAA 4L46A 1ZYJA 2UW4A 4BTMA 4GVJA 5JZJA 4LQMA 4N6ZA 1RJBA 2BAKA 4O96A 4IQ6A 5CSVA 3LHJA 5HCYA 4ZJJA 5CEKA 1K9AA 4I21A 5K3YA 4DTAA 3TZ7A 4FNZA 3B8RA 4L00A 2ERKA 2UZVA 3EZVA 5H8EA 5ETFA 3VN9A 4F6SA 4APPA 3FI8A 2WB8A 4KIPA 2W1FA 4M3QA 5E1SA 1PW2A 4FTTA 3QXPA 2PMOX 4Y72A 3MH1A 3ANQA 1CKJA 3IK3A 4LUEA 4WNPA 4XG9A 3JS2A 5BPYA 5CQWA 2VTNA 3ORMA 1IEPA 4KIKB 4UWCA 4V04A 4H36A 2CNVA 3TCPA 2OO8X 5E8SA 4C4GA 4WOVA 4BICA 1UA2A 4AZTA 5ANOA 3C50A 4DE4A 4WRSA 3DAKA 5HE0A 5BX0A 4KS8A 5CVHA 3BPRA 4RJ5A 4IZ7A 4TWCA 3FAAA 5EHYA 5ICPA 4JDIA 3D7TA 3TNWA 3ZUUA 4F1MA 4CFWA 2EVAA 4Q5EA 2BZJA 3QTWA 3KRWA 1UWHA 3OT3A 1P5EA 4IAYA 4WRGA 1V0BA 3VUDA 3ENHA 5C4KA 3B2TA 1RW8A 1S9IA 3VBTA 2UZTA 4FV2A 3CTJA 4M12A 4UBAA 2RL5A 2OIQA 4X3FA 5FXQA 3F5PA 3UGCA 3VC4A 4WBBB 3GUBA 1ZXEA 5IQDA 3R9HA 3MFTA 4V0GA 4Z3VA 5CEPA 5CF6A 3B8QA 3NS9A 3AT4A 4JRVA 2H9VA 1E9HA 3D94A 4U80A 2O8YA 2NPQA 3I6WA 4F6WA 3R8LA 2AC5A 2F2UA 4U6RA 4DAWA 4XV2A 3QTRA 1I09A 1A9UA 2QVSE 3OMVA 5CVGA 4FK6A 2J0LA 4YHFA 3DNEA 2WTDA 2OIBA 4ZTSA 3CXWA 5LMBA 3F66A 5EM7A 2RFDA 3RJCA 4IH8A 3WF7A 4CRSA 4F63A 3MV5A 5IU2A 3WI6A 4NW6A 5EOLA 4IDTA 1WZYA 3G15A 1JBPE 3OEFX 2XA4A 2XEYA 5CU3A 4BDKA 3M11A 2GHLA 2HZIA 3PXZA 5BVFA 4I20A 4ZZNA 4JDKA 5CX9A 3QYWA 1OPLA 4G5PA 3RI1A 5E91A 4ASEA 4DH8A 2XIXA 3QXOA 3UE4A 1H1RA 2C68A 3DQWA 2QKRA 1ZYDA 3FMEA 4IB5A 3BBTB 3SGCA 4JRNA 3LMIA 5AR2A 2PE1A 2X0GA 2XJ0A 2ESMA 1ZMWA 5J1WA 3H10A 3OCTA 3RHXA 5F20A 3BELA 2OICA 4V01A 4QMXA 4A06A 1W98A 5IDPA 2PMLX 5AR7A 4G3DA 4XH6A 3KN6A 2JFMA 3QL8A 5DT4A 3ZH8A 2B55A 4CGAA 4CT2A 3BE9A 4MNEA 3K5VA 4A9UA 2XKDA 4HCUA 3LOKA 4K33A 2CKOA 2X8IA 5LMKA 3FY2A 5IA1A 3OF0A 4W4WA 3MPMA 5DBXA 5IEYA 4ASDA 1IA8A 4BI2A 3KRRA 3A7HA 3AC2A 1NT2A 4PDYA 3ZLYA 4KNBA 3BU6A 3G0EA 1H27A 4MVFA 3R04A 3FZSA 2I0HA 3KC3A 4E5AX 3AG9A 4NK9A 3TTJA 4ITJA 3R8PA 4P5ZA 5LCKA 1OB3A 4Z55A 2VTPA 3V01A 4EWQA 4PL5A 3WBLA 4KSPA 3KXHA 3DA6A 4H58A 4M8TA 4IVCA 5CTPA 3ZLWA 5CF8A 4FTAA 3DAJA 1H01A 4KSQA 5J79A 2QKWB 2VTIA 3DBFA 3MPAA 3QQKA 5G1XA 3R1YA 1ZMVA 4AN9A 4AQCA 1HCLA 2BHEA 5M44A 3FMHA 4GK2A 5B0XA 4EKLA 4XOZA 5D10A 3QTXA 4C58A 2F57A 1XJDA 3R2YA 4C02A 2ONLC 4JBOA 4W8DA 5H8GA 4KIQA 2GSFA 4FF8A 2C30A 2HXLA 4FKJA 4EWHA 1ERKA 5DLSA 1ZLTA 3QTIA 4ZTRA 4YNEA 1K2PA 3RPOA 3HMMA 2P0CA 3NCGA 3U9NA 3DY7A 5HBHA 4AU8A 5F4NA 1PHKA 4OTFA 4D28A 3RK9A 2BALA 5KKRB 4BWXA 3D7TB 4AOTA 4O91A 2ETMA 5FD2A 5IMXA 3FHIA 4USDA 1KSWA 4DT9A 4MWIA 5CASA 1ND4A 3HRFA 1YWVA 3ORIA 2I40A 3NUYA 3QX4A 2JKOA 3MJ1A 4ZTQA 3VBXA 3ZUVA 5A4TA 2W1EA 2W5AA 5CNOA 5CANA 3I81A 2ZDUA 4X3FB 3A7JA 1OBDA 3QGYA 5ETAA 2QOFA 4IVBA 5BUJA 4JXFA 4OLIA 4V0GB 5M4IA 3H3CA 3WARA 4FEWA 1JQHA 3UOKA 1PYEA 2Y4IB 3QC9A 1BUHA 4MXOA 4FKPA 1IRKA 4I0RA 5AUWA 3SG8A 3ZO4A 1PYXA 3ORXA 3QF9A 4R1YA 3UMXA 4RQVA 5AJQA 4O82A 4FOBA 4HVGA 2DYLA 3BIZA 5D41A 3QQUA 2REIA 4S2ZA 4KUJA 4S32A 5BVNA 5C26A 4FIHA 5CEOA 