4BCGA

Structure of cdk9 in complex with cyclin t and a 2-amino-4-heteroaryl- pyrimidine inhibitor
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
321
structure length
312
Chain Sequence
SVECPFCDEVSKYEKLAKIGQGTFGEVFKARHRKTGQKVALKKVLMENEKEGFPITALREIKILQLLKHENVVNLIEICRTKGSIYLVFDFCEHDLAGLLSNVLVKFTLSEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLITRDGVLKLADFGLARAFSLAKNSQPNRYNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLALISQLCGSITPEVWPNVDNYELYEKLELVKGQKRKVKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWSDPMPSDLKGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/cell cycle
molecule keywords CYCLIN-DEPENDENT KINASE 9
publication title Substituted 4-(Thiazol-5-Yl)-2-(Phenylamino)Pyrimidines are Highly Active Cdk9 Inhibitors: Synthesis, X-Ray Crystal Structure, Sar and Anti-Cancer Activities.
pubmed doi rcsb
source organism Homo sapiens
total genus 87
structure length 312
sequence length 321
ec nomenclature ec 2.7.11.22: Cyclin-dependent kinase.
pdb deposition date 2012-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4bcgA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4bcgA01
2PK9A 1Q62A 4U5JA 2PULA 5B2MA 4EQMA 2XBAA 2BTSA 2BR1A 3F5UA 4UB7A 5L2QA 2ITXA 4WSYA 4QD6A 2PUUA 3A7IA 3GNIB 4FSMA 3WI6A 3H9OA 1Q99A 5IZFA 1XO2B 2BRGA 4W4YA 3ZYAA 4BBEA 4YC6A 1H25A 2B9FA 4IZ7A 3VUGA 3I7BA 3QC9A 4ZY4A 2R3PA 5JEBA 4F08A 3Q2JA 1ZOGA 4NTTA 5CVFA 4O6EA 3EN7A 4QMSA 4RQVA 2PYWA 2G2FA 2QR8A 2R3LA 3BGPA 3DAKA 5HVKA 4D2PA 2UVYA 1MRUA 3BV2A 3GCQA 3BZ3A 2WD1A 4H3PA 4U7ZA 2QURA 3G6GA 4F6UA 2I0VA 2GHGA 4O0SA 3IW7A 4GKIA 1H1WA 4YNOA 5A6OA 3D2IA 3HV6A 4EOQA 3V5WA 3CLYA 1XBBA 3DA6A 2J6MA 2BZJA 2R3KA 4MF1A 2ZV9A 3PUPA 5C1QB 5DHJA 4ZTHA 3OT3A 2JFLA 1OBDA 2HXQA 2E9NA 4TRLA 1NA7A 5DEYA 4QNYA 4LV5A 3DLSA 3O0GA 4E7WA 2O8YA 4ZTNA 3NWWA 4S32A 1FBNA 4ONAA 5CU6A 1IEPA 4BFMA 2HZ4A 2WZJA 4WG3A 3CTJA 3NS9A 4HOKA 4CTCA 1YDRE 3DAEA 3CJFA 5L8JA 5BVKA 4D1XA 3PYYA 2W1GA 4FSNA 4GMYA 3KVWA 3DDPA 5FLFA 4KABA 3TTIA 5A9UA 3FE3A 4AA5A 3EQBA 3C4FA 5JKGA 4ENXA 4FX3A 2Y6MA 2B9JA 3ET7A 4CLJA 5KMKA 3UQCA 4RVKA 3SW4A 2GMXA 2B54A 2WMUA 3A8WA 4UN0C 4PRJA 2VTLA 5HE3A 3JVSA 5FRIA 2OZOA 3OCGA 4D2VA 2OF2A 3L8VA 3EWHA 3VUMA 2PU8A 2ITOA 5C8KA 2BILB 1OECA 5ANEA 3EL7A 4YBKA 4GJ2A 3V5PA 2AC5A 3VUKA 4DH5A 4ITHA 1H0VA 3AOXA 4FTMA 4MXZA 4OTHA 3F3TA 4FSRA 4K18A 4XV1A 5AR7A 4RJ5A 3NMUF 2VRXA 5ANIA 5T3QA 3UC3A 3G90X 4IWPA 1YXSA 3FPQA 3UOKA 1OITA 1J7IA 5E1EA 4BCOA 2PMNX 4BI2A 1H1SA 3LLTA 3ZUTA 3WZJA 3EKKA 3UMWA 2V62A 4I23A 5AR5A 2HZIA 4FTCA 4PL3A 3TCPA 3V04A 5DRDA 1LR4A 1Y8YA 4E4NA 2V0DA 4S31A 4IVBA 3DBQA 1SYKA 3R71A 4FV9A 3FLNC 1L8TA 3MJ1A 3GC7A 3AXWA 4ANBA 4CFFA 1FINA 4ACMA 3EN9A 2C4GA 3UTOA 2UVXA 4RRVA 5FM3A 1GAGA 4DH3A 4ZTRA 3GC8A 5B2LA 2BCJA 4ZK5A 4HPTE 5C27A 5IDNA 3ZCLA 2V7OA 2YM6A 3QCSA 3QTXA 4G1WA 4NM5A 4LL0A 4TN6A 1G8AA 4M13A 3OBGA 4B7TA 3O8UA 1TQMA 2CJMA 3LXPA 3UVQA 4KRCA 1MQBA 2JAVA 4XX9A 3ZFMA 5TKDA 3JY9A 3H3CA 3QQGA 3Q4CA 4NKSA 4LGDA 3V8SA 3G51A 4DGNA 2QKRA 4AW1A 1XH6A 2J5EA 3KMMA 4RJ4A 1XH8A 1VYWA 4EHZA 3CD3A 3JXWA 1BL6A 3BLRA 3NUPA 4RVTA 4BIEA 1CKIA 1R1WA 3HX4A 4HW7A 3NW5A 3DLZA 3KN6A 3L1SA 3CP9A 2UW7A 3P7CA 2QG5A 1M52A 3JYAA 4O1OA 1GOLA 2C1BA 5TF9A 4C4HA 4RJ8A 4DG3E 5CAVA 2XCHA 2HZNA 4RX8A 3ZXZA 3SHEA 2G15A 3NYXA 1CTPE 3U9NA 2WTKB 2P0CA 3LFFA 3KRXA 1F0QA 1JSVA 2G1TA 3MB7A 1BUHA 2WKMA 5D41A 5HE1A 4YTCA 4AOTA 2X8IA 2HOGA 4NFNA 3ZTXA 4GT5A 2CGWA 5AIRA 5L6PA 4KBKA 1AQ1A 3PG3A 3RPYA 1SVEA 3HRBA 3NCGA 1DM2A 3CC6A 4ZSGA 5AA8A 2OI4X 1SMHA 5B0XA 1PKGA 3VO3A 2WTKC 3EYHA 5HVJA 3ZOSA 3MVMA 3D5UA 3QRJA 3QCYA 3UZPA 2VX1A 3HMMA 4FKPA 2C5XA 2JKKA 4W8DA 3LXKA 3PXRA 4J98A 3BRBA 3RCJA 3NUXA 4A9UA 4FICA 5JZNA 4FL2A 2RFDA 4HGEA 1REJA 4RC4A 2Z7QA 3PVBA 4GUBA 4ENYA 3CJGA 4UALA 2UZUE 5DN3A 4TYJA 4WO5A 4XH6A 1PHKA 4F9BA 5HTBA 3FKOA 4E3CA 4IM2A 4OLIA 3P1AA 4DHFA 3MESA 3DPKA 1IA8A 5IA4A 2BPMA 4MWHA 3EFJA 5LMAA 3EQPA 4AG8A 4BIBA 4CFUA 1A9UA 2XKCA 3OCTA 4FIFA 4IEBA 2OJ9A 4CKJA 3U6JA 3FMEA 4RLLA 5DLSA 2QQ7A 3VQUA 4GK2A 2PMLX 4BGGA 5J1WA 3D5WA 2C3KA 3HMIA 2UW8A 3UG1A 4AZTA 3I60A 4FIEA 1CDKA 4U44A 3Q96A 4ACCA 4EOPA 3MIAA 4QOXA 2PVFA 1PMEA 5JGDA 1P4FA 3RCDA 5CALA 3EIDA 5HD4A 3P78A 5EM5A 4OTQA 4FV4A 3S00A 4XP0A 3ZHPC 5E8UA 5AUZA 4AZWA 4XYFA 5F95A 2GQRA 2JIVA 3KKVA 1ZWSA 3E8CA 1Z57A 3R0TA 2C0OA 1XHAA 1PKDA 2Y4IB 5HCZA 3F2RA 5B2KA 4R6VA 4I0TA 5EHLA 3GU8A 5JFSA 5I9XA 3T3UA 4L46A 4YLKA 4YMJA 5CS6A 5DA3A 4Q5EA 3DKGA 4BKZA 2WMWA 4U42A 3ACJA 4V0GB 4OTIA 4J95A 3UPZA 3D5VA 2PSQA 2Y4IC 4P7EA 1APME 2YLFA 3EL8A 2ZDTA 4U0IA 2ETKA 2C68A 1IA9A 5KUPA 3IS5A 1Y91A 4AE6A 3R8LA 5EKOA 4O0YA 3PWYA 2VX0A 2Q0NA 2CPKE 2OG8A 4RSSA 3Q60A 2HW7A 1OIUA 1KV1A 2AYPA 3REPA 3ZDUA 3E93A 4N4SA 3MYGA 4XG4A 2O2UA 3FPMA 3HKOA 4JT3A 2XM9A 4BDFA 3TJCA 5IA0A 5DI1A 3C4WA 5JT2A 4JI9A 5AADA 2R0UA 4C4EA 5HESA 2WU7A 2VWYA 4YUQA 2VTRA 4FSZA 4BWXA 5J7BA 4J52A 1FGIA 2UZBA 3ZC5A 2ITZA 2J90A 3VNTA 4GT4A 4JS8A 1Q24A 2YDJA 1MRVA 2REIA 5D12A 3VJNA 2GU8A 2Y9QA 3D15A 4JNWA 2F49A 4GS6A 3S0OA 3NVMB 1M17A 1W82A 4GG5A 2GFCA 5A54A 3AD4A 5FBOA 3ORLA 3ENMA 4K77A 5HI2A 4FTQA 4CTBA 5GZAA 4EJ7A 2WOUA 5GNKA 2EUFB 3I4BA 