4I92A

Structure of the bsk8 kinase domain
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
289
structure length
289
Chain Sequence
QFREFSIETIRNATSGFAAENIVSEHGERAPNVVYKGKLENQRRIAVKRFNRKSWPDSRQFLEEAKAVGQLRNHRMANLLGCCYEDEERLLIAEFMPNETLAKHLFHWESQPMKWAMRLRVALHIAQALEYCTSKGRALYHDLNAYRVLFDDDANPRLSCFGLMKNSRDGKSYSTNLAFTPPEYLRTGRVTPESVIYSFGTLLLDLLSGKHIPPSHALDLIRDRNIQMLMDSGLEGQFSSDDGTELIRLASRCLQYEPRERPNPKSLVSAMIPLQKDLEIASHQLLGVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Probable serine/threonine-protein kinase At5g41260
publication title Structural Characterization of the RLCK Family Member BSK8: A Pseudokinase with an Unprecedented Architecture
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 88
structure length 289
sequence length 289
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4i92A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4i92A01
4FT9A 1OM1A 3NCGA 2J0KA 4U6RA 5CNOA 2BKKA 3B2WA 1X8BA 1KE9A 4XP3A 3KULB 3WE4A 1ZZ2A 4JG8A 3QRKA 2WTDA 3GP0A 2C5NA 4ZTQA 3D5UA 4AGUA 3H9RA 3PIZA 4DG0E 4PDOA 5CI6A 3AGMA 4AWIA 4EQUA 5JSMA 3V6RA 3ZS5A 2BIKB 3FL4A 4H39A 4LUEA 3QHWA 3KC3A 5CYIA 3OCBA 4V0GB 5M07A 2XH5A 4ZK5A 1MQBA 1M2RA 3LFBA 4WRGA 3I1AA 3KXHA 3BBWA 4FTOA 5CI7A 2NNWB 5DNRA 5LMKC 2JFLA 4D1ZA 4X7QA 4N6ZA 2PZ5A 4F9WA 4DBXA 4L68A 4ZSJA 3PZEA 2CJMA 4N57A 1ZY4A 2I40A 2XKDA 5DLSA 3T9IA 4RWKA 4QTDA 3ACKA 3C13A 2RG6A 4R1YA 3QRUA 5FEQA 3FPQA 3ZO2A 4Z16A 4PDSA 4BF2A 4BYIA 3P1AA 2G15A 4GU9A 1UV5A 2GU8A 2WO6A 3QTSA 3N4UA 3Q96A 4QNYA 4QYHA 4FV5A 2WMQA 4GS6A 2OF4A 2XJ2A 3NAXA 3R8PA 1TQIA 3IW5A 4RX7A 2KULA 4IBMA 1JVPP 2X39A 1ZYJA 2ZB0A 4IDTA 3U51A 3W10A 3ZZEA 5K5XA 5EOLA 3V5JA 1OKZA 1SNXA 2C6OA 2EB3A 