4HGTA 4UXQA 2OF4A 2HYYA 3PA4A 4QYYA 3W2CA 4BCHA 5J7BA 4AZFA 1H8FA 3KB7A 4FR4A 4DEAA 4Y5HA 2AYPA 1WBWA 5BVKA 2UVYA 4LGHA 3R63A 5AV3A 2IWIA 3NRMA 2Q0NA 2XK4A 4Y5QA 3WZDA 5AUTA 4YC6A 4AGUA 2P55A 5KZIA 5F1ZA 2R7IA 2BRHA 2FSTX 3Q52A 4CRLA 5EYKA 3HV7A 3KREA 1ZYLA 1H4LA 2YM4A 2VWIA 2R3GA 4IVAA 4YTFA 4L3PA 4BCPA 1UNHA 3VBQA 3OWJA 5B7VA 3PA3A 2VNYA 3R8ZA 5I9YA 3DNDA 1YHVA 2JKKA 3ODZX 4FTMA 2R3HA 3D15A 2WELA 4FT5A 5HE2A 4HGEA 2OU7A 4J97A 3F2AA 2BR1A 4LFIA 3SAYA 4MNEB 2YHVA 3NW7A 4MD9E 4YC3A 3RGFA 5A4EA 3RWQA 4DYMA 5K5NA 3GOKA 1JPAA 3JY9A 3IONA 3VUMA 1WMKA 1ZOHA 4RC2A 3WIGA 2A19B 4J96A 4X2KA 2UZDA 2V55A 4A9YA 2YM6A 1OMWA 2ITZA 2VTHA 4G3CA 5CU2A 4E4NA 4GFGA 4FNYA 4MTAA 2O65A 3II5A 4IAZA 4UZDA 4XLVA 1TQIA 5TOZA 5LCJA 3DKGA 4BCMA 5D9HA 4PNKA 2HY81 2YZLA 5D7AA 4YJQA 2GNGA 4H3BA 2CN8A 2X4FA 4GK3A 2W1DA 1Q8UA 3A99A 4PV0A 4QTCA 4DEIA 2R3MA 3QTZA 4AGCA 2PULA 2X6DA 4M0YA 3ERKA 5HZNA 3F61A 3ID6C 3E64A 3FMNA 4A9TA 5D7VA 1J7LA 4UEUA 1OI9A 3RMFA 2FUMA 2RSVA 3BHYA 5AUXA 4ANBA 3GCSA 1YI4A 2GPHA 2PZRA 4RWIA 4WKQA 3HECA 4GIIA 2OKRA 5J9YA 2VAGA 4JJRA 4LYNA 4QMTA 3S95A 1RQQA 4DEHA 2GCDA 2GNIA 1PY5A 2XVDA 4IB3A 5FEDA 4DLJA 3QU0A 4FVQA 4PX6A 1Z9XA 3FLSA 4OBQA 5AP2A 2OZAA 2J7TA 5I9WA 4RT7A 2YN8A 3UOHA 4JG6A 3NWWA 5DVRA 3RK5A 3EFWA 3FHRA 3F82A 3QTSA 1PXLA 3VS0A 2WU6A 4QYGA 2R4BA 2XIKA 4UMQA 3VW6A 4I0SA 2Y8OA 4JDHA 4UMPA 5EW3A 2I0VA 4A9RA 2JIUA 3RINA 2C5NA 2G15A 4D4YA 4RVKA 2JEDA 1XBAA 4DITA 5M4FA 3CTHA 4HPUE 4UWBA 1L8TA 3QWKA 3FKNA 4FTJA 3RM7A 4KKEA 3D14A 2XKEA 3N4UA 2X2MA 3G9NA 4IDVA 4FMQA 1VYZA 5GZ8A 3ZRKA 3Q5IA 5FP6A 4O27B 2JLDA 3GB2A 2KULA 2C0IA 3P7CA 5IUHA 4KB8A 3LFFA 3DBDA 2BDWA 4U43A 3E3BX 3O50A 4BCNA 4D0WA 3TM0A 2Y0AA 4FSWA 3F7WA 4JX3A 2C6OA 4LI5A 3HNGA 3T3VA 3ZXZA 2OXYA 1O9UA 2PUUA 3FWQA 2UW9A 3RAWA 3LMGA 4NKSA 4WUNA 3AGMA 3SKCA 4FIGA 3VWAA 3OWKA 4GJ3A 4AGWA 4FEVA 1MQ4A 5TF9A 3HRCA 2Z60A 1XO2B 3G6GA 3DS6A 5AP3A 4ACCA 4BYIA 4DEBA 2VO7A 4F0IA 3HA6A 4C34A 2NO3A 5LMAA 4XV9A 1H07A 2SRCA 4FUXA 5LOHA 3S3IA 4E73A 3DGKA 3PPZA 5KUPA 4HGSA 4PQNA 3QZGA 3EFJA 3C0HA 4FNWA 3CKXA 4ZOGA 2YITA 3E7VA 3U9CA 5HVKA 4CCUA 4KBAA 3EN5A 2OXDA 3EQCA 2C69A 4EZ5A 4ONAA 4I4EA 4C62A 4KKGA 3V6SA 4D9TA 4A07A 4AW5A 5L2SA 3KMMA 3MIYA 1VJYA 3DTWA 3KN5A 5EHLA 2AUHA 3QQLA 5HO6A 4QP6A 4AW1A 4J95A 5T68A 3GVUA 5HLNA 3ZC6A 3R1SA 4DGGA 2PMIA 5DT3A 3KVWA 4ZK5A 1Q8WA 3PXFA 3RM6A 3THBA 1BYGA 4F1TA 1J1BA 4M15A 4FKSA 2ZDTA 3HRBA 3KY2A 3LFQA 4CZYB 1W83A 3R7GA 4GU6A 4E20A 3TT0A 1L3RE 3V8TA 3HL7A 4Z7HA 3MTLA 5J8IA 1YDSE 1OIQA 4F4PA 2R9SA 2WO6A 2BFXA 3MY0A 4EH6A 1Y91A 4GMYA 3HAVA 1E1XA 4FV7A 3DFCB 2X39A 4F7NA 2RG5A 5TE0A 4ZMEA 3C9WA 4S30A 2IJMA 3LIJA 3MY1A 4YTCA 3UP7A 4CD0A 1UNLA 3I0QA 1UU8A 2W5HA 3V8WA 3TNPC 2WTCA 3L9PA 3RKBA 4RWKA 3BYOA 4WNOA 1YHSA 1ZOEA 4JAIA 4YJTA 4ZSEA 3V51A 1UNGA 4OW8A 2GTMA 2R3RA 1NW1A 4LL0A 5HE1A 3SD0A 4BVUA 5IMEA 3ZTXA 