3TZ7A 1O6LA 4AF3A 4NW6A 4M0YA 4U8ZA 3I81A 3CY3A 1WVYA 3DNEA 4DEGA 3ZMMA 1UA2A 4ACHA 5K0XA 2B0QA 3MVLA 2YISA 2CKPA 4E26A 1OPLA 4OTWA 3TNIA 1GNGA 4YU2A 3TM0A 4OR5A 3FY0A 3R83A 5J7HA 4JIKA 3ZSIA 3OT8A 4YJQA 4KNBA 4GU6A 3UG2A 3HRCA 4C3FA 2OH4A 5IH6A 5K4JA 4E8AA 5FDPA 3CPBA 2XK4A 3ZRLA 5M53A 2RFNA 5BVEA 4BYJA 3OVVA 5HNGA 3HMPA 4CSVA 2OFUA 4CQGA 5LMKC 1YQJA 2X4ZA 2WMBA 3U4WA 4EHEA 4CRLA 3F3VA 3QKKA 4LRMA 4O27B 3N9XA 4ASXA 3Q3BA 2IN6A 4DYMA 3Q4ZA 4Z3VA 2B4SB 3PSDA 2XNGA 5IMEA 4W4VA 4AA0A 1GIIA 4XG8A 2C3LA 5DMZA 2OBJA 3CQUA 4WIHA 3MGYA 2FO0A 4NSTA 4PPCA 3UO6A 4E73A 1GY3A 1Q8TA 4AT3A 4A9RA 4NTSA 3G5DA 3D0EA 4MKCA 4KA3A 5M4FA 1NW1A 4PMMA 3MV5A 4YHFA 4G3FA 4ALUA 4CCUA 2OU7A 3KF4A 5CEIA 1XBCA 4YZMA 4QTEA 4YTFA 5HG8A 4FSYA 3C9WA 3GT8A 3KK9A 4JX7A 4QTDA 4AZVA 2W4OA 5EDRA 2X7OA 2VN9A 4M3QA 2GQGA 3QYZA 3ACKA 3N4VA 3QD4A 4UEUA 4CRSA 4GIIA 4ZSEA 4N6ZA 2B9HA 4ITIA 1S9IA 2GHLA 2QR7A 3CKXA 3FKNA 4QMXA 4B9DA 3W1FA 1KE7A 5BVFA 2WMAA 4MTAA 4FOBA 3MIYA 4BCHA 3JY0A 2ZAZA 4KBAA 3GGFA 3ZSGA 4F1TA 4QP6A 4Y5HA 3WILA 4RQKA 4EHVA 3EQIA 4EK5A 1QL6A 2R3FA 3K3IA 4ID7A 3FMKA 3FY2A 4XEYA 2BZKB 5HOAA 3VS2A 5HIEA 3QX2A 1OKWA 2YN8A 3CPCA 4IX4A 3QTZA 1B39A 1R0PA 3CR0A 2VTJA 3BGZA 3C51A 3EMGA 4IVCA 2GPHA 3HRFA 4H36A 4QMVA 3LZBA 3R7EA 4BTJA 5FEEA 4DTBA 2OXDA 3PRIA 3L9LA 3HV3A 4QP9A 2I6LA 2NRUA 3KVXA 3ODYX 3R04A 4RJ7A 4EC9A 4EZ3A 4UXLA 1UV5A 4ZZMA 4A07A 5BMSA 2C5VA 5BQ0A 1WBSA 1SNXA 1WBVA 3HA8A 4I22A 5IA2A 3ULIA 1HOWA 2BUJA 3QC4A 3WIKA 1IG1A 5DR6A 4CFMA 4DLJA 3RNYA 3O8PA 2PE0A 3H30A 4ARKA 2H6DA 2Q83A 1H1RA 4D1SA 3MFTA 2QHMA 3QA8A 4CV9A 2RG6A 3MPAA 4HVHA 4NIFA 4EH8A 5KKRC 3V5QA 2HXLA 1Q5KA 2VAGA 2XRUA 4GEOA 2XZSA 2YDIA 2F9GA 3O51A 5C4LA 4XRJA 5HBJA 4MBIA 5H2UA 3KK8A 1TKIA 1UU7A 2C6TA 4FT0A 3BE2A 4YPDA 3R8PA 2Y0AA 5CEQA 5TR6A 2X8DA 5K5NA 3DTWA 4YZBA 4BIDA 4AZSA 1WMKA 3WYXA 4UMRA 2WPAA 4JOAA 4AZEA 5DG5A 3UIBA 4ANNA 3ZLSA 5E90A 4IDVA 1KE9A 3QAME 3VUTA 2CDZA 2EU9A 4DBXA 3D83A 2XKFA 3GEQA 1P5EA 4EH4A 5CEMA 2B1PA 2ITWA 2VO6A 1YI4A 2QU6A 5FP6A 3TZ9A 4C4FA 1ZMUA 2UW0A 2FYSA 3F2NA 4FL3A 3FZOA 4ACDA 3EHAA 2WTIA 1UNHA 3TI1A 3BELA 1CMKE 4S33A 3TV7A 4ANQA 4BN1A 5FD2A 3F9NA 4GK3A 5JQ8A 5AEPA 5ANKA 1YXVA 3PA4A 4XNEA 4QMWA 2C5YA 5DR2A 3VC4A 4I41A 3FJQE 1PYXA 4KS8A 2JIIA 3IK3A 4QYEA 3OWJA 3ZEWA 1SVHA 2RL5A 4D55A 3VVHA 4X2KA 3S95A 3PP0A 3LJ2A 2YM5A 3I6WA 2QO9A 4W8EA 3GOKA 2ERZE 3KRLA 4X6RA 4BCKA 4BGQA 3IO7A 3QD0A 4C02A 4XCUA 4D28A 4DCEA 5BUJA 4YTHA 5CAPA 5HLWA 3WZUA 1T45A 2EXMA 4G9CA 4K2RA 3LFEA 4V0GA 4H3BA 3P23A 3ZZEA 4XHKB 2PZIA 1P2AA 2VWXA 4I0SA 4D4SA 3DJ6A 3PJCA 2HENA 4L52A 3QTWA 4MAOA 4UZHA 3VJOA 3NUSA 1EH4A 4G31A 4ZSJA 4QT1A 5J8IA 4UWYA 4AACA 3PG1A 5CSWA 2VTHA 2X8EA 3FAAA 3BQRA 4EOOA 4KAOA 5CSXA 2CCIA 5A46A 5L3AA 2XNEA 4RC2A 2W1FA 4FV7A 5AJQA 3AC1A 2YJSA 4PP9A 2F2UA 3FHRA 4QYYA 4CMUA 3BU5A 4GV1A 4O96A 3UMXA 2ITUA 2WQNA 4R5SA 3K5UA 4NKAA 3ORTA 3VS0A 4B8MA 5JGAA 1Y57A 3HDMA 4ITJA 3G9LX 4D2SA 1JSUA 3UC4A 4EK8A 3U87A 2UW4A 3R02A 4F0FA 5AAEA 3ODZX 4O83A 3GCSA 4IM0A 3KRRA 4FKTA 3D14A 3C4XA 3RVGA 2VTNA 4FTTA 3MW1A 3PA3A 1JLUE 1UU9A 4HNFA 5ETIA 4ZLYA 2DWBA 3U51A 5AA9A 2FSLX 5CU0A 3QQJA 3HUCA 2P3GX 5CZHA 3BWFA 3R63A 4IADA 2JC6A 4OTFA 3LHJA 5HCYA 3WYYA 4E1ZA 4ZS4A 3C4EA 5H3QA 2YFXA 5BPYA 5J95A 5LMKA 5LOHA 4EQUA 2GSFA 4DFYA 1PXJA 3IQ7A 1OL1A 2C3JA 2Z2WA 4F6SA 2VTOA 1OL5A 3WZEA 1KE6A 5FTOA 3NUAA 2WIHA 1ZZLA 4M69A 4X21A 5AUVA 2UZVA 4ZJVA 3OHTA 3PPJA 3QALE 4FZ6A 2YZLA 4QP1A 1OGUA 3FC2A 3KC3A 4TXCA 4U3ZA 4EQCA 5KX8A 2RGPA 5HG7A 4QPAA 3UP7A 4E6CA 4HVSA 1G5SA 2F2CB 2C6IA 4IH8A 3SQQA 4IVDA 3L9NA 4P90A 3RAWA 4WOVA 4ZMEA 3QUPA 1DAWA 4LFIA 2BRHA 4A06A 2CCHA 3CSVA 3DQXA 2XIXA 2Z7RA 2LAVA 3PDTA 1U5QA 2WEVA 5KHWA 2GNJA 2YEXA 4X2JA 2PZRA 4E6DA 3QHWA 5LQFA 5GIOE 5EYMA 5DE2A 3P08A 4EOSA 4ZMFA 2R3IA 5M4UA 1Z9XA 1O6YA 3AT3A 4FKWA 5AUUA 1FQ1B 1RW8A 4FUYA 4USDA 2J0MB 2NRYA 3PJ3A 3CEKA 1UVRA 4RIOA 4TWCA 2VGOA 2P55A 3OBJA 4C62A 4NUSA 5A4CA 3R73A 3MN3A 5JRQA 5LMBA 3P79A 4YJRA 1OL7A 3F61A 4FNYA 4J1RA 4NH1A 4XBRA 4ALVA 3RINA 2BKKA 1Q41A 2IZUA 3PLSA 1BI7A 4MD8E 3ZO3A 3V3VA 4LL5A 2XNOA 4K11A 4UYAA 3TKHA 4S30A 5KCVA 3WIGA 4JBOA 3IONA 4GT3A 2CKEA 3D2KA 3R1QA 2Y6OA 5C01A 3SX9A 3W10A 5LVOA 2E9OA 2ZM1A 2ACXA 4BDCA 4NZWB 2R7BA 2UVZA 4S34A 2JDTA 3QRIA 4G3EA 3PZEA 5AP0A 4YZDA 1YI6A 4FT9A 5CI6A 3C5IA 5CAQA 3EFWA 3BCEA 3TL8A 3UBDA 1QMZA 2VTIA 4R5YA 3DXNA 2OJFE 4J8MA 4PMTA 4XP2A 3RPOA 5HQ0A 5LXMA 4TY1A 2R2PA 2ZVAA 4HGLA 3C4CA 3ZZWA 3LOKA 4BDKA 3PFQA 4O0WA 3OF0A 1W7HA 5HG9A 4PDOA 5L6WL 1H24A 4AT5A 2FGIA 3LFNA 2P33A 4FNXA 4EH7A 1GZ8A 1V0PA 3MTFA 2FA2A 3MI9A 5TO8A 4QMQA 4DH7A 4G6NA 4FIHA 1KOBA 3FXWA 2UW3A 4HCUA 4DEDA 5JZJA 4D9UA 3ROYA 5AV1A 1B6CB 5CZIA 4CCBA 2Y8OA 4QYFA 4KINA 2CGVA 3CQEA 2YCSA 3VUIA 2XK3A 4XG9A 1URCA 5AR4A 2CMWA 4U81A 3RK5A 3OC1A 4TWPA 3LE6A 3R8MA 3VBVA 4E5WA 1BL7A 4KKGA 3AC5A 3MH2A 4U3YA 1YDTE 3G15A 5I9YA 4RMZA 4YLLA 3QTRA 4KSPA 2X6DA 4RLKA 3O50A 3W33A 5IA3A 2CHLA 2C6OA 3FC1X 3OUNB 3R00A 3A2CA 3WF9A 2J5FA 4R7IA 5M08A 1PXPA 3RHKA 2GNGA 3NDMA 5F4NA 3MBLA 1OBGA 2BRNA 3KXGA 3BEGA 4RZWA 5TE0A 4FKSA 4LOPA 3T9TA 3CY2A 3OTVA 4AUAA 4FV1A 4YJVA 3EFLA 4L44A 3EH9A 5FXRA 3TT0A 4FTAA 4BTFA 2RKUA 4ZAUA 