3ACJA 4FKUA 4FZDB 4DFLA 4YP8A 4E5WA 5CEPA 2EB2A 5IH6A 3MS9A 4WO5A 3LFEA 4MD7E 4DEHA 4FKGA 2ITXA 3RP9A 2QKWB 4L7SA 3PYYA 3ZOSA 3NUSA 3R2BA 4F0IA 1YDRE 3NUNA 3IW4A 3EQBA 2Q0NA 4XUFA 4YTCA 3S1HA 1YW2A 4JDJA 2R3JA 3PJ8A 4RVTA 3ULZA 4EH3A 4GKIA 3QX2A 1DAYA 1H8FA 1GOLA 5AAEA 4ZJIA 2QODA 4MNEA 1OL1A 4MXCA 3R9OA 2EXMA 4JDIA 4YJUA 3TNWA 4JDHA 2GCDA 2BKZA 2QLUA 3DQWA 5E8ZA 3FMMA 3OUKA 3IW8A 5CAOA 2UW4A 2HW7A 1ZXEA 3NR9A 3PE1A 5FQDC 3DBQA 4BDAA 1UU3A 3PG1A 1YHSA 2QOQA 2CSNA 1UU8A 4DGOA 2IVSA 4AW1A 1MUOA 2FSTX 1ND4A 4BI2A 4CFXA 3UG2A 4RFMA 4LV8A 4KS7A 2PTKA 3IPHA 3EQPA 3O8TA 2IO6A 4LFIA 4UY9A 1SZMA 5L8KA 2Z7SA 4E4XA 2J5FA 3TV7A 3V01A 3UDBA 4IVAA 3VNTA 3G9NA 5CZHA 2C1BA 4O1PA 4QOXA 3N51A 1SM2A 2AC3A 3Q6WA 1XBAA 3SQQA 4Q5HA 3FSFA 3R8MA 3K3JA 4AZTA 4K9YA 2PL0A 2FSMX 3ORPA 3OW4A 4YZNA 4FSZA 4ZSLA 1GIJA 1Q24A 4TWCA 2B9JA 5BVWA 3UIMA 4F99A 1O6YA 2PZRA 4RRVA 4YZ9A 3UMWA 4EOQA 1U59A 1JLUE 4UB7A 4XBRA 2YJRA 4RJ8A 4WBOA 4DHFA 1ZLTA 2Y0AA 5HU9A 2JBPA 4YPDA 4C35A 1GZNA 3V5PA 3Q60A 2PUIA 5BQ0A 5DR2A 1OIRA 4QMVA 3ORMA 3DZQA 3ZUVA 1Y8YA 4WG5A 4X2NA 2REIA 1NY3A 1YXUA 3AD4A 1MP8A 5ETCA 4AAAA 2OJJA 3Q9ZA 4Z3VA 4BVUA 5M56A 3KKVA 3VVHA 4DCAA 1YQJA 3GC8A 1NA7A 4H36A 5E8XA 2JDVA 4YNOA 3UQCA 1DM2A 1QPJA 5DT0A 1T46A 3CEKA 3BLHA 4FUYA 3VUDA 3ZMMA 1J91A 3TV4A 4CMOA 2X8DA 3KMMA 1FVVA 3FLQA 5A54A 3RHXA 4G6OA 4D4VA 3ODZX 5AIKA 3LFQA 1OMWA 4J1RA 3PA4A 4TYEA 1OIQA 4U80A 1J7LA 3NUAA 4G9RA 3WIKA 4FC0A 5CAPA 2XBJA 2QVSE 3GQLA 3SOCA 4FK3A 3DAEA 5AUVA 2WIPA 2BRHA 2YACA 4CFFA 4E6DA 4UMUA 3LKMA 3QQUA 4OTPA 2VTRA 4J97A 4R7IA 4YNEA 2DYLA 5K3YA 2FO0A 1ERKA 3QD0A 3EQHA 5FD2A 3KA0A 4EHVA 2VTMA 4E93A 4AA0A 5J5SA 4R77A 1A06A 3BPRA 4O7LA 2A4LA 3AC2A 2VTIA 