2FSOX 3OXZA 2ETKA 5FTOA 5A4CA 4E6CA 4IE9A 4RA5A 2WNTA 4ZLOA 4II5A 5M56A 1OGUA 1R0PA 3ULIA 3UIUA 5GZAA 4X7QA 4QMMA 3I79A 1IASA 3KXNA 5FM3A 2CCHA 1OBGA 2X8DA 3FXXA 4FKUA 3E8DA 2PWLA 2PYWA 5EHOA 4E6AA 3ZC5A 3E92A 2OZAB 3I6UA 4Z16A 4JG7A 3QD3A 5E8UA 3QD4A 3HLLA 3PTGA 4D4SA 3C51A 1YDTE 3KXXA 4W9WA 4EK5A 2JAVA 5HBJA 2Y4PA 4XBUA 2RGPA 4U81A 2VWVA 2R2PA 4F9AA 3UOJA 3DAEA 2R3KA 1KV2A 2XBAA 4NWMA 2R3PA 1M17A 1FQ1B 4ZLZA 3NYNA 4FI1A 4YP8A 4R5YA 5HLPA 5CALA 5HU9A 3K5UA 1UU3A 3D2IA 4X2NA 4X6QC 5F94A 5I9XA 2R0IA 4IC8A 3R30A 2C3LA 3IOPA 4YJUA 3KFAA 2RKUA 4Z9LA 1K3AA 5AM6A 4AGDA 3EQBA 2BROA 3KKVA 3PZEA 1ZYSA 1WCCA 2J5EA 3V04A 4O7ZA 4RSSA 4BZNA 5IUIA 3NNVA 3RCJA 4BDCA 2VD5A 3VS3A 3BLRA 5AR3A 3MH0A 4XOYA 5KBRA 3TJCA 3D9VA 4FV9A 4U7ZA 3TACA 5G6VA 2W4OA 2W7XA 3UIMA 3O7LB 3ZU7A 4O0XA 1V1KA 3M2WA 4L7FA 5D11A 5TT7A 4ZTMA 5CAUA 3TL8A 3OOMA 1Q3DA 2J5FA 4XX9A 1OVEA 4UXLA 4O1PA 2H6DA 4FTLA 3DDPA 4L67A 5DGZA 4CFNA 3UQCA 4HW7A 2XK3A 2C5YA 4OTRA 4EHZA 3EKKA 3AQVA 2B52A 4I24A 2OWBA 5AA8A 5I9VA 2BAJA 4DGNA 5HICA 1FPUA 4U5JA 3DLZA 3U51A 2CCIA 2XNMA 1ZAOA 4QMSA 4X3JA 4IC7A 3P7AA 4MBIA 3PVGA 3OCBA 2WTWA 2ONLA 4KIOA 5J1VA 3PY3A 2E9UA 5BVEA 3O8UA 3VNTA 5HO7A 4RVTA 3QD2B 1R78A 4NW5A 3E7OA 2QU6A 1SM2A 5BVOA 4F9YA 3CC6A 2EUFB 3PIYA 5LVOA 2VTAA 2X9EA 3FLYA 4JL9A 4C3FA 1NA7A 4RJ4A 4AN2A 5C1QB 5EI2A 2WQBA 4OBOA 5LVLA 4IWOA 4Q5HA 4QP1A 4DG2E 1U54A 3DU8A 4CTBA 2ITWA 3BGPA 4DH1A 4BYJA 3LQ3A 4FKWA 3LCTA 2FB8A 4QOXA 4HYIA 4RJ7A 3CE3A 4ARKA 1KE8A 3HDMA 1URCA 4YO4A 2VNWA 4RC3A 4P4CA 2WIPA 5K4JA 2OJFE 3EOCA 2VO6A 5AX3A 3EN7A 3R1QA 3C5UA 5JRQA 3RNYA 4GH2A 4J71A 3C5IA 4XRJA 1YOJA 1JAMA 5GJGA 4C2VA 3OVVA 4GUEA 3MN3A 4MXAA 2YJSA 4XMOA 5FBOA 3SXSA 4AN3A 4C61A 3F3ZA 3FKLA 2QG7A 5E8ZA 4ZTNA 2QC6A 2HWOA 2J0KA 3Q6UA 2ETRA 2UUEA 4FSUA 4UMTA 4OTPA 3K54A 4BDIA 3MB6A 1YXUA 4E26A 3BYSA 4MF1A 3TNQB 4RX9A 2WMXA 4MK0A 5CXHA 3L8VA 3W1FA 3BEGA 3IQ7A 4RFZA 2YA9A 5HHWA 1OKZA 2PVFA 3ACJA 3E63A 3R01A 2YIXA 3E8CA 5AIRA 5ETIA 4ZZMA 2JC6A 3MBLA 3KEXA 3BQCA 3JUHA 4RMZA 4HYUA 4O81A 4O84A 3WZJA 5L2WA 1YWRA 3CPCA 5CSPA 2YWVA 3ORLA 4ZMFA 4O21A 3VS6A 2QOQA 4C4IA 4FTRA 3NVMB 3I7BA 5IA2A 3FYKX 5GZ9A 3TIZA 4QNYA 1MRYA 2IZSA 5DA3A 4BCIA 2CGUA 5FQDC 1PF8A 2QLQA 3ELJA 4RQKA 3BV2A 2XK8A 5AR8A 1AGWA 5I3OA 3H0ZA 3PIXA 4U40A 4GRBA 3LFDA 2UZWE 3Q9YA 3O71A 5KMJA 4FEQA 3O8TA 1YXVA 5H3QA 4ANLA 3SOCA 4E6QA 2UZEA 4N4SA 4R8QA 3ZCLA 4PMSA 3OT8A 2R5TA 4BDHA 5F9EA 1U5RA 3KCFA 4IAIA 2YLEA 5HNGA 2YCQA 3CP9A 3FUPA 4XP0A 4ZSAA 3EB0A 5E8WA 4EUTA 5CNNA 3A7IA 3L1SA 4LV8A 1J7UA 4M14A 3GI3A 3P1AA 4FUYA 5IA3A 5JRSA 4QMQA 4GIHA 1YOMA 2FO0A 4ACMA 2A1AB 4R7IA 4J98A 2YM5A 5L4QA 4WT6A 3L8PA 3ZMMA 4D55A 3VRZA 3D0EA 4G3FA 3GC7A 3KXZA 3GENA 3QFVA 2V22A 4FTKA 3UO5A 1F0QA 5AMNA 4CTCA 5ANEA 4KKHA 5HE3A 4EL9A 4AAAA 2GFSA 3A61A 2VZ6A 2GS2A 3W2RA 4OAUC 4F9BA 3U6JA 4I1ZA 3JR1A 1J1CA 3S00A 3R21A 