3QGYA 5FTGA 4EYJA 5IQBA 5AP2A 4KWPA 3II5A 4FTRA 4F0GA 3SXFA 4P4CA 5CI7A 1V0BA 4FT5A 5IQAA 2W4JA 3QBNA 3I0OA 1OB3A 4I24A 1LEWA 4B4LA 5D10A 5AP4A 4DH1A 4FSQA 1TQIA 2XNBA 3DGKA 3I0QA 4IIRA 3WF6A 3ENHA 5L2WA 2WOTA 5FG8A 3PPZA 5D7VA 4C0TA 2YWVA 3TDWA 3WF5A 3VBWA 1WCCA 3E3PA 4QYHA 5CU2A 4CMOA 5J5TA 1VZOA 4XRLA 1L3RE 4BDIA 4FR4A 4FTUA 4QYGA 1XJDA 4WKQA 3QTUA 1U4DA 3NUNA 3OOMA 1ZYJA 1OMWA 1OZ1A 4EOJA 2WQOA 3F3UA 3QQLA 5BMMA 2XJ0A 4IAZA 1QPCA 4CGAA 3OZ6A 4PF4A 2XUUA 3R9OA 3W18A 2XP2A 4C37A 4KIKB 4F09A 4B6LA 1ZY4A 3HGKA 3TACA 4JBQA 4O2PA 3O7LB 3OWKA 5JRSA 1BYGA 4LRJA 3AG9A 1E1XA 1WBTA 3R1YA 4FV5A 4G9RA 5F20A 3B2WA 3UYSA 4ERKA 1ZMVA 4EI4A 1DI9A 2BALA 4FKRA 3W2SA 1LP4A 4WG5A 4Y83A 4Z55A 5E9EA 2ONLC 1KE8A 2HCKA 3DJ7A 3ZO4A 5DNRA 4OAUC 2F7ZE 3EZVA 4G17A 4AW0A 5K4IA 4BL1A 1M2RA 4NEUA 5E8VA 4B8LA 4E20A 5J79A 5LARA 2C6EA 5JH6A 2OWBA 4MVFA 2C3IB 2C69A 4HGTA 4CZYB 1P14A 4MXYA 1BKXA 1AGWA 4OBPA 4TNBA 4I5PA 4UMQA 4EUUA 5BVNA 4E93A 4UV0A 3DJ5A 1G8SA 4O0UA 4A4LA 5IH4A 2ZB0A 4FTNA 1Q3DA 3UZRA 3OW3A 3FLQA 2W0JA 4FNZA 4FA2A 4YJSA 2ITVA 4BHZA 4XS2A 5L2TA 3O7LD 4DFLA 1MP8A 3C0GA 3QXPA 4AU8A 2J51A 3IGGA 4IANA 3OG7A 3N51A 4HCTA 5AFVA 5ANDA 1K3AA 2VWWA 4AGDA 3W2OA 4EORA 4GKHA 4LOQA 3NW6A 4OT6A 5CX9A 1MQ4A 5TT7A 4OW8A 2J4ZA 4O7LA 1UKHA 2O64A 3E87A 5HKMA 1ATPE 4UMTA 5CVGA 2GS2A 5A3XA 2OIBA 2B55A 5EFQA 3UQFA 2PY3A 3T9IA 4EWQA 2Q0BA 2CKOA 4BDAA 2BRMA 4M15A 3R28A 2JGZA 3LQ5A 1JPAA 3EQHA 3DBEA 5FDXA 1KE5A 4ZTSA 3EQGA 1RDQE 3OTUA 5FP5A 3IDPA 5I9UA 4I4EA 2Y7JA 4YJUA 4PL4A 4GK4A 4HVIA 5A14A 4C2WA 3NUYA 4EONA 3R30A 5K3YA 4FG9A 2EB3A 2OFVA 2CGUA 4C58A 3FQHA 3E7VA 2VTMA 1S9JA 3G0EA 3POZA 4R7HA 3FL4A 3JUHA 1RJBA 3R7VA 5A4LA 3NLBA 4GFOA 4YC8A 4F9AA 4DAWA 4I94A 3Q5ZA 3BIZA 1PJKA 2VGPA 3RALA 2V7AA 2XM8A 1XH5A 4U40A 4K33A 2W9ZB 4TYHB 2B9IA 4CQEA 4EHGA 3RWQA 2R3RA 2ETRA 3DDQA 5EK7A 1DAYA 5CSVA 4FV8A 4M7IA 1Q8YA 4ZLZA 4UMPA 5AP7A 4AGUA 3RPRA 5CT0A 4NIFB 2Y4PA 4YURA 2XNNA 4M97A 4QQJA 2HY81 4DT9A 3RNIA 3BV3A 1H27A 1WAKA 4MF0A 3CE3A 4ACGA 3WE4A 5A4QA 1UWJA 2IPXA 3LM5A 4AN3A 1A48A 1OIYA 4XOZA 5DWRA 4R8QA 3ZO2A 2R3GA 1YXTA 4C34A 1REKA 4CFVA 2X2KA 1SZMA 1QCFA 4YZNA 5G1XA 1J1BA 1R78A 3FMMA 3IW5A 3ORXA 4MBLA 1PXMA 3DB6A 1YWNA 4NJDA 3V8TA 2J7TA 1PF8A 3LFSA 3P9JA 4ZY6A 4FK3A 5AAFA 5LVPA 4J99A 3LJ0A 5CXHA 4IJPA 3OOGA 3FBVA 5I0BA 3R9DA 3UE4A 5CY3A 4ZXTA 2J0IA 3FXZA 5AR2A 3FI4A 3ATSA 4EBWA 1U54A 3AC2A 3FXXA 4PTEA 3TJDA 4I6BA 4UWBA 1YWVA 3K5VA 3NIZA 3IPHA 2PUPA 2XJ1A 2XK8A 2XIRA 3DBDA 4IB1A 5AX9A 5T6KA 2WXVA 3VS4A 4CD0A 4CMTA 1SNUA 3ZLYA 4MHAA 4MXOA 4IHPA 4M8TA 4IX3A 4UMUA 3KFAA 2GDOA 4D58A 2ERKA 2CLXA 4R1YA 3DFAA 5HX6A 1K9AA 2XNPA 3L9PA 3AQVA 4F63A 3R8ZA 4EK4A 3U8WA 3ZONA 3UQGA 4BDHA 3BHTA 5CF5A 3F5PA 4L42A 2GQSA 2OW3A 4CYIA 3LQ8A 3E63A 5KMOA 3FI3A 4JRNA 3F7ZA 4IZYA 5HBEA 4Q5HA 4FV2A 3POOA 4QP4A 5J5SA 2ZM4A 3MA6A 3AT4A 4O1PA 4K9YA 4AA4A 4RVLA 5F1ZA 3O23A 3NGAA 4IJ9A 5E92A 5EDPA 4AW2A 5IQGA 3V6RA 4ZOGA 3R7OA 3R2YA 4BKJA 1U46A 2HWPA 3LKMA 5ETFA 2QOCA 1R3CA 4FIGA 4KKHA 3AGMA 3Q5IA 5K5XA 4I3ZA 1PRYA 1UNGA 3M11A 4M66A 2WQMA 1ZY5A 2BZIB 2W9FB 3R7UA 2BFYA 2YWPA 5FM2A 2DS1A 4QMYA 2DYLA 4L53A 5EH0A 4F64A 2C6MA 3UOJA 2OJIA 5BVOA 4KIKA 3LQ3A 2A2AA 5J9ZA 5IQIA 4GU9A 2ONLA 3TDVA 4JQ7A 3TIYA 3VRYA 4AN2A 3SXRA 5HTIA 1I09A 4RBLA 2UW5A 5BUIA 4I6QA 3BKBA 4J7BA 3NPCA 4FGRA 5I9WA 2WMXA 2QG7A 1VYZA 3GFEA 3GQIA 4DC2A 4O7NA 4GJ3A 4O7ZA 3HDNA 1R39A 4C3PA 3NNUA 4DEEA 5IUHA 3W2CA 5J1VA 5E8TA 4EOKA 2C47A 3TN8A 4YTIA 3VBTA 5HX8A 5FUTA 4RA4A 4U43A 3L8SA 2PVLA 5IH5A 4K0YA 3PXKA 4XP3A 3ORNA 3UIUA 3O96A 3PJ1A 4JJRA 4YC3A 3MJ2A 2A19B 3A8XA 2O3PA 4APCA 3ALOA 2C5NA 4H58A 4M69B 4EKKA 3KEXA 2GS7A 2J50A 3MPTA 5AUYA 4HZSA 1NVQA 2BDWA 3SC1A 3ZU7A 3FZTA 3Q9XA 4UBAA 3DTCA 4BI0A 3U9CA 3DZOA 1OIQA 3E8NA 1B38A 2QOBA 3MWUA 4IE9A 3FI2A 4K1BA 4G2FA 5AP6A 4BB4A 4AT4A 3WARA 2XEZA 1JSTA 5I9VA 1FMKA 5FEQA 5IUIA 4IWOA 3LCDA 2OJGA 4I5HA 4M68A 4X2NA 3KULB 2Z8CA 4CEGA 1FVTA 1Y8GA 2ITNA 3BU3A 4WNKA 3VUHA 1BI8A 2YZAA 4CZUA 3I5ZA 2ZDUA 4IAIA 2VWIA 3AD6A 4LGGA 4TNDA 4YBJA 5HIBA 3TWJA 2NO3A 5T68A 3LMHA 4YP8A 5L4QA 3FMLA 3LCSA 4I93A 4NT4A 3S2PA 4DN5A 4F7JA 4TYGA 5DT0A 4QMLA 4R77A 3ANQA 3AC3A 1XBAA 3HV4A 4Y5QA 2I7QA 2IVUA 4X6QC 3H0ZA 2BHHA 3QU0A 4HZRA 5CF8A 3EJ1A 3E5AA 2G9XA 4HYHA 4E4LA 1JOWB 4BDEA 2YHVA 1G3NA 3MA3A 1XH7A 3UPXA 3UJGA 3A4OX 1PYEA 4PX6A 3TNHA 3W2RA 5K9IA 4LMNA 5DFPA 3R1NA 3LCTA 2CNQA 1HCKA 2WMRA 3NRMA 5LJJA 3Q6WA 2EXEA 4DGLC 4JR3A 1OVEA 4HCVA 1U59A 3LIJA 2SRCA 3PSBA 3FMDA 1W0XC 3C50A 2J0KA 5LWMA 5LWNA 3V5TA 3SGCA 4ASEA 2HZ0A 4JDJA 3ZLWA 1Q3WA 3DNDA 2VTSA 2VUWA 4DEHA 2XIKA 2VWUA 3UIMA 3P7AA 2PZPA 2QO7A 5FBNC 3VS5A 4C36A 3U6HA 3UZTA 3PE2A 2X9FA 3FLZA 4GG7A 4OTDA 4FGBA 4BCFA 3ORZA 3IDBA 4IAKA 3LCOA 5HLPA 4AS0A 5HVYA 3RAKA 3E64A 5M07A 2OICA 3IGOA 2I0EA 1ZRZA 3DT1A 4IC8A 2J0JA 4LRKA 2G2IA 3KF7A 4LGHA 4RX5A 4FV3A 2YM7A 2DQ7X 5KKRB 4H05A 4ZP5A 3DQWA 4TYHA 5I3OA 3NX8A 3OEZA 4CT2A 3WOWA 1CSNA 1RE8A 4FMQA 4XV9A 2R4BA 3EN5A 5FTQA 1ND4A 3D94A 4PMPA 3WF7A 4D4YA 1Q8ZA 3LVPA 3QZIA 4QP3A 5B7VA 4CVAA 5IEVA 5M51A 2BAKA 1ZOEA 3FHIA 1OL2A 3DBFA 4MNEB 4TL0A 1OI9A 2Z7SA 2WTJA 3LXLA 2UZDA 1ZMWA 5KBQA 4DBNA 3MB6A 1YOLA 3BYMA 5AIKA 