3QQLA 4EBVA 4ZAUA 2W7XA 3GOPA 3HRBA 4L42A 4YJVA 4E6AA 4MXAA 4OBQA 3IOKA 3ORZA 1WCCA 2JDSA 2CKPA 4F6WA 5IEYA 3FQHA 3EZRA 3VRZA 3UNKA 4NIFB 2GQGA 3QGYA 5HLWA 5LMBA 4NKSA 1PYEA 4EBWA 2V5QA 4GK2A 5CXZA 4CG9A 1URCA 2R3RA 3B8QA 4EQCA 3UO5A 2HZNA 4BCOA 2Z7LA 1GIIA 3L8VA 2YHVA 3LXKA 3RTPA 4AN9A 2WMWA 4GSBA 4JQ7A 3VS4A 1PXOA 4JBVA 2CMWA 3FYKX 1XH8A 4OTQA 2OJ9A 4ASZA 3QTWA 4CYIA 1YI3A 3MY1A 5IDNA 2O8YA 3OY1A 4JR7A 3JY9A 4LRMA 4ERWA 4X2GA 2IVUA 4ZY4A 4BTJA 2XMYA 3V5TA 4IMYA 4RVKA 4A4OA 4X6RA 5C1QB 4JX7A 4KB8A 4NTSA 4USFA 3A8WA 3MH1A 2GQRA 5GINE 4QMWA 5I3RA 1CKPA 5TE0A 2X0GA 3RGFA 5IQAA 4EOJA 3GU8A 5FEDA 3TKHA 2PY3A 3IQ7A 3G0EA 2GNHA 1JWHA 3PSCA 2JDOA 4BC6A 4ANOA 5I9VA 4CFWA 3RPOA 3ZDUA 3LOKA 3SOAA 3T3UA 3ZLSA 4BR3A 3P4KA 3O7LB 5CVHA 4AFJA 5IDPA 1KOAA 3R1NA 3ZHPC 3O0GA 5ANJA 2BRBA 3OHTA 4MQ1A 2PVHA 5DI1A 2ITNA 3PVUA 3OZ6A 3DJ5A 4AN2A 3FC1X 2QOOA 3QD4A 4J8MA 4F6UA 5I9XA 3A7FA 4GFGA 4J53A 4YJOA 2O64A 4RQKA 3QTXA 4D2RA 3RNIA 3ZFMA 3A8XA 4ACGA 3AC1A 3OEZA 5JQ5A 2PVMA 4TPTA 3SG9A 2JEDA 1Z5MA 1OIYA 4FT7A 3IG7A 2ZVAA 3R8ZA 4H3BA 2VTQA 3FI8A 4C8BA 3L8XA 3NW7A 2UW7A 4XEYA 4ALWA 4PNKA 3LE6A 1WBSA 4FTJA 4BBFA 3K5UA 1R78A 5IISA 3R7VA 3BELA 4FI1A 3QKLA 3D7TB 4D2SA 3CQEA 1FGKA 4BGHA 4HVHA 5K0XA 3FLNC 3ZTXA 1SVHA 3M42A 2W9ZB 1WVXA 3C9WA 1NVQA 3R9NA 4EH7A 4YPSA 4O7TA 3GFWA 5EQPA 2IW8A 1J1BA 1PMVA 3BV2A 3EH9A 2R3MA 2XIXA 2FSOX 3MDYA 5A4LA 4FIGA 3HAVA 3IDPA 5HE0A 2P2IA 3OCSA 4L3PA 3Q2MA 3B2TA 4MTAA 3MN3A 5BMMA 3R9HA 1Y8GA 1ZYCA 5IA3A 3MFSA 2OICA 3KRJA 4YHTA 3RHKA 4PMPA 2PE0A 3UYTA 1BKXA 1Q4LA 4GUBA 2Y8OA 1BYGA 3HV4A 2Y4IC 3PXQA 4QMZA 4RX9A 3ZSIA 4EOPA 1VYWA 4ACHA 3UBDA 5JZJA 4FTRA 4IVBA 3V8TA 2CGVA 4KKGA 2ETRA 5C8KA 4IX3A 4EOMA 2BZHB 