2PTKA 3LQ5A 1TKIA 4TRLA 1PMNA 4BBFA 4M84A 3EQPA 1WBOA 2VGPA 3NYOA 4EOPA 4L45A 5H8BA 4B6LA 3FMKA 5EDPA 4FZFB 3MS9A 1OL2A 4KS7A 4K9YA 1NY3A 1PXMA 4JDJA 1FOTA 3FQEA 4QPSA 2A0CX 1PRYA 4DG3E 4FNXA 4QYEA 1SMHA 5KMOA 2GTNA 1MUOA 2QOKA 1J3HA 4FKVA 4E7WA 2XYUA 4GSBA 2IN6A 1JLUE 1U54B 4BZOA 2BZIB 4ZAUA 4FEXA 2A27A 4O7RA 2ZVAA 4XNEA 2IO6A 1PXOA 4F65A 4WG5A 2ITOA 4EEVA 2PZYA 1CMKE 3I5NA 3U6IA 2PE2A 2WMVA 3C4XA 4C36A 3CQEA 3NDMA 3UJGA 4RX8A 2J6MA 3GFEA 3LJ2A 1NVQA 5KMIA 3TJDA 3OWPA 3FDNA 4QMPA 2CN5A 4I23A 2GQRA 4PDPA 3OCSA 2WQMA 3NYXA 4RC4A 5IA4A 3E88A 2ZMCA 4D2PA 3EJ1A
chains in the Genus database with same CATH superfamily
4EORA 2XAOA 5DHJA 5HU3A 1UKHA 5CI6A 2JBPA 4HZRA 3IW6A 5AIKA 2B0QA 5BMMA 4M66A 1R39A 3LFNA 4M67A 1XBBA 4F9WA 2BHHA 1OM1A 4FGBA 5J5SA 4WSQA 2ZMDA 3Q2JA 3ZDUA 3EQRA 5CVFA 2Z7QA 4B99A 3O5AA 2VGOA 4AXDA 4IX6A 2Z7SA 3EYHA 3DJ5A 3NR9A 4NJ3A 3LM0A 5B2KA 1Q24A 2X7GA 3Q5ZA 2BZHB 3IO7A 3OP5A 5KBQA 3U55A 4AAYA 4YPDA 4O2ZA 3PXRA 3IGOA 1M2RA 2JKMA 3NUPA 3V5TA 2VWUA 4AA0A 3ZEPA 1UV5A 1ST4A 3LXKA 5L3AA 3KCKA 2WTIA 3CKWA 4I3ZA 4I5MA 4BWKA 3WF8A 2HXQA 2WMRA 2X9FA 3TIYA 2UW6A 4X2FA 4B7TA 5AP4A 3PXYA 4KRCA 4CT1A 3EH9A 1Z5MA 1SZMA 4IX3A 3V5LA 3POZA 4TL0A 4GKIA 4J52A 1R3CA 3QC4A 3P4KA 2XKCA 4IHPA 4ANQA 5IQFA 5LARA 2WEIA 1YI3A 3NPCA 4G5JA 3PSDA 4GFMA 3F88A 4DCAA 4RLLA 1OPKA 3TTIA 1OL6A 4BFMA 4RJ8A 5DIAA 5EI8A 3L9MA 2LGCA 3FBVA 2R7BA 2IZUA 4WHZA 4JOAA 2WOUA 2C0TA 3G2FA 4IAAA 4R3PA 4B8MA 2DUVA 4IM2A 2Y7JA 4CNHA 2O2UA 5FGKA 4QMVA 4BZDA 4YLLA 4PP7A 4L68A 4C4FA 3ML1A 4FV5A 3EQGA 4FTNA 2C6IA 4H1JA 2W17A 4PMPA 3NNXA 2ITVA 3UC4A 3LQ8A 4O7VA 3MYGA 3PVWA 4RIWA 4BDEA 1V0PA 4DDGA 3DV3A 5A54A 3UDSA 3UMWA 1ZY5A 2ZAZA 2IW6A 5HKMA 4AZSA 2XCHA 2HZNA 3HZTA 4IB0A 1QMZA 4EOOA 2CNUA 3BWFA 1M52A 3B2WA 4YZBA 3IDCA 4AW2A 4XG2A 1P4FA 5EQEA 1KE5A 2XH5A 3IW4A 3HMPA 3CBLA 4Q9SA 2PVYA 4USFA 5KE0A 3F2RA 4ANMA 3QRIA 1ZRZA 1DI8A 4EOSA 1W8CA 1GZNA 1ZARA 3IECA 4U9AA 4FK3A 4ZEGA 3QUDA 4IFGA 2BZKB 3OY1A 2EB2A 3CCNA 3OUNB 2C1AA 3NYVA 4DEDA 5DRBA 1PMVA 4IMYA 1W0XC 4XJ0A 2XIZA 3H9FA 3LCDA 4F7SA 1H0WA 3WF5A 3QHRA 4QTBA 4D5KA 4QP4A 3CQWA 3R7OA 2XB7A 4FKQA 3LXLA 4PPBA 2G2IA 5IQIA 3QZFA 3QUEA 3HUCA 4QP3A 4BIBA 2P2IA 5A4QA 1CKIA 3UYTA 1DS5A 3HVCA 4X6RA 4FC0A 4MHAA 4F7LA 5AAFA 2R3LA 2WQOA 1H1QA 3OEZA 5CT7A 5FXSA 2ZV2A 3C0IA 1G8JA 3PZHA 1FINA 3EQIA 3C13A 4LGGA 3H9OA 2Y6OA 5DR9A 3VHEA 3IDPA 3ROCA 3VRYA 2XS0A 2X0PA 4FVPA 5CYIA 1U46A 4N57A 5CAQA 1XBCA 2YAKA 2QOIA 4JT3A 4ZY6A 4F6UA 4ID7A 5D1JA 4F99A 4JBPA 4OT6A 4R6VA 4YJRA 3LVPA 4NUSA 4AS0A 3QZIA 2HW7A 4GV1A 3ORKA 4QQTA 4XP2A 2QQ7A 3C1XA 2NP8A 3NAXA 4K1BA 1YOLA 5EQYA 4JR7A 3AC1A 2CLQA 3LJ0A 5JGDA 1Q4LA 3W2PA 1BKXA 2PVMA 3HP2A 3LFAA 4OBPA 5HIEA 4AT5A 3DBQA 4E4MA 3GCUA 4HZSA 4TWNA 4XG8A 5B2LA 3SA0A 4TYIA 4F09A 3TUCA 4FKGA 4I92A 3F5UA 4NM5A 3VUTA 3CTQA 4GVAA 3EHAA 2EWAA 3QQFA 4O86A 