4PL5A 3KB7A 4FKJA 3F66A 2WIPA 3HP2A 5AR8A 4O0RA 5CF4A 3LFBA 3DK6A 4XOYA 2BROA 4JXFA 4L43A 3FDNA 4EEVA 2ITYA 5TOZA 3EQCA 3QZFA 4W4WA 4L7SA 5AM6A 2X2MA 4D0WA 1NXKA 3KMUA 5M56A 4KS7A 3KN5A 1M2QA 5BUEA 3OEFX 1WVXA 2YCFA 4NJ3A 5GJDA 5CF6A 4LUDA 5JN2A 5AV4A 4WG4A 2J2IB 3VS3A 4C7TA 4QP7A 5CNNA 3E88A 4JVGA 3FSKA 1TVOA 3FUPA 1XH4A 3K54A 3VS6A 3BE9A 5JK3A 3DXPA 4DG0E 5HU3A 3HV7A 4KIPA 3MFRA 3VS7A 2OXXA 4XUFA 3R7YA 3E3BX 1JKLA 3L8PA 4FZAB 4ERWA 5IF1A 3OMVA 1Q4LA 1QPEA 2BFXA 3NSZA 2H8HA 2JDOA 3ZRMA 3UNKA 4BKYA 3E8EA 1OPKA 3UP2A 1PMUA 4KSQA 3FSFA 4DE4A 5D7AA 3VW6A 3FV8A 4BVUA 3QZHA 3PXQA 4H1MA 4IB3A 2GNIA 4R3CA 3C0IA 3BHVA 2VZ6A 4NL0A 4AGCA 4PUZA 3KL8A 3IOKA 4Z16A 3G6HA 4DEIA 2GFSA 5EM8A 5IA5A 1W83A 2XBJA 3RHXA 5IPJA 5HU9A 3VULA 2XKDA 3F6XA 4XG3A 3KXMA 2FB8A 4F7LA 3ZUVA 2WQEA 4MYGA 4L7FA 3BLHA 4A7CA 1DI8A 3P4KA 4JDIA 1XWSA 2PE2A 4XG6A 1OIRA 4EK6A 1P4OA 3OP5A 4IZAA 4PP7A 4ZZOA 4GFGA 4FK6A 4BTKA 4ALWA 2AC3A 5EYKA 3A99A 4RWJA 1YXXA 4USFA 3VHEA 1IR3A 4MXAA 3QCXA 5M09A 2O63A 3GCUA 4L3PA 3BYVA 2WB8A 4MWIA 3VBQA 2FVDA 4WNOA 2IW9A 2JD5A 3COKA 3FQSA 3HUBA 3QTSA 3RMFA 2ZMDA 2IJMA 4O7WA 4GUEA 3RZBA 4C4GA 5I5ZA 4E6QA 1OUKA 5EW3A 2E9VA 3Q53A 5HO7A 5KMMA 1KWPA 1ZYSA 4D2RA 4UWCA 1J91A 3R9RA 2YABA 3TTJA 2EB2A 3BHHA 4WUAA 4R3PA 4RIXB 2JLDA 3CBLA 4IVAA 3KXXA 3W8LA 2OO8X 3MY0A 4J8NA 4HNIA 5FXQA 2CNVA 3L9MA 5AX3A 3I6UA 3TIZA 4E5AX 4FBXA 3N4TA 3BWJA 3PXFA 4EH9A 4KIOA 3RBWA 1WBPA 5HG5A 2BDJA 3EN4A 5CU3A 5LVLA 4FF8A 4IB5A 2OK1A 4DFZE 4RFZA 2YIWA 4IXPA 4DITA 4FKVA 3SD0A 3A7HA 2QO2A 5AV3A 5GJFA 5ETCA 4I4FA 3VF8A 4ANMA 2YM4A 4ZZNA 4ZJIA 4EZ7A 1V0OA 3CGOA 5M4CA 4F99A 2X4FA 4D4RA 3PJ2A 3T3VA 3VRZA 2RSVA 2VTTA 2XJ2A 3FZSA 5ANJA 3KULA 3RAHA 4IWQA 3BEAA 1NY3A 3HZTA 4G6LA 2XMYA 2Z7LA 1ZOHA 3OY1A 4TWOA 4PY1A 4CFWA 4F9YA 4X7QA 5BVWA 4WA9A 4YJNA 4YJTA 5KZ0A 2UW9A 4XV3A 5A4TA 2QOKA 3HEGA 4RX7A 3DK3A 1KUTA 2E9PA 2IVVA 2ZV8A 4NM7A 4QPSA 4BGHA 2YIQA 1TQPA 3A7JA 4RX9A 5CVHA 5CANA 5CAUA 3H4JA 5IA1A 2J9MA 3ZXTA 4FTOA 1W98A 3QD3A 4M14A 4QP2A 5H8BA 1FMOE 2VO7A 5A4EA 4XLIA 5IEXA 3AC8A 3RTPA 3V01A 5AUWA 2UZNA 4NM3A 3ALNA 4HYSA 2W1EA 5IKWA 5FWKK 2P2HA 4I5MA 3PJ8A 1JKKA 5AUXA 4ZSLA 3R9HA 1JBPE 1PXLA 3FZ1A 2XCKA 2VO3A 1STCE 3LW0A 2R9SA 3HAMA 1PMVA 2ZYBA 4F4PA 2XF0A 3C1XA 5HE2A 3TNQB 4C57A 3ZM9A 3PA5A 2BIYA 3BBTB 3VBYA 3T8OA 3V5JA 4DF3A 2CGXA 3BX5A 4Y73A 3E62A 4V05A 1PY5A 3DBCA 1YW2A 1F5QA 5IU2A 4YZCA 3RAIA 2XYUA 3QXOA 4MX9A 3B2TA 5EQYA 3WZKA 1SM2A 4QRCA 5EKNA 3VUDA 3C4ZA 2Z02A 4TKSA 4F1MA 4DH8A 3DY7A 1YOMA 4BWPA 4BZDA 4BZOA 3M42A 4RFMA 1JWHA 5KO1A 3KXHA 5HD7A 5GIPE 3NUUA 4CLIA 1OUYA 4O7YA 3DB8A 3QWKA 4RJ3A 4QMOA 3TKIA 4MNEA 2BAQA 3UGCA 1VEBA 3SAYA 4EC8A 4O7SA 4MNFA 3NR9A 4RIYB 4ZTQA 4HPUE 4KUJA 2WMSA 4HGSA 4IZ5A 4DEBA 4G16A 3SV0A 4PDYA 4WRGA 2OGVA 4BI1A 1FOTA 1PXNA 2DUVA 3LJ1A 4IW0A 3DKCA 4GSBA 5E91A 4EOMA 5M57A 4Z7GA 3IDCA 4DFBA 2H96A 1ZAOA 4FTLA 5C03A 4EOIA 1JKTA 4OTPA 5HE0A 4AP7A 5HBHA 3QRTA 3PPKA 2C30A 2YERA 4PDSA 2IVSA 4FVRA 4IX6A 4JIAA 3QLGA 3L8XA 1KSWA 1U54B 4FV6A 2XEYA 3QGWA 4BICA 3D7ZA 3UO5A 2G2HA 5C8NA 5EOLA 4ANOA 2PVNA 5DEWA 4ANSA 4V01A 5D1JA 5M44A 3W2QA 3MY5A 4FKGA 1JNKA 4X3FB 2J0LA 4JL9A 3VF9A 1ZYDA 3UVPA 3MH0A 3TV6A 4EOLA 5KE0A 1E9HA 3V6SA 4LMUA 5EW8A 1H0WA 3OY3A 3G0FA 4BCJA 3U6IA 1MUOA 1ZYCA 3QTIA 1R0EA 3ZDIA 3NZ0A 5KMNA 2XYNA 2W06A 4BTMA 3SDJA 4RIWB 5L6OA 3PIZA 4C8BA 4X3FC 1M7NA 5IQHA 1Z5MA 4L6QA 2QHNA 2A1AB 3H0YA 3SW7A 3WE8A 4B0GA 1OL6A 4EWHA 4C3RA 1JKSA 4D5KA 4U45A 4QMNA 4C35A 4EK3A 2YM3A 3I5NA 4FG8A 4CKRA 2UZLA 3ORPA 1WVWA 2V55A 3EZRA 4DFXE 3LM0A 5ANGA 4I92A 4FTJA 1H4LA 4OT5A 3WZDA 5JQ5A 4YSMA 5E7RA 3NAYA 4WT6A 3COHA 3OROA 2ITQA 2PUNA 1RQQA 3A62A 4TT7A 2CN5A 2IVTA 4OBOA 4BF2A 2OKRA 4FE2A 4BWKA 1U5RA 3AMBA 3RM6A 3P7BA 4QTBA 3R6XA 1IRKA 4DGGA 4QMUA 5IUGA 1PW2A 3Q9WA 1WBWA 3GP0A 3UOLA 2QC6A 3AGLA 1PMNA 3A4PA 2IW8A 1Q97A 4NW5A 4M84A 3LAUA 4FG7A 4OUCA 3HECA 5E8XA 2WTDA 4ASZA 5ITAA 3LMIA 3AT2A 4N6YA 3LFAA 4Y46A 4YPSA 2B52A 4ZEGA 4BYIA 2R0IA 3DKOA 1VR2A 2YCQA 1BMKA 1Y6AA 3E7OA 4DT8A 2W5AA 2VD5A 4IAAA 4A9TA 4CXAA 4IBMA 3VQHA 4QP8A 1F3MC 4FV0A 2ZM3A 3FZRA 5EM7A 4XG2A 2XIZA 2OF4A 2HY0A 4AOIA 4RT7A 2BMCA 3A60A 3KRWA 2IW6A 4RIXA 4HVGA 4PDPA 3R8VA 4APPA 3UDBA 2R3QA 2JBOA 4FOCA 1OKYA 5GJGA 4ZLOA 2O65A 2UW6A 2E9UA 2WTCA 1H1QA 1YHWA 2VU3A 2XK7A 2YITA 3G9NA 3ITZA 4JDHA 4FKLA 2OH0E 2GS6A 5CENA 5HLNA 4L9IA 3GOPA 4TZRA 4Z7HA 4XLVA 4ZSAA 2PZ5A 3TNWA 2WGJA 3PLAE 2W7XA 3EKNA 3MH3A 5I3RA 3Q2MA 4QNAA 3PY0A 1JAMA 3ATTA 4GCJA 2PE1A 4G5JA 4B99A 4O86A 5GINE 1NVSA 4BR3A 2HK5A 2ITTA 5KMIA 4FL1A 5AP1A 4JX3A 4P5QA 2X39A 5F9EA 3SRVB 3WBLA 3PVWA 5JGBA 2X7GA 5IDPA 1KV2A 1LEZA 4MQ2A 3DK7A 2XB7A 3M1SA 3GUBA 4O84A 1YI3A 2WAJA 3HP5A 3SVVA 1O9UA 1ZLTA 4BCNA 5J9YA 3I79A 1URWA 4Q2AA 3PZHA 3WF8A 3KCKA 2VNYA 4FYNA 1ZXEA 3ID6C 2PWLA 5JSMA 3KCFA 5E4HA 2I1MA 4L3JA 4CFXA 2FSTX 4MH7A 3QCQA 5ANOA 4FYOA 2BHEA 3RZFA 5EHOA 4MXXA 3U55A 3KMWA 3KXNA 3KXZA 4FSUA 4IFCA 5E8ZA 4BC6A 5I4NA 2FSOX 2IZTA 4IAFA 2A4LA 3C7QA 3CTHA 3RWPA 3S1HA 4F70A 4O0VA 3VBXA 2CN8A 5HNIX 2HW6A 2NPQA 2R5TA 3FLSA 4FKIA 4L01A 2W1IA 4J96A 2XIYA 3OWPA 2QNJA 3ZRKA 4PTCA 3P0MA 3ZH8A 4EL9A 1H8FA 2PVYA 3CXWA 4L68A 4WRSA 4XG7A 