2VAGA 2PE2A 3NAYA 5HBHA 3U9NA 4EJNA 3P78A 2IN6A 3PY0A 3FYJX 4QMYA 5FBNC 3RM7A 4A9UA 2OIQA 1LR4A 1H0VA 4PMMA 4ZJVA 2W5AA 3MGYA 4F09A 3UVQA 4EH6A 2J0MB 2BDWA 2QURA 3BHUA 4RG0A 5DWRA 2XM9A 4C2VA 3UNZA 2C6DA 4X6QC 3TDVA 3ZBXA 2YM5A 3OWPA 4QYYA 3WYXA 4Y83A 2VO7A 5IQEA 2ITTA 4PRJA 5E8SA 4FZAB 4JAIA 2Y4IB 4O2PA 5ETIA 3AC4A 4FIJA 5E92A 3A7GA 4AA4A 3ZO4A 4YC8A 4LI5A 5AV2A 1W7HA 3CGFA 4O0SA 1MQ4A 4B8LA 4FUXA 4LOQA 3OWLA 2X7FA 4JBOA 4RIYA 4LMNA 3R6XA 5E8VA 3ZU7A 4WSQA 4WNMA 3L9MA 4EWQA 4JVGA 2Y6OA 3VBVA 3MVLA 2Y4PA 4TL0A 4UMPA 3PP0A 4NW6A 4JIKA 4JNWA 4F0FA 3ALNA 2FUMA 1KE7A 5IMXA 2LGCA 3KB7A 1H07A 2GFSA 3QQKA 2OFVA 3HMPA 4AZSA 4HCTA 3VF8A 4MBLA 4J98A 4FKRA 4XCUA 4D28A 5HHWA 5EQEA 3R8LA 1OGUA 1JKKA 2PMLX 4RJ7A 2ZOQA 3QKKA 4GRBA 4XG4A 1FMOE 3DK6A 4C4JA 4U3YA 3QWKA 4ZY5A 4ZS0A 4J7BA 1YWVA 3QTZA 4L7FA 5C27A 1GZKA 4MBJA 3QF9A 3PP1A 4L9IA 5FTQA 4GIHA 4JRNA 3FHRA 4DTAA 4CGAA 1ZMVA 1KUTA 1XJDA 4W9WA 3D0EA 3BHTA 2YWVA 3P7CA 1OUKA 1GY3A 3O23A 4C34A 1FINA 5IG1A 1Q8TA 5FG8A 4PMTA 4KIKA 2XNGA 3CCNA 2A0CX 3RPRA 2PMIA 2V22A 5H3QA 4CLIA 5HQ0A 2W1CA 5IH5A 3TKUA 5E8YA 3S3IA 4IFCA 3AD5A 3QX4A 4G3CA 4U9AA 4FOBA 4C61A 4FX3A 1A48A 4FVPA 5ANDA 3BCEA 4FICA 1FVRA 5FEEA 4IB0A 3RPVA 3UGCA 5BX0A 4EZ5A 3OMVA 3BEAA 2JC6A 4PL3A 3II5A 4YJPA 5B7VA 1WFCA 2VTLA 4HJOA 4QNAA 2B54A 5BUEA 4XV2A 1H1PA 3EZVA 3PY3A 3KEXA 5BNJA 3ORNA 3COHA 1STCE 3W1FA 4AGWA 2WZJA 4FG8A 2EXEA 5H2UA 3PLSA 3QZHA 3WF9A 5HIDA 3KK8A 4FV8A 5CNNA 4AS0A 1PMNA 4EC8A 5IF1A 5HE2A 4LRKA 3EN7A 3GENA 3FI4A 4O7NA 5CF6A 5DBXA 5JT2A 2RG5A 3MTFA 1FBNA 3GEQA 3V51A 1F0QA 4FKJA 4AN3A 5CF5A 1JSUA 3HUBA 4K6ZA 4PPCA 5IA4A 3E64A 4ITHA 5LWNA 1O6LA 2UZOA 3MPAA 5AX9A 5AP6A 3FWQA 3QZIA 3KMWA 3BYSA 