3CY3A 4EQUA 5L8KA 2PVJA 3TV6A 2VTLA 4WG3A 5KX8A 5HTIA 1GIHA 4CFVA 5IH5A 3COKA 2OFUA 2B54A 3D5VA 1SVHA 4L43A 4R3RA 1JOWB 1PXIA 1ZMUA 4D2TA 1G8AA 5ANJA 4BJJA 4KWPA 4EQMA 3N4VA 5A14A 2I1MA 3LMHA 4FL2A 1CM8A 5HESA 2IF8A 4AOJA 4K8AA 4DN5A 3W10A 2PPQA 2WMUA 5A4LA 4JG8A 3FL5A 5C01A 3ETAA 2YACA 5C8KA 2JD5A 3COIA 4KD1A 3CGFA 3U6HA 4HNFA 3W2OA 3I60A 5IQGA 1FGKA 3HDNA 4NTTA 2IW9A 3TZ8A 3NAYA 3WZUA 5CI7A 5EH0A 2R64A 5ACBC 4DBNA 4F64A 5M57A 4O83A 3PP0A 4YNOA 3PUFC 4RIWB 1T45A 5DPVA 4BB4A 4WSYA 2BRNA 2ZB0A 2F7EE 2HZ0A 3PA5A 3AT2A 1WVXA 3P9JA 4B9DA 2OFVA 1LUFA 2YERA 2X0QA 2C0OA 3ORNA 4MH7A 4X0MA 5FBNC 1Q8YA 3COMA 3LLAA 4BDDA 2CLXA 4ZP5A 4PDOA 5HBEA 3W18A 4DFXE 1G5SA 3CGOA 3CJFA 5GIOE 1YXTA 4QT1A 2G01A 4MXZA 3ORTA 3T8OA 3DBCA 4I94A 4L9IA 1WBPA 4AOIA 4CLJA 4GUBA 5DEYA 1REKA 3DZOA 2BILB 3E62A 4JBVA 2VWYA 4AG8A 3LFEA 4CFFA 5J95A 1GJOA 4YTHA 3NZ0A 4FSTA 4N70A 5AP1A 3ZZEA 5AAEA 5AP5A 5KMLA 2W1IA 4BHNA 2C6MA 4JQ8A 2W1GA 1UKIA 1QPEA 2O0UA 3N51A 4G3GA 5E8TA 5HG7A 4NCTC 2RFSA 2WTVA 5DYJA 4NH1A 1O6LA 3WZEA 4O6LA 4S33A 4O0RA 4MX9A 3A8XA 3ORZA 2PU8A 3AC5A 3Q4TA 3UZRA 4EKKA 2QOHA 2ZB1A 4BCJA 1REJA 4ZSLA 4I41A 5DMZA 3QBNA 3ORPA 1BL7A 3POOA 5M51A 3VS1A 1RE8A 3PG1A 4S31A 4CMOA 5HEZA 3A2CA 4H05A 1I44A 2V62A 2B9FA 5C27A 3G90X 4AE6A 4MEDA 4G2FA 4CLIA 2A4LA 4EC9A 4QP8A 2QO9A 4IWPA 4FSZA 5CQUA 3OXTA 4LGDA 2GNJA 4AQKA 2PVLA 4LV5A 4UMUA 4FG7A 5DH3A 1B38A 3R73A 3H0YA 4MBLA 5JSMA 4K0YA 5FG8A 3GCVA 3GCPA 3HEGA 3PJ2A 5CLPA 3VBVA 4EYMA 2JDTA 2WEVA 3MDYA 4LMNA 3BHTA 3W2SA 3ZSHA 5K0XA 3QLGA 3UBDA 3WIKA 3ZOSA 4ERKA 4IJPA 2OF2A 3UPXA 4F70A 3NIEA 2XNBA 4O4EA 3FC1X 2Z02A 1PXKA 3G51A 3OS3A 5IISA 2EU9A 2B4SB 4O0SA 3F69A 4PPCA 1CDKA 3LM5A 3R22A 4DDIA 1OGYA 3HV3A 4EOIA 4YTIA 4FIJA 2PVRA 4QMWA 2QR8A 4NEUA 4QPAA 1YVJA 3QUPA 4PL4A 5M4CA 3BI6A 3TXOA 4GCJA 3BLHA 1WBSA 2XZSA 3FKOA 3BKBA 4LRKA 4FRFA 1A48A 3LFCA 1SVEA 3NUNA 4JIAA 2C3KA 5I5ZA 3ITZA 4HOKA 2BUJA 4I5HA 4IX5A 4K11A 5BYYA 4FSRA 4U42A 4G9CA 5AA9A 2VX0A 2YIYA 2OJ9A 3PFQA 4IZAA 2VO3A 3Q4CA 4QYHA 3ZLXA 4E8AA 3EYGA 3K3IA 5CEMA 4BJJB 5KHWA 2OIDA 3UYSA 4O0YA 4BGGA 1H00A 2Z7LA 3AC8A 3RNIA 3DQXA 4FODA 2HOGA 4A9SA 3R28A 2YJRA 2PUNA 4DH3A 4HGLA 4TW9A 5M08A 3FPMA 1KE6A 3L9NA 1UWJA 3BX5A 3NSZA 1ZY4A 3VBWA 5A6NA 4OTQA 3MI9A 4D1SA 4CEGA 4FL1A 1HCKA 3R1NA 5A46A 3SX9A 3FC2A 4CFUA 3T3UA 3JPVA 3KMUA 1LR4A 4E5WA 3A4OX 3SW7A 2CNQA 2ZM3A 3MB7A 4MKCA 3P7BA 4HVDA 2XAMA 4YUQA 4PRJA 3UG1A 5A9UA 2OI4X 2YAAA 4GT4A 5CU4A 3M1SA 5AV1A 2RFNA 1JNKA 3GNIB 3RAKA 3OW4A 4UN0C 5TR6A 4DEEA 3SDJA 3ALOA 4B8LA 4CKIA 3IW5A 3IDBA 3O7LD 3BCEA 3PLSA 4ANOA 2PK9A 3CS9A 3C4ZA 3VULA 3Q53A 4AFEA 4XCUA 2ZJWA 2IVTA 3LE6A 3GU6A 4IXPA 2XF0A 3PSBA 3COHA 5HORA 3UQGA 2B1PA 1OIYA 2W05A 2A98A 3W8LA 1PMUA 2E9PA 3L8SA 4L3LA 2G9XA 4RRVA 3O17A 2ZOQA 4RVMA 5CWZA 4O0TA 1LPUA 5AADA 3VQHA 2VX1A 3SRVA 3TV7A 4BBEA 2Y6MA 4YHTA 1FBNA 4CG9A 