2O5KA 3PVGA 2I40A 2FSMX 3RK7A 3VN9A 4I1ZA 4KB8A 5DOSA 1Q8WA 4JAIA 3R8UA 5E8SA 1J1CA 4GVJA 3VHKA 5GZ8A 4FI1A 4KIQA 3UNJA 4I20A 1BX6A 5C8MA 1Q61A 1JVPP 4I0RA 3MFUA 4WHZA 4C4IA 3H9RA 3ULZA 1OPJA 4PV0A 4F6WA 2WELA 2OJJA 2QONA 3Q04A 3KRJA 3LFDA 3S3IA 1H01A 2PZYA 2R7IA 5CWZA 3D7TB 3BYUA 3QYWA 3OFMA 4CV8A 5DVRA 2O0UA 4BBFA 4FEXA 5DRBA 2RG5A 2OZAB 4IDTA 3GC9A 4FZ7A 2GCDA 4RIYA 3PIYA 4DTKA 3FMJA 3QQFA 4E4XA 3DU8A 4H1JA 1OKVA 1Y6BA 2VTQA 3HA6A 4QQCA 4WSQA 3TNPC 3PWDA 4AFJA 4AXAA 4BCQA 4ZY5A 3OUKA 3E92A 3UIXA 4FEWA 3GI3A 2PHKA 4LUEA 4YR8A 5CNOA 4E5BA 4WBBB 2H34A 3UYTA 3NYNA 2PVHA 2VV9A 4LOOA 3BHUA 5LVNA 4IFGA 3PY3A 4YJOA 4M0ZA 4UY9A 2XA4A 5BYYA 2C0TA 4NFMA 3SOAA 4Y95A 4AE9A 4CG9A 1YWRA 4P2KA 5IQEA 2C0IA 1PXIA 3F5XA 1XH9A 1CKPA 3DZQA 2VO0A 3VAPA 2VNWA 3HMOA 4X3JA 4CKIA 4E4MA 3O2MA 4LYNA 4X3FA 4CG8A 5LVMA 4U80A 2QOFA 3F2AA 1J7UA 5JMSA 2XK6A 2KULA 2JKMA 3F88A 4ZIMA 3GC0A 2JAMA 4JLCA 2ZV7A 5EOBA 4QMPA 4D5HA 3BI6A 5BNJA 5CEKA 1LPUA 4TYIA 3TZMA 4FIIA 4U6RA 3SG9A 4U41A 3RP9A 5HO8A 4JBVA 3LFCA 4MXCA 4RIWA 2UZEA 2ZJWA 3THBA 4FZDB 1Q8UA 5DYJA 3U54A 3JS2A 4U97A 3DFCB 3GCVA 4LQMA 3CKWA 1FVVA 2V5QA 4CFNA 4O6LA 5G6VA 4AWIA 2CNUA 4FEQA 5I9ZA 4Y8DA 5BX0A 4G3DA 4TPTA 1UU3A 5IISA 1WBNA 1YKRA 2JIUA 2OIDA 2XRWA 3KU2A 2JDSA 4FT3A 4GIHA 4F9CA 5CSPA 5EW9A 4DEAA 1FPUA 4L67A 3ZFXA 4UX9A 5M06A 5FGKA 3R01A 3I1AA 3EB0A 4MK0A 3TUBA 4OBQA 5AMNA 2UZOA 2UZWE 4D4VA 4L00A 3ZEPA 5KMLA 3W16A 4BCMA 5EDQA 5CT7A 5HGIA 3ZBXA 1X8BA 2JDVA 4MBJA 4Z9LA 3VW8A 4J97A 2QOIA 4YJPA 3W8QA 4D1ZA 4FODA 3GU4A 4V04A 3OS3A 2C6LA 3MSSA 1SVGA 2WO6A 2IZRA 2QLQA 2NP8A 3HYHA 1ZZ2A 2BAJA 5IG1A 3F3WA 4BY9E 3OW4A 4A4XA 2G01A 4F1OA 2YA9A 5AR3A 2CLQA 3BPRA 3GB2A 5GHVA 2X7FA 4O82A 1K2PA 3FI8A 3Q32A 3KY2A 4F7SA 2CSNA 2R3OA 1ZYLA 2RIOA 2BRBA 3OCBA 4JBPA 4X0MA 4FKOA 1NVRA 2C5OA 5AWMA 2FUMA 2W96B 4X2FA 3TEIA 2C1AA 2PL0A 4QMZA 3N4UA 2W05A 2YCRA 4QTAA 4X2GA 5CU4A 2GNLA 3P86A 4NK9A 5CQWA 4F7NA 4UXQA 2X2LA 3RI1A 2PVJA 1YDSE 4CT1A 4RWIA 2ZOQA 3B8QA 3FYKX 4TTHB 3ZSHA 2IO6A 1H26A 3HMNA 5ACKA 2PPQA 3EQRA 2PUIA 3AC4A 5DGZA 3DV3A 4BZNA 4O38A 4F65A 3BBWA 2F57A 2UZTA 4A9SA 2W17A 3JVRA 3NVKI 5ICPA 4FZFB 4GVAA 3P5KA 3AD5A 3MY1A 4BDGA 3PE1A 4DGMA 4N57A 4O0TA 3UODA 3R2BA 5CAOA 5AV0A 3H10A 3VIDA 4EUTA 2QLUA 3TG1A 3BLQA 2VWBA 3MDYA 2VWVA 4UZDA 4JRVA 4WNMA 4YHJA 5DIAA 4ZTLA 3Q9YA 3FYJX 5L8KA 4G5PA 5AP3A 3GENA 5EG3A 4DG2E 3KQ7A 5M4IA 3SRVA 2ZMCA 4DINA 4L8MA 4AQCA 4H3QA 2QI8A 4USEA 2WTVA 4F0IA 3GU6A 5IQCA 4JAJA 5DR9A 5AAGA 5C4KA 2BKZA 2ZV2A 4M12A 4EZ5A 4II5A 4NM0A 5L8LA 3FZPA 4WBOA 2IWIA 2JDRA 1M7QA 4NU1A 4BHNA 2QVSE 4FTKA 4YGAA 5H8GA 3FLWA 1DS5A 2WQBA 3JPVA 3KA0A 5HO6A 5EHYA 4FT7A 1H00A 3H9FA 4YNEA 2ZB1A 5DBXA 5LCJA 3PXYA 3F82A 5DT4A 3SA0A 3ORKA 5C9CA 4RZVA 3I7CA 4IACA 4K6ZA 3QFVA 4KD1A 3ZM4A 5CEPA 2QOQA 2UV2A 3R21A 3CGFA 4MD7E 4TYEA 4DLIA 5BYLA 4HYIA 4DA5A 4IX5A 2B7AA 2EXCX 2RF9A 3HLLA 4C4JA 1YVJA 5FQDC 5BVDA 3GXLA 3PRFA 4AZFA 3PXZA 4NWMA 2E2BA 3BHYA 3FL5A 3TXOA 2XVDA 4BBMA 5HTCA 1OM1A 3MVHA 4JQEA 4FKQA 5L2IA 1GZNA 3VWAA 1O6KA 2W4KA 4QO9A 4Q9ZA 5FEDA 3CIKA 4N70A 3RJCA 2OIQA 3G2FA 3UOHA 2QCSA 1J7LA 4IB0A 2Z60A 4LG4A 4PQNA 4EKLA 4U9AA 4ZJJA 2XH5A 3M2WA 2IZSA 3MFSA 4R7BA 3LXNA 4JG7A 1IASA 4OTGA 5DH3A 3R7IA 4U79A 4MCVA 3OD6X 2BTRA 4XV2A 5EI6A 5CTPA 4C33A 2I0HA 2WEIA 3AMYA 4WNPA 5IMXA 1XQZA 3QTQA 3G33A 2CKQA 1GIJA 3D7TA 4PMSA 1XR1A 1UKIA 3BQCA 3GU5A 4KRDA 5KHXA 3O71A 2OLCA 3NNVA 1W84A 3COIA 1XKKA 2OZAA 4NCTC 4O2ZA 4G6OA 5EI2A 5AV2A 3QWJA 4G3CA 5AM7A 4C2VA 2GNFA 4FNWA 4QTCA 4I6HA 2W5HA 4G3GA 4HJOA 4PWNA 1NT2A 1IAJA 3UO4A 5LCKA 2W1DA 3UNZA 3BYOA 5FXSA 4IWDA 2YAAA 3Q4UA 2R3HA 2XK9A 4RFYA 4W9WA 2ITPA 2KTYA 1MRYA 3NNXA 3NEWA 3QX4A 2JFMA 3SG8A 4NYEA 3F7WA 3FMNA 2ETMA 4GYIA 3C5UA 4O91A 4FSWA 4QQ5A 4AAAA 1LUFA 5CEOA 4KBCA 5CYIA 1GZKA 3U4UA 4O81A 4IM3A 4ASDA 3NYOA 1BLXA 3QQHA 4QMTA 1FGKA 5IEYA 5E8WA 3PY1A 3FWQA 3KGAA 3GCPA 3DOGA 2YIXA 3ORMA 4A4OA 5KNJA 3TKUA 3QD2B 2WTWA 2HIWA 4O7VA 3EN6A 3NNWA 4ANLA 3IW8A 4J71A 4AFEA 3OWLA 3SOCA 1WFCA 3RPSA 4BCPA 3TUCA 4P5ZA 4MD9E 4F9WA 2VTPA 4IQ6A 3O8TA 2JITA 4AGWA 2H9VA 3IG7A 3W32A 3LCKA 2QOLA 4ZS0A 4FEVA 2ESMA 3V8WA 2P4IA 2WFYA 1W8CA 1T46A 3B8RA 5HZNA 4XBUA 2EWAA 3Q6UA 2B53A 4AOJA 3QRKA 4FC0A 4LV8A 4PTGA 4MEDA 2VTAA 2WMQA 3ELJA 2RFEA 4I5CA 2XKEA 5KMJA 2YDKA 5K0KA 3ZUUA 2OSCA 3QUEA 5JFXA 2IG7A 4L3LA 4DCAA 1J3HA 3MS9A 3QLFA 3FKLA 4DGOA 1UU8A 3CQWA 4O21A 3LMGA 3EQFA 3ZC6A 3SKCA 2FH9A 2YIRA 1H08A 2YLEA 2X1NA 5JFWA 2HAKA 5HNBA 2F4JA 2GTNA 2WU6A 3A61A 3QL8A 3DXQA 2HYYA 2XNMA 3FEGA 5IQDA 5GZ9A 3W55A 3GQLA 4TWNA 4AX8A 2A27A 1YHSA 1CKJA 4R3RA 3C0HA 3Q52A 4WUNA 4D2TA 4AN9A 4DFNA 5D11A 3CCNA 3D5XA 3R22A 3F5GA 2HWOA 2YAKA 3BYSA 4RGJA 3OXIA 1VJYA 2BIKB 2W99B 3BU6A 4GFMA 3KREA 4R1VA 2YM8A 5AP5A 1M2PA 4EYMA 4O7TA 5EQPA 3Q4TA 5C26A 2OXYA 4BCIA 3QRUA 3R9NA 4D0XA 2NNWB 1I44A 4FSTA 4M67A 4JG6A 1QPJA 4EH6A 1WZYA 5EM6A 5HORA 2GTMA 4K8AA 3NIEA 1IAHA 4RWLA 2RFSA 4JQ8A 2UUEA 4BDBA 5J87A 3RK9A 3RPVA 2W1CA 4YO4A 2W1ZA 4GL9A 4ORKA 2P2IA 3LPBA 2JKQA 2VX3A 1H07A 3NW7A 4O7RA 2YACA 4RWKA 2VWZA 2X0GA 4W9XA 3ZS5A 2YJRA 4LI5A 2QOHA 4GRBA 5HCXA 3GFWA 3C13A 1H1PA 3DKFA 3ORIA 3QA0A 3IKAA 2PVKA 4D2WA 2V22A 4EJNA 