2VTJA 2WKMA 4NFMA 5EI2A 3BZ3A 2C1AA 2YIXA 3DB8A 1P5EA 1RE8A 3MTLA 5GNKA 3MB6A 2HCKA 4I0RA 3QALE 4XH6A 3SRVB 4AU8A 4FA2A 2VX0A 4QPAA 3UO6A 2CKEA 1Q62A 2IW9A 2H34A 3P08A 4FZ6A 5KHXA 2HK5A 1XH9A 2C3LA 3W2OA 3SGCA 5J79A 4C37A 3AC8A 5EOBA 5DE2A 3SC1A 4U40A 5KMIA 2PK9A 3DFCB 5CVGA 4CD0A 4AZEA 4FMQA 3DK3A 4QPMA 4OW8A 5HD7A 2HOGA 3F2AA 2ZMDA 1JQHA 3MH0A 4BCIA 4DFYA 2B9HA 4XG9A 2VTNA 5FM3A 3JXWA 2GNIA 3RNYA 2XNNA 2B7AA 4G3EA 4L43A 5AUUA 4APPA 5CU0A 4PNIA 2CCHA 5HG5A 4X0MA 3ZRLA 2JKKA 4C59A 3UVPA 4H3PA 4WHZA 3RCDA 3PXFA 2YAKA 4LQMA 3FLZA 4ZMFA 3GCQA 5HBJA 3CIKA 4FOCA 4WUNA 3S4QA 3COMA 4I3ZA 5I9WA 5FXRA 2HYYA 5ANKA 2I7QA 5GHVA 4CZYB 3DLZA 4CG8A 2WQNA 2UUEA 4FIHA 1Q8ZA 1REKA 3R71A 1ATPE 4BDFA 4BGGA 3IECA 1SVEA 3C4CA 2R4BA 2WD1A 3VUMA 3D94A 1W82A 3OWKA 4V04A 2P4IA 4CSVA 4CZTA 4D2PA 2R3IA 5ITAA 3F6XA 4L3LA 3Q2JA 3QQHA 2PVJA 2JKQA 3PIXA 4QMUA 2WMRA 3QU0A 4FKPA 4PTGA 5HI2A 3WF6A 5KZ0A 4OTDA 1Y6AA 1FOTA 5DMZA 2P0CA 4KIQA 3FMHA 5G1XA 2QG7A 4K18A 2OJGA 5KZIA 3DGKA 3RK5A 3JVSA 3ZBFA 2YEXA 4AG8A 4KD1A 5IPJA 2X6DA 1ZRZA 4X3FB 1OPJA 4BCKA 1U4DA 3KGAA 4I5HA 5EFQA 3TCPA 4MBIA 4RWLA 5GJDA 4DITA 4B0GA 4FV7A 2BIYA 3SLSA 2WTWA 3NLBA 3I5ZA 3EB0A 5L2SA 4NM7A 5D1JA 3W2PA 4BGQA 4U5JA 3ODYX 4I6FA 1UKHA 4G1WA 4BWKA 4X2JA 3RI1A 1IRKA 1WAKA 5BVFA 5IU2A 3F88A 2C0IA 3Q9XA 4FV0A 4KS8A 4L6QA 4YJNA 3C0GA 2O2UA 3HGKA 3ZRMA 4BCMA 1XH5A 2JIUA 1M2PA 2OW3A 3E8EA 3EKKA 3OG7A 3U9CA 4BN1A 4F0GA 1UA2A 4EK5A 4PF4A 1Q61A 4QP3A 3CQUA 2SRCA 4IAFA 4Y8DA 3IW6A 5CAQA 1J7UA 3OTVA 5AUWA 5IA0A 5KUPA 4FG7A 3U6JA 1CTPE 4A9YA 2VWZA 3EQGA 3GCVA 4YJQA 3RALA 4I24A 2F7XE 5EM8A 1R0PA 3Q4UA 3OBJA 4U79A 4DH3A 4K1BA 3WZJA 4TYJA 3H10A 4YMJA 4H05A 4EKKA 4EK4A 1GIHA 1VYZA 3NPCA 