3QCYA 2XM9A 4FKIA 4JR3A 2UW8A 4V05A 3KXGA 2HW6A 4H3QA 3WOWA 1Q3WA 3BHVA 5IQCA 4UWYA 3RPVA 2ACXA 3CY2A 4BTJA 2B9JA 2H96A 4BY9E 4D1XA 4AXAA 3GC9A 3V3VA 3SG9A 1H1WA 3ZZWA 4EK3A 2B9HA 2YCRA 4H39A 4TYHA 4ZSJA 5BYLA 5FTQA 2UVXA 3E87A 3GGFA 3FV8A 3RPRA 4D2WA 4F7JA 3F6XA 4R1VA 4C4HA 4KRDA 2F7ZE 3H30A 2QOCA 3KL8A 4QRCA 3IW8A 4WUAA 1U5QA 3PDTA 2GDOA 3QALE 3UDBA 3BL9A 2YFXA 3CQUA 2ITUA 3VQUA 4WBOA 5EOBA 2UZOA 3R83A 4IW0A 5EKNA 5BNJA 1H28A 4J99A 5CU6A 2UZNA 3S4QA 3QRKA 4IFCA 4WG4A 4GL9A 3OFMA 4NM7A 3CLYA 3D7ZA 4ENXA 2E9OA 3RALA 1AD5A 2R3NA 4XS2A 4C37A 4YGAA 3QKMA 4IJ9A 4A4XA 4NM0A 3FMDA 4AA5A 2JITA 2P33A 4EQCA 4EUUA 3QA0A 4C3RA 5JN2A 5EDQA 3R9RA 3P23A 3QLFA 2QNJA 3AXWA 2RFEA 3KK9A 3P0MA 2W96B 5DT0A 4QMOA 5IA5A 4L44A 5CEIA 5CAPA 3SVVA 3UDZA 3UVRA 3P08A 3VJNA 1F5QA 4JI9A 1ZWSA 4TYEA 3H9RA 2VTMA 3NNWA 2QURA 3BZ3A 3R8VA 2YLFA 2EB3A 3O8PA 4AXEA 3IOKA 4EZ7A 3ATSA 5DN3A 3V8SA 2J0JA 3H4JA 5IDNA 3QRUA 4OTHA 1FGIA 4TT7A 4BWPA 1JSVA 4TWOA 5CF5A 4Q2AA 1W2FA 3W2QA 2VU3A 2WU7A 2DQ7X 4O7YA 1YXSA 1Q61A 4DINA 3UQFA 2C3IB 1LEZA 4R77A 3KF7A 2GQSA 5EM8A 3EN9A 4DEGA 3HAMA 2XNPA 3RPSA 5JGBA 3U87A 3CR0A 3BU3A 2QOLA 3MIAA 2BMCA 2J50A 3AT3A 4O22A 3WF9A 4XHKB 2XK9A 4O0UA 5KZ0A 1KUTA 3BGZA 4RA4A 1W82A 2RIOA 4QD6A 4R7HA 4F9CA 2E2BA 4CYIA 3UP2A 5ANGA 4YMJA 5LQFA 2E9VA 1IA9A 3Q9WA 4FSYA 4OAVB 2ZV8A 4I0TA 2F7XE 4D2VA 4J7BA 2C4GA 5DR2A 4U41A 4EBVA 3BWJA 5ACKA 2CGWA 3TV4A 5I0BA 2EXMA 3LXPA 4TNBA 5CT0A 1KWPA 3BEAA 1S9JA 2OK1A 2PVHA 3EIDA 5EK7A 4O0VA 4UY9A 4HVIA 3QD0A 1M7QA 5FP5A 4I6QA 3MSSA 5CU0A 3E5AA 4PDSA 3LCKA 4P90A 3FXWA 1YRPA 1OKYA 2UZBA 1U59A 3W32A 5LVPA 3F3VA 4D2SA 4FTUA 4AW0A 2UW7A 3HV4A 4U3ZA 1YI6A 4U79A 5C9CA 1V0OA 4DHIB 3GT8A 2YIQA 4PTGA 2VO0A 5ANIA 5I9ZA 3DJ7A 5AUUA 2W4KA 2C47A 2CKEA 5TO8A 1XMLA 3PPJA 4CZUA 4YLKA 3SRVB 3F5XA 5CEQA 1GOLA 1W7HA 2PZIA 3I7CA 3Q6WA 4GW8A 2YIRA 4O6EA 3DZQA 5EKOA 2WKMA 3QKLA 4S34A 4YZMA 3R7EA 3JVRA 4PPAA 5LJJA 3UO4A 2BTRA 4ANNA 5C8NA 4Y85A 3FMJA 5DFPA 3SLSA 2JDVA 2QO2A 1Q8TA 2G1TA 4XV1A 4QQJA 4TYHB 3RAHA 3VF9A 2YM7A 4D5HA 3ZEWA 2WZJA 3K3JA 4Y95A 3P78A 4M0ZA 4G16A 3HV6A 3VIDA 2ZV7A 1O6YA 3FLNC 3FZ1A 2BAQA 2QG5A 5GINE 2QD9A 4KA3A 2IZTA 1ZOGA 4YHJA 4BCKA 5IA0A 4BCQA 2PZ5A 4D2RA 1HOWA 2FYSA 5BUEA 3QYZA 4G6OA 5AUZA 3SC1A 4BDAA 3D5WA 1H26A 5JZNA 2JAMA 1JKSA 5JFVA 1PXPA 2HK5A 4DGLC 5BV3A 4U45A 3ZLSA 3ZO3A 3WYYA 4FV6A 3TDWA 3BBWA 5IH4A 5JFXA 3NUXA 5K5XA 2XM8A 3HUBA 3E8NA 2QODA 4MYGA 4NTSA 4FTQA 5HGIA 3PY1A 3VO3A 4CYJA 5M4UA 2R3JA 4U44A 4PY1A 2V5QA 4BGHA 5H2UA 3LCOA 3KGAA 1NVSA 3TNIA 2IW8A 4C4EA 5DE2A 4D0XA 3GBZA 1Y8YA 4DTKA 5HVYA 4A4LA 4BGQA 4PWNA 5L2QA 2ITPA 3OBGA 3RK7A 1PXJA 3OD6X 5GJDA 4BIDA 3BV3A 2PL0A 4UB7A 4TYJA 2X1NA 1CKPA 2WPAA 2VTOA 5I3RA 1BI7A 2O5KA 3WZKA 3OCGA 5CF4A 3KIOC 3V5WA 3AMBA 2BCJA 3O51A 3QA8A 4Q9ZA 4TZRA 5AP0A 5FDPA 4BCFA 4JVGA 3C4WA 3QCXA 4X21A 4WNMA 4ASZA 3PWYA 