3HVCA 2BZHB 3DS6A 4WD5A 4YZ9A 3NYVA 2GNHA 3QUDA 5EYDA 3A7FA 4MQ1A 4JG8A 4ZTMA 1M14A 4EH2A 4YSJA 3RGFA 1WBOA 2QODA 3OXTA 2R3MA 4FIJA 2LGCA 3OXZA 4Y72A 3PTGA 2QKWB 2YIYA 1PXKA 4BCGA 4FEUA 1HCLA 3FLYA 3HV5A 4KKEA 4Y85A 3LLAA 3PIXA 3PSCA 3R7GA 3NAXA 3K3JA 2X81A 4S2ZA 3QKMA 4C59A 1FVRA 4E6AA 3ETAA 5EI8A 3ZBFA 3NCZA 3DAJA 3SXSA 3VS1A 3BGQA 5E1SA 4IAYA 1OKZA 3ZLXA 3OCSA 3EOCA 4XMOA 4RVMA 3K2LA 4H39A 2PVMA 5E8YA 2QOOA 3MPMA 3PVUA 3PP1A 5HEZA 2W5BA 2C6DA 1GJOA 5AUTA 3GBZA 2QU5A 3CS9A 4AW5A 4EH3A 2WNTA 3GU7A 5ACBC 4PNKA 2I0YA 4QMMA 2PTKA 4O22A 3TV4A 5HICA 1QPDA 2QD9A 3QKLA 5EQEA 5L2SA 1YXUA 2X6EA 1JQHA 3GVUA 4N0SA 3COMA 3S4QA 4CNHA 3JR1A 2WMVA 5HIDA 5H8EA 3D9VA 3EQDA 4R78A 1UWHA 2WHBA 4YLJA 3TUDA 5JFVA 4JR7A 2GHMA 3RKBA 4CZTA 3AMAA 4GYGA 3IECA 3IOPA 4RJ6A 4TW9A 1GZOA 1CM8A 4RPVA 2JKOA 1GIHA 1A06A 3MH1A 3FQEA 4OTRA 4J53A 4RA5A 3IW6A 4NCTA 4XJ0A 4PNIA 4GW8A 5HHWA 5D9HA 3QHRA 3D4QA 2JBPA 4GH2A 4C61A 3UVRA 4RG0A 1E1VA 4O0XA 5CQUA 5DPVA 2PMOX 3DCVA 3EYGA 3ANRA 4LM5A 2R3NA 1YOJA 5CSHA 3HNGA 3Q9ZA 4BDJA 3QZGA 4FVQA 2XS0A 4IC7A 3HAVA 2WMTA 1V1KA 3SLSA 3V51A 4CYJA 4C38A 5CLPA 3W2PA 4EH5A 3ERKA 5BYZA 4DTAA 4A9YA 4HVDA 4UYNA 1ERKA 1YHVA 5M55A 4RC3A 4W4XA 5A6NA 3F69A 3R1SA 3LFQA 4JDKA 5KBRA 3QQKA 3A7GA 4IMYA 1PXOA 3MVJA 4G34A 2PVRA 2W1HA 3IW4A 4L45A 2F7EE 4YHTA 4PPAA 4D9TA 4FTIA 4PPBA 3F3ZA 5EYCA 5DT3A 4HYUA 2JEDA 3RM7A 2F7XE 3TZ8A 1UNLA 2R3JA 4OGRA 4QQTA 1AD5A 3ZO1A 4Q9SA 3MTLA 2C6KA 5KZIA 3EFKA 4FVPA 2A0CX 4I6FA 4EBVA 2AUHA 3ZFYA 4BDDA 5CXZA 1YRPA 3V5LA 3E8DA 4I21A 4DFUA 3QF9A 3QQUA 1KOAA 3CD8A 4QPMA 4BRXA 5CASA 2BVAA 3ROCA 2BDFA 5F94A 3O17A 5IQFA 1ZARA 2PMIA 4OAVB 3HL7A 4FKUA 5J9LA 1H28A 2HELA 4FUXA 2EVAA 2X9EA 5H9BA 3FMHA 4YO6A 5ETAA 3CTQA 2R64A
chains in the Genus database with same CATH superfamily
2PK9A 1Q62A 4U5JA 2PULA 5B2MA 4EQMA 2XBAA 2BTSA 2BR1A 3F5UA 4UB7A 5L2QA 2ITXA 4WSYA 4QD6A 2PUUA 3A7IA 3GNIB 4FSMA 3WI6A 3H9OA 1Q99A 5IZFA 1XO2B 2BRGA 4W4YA 3ZYAA 4BBEA 4YC6A 1H25A 2B9FA 4IZ7A 3VUGA 3I7BA 3QC9A 4ZY4A 2R3PA 5JEBA 4F08A 3Q2JA 1ZOGA 4NTTA 5CVFA 4O6EA 3EN7A 4JMQA 4QMSA 4RQVA 2PYWA 2G2FA 2QR8A 2R3LA 3BGPA 3DAKA 5HVKA 4D2PA 2UVYA 1MRUA 3BV2A 3GCQA 3BZ3A 2WD1A 4H3PA 4U7ZA 2QURA 3G6GA 4F6UA 2I0VA 2GHGA 4O0SA 3IW7A 4GKIA 1H1WA 4YNOA 1TZDA 5A6OA 3D2IA 3HV6A 4EOQA 3V5WA 3CLYA 1XBBA 3DA6A 2J6MA 2BZJA 2R3KA 4MF1A 2X0PA 2ZV9A 3PUPA 5C1QB 5DHJA 4ZTHA 3OT3A 2JFLA 1OBDA 2HXQA 2E9NA 4TRLA 1NA7A 5DEYA 4QNYA 4LV5A 3DLSA 3O0GA 4E7WA 2O8YA 4ZTNA 3NWWA 4S32A 1FBNA 4ONAA 5CU6A 4FRFA 1IEPA 4BFMA 2HZ4A 2WZJA 4WG3A 3CTJA 3NS9A 4HOKA 4CTCA 1YDRE 3DAEA 3CJFA 5L8JA 5BVKA 4D1XA 3PYYA 2W1GA 4FSNA 4GMYA 3KVWA 3DDPA 5FLFA 4KABA 3TTIA 5A9UA 3FE3A 4AA5A 3EQBA 3C4FA 5JKGA 4ENXA 4FX3A 2Y6MA 2B9JA 3ET7A 4CLJA 5KMKA 3UQCA 1W2FA 4RVKA 3SW4A 2GMXA 2B54A 2WMUA 3A8WA 4UN0C 4PRJA 2VTLA 5HE3A 3JVSA 5FRIA 2OZOA 3OCGA 4D2VA 2OF2A 3L8VA 3EWHA 3VUMA 2PU8A 2ITOA 5C8KA 2BILB 1OECA 5ANEA 3EL7A 4YBKA 4GJ2A 3V5PA 2AC5A 3VUKA 4DH5A 4ITHA 1H0VA 3AOXA 4FTMA 4MXZA 4OTHA 3F3TA 4FSRA 4K18A 4XV1A 5AR7A 4RJ5A 3NMUF 2VRXA 5ANIA 5T3QA 3UC3A 3G90X 4IWPA 1YXSA 3FPQA 3UOKA 1OITA 1J7IA 5E1EA 4BCOA 2PMNX 4BI2A 1H1SA 3LLTA 3ZUTA 3WZJA 3EKKA 3UMWA 2V62A 4I23A 5AR5A 2HZIA 4FTCA 4PL3A 3TCPA 3V04A 5DRDA 1LR4A 1Y8YA 4E4NA 2V0DA 4S31A 4IVBA 3DBQA 1SYKA 3R71A 4FV9A 3FLNC 1L8TA 3MJ1A 3GC7A 3AXWA 4ANBA 4CFFA 1FINA 4ACMA 3EN9A 2C4GA 3UTOA 2UVXA 4RRVA 5FM3A 1GAGA 4DH3A 4ZTRA 3GC8A 5B2LA 2BCJA 3CTQA 4ZK5A 4HPTE 5C27A 5IDNA 3ZCLA 2V7OA 2YM6A 3QCSA 3QTXA 4G1WA 4NM5A 4LL0A 4TN6A 1G8AA 4M13A 3OBGA 4B7TA 3O8UA 1TQMA 2CJMA 3LXPA 3UVQA 4KRCA 3BL7A 1MQBA 2JAVA 4XX9A 3ZFMA 5TKDA 3JY9A 3H3CA 3QQGA 3Q4CA 4NKSA 4LGDA 3V8SA 3G51A 4DGNA 2QKRA 4AW1A 1XH6A 2J5EA 3KMMA 4RJ4A 1XH8A 1VYWA 4EHZA 3CD3A 3JXWA 1BL6A 3BLRA 3NUPA 4RVTA 4BIEA 1CKIA 1R1WA 3HX4A 4HW7A 3NW5A 2A98A 3DLZA 3KN6A 3L1SA 3CP9A 2UW7A 3P7CA 2QG5A 1M52A 3JYAA 4O1OA 1GOLA 2C1BA 5TF9A 4C4HA 4RJ8A 4DG3E 5CAVA 2XCHA 2HZNA 4RX8A 3ZXZA 3SHEA 2G15A 3NYXA 1CTPE 3U9NA 2WTKB 2P0CA 3LFFA 3KRXA 1F0QA 1JSVA 2G1TA 3MB7A 1BUHA 2WKMA 5D41A 5HE1A 4YTCA 4AOTA 2X8IA 2HOGA 4NFNA 3ZTXA 4GT5A 2CGWA 5AIRA 5L6PA 4I6LA 4KBKA 1AQ1A 3PG3A 3RPYA 1SVEA 3HRBA 3NCGA 1DM2A 3CC6A 4ZSGA 5AA8A 2OI4X 1SMHA 5B0XA 1PKGA 3VO3A 2WTKC 3EYHA 5HVJA 3ZOSA 3MVMA 3D5UA 3QRJA 3QCYA 3UZPA 2VX1A 3HMMA 4FKPA 2C5XA 2JKKA 4W8DA 3LXKA 3PXRA 4J98A 3BRBA 3RCJA 3NUXA 4A9UA 4FICA 5JZNA 4FL2A 2RFDA 4HGEA 1REJA 2NYAA 4RC4A 2XARA 2Z7QA 3PVBA 4GUBA 4ENYA 3CJGA 4UALA 2UZUE 5DN3A 4TYJA 4WO5A 4XH6A 1PHKA 4F9BA 5HTBA 3FKOA 4E3CA 4IM2A 4OLIA 3P1AA 4DHFA 3MESA 3DPKA 1IA8A 5IA4A 2BPMA 4MWHA 3EFJA 5LMAA 3EQPA 4AG8A 4BIBA 4CFUA 1A9UA 2XKCA 3OCTA 4FIFA 4IEBA 2OJ9A 4CKJA 3U6JA 3FMEA 4RLLA 5DLSA 2QQ7A 3VQUA 4GK2A 2PMLX 4BGGA 5J1WA 3D5WA 2C3KA 3HMIA 2UW8A 3UG1A 4AZTA 3I60A 4FIEA 1CDKA 4U44A 3Q96A 4ACCA 4EOPA 3MIAA 4QOXA 2PVFA 1PMEA 5JGDA 1P4FA 3RCDA 5CALA 3EIDA 5HD4A 3P78A 5EM5A 4OTQA 4FV4A 3S00A 4XP0A 3ZHPC 5E8UA 5AUZA 4AZWA 4XYFA 5F95A 2GQRA 2JIVA 3KKVA 1ZWSA 3E8CA 1Z57A 3R0TA 2C0OA 1XHAA 1PKDA 2Y4IB 5HCZA 3F2RA 5B2KA 4R6VA 4I0TA 5EHLA 3GU8A 5JFSA 5I9XA 3T3UA 4L46A 4YLKA 4YMJA 5CS6A 5DA3A 4Q5EA 3DKGA 4BKZA 