3TN8A 2B4SB 4AE6A 4FSQA 4ALVA 2I0VA 4S34A 4CFUA 4LMUA 4ZZOA 4MXXA 5T6KA 1YDSE 2ZV2A 3G2FA 5FXSA 3UODA 1RDQE 4D2WA 4EOSA 4KSQA 3TZ8A 2VWUA 5CWZA 4FTCA 4I5CA 5J1WA 4R3RA 3HL7A 4TNDA 2QONA 4YC6A 3VBYA 4E4LA 4EH2A 3NVMB 2QKRA 2R3GA 2JDRA 4KSPA 3R83A 3QKMA 1I09A 4ACDA 1TQPA 3DT1A 2V62A 3C0IA 4FT5A 2FB8A 3CGOA 2WQEA 5EG3A 3ZEWA 2OFUA 4ZLYA 4E7WA 2X9FA 1OBGA 3GFEA 3IS5A 5KHWA 2ZMCA 4CZUA 2ZM3A 3D15A 3EN6A 1Q8UA 3ZONA 4DG2E 2C3IB 2IW6A 3ZLWA 4AZWA 2XEYA 4RLLA 2DQ7X 3PVBA 3L9LA 4G6NA 4L67A 5J7HA 2C69A 3BGQA 2VTAA 4S2ZA 4Y72A 5HO6A 4FEVA 4AGCA 4IACA 3FDNA 4DEDA 4DGGA 4DFUA 4BHNA 2GFCA 1XHAA 4U42A 4YZDA 5CF4A 3PA3A 3IGGA 4IB1A 2CGUA 2QR7A 3VBXA 4W4YA 1SNUA 4NJ3A 5IQFA 3V6SA 2PVYA 2OU7A 4Z9LA 4BDCA 5HD4A 2C6TA 2ZM4A 4H58A 1TKIA 4XV9A 3TTJA 3GU4A 3L9PA 1SVGA 3BWJA 4O6LA 4I93A 3TUCA 3M11A 4TT7A 3B8RA 2I0EA 2GTNA 4XJ0A 4YGAA 1IA9A 4A9RA 4G3FA 3V04A 2XK8A 3NIZA 3W8LA 1IR3A 4F7LA 2IZUA 3HDMA 1H27A 2YZAA 5AR8A 3GVUA 4ANLA 5HNGA 3P23A 5I4NA 2UZWE 4D5KA 4O91A 3NW6A 5JK3A 3VN9A 1PXNA 3P79A 4TRLA 4D5HA 4F1OA 3DOGA 3FUPA 4GH2A 3QRJA 2YIRA 5EH0A 3CQWA 3I0QA 4YTIA 3UMXA 3OCGA 4NJDA 3ALOA 2XBAA 4IX6A 2QHMA 4DFZE 3EFJA 3I6WA 4I4EA 4P7EA 4C62A 4X2KA 1L3RE 4XP2A 4MD8E 3LJ0A 3FEGA 5GIPE 5FTOA 5EW9A 2BHEA 4C4GA 3DLSA 4N70A 2QCSA 2PE1A 2WNTA 3G15A 4FEWA 1Y57A 4JG7A 2QOCA 4ZZNA 1M7NA 5M53A 4BWXA 3KRLA 4KRDA 2OG8A 3KQ7A 3R7UA 3Q6UA 4ANSA 4APCA 4AW0A 4BIBA 5F9EA 5AV4A 5E8WA 2VTTA 4O7WA 1UNGA 2B1PA 2V55A 1K2PA 4FTUA 4NH1A 4O38A 3F3ZA 4YUQA 2Q0BA 4BDGA 1U54A 2IPXA 2XRUA 4KABA 3AXWA 2WU6A 3LIJA 2HZIA 3R7YA 3P0MA 3SX9A 4FZFB 5KO1A 1OL7A 2R3PA 4FT3A 5AUYA 3ENHA 3MWUA 4I6HA 3OY3A 2PHKA 4M97A 4HCUA 2NRYA 3F5GA 5DOSA 3LCOA 3EFWA 2JAMA 4Y46A 