4LRJA 3NUUA 3SHEA 4EK6A 3FL4A 4QQ5A 3A8WA 2UVZA 3UIBA 2C6DA 4MCVA 4RPVA 5CSHA 3C0GA 4NCTA 2JDOA 5AEPA 4MQ2A 1ZZ2A 4FTOA 4ERWA 2E9NA 3W0NA 5KMMA 3VUKA 4WNKA 3FXZA 2C5XA 3BLAA 4BCOA 5KO1A 2J0MB 4RIYA 4ZJIA 4MF0A 3D5XA 2FSMX 4GJ2A 4DF3A 4AF3A 2B53A 2FH9A 4O1OA 3JYAA 3ZYAA 4IIRA 1PJKA 5DWRA 2IPXA 2QHMA 3O96A 3MH2A 3BQRA 1Q97A 4TWPA 4FZ7A 4X2JA 4CQGA 3PYYA 4UYNA 5HIDA 1GIJA 5BVWA 3R9NA 3UG2A 3V5QA 3HMOA 4G3EA 3ATTA 3W0QA 2B7AA 5E9EA 3PJ3A 4DH7A 3F9NA 4QYFA 3F2NA 1YW2A 3R7YA 4RX5A 2AC3A 2JGZA 3QCSA 2O64A 4G6LA 4CV9A 2PZPA 2PHKA 2CPKE 1KE9A 3BE2A 3OHTA 4BDGA 4QEBA 1X8BA 2C5OA 2JIIA 5AAGA 2WOTA 4G17A 4XRLA 3VW8A 2J2IB 3MVLA 4RZWA 2GHGA 3R8MA 5FDXA 5JFWA 5KMKA 3PSCA 4EH3A 4TKSA 3IGGA 1P14A 4OUCA 3QWJA 1KOBA 1PMEA 3RZBA 4C33A 4KBKA 3MFRA 3W16A 4CCBA 5HTBA 1OPJA 3AMAA 4GYGA 4L7SA 1XMMA 1QCFA 2HZ4A 4HJOA 3EN6A 1SNXA 4RX7A 2YISA 4J8NA 1GIIA 3KF4A 3GOPA 4JLCA 4L6QA 5HCXA 4YURA 2YCFA 2UZUE 4CZTA 2P2HA 1JSUA 4FIFA 2BPMA 4EH8A 3ZFMA 2X6EA 4GKHA 5I4NA 1URWA 2CDZA 1DAWA 1EH4A 3C4CA 1H25A 2X4ZA 2QONA 1Y8GA 1R1WA 2ITXA 1OITA 2YCSA 2ZM4A 4W4YA 4EONA 3R7VA 4AZEA 2CGVA 3W55A 5LWNA 2OZOA 2XALA 2ZFYA 3BHUA 2ERZE 3SXFA 4E5BA 3LFBA 4F0GA 3A62A 4UYAA 4BKYA 3DXPA 3O0GA 3U4UA 3EKNA 3OC1A 4A4OA 4ALUA 2X7OA 3EMGA 4XG3A 4BF2A 2J4ZA 4GT3A 5M07A 5AX9A 3UNZA 4ZS4A 3UIXA 3P79A 1IAHA 3R6XA 1XH9A 5AR5A 3QGWA 4PMTA 2H8HA 3BU5A 3FMLA 4RZVA 4U3YA 1E1VA 3S2PA 4DC2A 2W9ZB 4GFOA 2VWWA 4QTAA 1XH6A 5IQHA 4NSTA 3DFAA 4KINA 3Q32A 3MPTA 4F0FA 3O2MA 4YJNA 3DXQA 4RIXA 5DG5A 2C6KA 1KE7A 2AQXA 4L3JA 4Y8DA 4IACA 3QQGA 3ZFXA 4ZZOA 2FGIA 4FT0A 3UVQA 2VTRA 3OZ6A 2GMXA 5IKWA 5HOAA 4YJSA 4U8ZA 4BC6A 3ZFYA 4P7EA 3DKFA 3JVSA 4FEUA 4O7SA 3GC8A 4EOLA 2C6TA 1BX6A 2VWXA 3TZ9A 4TYGA 3GEQA 4LOPA 4RVLA 4MQ1A 3MA3A 2WIHA 4FT7A 1STCE 4HYHA 1VYWA 2VUWA 2BIYA 4GEOA 4I4FA 4MNFA 3KA0A 1NXKA 4JIKA 4O4DA 5BMSA 5L2IA 2C6LA 2HWPA 2J0IA 3KXMA 5L6WL 4ACGA 4DFYA 4D4RA 1OIRA 5EI6A 4L01A 4W9XA 4CFMA 4LOOA 4CKRA 2BRBA 4RIYB 3OXIA 4ENYA 2NNWB 3TG1A 1M7NA 5EYCA 4EJNA 2Q83A 3AGLA 3KRLA 3PXKA 3UNKA 5DNRA 5EG3A 3N4TA 3GQLA 4BBMA 5JKGA 2IG7A 5LXMA 4L8MA 3QKKA 4OTIA 2O63A 2VTTA 2WTJA 1XKKA 5F95A 2R3IA 2YDKA 2VTJA 3MA6A 4BR3A 1Q99A 5IQEA 5HO8A 3FQHA 3R02A 2WMWA 4BRXA 3CPBA 2IVUA 2QLUA 2BKZA 2OLCA 5AV0A 4W8EA 1YQJA 4XBRA 1JKLA 3LJ1A 3OY3A 3TI1A 4YZCA 4IANA 2XNEA 4AFJA 5IF1A 2QR7A 2J51A 2OJIA 4EBWA 4EOJA 4FIEA 4OGRA 4ORKA 4CG8A 2VX3A 4R78A 2WTKC 2PSQA 3PRIA 1JVPP 2WFYA 4FZDB 2GU8A 1H1PA 4F78A 4UZHA 2FA2A 2X0OA 1XH7A 3GU4A 3VJOA 2XKFA 4EH9A 5KCVA 3FMMA 2IVVA 5IH6A 4QTEA 4IADA 2JDSA 3QRJA 2UW0A 4NJDA 5IZFA 3TKHA 1KV1A 5A3XA 4BKJA 3ACKA 3DT1A 1YXXA 5AP6A 5B2MA 3UO6A 1UU7A 4BDBA 5HD4A 4YSMA 3NIZA 5JH6A 2C1BA 4FA2A 2JBOA 3HGKA 5DR6A 2W06A 2W1CA 1P2AA 2C3JA 2YDJA 5CAVA 3ZS5A 5EQPA 3F3TA 5J7HA 4YC8A 4E4LA 4HVHA 2I7QA 1CTPE 1PXNA 1R0EA 1OECA 3ENMA 4PMMA 5CZHA 4CFXA 