2WMWA 4U42A 3ACJA 4V0GB 4OTIA 4J95A 3UPZA 3D5VA 2PSQA 2Y4IC 4P7EA 1APME 2YLFA 3EL8A 2ZDTA 4U0IA 2ETKA 2C68A 1IA9A 5KUPA 3IS5A 1Y91A 4AE6A 3R8LA 5EKOA 4O0YA 3PWYA 2VX0A 2Q0NA 2CPKE 2OG8A 4RSSA 3Q60A 2HW7A 1OIUA 1KV1A 2AYPA 3REPA 3ZDUA 3E93A 4N4SA 3MYGA 4XG4A 2O2UA 3FPMA 3HKOA 4JT3A 2XM9A 4BDFA 3TJCA 5IA0A 5DI1A 3C4WA 5JT2A 4JI9A 5AADA 2R0UA 4C4EA 5HESA 2WU7A 2VWYA 4YUQA 2VTRA 4FSZA 4BWXA 5J7BA 4J52A 1FGIA 2UZBA 3ZC5A 2ITZA 2J90A 3VNTA 4GT4A 4JS8A 1Q24A 2YDJA 1MRVA 2REIA 5D12A 3VJNA 2GU8A 2Y9QA 3D15A 4JNWA 2F49A 4GS6A 3S0OA 3NVMB 3W0NA 4AXEA 1M17A 1W82A 4GG5A 2GFCA 5A54A 3AD4A 5FBOA 3ORLA 3ENMA 4K77A 5HI2A 4FTQA 4CTBA 5GZAA 4EJ7A 2WOUA 5GNKA 2EUFB 3I4BA 3TZ7A 1O6LA 4AF3A 4NW6A 4M0YA 4U8ZA 3I81A 3CY3A 1WVYA 3DNEA 4DEGA 3ZMMA 1UA2A 4ACHA 5K0XA 2B0QA 3MVLA 2YISA 2CKPA 4E26A 1OPLA 4OTWA 3TNIA 1GNGA 4YU2A 3TM0A 4OR5A 3FY0A 3R83A 5J7HA 4JIKA 3ZSIA 3OT8A 4YJQA 4KNBA 4GU6A 3UG2A 3HRCA 4C3FA 2OH4A 2XALA 5IH6A 5K4JA 4E8AA 5FDPA 3CPBA 2XK4A 3ZRLA 5M53A 2RFNA 5BVEA 4BYJA 3OVVA 5HNGA 3HMPA 4CSVA 2OFUA 4CQGA 5LMKC 1YQJA 2X4ZA 2WMBA 3U4WA 4EHEA 4CRLA 3F3VA 3QKKA 4LRMA 4O27B 3N9XA 4ASXA 4QDVA 3Q3BA 2IN6A 4DYMA 3Q4ZA 4Z3VA 2B4SB 3PSDA 2XNGA 5IMEA 4W4VA 4AA0A 1GIIA 4XG8A 2C3LA 5DMZA 2OBJA 3CQUA 4WIHA 3MGYA 2FO0A 4NSTA 4PPCA 3UO6A 4E73A 1GY3A 1Q8TA 4AT3A 4A9RA 4NTSA 3G5DA 3D0EA 4MKCA 4KA3A 5M4FA 1NW1A 4PMMA 3MV5A 4YHFA 4G3FA 4ALUA 4CCUA 2OU7A 3W0SA 3KF4A 5CEIA 1XBCA 4YZMA 4QTEA 4YTFA 5HG8A 2X0QA 3C9WA 3GT8A 3KK9A 4FSYA 4JX7A 4QTDA 4AZVA 2W4OA 5EDRA 2X7OA 2VN9A 4M3QA 2GQGA 3QYZA 3ACKA 3N4VA 3QD4A 4UEUA 4CRSA 4GIIA 4ZSEA 4N6ZA 2B9HA 4ITIA 1S9IA 2GHLA 2QR7A 3CKXA 3FKNA 4QMXA 4B9DA 3W1FA 1KE7A 5BVFA 2WMAA 4MTAA 4FOBA 3MIYA 4BCHA 3JY0A 2ZAZA 4KBAA 3GGFA 3ZSGA 4F1TA 4QP6A 4Y5HA 3WILA 4RQKA 4EHVA 3EQIA 4EK5A 1QL6A 2R3FA 3K3IA 4ID7A 3FMKA 3FY2A 4XEYA 2BZKB 5HOAA 3VS2A 5HIEA 3QX2A 4AXDA 1OKWA 2YN8A 3CPCA 4IX4A 3QTZA 1B39A 1R0PA 3C51A 2VTJA 3BGZA 3CR0A 3EMGA 4IVCA 2GPHA 3HRFA 4H36A 4QMVA 3LZBA 3R7EA 4BTJA 5FEEA 4DTBA 2OXDA 3PRIA 3L9LA 3HV3A 4QP9A 2I6LA 2NRUA 3KVXA 3ODYX 3R04A 4RJ7A 4EC9A 4EZ3A 4UXLA 1UV5A 4ZZMA 4A07A 5BMSA 2C5VA 5BQ0A 1WBSA 1SNXA 1WBVA 3HA8A 4I22A 5IA2A 1ST0A 3ULIA 1HOWA 2BUJA 3QC4A 3WIKA 1IG1A 5DR6A 4CFMA 4DLJA 3RNYA 3O8PA 2PE0A 3H30A 4ARKA 2H6DA 2Q83A 1H1RA 4D1SA 3MFTA 2QHMA 3QA8A 4CV9A 2RG6A 3MPAA 4HVHA 3W0PA 4NIFA 4EH8A 5KKRC 3V5QA 2HXLA 1Q5KA 2VAGA 2XRUA 4GEOA 2XZSA 2YDIA 2F9GA 3O51A 5C4LA 4XRJA 5HBJA 4MBIA 5H2UA 3KK8A 1TKIA 1UU7A 2C6TA 4FT0A 3BE2A 4YPDA 3R8PA 2Y0AA 5CEQA 5TR6A 2X8DA 5K5NA 3DTWA 4YZBA 4BIDA 4AZSA 1WMKA 3WYXA 4UMRA 2WPAA 4JOAA 4AZEA 5DG5A 3UIBA 4ANNA 3ZLSA 3BLAA 5E90A 4IDVA 1KE9A 3QAME 3VUTA 2CDZA 2EU9A 4DBXA 3D83A 2XKFA 3GEQA 1P5EA 4EH4A 5CEMA 2B1PA 2ITWA 2VO6A 1YI4A 2QU6A 5FP6A 3TZ9A 4C4FA 1ZMUA 2UW0A 2FYSA 3F2NA 4FL3A 3FZOA 4ACDA 3EHAA 2WTIA 1UNHA 3TI1A 3BELA 1CMKE 4S33A 3TV7A 4ANQA 4BN1A 5FD2A 3F9NA 4GK3A 5JQ8A 5AEPA 5ANKA 1YXVA 3PA4A 4XNEA 4QMWA 2C5YA 5DR2A 3VC4A 4I41A 3FJQE 1PYXA 4KS8A 2JIIA 3IK3A 4QYEA 3OWJA 3ZEWA 1SVHA 2RL5A 4D55A 3VVHA 4X2KA 3S95A 3PP0A 3LJ2A 2YM5A 3I6WA 2QO9A 4W8EA 3GOKA 2ERZE 3KRLA 4X6RA 4BCKA 4BGQA 3IO7A 3QD0A 4C02A 4XCUA 4D28A 4DCEA 5BUJA 4YTHA 5CAPA 5HLWA 3WZUA 1T45A 2EXMA 4G9CA 4K2RA 3PUFC 3LFEA 4V0GA 4H3BA 3P23A 3ZZEA 4XHKB 2PZIA 1P2AA 2VWXA 4I0SA 4D4SA 3DJ6A 3PJCA 2HENA 4L52A 3QTWA 4MAOA 4UZHA 3VJOA 3NUSA 1EH4A 4G31A 4ZSJA 4QT1A 5J8IA 4UWYA 4AACA 3PG1A 5CSWA 2VTHA 2X8EA 3FAAA 3BQRA 4EOOA 4KAOA 5CSXA 2CCIA 5A46A 5L3AA 2XNEA 4RC2A 2W1FA 4FV7A 5AJQA 3AC1A 2YJSA 4PP9A 2F2UA 3FHRA 4QYYA 4CMUA 3BU5A 4GV1A 4O96A 3UMXA 2ITUA 2WQNA 4R5SA 3K5UA 4NKAA 3ORTA 3VS0A 4B8MA 5JGAA 1Y57A 3HDMA 4ITJA 3G9LX 4D2SA 1JSUA 3UC4A 4EK8A 3U87A 2UW4A 3R02A 4F0FA 5AAEA 3ODZX 4O83A 3GCSA 4IM0A 3KRRA 4FKTA 3D14A 3C4XA 3RVGA 2VTNA 4FTTA 3MW1A 3PA3A 3BL9A 1JLUE 1UU9A 4HNFA 5ETIA 4ZLYA 2DWBA 3U51A 5AA9A 2FSLX 5CU0A 3QQJA 3HUCA 2P3GX 5CZHA 3BWFA 3R63A 4IADA 2JC6A 4OTFA 3LHJA 5HCYA 3WYYA 4E1ZA 4ZS4A 3C4EA 5H3QA 2YFXA 5BPYA 5J95A 5LMKA 5LOHA 4EQUA 2GSFA 4DFYA 1PXJA 3IQ7A 1OL1A 2C3JA 2Z2WA 4F6SA 2VTOA 1OL5A 3WZEA 1KE6A 5FTOA 3NUAA 2WIHA 1ZZLA 4M69A 4X21A 5AUVA 2UZVA 4ZJVA 3OHTA 3PPJA 3QALE 4FZ6A 2YZLA 4QP1A 1OGUA 3FC2A 3KC3A 4TXCA 4U3ZA 4EQCA 5KX8A 2RGPA 5HG7A 4QPAA 3UP7A 4E6CA 4HVSA 1G5SA 2F2CB 2C6IA 4IH8A 3SQQA 4IVDA 3L9NA 4P90A 3RAWA 4WOVA 4ZMEA 3QUPA 1DAWA 4LFIA 2BRHA 4A06A 2CCHA 3CSVA 3DQXA 2XIXA 2Z7RA 2LAVA 3PDTA 1U5QA 2WEVA 5KHWA 2GNJA 2YEXA 4X2JA 2PZRA 4E6DA 3QHWA 5LQFA 5GIOE 5EYMA 5DE2A 3P08A 4EOSA 4ZMFA 2R3IA 5M4UA 1Z9XA 1O6YA 3AT3A 4FKWA 5AUUA 1XMLA 1FQ1B 1RW8A 4FUYA 4USDA 2J0MB 2NRYA 3PJ3A 3CEKA 1UVRA 4RIOA 4TWCA 2VGOA 2P55A 3OBJA 4C62A 4NUSA 5A4CA 3R73A 3MN3A 5JRQA 5LMBA 3P79A 4YJRA 1OL7A 3F61A 4FNYA 4J1RA 4NH1A 4XBRA 4ALVA 3RINA 2BKKA 4AAYA 1Q41A 2IZUA 3PLSA 1BI7A 4MD8E 3ZO3A 3V3VA 4LL5A 2XNOA 4K11A 4UYAA 3TKHA 4S30A 5KCVA 3WIGA 4JBOA 3IONA 4GT3A 2CKEA 3D2KA 3R1QA 2Y6OA 5C01A 3SX9A 3W10A 5LVOA 2E9OA 2ZM1A 2ACXA 4BDCA 4NZWB 2R7BA 2UVZA 4S34A 2JDTA 3QRIA 4G3EA 3PZEA 5AP0A 4YZDA 1YI6A 4FT9A 5CI6A 3C5IA 5CAQA 3EFWA 3BCEA 3TL8A 3UBDA 1QMZA 2VTIA 4R5YA 3DXNA 2OJFE 4J8MA 4PMTA 4XP2A 3RPOA 