4DFUA 4FSQA 3TZMA 3PE1A 4RWJA 4DBXA 2GFCA 4FKTA 1XH4A 4YZNA 3T9TA 5FWKK 5C03A 3ZBXA 3OWLA 2HAKA 3Q4UA 2JKQA 4Y83A 4DGOA 5M06A 4PTCA 4MAOA 3NLBA 3VS4A 4NYEA 4IWQA 3K2LA 3JXWA 5E8YA 5HI2A 4AX8A 4G31A 4JQ7A 4EHEA 4FT3A 4M7IA 5J9ZA 2W5BA 3Q9XA 3I0OA 1OIUA 5IG1A 1Y57A 4H3PA 2XIRA 4LUDA 4EOKA 3DOGA 5D12A 3HMIA 3T9IA 3GFWA 2QCSA 4NIFA 5JEBA 2VN9A 3FLZA 5M55A 1XR1A 4RIXB 3TEIA 5EW8A 4NKAA 2UW3A 3R7IA 3GP0A 3PE2A 4FYOA 3Q04A 3MVHA 1FVRA 2HIWA 4IAKA 4TY1A 3WYXA 5IPJA 3EQHA 4FICA 3DK6A 4IM0A 4BHZA 4E3CA 2W4JA 2BFYA 3ODYX 3DXNA 3UZTA 3RP9A 5KHXA 3BYVA 1APME 3KK8A 2WMAA 2YIWA 4FYNA 3C4FA 4FG8A 4BDJA 4EC8A 5FEQA 1GAGA 3EQFA 1WAKA 2EXEA 1OKVA 1WBNA 3R8UA 3PVUA 3UOLA 4C57A 3C4EA 1OL5A 2ZYBA 4A7CA 1BI8A 4ZS0A 4ZIMA 2PMNX 2JDRA 4EH5A 4J8MA 3HYHA 1FMKA 3QTUA 4K77A 2BRMA 5LVMA 2Z7RA 3EL8A 3WE4A 1W84A 5DEWA 5T6KA 5TKDA 3WE8A 4B4LA 4OTDA 4IB1A 1ATPE 1MRVA 4CXAA 1YKRA 3VS2A 4I5PA 4IAFA 3DPKA 4D9UA 3GQIA 4ANSA 1TQPA 2FSLX 2QOOA 5EW9A 2XNOA 3R9OA 2NYAA 3QRTA 1CSNA 3Q60A 4LG4A 3QAME 4IEBA 1GY3A 2YZAA 3TKIA 3DB8A 2W9FB 3G5DA 3UZPA 4DTBA 4OTGA 1OL1A 2ITQA 4PF4A 2JIVA 4NM3A 4Y73A 3V6RA 4K2RA 1XHAA 3G33A 4QP9A 3VF8A 5HCZA 4ASXA 3Q2MA 1TQMA 5L2TA 1SNUA 4F08A 5GJFA 4ZY5A 3AD6A 5E7RA 3DKCA 5JQ5A 4XV3A 2O3PA 2W0JA 4JBQA 4EZ3A 5IEVA 5JFSA 1OZ1A 2Z2WA 2V7AA 2G2HA 3GU8A 4I5CA 4I6BA 2WD1A 2XCKA 4MD7E 3W8QA 4EI4A 4QDVA 5ITAA 4CSVA 4ZJVA 4MBJA 2F9GA 3ROYA 2CGXA 5EM6A 5K0KA 4YU2A 3R71A 2ITYA 2RF9A 2XJ1A 3G0FA 5A6OA 3PJCA 1XWSA 2VTQA 4C7TA 1XH5A 1J91A 3ZXTA 2XP2A 3IW7A 4IZYA 4XLIA 5FRIA 4C8BA 1M14A 2XNNA 4GYIA 3LLTA 2PUIA 4FOCA 4AZVA 2FVDA 3HP5A 4ITIA 3ALNA 3ZRMA 4E6DA 4BIEA 4RG0A 2YDIA 3UODA 4UX9A 3ANRA 4O38A 3AD5A 4RJ3A 5IEXA 3A60A 2XK7A 3P5KA 2YM3A 5AP7A 3Q96A 4NFNA 3DDQA 4FBXA 3G6HA 3MW1A 3ZSGA 3F7ZA 3BYMA 4FL3A 2Z8CA 1GZKA 4J53A 5EYDA 5AM7A 3VS5A 3IPHA 1ZYCA 2X81A 2VRXA 4LM5A 4EK4A 4WD5A 4FKRA 5HLWA 4FGRA 2I0YA 5E90A 5I9UA 3QTQA 2HY0A 5AUVA 3HMNA 5FLFA 3MESA 4CQEA 4DCEA 3L9LA 5J87A 1NVRA 2J90A 3RHKA 4LMUA 3QQJA 1M2PA 4J1RA 3PP1A 4YPSA 4D4VA 3HA8A 4CVAA 5K9IA 4FIIA 2VV9A 1WVWA 1ZZLA 3W33A 5HTCA 3DLSA 4U97A 4DLIA 2GS7A 4EHGA 4DFBA 3KMWA 3OTVA 4TTHB 5E92A 4WO5A 5CS6A 4FV8A 2P4IA 5HNBA 4PP9A 3FLWA 3FY0A 4GS6A 1P4OA 4DFZE 5FXRA 4K18A 4W4VA 2F49A 4NIFB 3MFSA 2BDFA 2GNFA 4XUFA 3WF6A 3U54A 4XEYA 1H0VA 3BLQA 3RTPA 1TVOA 2UZLA 2WMBA 3I5ZA 1FMOE 1Q62A 2X8EA 3OW3A 3ZDIA 5KKRC 1BMKA 4DFLA 1QPCA 3EFKA 3GU5A 1WVYA 3NUSA 4HCVA 2DWBA 4LRMA 4NT4A 1Q5KA 3DB6A 5EM5A 4FX3A 3VBYA 5L6OA 2R0UA 4EOQA 4Y46A 5BQ0A 4X3FC 2XMYA 3W0RA 5AV4A 2QO7A 2X2LA 3RPYA 5KMNA 3E93A 4RIOA 4P2KA 2WAJA 2RG6A 3U4WA 4ZTHA 4APCA 4IM3A 3UVPA 3ZM9A 1DI9A 4JQEA 1VEBA 2Y4IC 5IQBA 3VS7A 4YR8A 3F5GA 4JX7A 2OJJA 3EQDA 4RGJA 4F1OA 4FJVA 4YLJA 4MXCA 1J7IA 1PKGA 2YEXA 4C35A 3TUDA 2G2FA 3FQSA 4FV0A 4MD8E 2J9MA 4YZ9A 5HIBA 1B39A 2XK6A 3PWDA 4HCTA 3LKMA 3F3WA 2GQGA</