5HQ0A 5LXMA 4TY1A 2R2PA 2ZVAA 4HGLA 3C4CA 3ZZWA 3LOKA 4DHJA 4BDKA 3PFQA 1VLRA 4O0WA 3OF0A 1W7HA 5HG9A 4PDOA 5L6WL 1H24A 4AT5A 2FGIA 3LFNA 2P33A 4FNXA 4EH7A 1GZ8A 1V0PA 3MTFA 2FA2A 3MI9A 5TO8A 4QMQA 4DH7A 4G6NA 4FIHA 1KOBA 3FXWA 2UW3A 4HCUA 4DEDA 5JZJA 4D9UA 3ROYA 5AV1A 1B6CB 5CZIA 4CCBA 2Y8OA 4QYFA 4KINA 2CGVA 3CQEA 2YCSA 3VUIA 2XK3A 4XG9A 1URCA 5AR4A 2CMWA 4U81A 3RK5A 3OC1A 4TWPA 3LE6A 3R8MA 3VBVA 4E5WA 1BL7A 4KKGA 3AC5A 3MH2A 4U3YA 1YDTE 3G15A 5I9YA 4RMZA 4YLLA 3QTRA 4KSPA 2X6DA 4RLKA 3O50A 3W33A 5IA3A 2CHLA 2C6OA 3FC1X 3OUNB 3R00A 3A2CA 3WF9A 2J5FA 4R7IA 5M08A 1PXPA 3RHKA 2GNGA 3NDMA 5F4NA 3MBLA 1OBGA 2BRNA 3KXGA 3BEGA 4RZWA 5TE0A 4FKSA 4LOPA 3T9TA 3CY2A 3OTVA 4AUAA 4FV1A 4YJVA 3EFLA 4L44A 3EH9A 5FXRA 3TT0A 4FTAA 4BTFA 2RKUA 4ZAUA 3QGYA 5FTGA 4EYJA 5IQBA 5AP2A 4KWPA 3II5A 4FTRA 4F0GA 3SXFA 4P4CA 5CI7A 1V0BA 4FT5A 5IQAA 2W4JA 3QBNA 3I0OA 1OB3A 4I24A 1LEWA 4B4LA 5D10A 5AP4A 4DH1A 4FSQA 1TQIA 2XNBA 3DGKA 3I0QA 4IIRA 3WF6A 3ENHA 5L2WA 2WOTA 5FG8A 3PPZA 5D7VA 4C0TA 2YWVA 3TDWA 3WF5A 3VBWA 1WCCA 3E3PA 4QYHA 3W0OA 5CU2A 4CMOA 5J5TA 1VZOA 4XRLA 1L3RE 4BDIA 4FR4A 4FTUA 4QYGA 1XJDA 4WKQA 3QTUA 1U4DA 3NUNA 3OOMA 1ZYJA 1OMWA 1OZ1A 4EOJA 2WQOA 3F3UA 3QQLA 5BMMA 2XJ0A 4IAZA 1QPCA 4LDTA 4CGAA 3OZ6A 4PF4A 2XUUA 3R9OA 3W18A 2XP2A 4C37A 4KIKB 4F09A 4B6LA 1ZY4A 3HGKA 3TACA 4JBQA 4O2PA 3O7LB 3OWKA 5JRSA 1BYGA 4LRJA 3AG9A 1E1XA 1WBTA 3R1YA 4FV5A 4G9RA 5F20A 3B2WA 3UYSA 4ERKA 1ZMVA 4EI4A 1DI9A 2BALA 4FKRA 3W2SA 1LP4A 4WG5A 4Y83A 4Z55A 5E9EA 2ONLC 1KE8A 2HCKA 3DJ7A 3ZO4A 1G8KA 5DNRA 4OAUC 2F7ZE 3EZVA 4G17A 4AW0A 5K4IA 4BL1A 1M2RA 4NEUA 5E8VA 4B8LA 4E20A 5J79A 5LARA 2C6EA 5JH6A 2OWBA 4MVFA 2C3IB 2C69A 4HGTA 4CZYB 1P14A 4MXYA 1BKXA 1AGWA 4OBPA 4TNBA 4I5PA 4UMQA 4EUUA 5BVNA 4E93A 4UV0A 3DJ5A 1G8SA 4O0UA 4A4LA 5IH4A 2ZB0A 4FTNA 1Q3DA 3UZRA 3OW3A 3FLQA 2W0JA 4FNZA 4FA2A 4YJSA 2ITVA 4BHZA 4XS2A 5L2TA 3O7LD 4DFLA 1MP8A 3C0GA 3QXPA 4AU8A 2J51A 3IGGA 4IANA 3OG7A 3N51A 4HCTA 5AFVA 5ANDA 1K3AA 2VWWA 4AGDA 3W2OA 4EORA 4GKHA 4LOQA 3NW6A 4OT6A 5CX9A 1MQ4A 5TT7A 4OW8A 2J4ZA 4O7LA 1UKHA 2O64A 3E87A 5HKMA 1ATPE 4UMTA 5CVGA 2GS2A 5A3XA 2OIBA 2B55A 5EFQA 3UQFA 2PY3A 3T9IA 4EWQA 2Q0BA 2CKOA 4BDAA 2BRMA 4M15A 3R28A 2JGZA 3LQ5A 1JPAA 3EQHA 3DBEA 5FDXA 1KE5A 4ZTSA 3EQGA 3OTUA 5FP5A 3IDPA 5I9UA 4I4EA 2Y7JA 4YJUA 4PL4A 4GK4A 4HVIA 5A14A 4C2WA 3NUYA 4EONA 3R30A 5K3YA 4FG9A 2EB3A 2OFVA 2CGUA 4C58A 3FQHA 3E7VA 2VTMA 1S9JA 3G0EA 3POZA 4R7HA 3FL4A 3JUHA 1RJBA 3R7VA 5A4LA 3NLBA 4GFOA 4YC8A 4F9AA 4DAWA 4I94A 4QDEA 3Q5ZA 3BIZA 1PJKA 2VGPA 3RALA 2V7AA 2XM8A 1XH5A 4U40A 4K33A 2W9ZB 4TYHB 2B9IA 4CQEA 4EHGA 3RWQA 2R3RA 2ETRA 3DDQA 5EK7A 1DAYA 5CSVA 4FV8A 4M7IA 1Q8YA 4ZLZA 4UMPA 5AP7A 4AGUA 3RPRA 5CT0A 4NIFB 2Y4PA 4YURA 2XNNA 4M97A 4QQJA 2HY81 4DT9A 3RNIA 3BV3A 1H27A 1WAKA 4MF0A 3CE3A 4ACGA 3WE4A 5A4QA 1UWJA 2IPXA 3LM5A 4AN3A 1A48A 1OIYA 4XOZA 5DWRA 4R8QA 3ZO2A 2R3GA 1YXTA 4C34A 1REKA 4CFVA 2X2KA 1SZMA 1QCFA 4YZNA 5G1XA 1J1BA 1R78A 3FMMA 3IW5A 3ORXA 4MBLA 1PXMA 3DB6A 1YWNA 4NJDA 3V8TA 2J7TA 1PF8A 3LFSA 3P9JA 4AQKA 4ZY6A 4FK3A 5AAFA 5LVPA 4J99A 3LJ0A 5CXHA 4IJPA 3OOGA 3FBVA 5I0BA 3R9DA 3UE4A 5CY3A 4ZXTA 2J0IA 3FXZA 5AR2A 3FI4A 3ATSA 4EBWA 1U54A 3AC2A 3FXXA 4PTEA 3TJDA 4I6BA 4UWBA 1YWVA 3K5VA 3NIZA 3IPHA 2PUPA 2XJ1A 2XK8A 2XIRA 3DBDA 4IB1A 5AX9A 5T6KA 2WXVA 3VS4A 4CD0A 4CMTA 3TMOA 1SNUA 3ZLYA 4MHAA 4MXOA 4IHPA 4M8TA 4IX3A 4UMUA 3KFAA 2GDOA 4D58A 2ERKA 2CLXA 4R1YA 3DFAA 5HX6A 1K9AA 2XNPA 3L9PA 3AQVA 4F63A 3R8ZA 4EK4A 3U8WA 3ZONA 3UQGA 4BDHA 3BHTA 5CF5A 3F5PA 4L42A 2GQSA 2OW3A 4CYIA 3LQ8A 3E63A 5KMOA 3FI3A 4JRNA 3F7ZA 4IZYA 5HBEA 4Q5HA 4FV2A 3POOA 4QP4A 5J5SA 2ZM4A 3MA6A 3AT4A 4O1PA 4K9YA 4AA4A 4RVLA 5F1ZA 3O23A 3NGAA 4IJ9A 5E92A 5EDPA 4AW2A 5IQGA 3V6RA 4ZOGA 3R7OA 3R2YA 4BKJA 1U46A 2HWPA 3LKMA 4DDGA 5ETFA 2QOCA 1R3CA 4FIGA 4KKHA 3AGMA 3Q5IA 5K5XA 4LV7A 4I3ZA 1PRYA 1UNGA 3M11A 4M66A 2WQMA 1ZY5A 2BZIB 2W9FB 3R7UA 2BFYA 2YWPA 5FM2A 2DS1A 4QMYA 2DYLA 4L53A 1W2CA 5EH0A 4F64A 2C6MA 3UOJA 2OJIA 5BVOA 4KIKA 3LQ3A 2A2AA 5J9ZA 5IQIA 4GU9A 2ONLA 3TDVA 4JQ7A 3TIYA 3VRYA 4AN2A 3SXRA 5HTIA 1I09A 4RBLA 2UW5A 5BUIA 4I6QA 3BKBA 4J7BA 3NPCA 4FGRA 5I9WA 2WMXA 2QG7A 1VYZA 3GFEA 3GQIA 4DC2A 4O7NA 4GJ3A 4O7ZA 3W0RA 3HDNA 1R39A 4C3PA 3NNUA 4DEEA 5IUHA 3W2CA 5J1VA 5E8TA 4EOKA 2C47A 3TN8A 4YTIA 3VBTA 5HX8A 5FUTA 4RA4A 4U43A 3L8SA 2PVLA 5IH5A 4K0YA 3PXKA 4XP3A 3ORNA 3UIUA 3O96A 3PJ1A 4JJRA 4YC3A 3P5JC 3MJ2A 2A19B 3A8XA 2O3PA 4APCA 3ALOA 2C5NA 4H58A 4M69B 4EKKA 3KEXA 2GS7A 2J50A 3MPTA 5AUYA 4HZSA 1NVQA 2BDWA 3SC1A 3ZU7A 3FZTA 3Q9XA 4UBAA 3DTCA 4BI0A 3U9CA 3DZOA 1OIQA 3E8NA 1B38A 2QOBA 3MWUA 4IE9A 3FI2A 4K1BA 4G2FA 5AP6A 4BB4A 4AT4A 3WARA 2XEZA 1JSTA 5I9VA 1FMKA 5FEQA 5IUIA 4IWOA 3LCDA 2OJGA 4I5HA 4M68A 4X2NA 3KULB 2Z8CA 4CEGA 1FVTA 1Y8GA 2ITNA 3BU3A 4WNKA 3VUHA 1BI8A 2YZAA 4CZUA 3I5ZA 2ZDUA 4IAIA 2VWIA 3AD6A 4LGGA 4TNDA 4YBJA 5HIBA 3TWJA 2NO3A 5T68A 3LMHA 4YP8A 5L4QA 3FMLA 3LCSA 4I93A 4NT4A 3S2PA 4DN5A 4F7JA 4TYGA 5DT0A 4QMLA 4R77A 3ANQA 3AC3A 1XBAA 3HV4A 4Y5QA 2I7QA 1TFFA 2IVUA 4X6QC 3H0ZA 2BHHA 3QU0A 4HZRA 5CF8A 3EJ1A 4DDIA 3E5AA 2G9XA 4HYHA 4E4LA 1JOWB 4BDEA 2YHVA 1G3NA 3MA3A 1XH7A