3OBGA 3CD3A 4CT1A 4N6YA 1ZOHA 4YR8A 1XH4A 2GS6A 4FKLA 2PUPA 2WB8A 1XH6A 3QTQA 5LJJA 1H0WA 4RIXA 4J95A 3EQCA 1CM8A 4IX5A 4C4FA 4KA3A 4V05A 5M09A 2WPAA 5DRBA 3E3PA 4D9UA 2NP8A 3COIA 2OLCA 4Z55A 3UC4A 4NK9A 3F5PA 2VTSA 1V1KA 1IG1A 4DEAA 3F3WA 4FV3A 3OT3A 5HNIX 1ZOGA 2R0UA 4JS8A 3BKBA 1T45A 4XHKB 5H9BA 1EH4A 3TJDA 2C6EA 1ZARA 5I9YA 1W98A 4DH1A 2PPQA 1VEBA 4W9XA 4RX8A 3PZHA 4QQ5A 2W1GA 4FTNA 4YZBA 3ENMA 1WBTA 4CQEA 3R00A 4IANA 3H0ZA 3ETAA 3MW1A 2YDKA 3GB2A 5CALA 5HTBA 3E8NA 4BIEA 3MPTA 5CASA 5EHOA 3UNJA 3EN4A 5LOHA 5I3OA 2UZNA 3LXPA 4X3JA 2P55A 3BGZA 4GFOA 5H8GA 3R8UA 3TNHA 5HO8A 2C6LA 5EDPA 3ZCLA 5CXHA 4NZWB 4TWOA 4W4VA 3PRIA 4CFNA 5JFSA 4DGMA 3MSSA 1OBDA 3GI3A 5IA1A 3R73A 2J6MA 3ITZA 4QYFA 3ZUTA 2R64A 4PDPA 4QMOA 2E9NA 4O0WA 3O50A 1PXPA 4WD5A 3AD6A 3VQHA 4I21A 4LOPA 4O0YA 4ZS4A 3R22A 2B9FA 4PX6A 1Y91A 3BU5A 2XS0A 3FZSA 4MYGA 4BCNA 4AA5A 2VWWA 3QWJA 3OVVA 3AQVA 3PXZA 3AT3A 5AR3A 5LARA 4P2KA 3PJ3A 5IQDA 3RKBA 5EYCA 3HKOA 5G6VA 3HMNA 3NDMA 4HYSA 1PJKA 1ZWSA 2OIDA 4MAOA 5C26A 5HOAA 2VWVA 3C5IA 4C3FA 4YSMA 3G33A 5A46A 2Y7JA 1VZOA 3DXNA 4KNBA 5JFWA 5JRSA 3FZPA 4UMTA 4DTBA 2X6EA 4QP8A 4NM5A 4F9BA 4RSSA 2RL5A 3DB6A 2OZOA 3W16A 3LQ3A 4CCUA 5HVKA 3LXNA 4CRLA 3GU5A 5BVNA 4X3FA 5DT3A 5IEXA 3VJOA 3ZFYA 4AGDA 1YKRA 4XX9A 3S00A 4O6EA 5IQBA 3P5KA 4QTCA 5BUJA 5C4KA 1Q3WA 3Q5ZA 3BQRA 5ACBC 3RINA 4ZIMA 2QU6A 5C01A 3PVGA 3CE3A 4TTHB 3NGAA 5DEYA 3OXZA 3QC4A 5ACKA 3FC2A 3DKGA 1FMKA 2G1TA 3BRBA 4BDEA 4XP0A 3E7OA 4X21A 4DEGA 2YDJA 2RSVA 4ZP5A 2F7EE 4M13A 4ZSEA 3V8SA 2HELA 2UZTA 5A6NA 3MYGA 3LCSA 3R7EA 2HWPA 4I6BA 5CLPA 5AM7A 2XRWA 2GS7A 5K0KA 4DBNA 4O84A 2G2IA 3QGWA 4FKTA 4PPAA 4Y5HA 4F65A 4FEQA 3FXXA 5TOZA 4Y95A 5CT7A 4EWHA 3AG9A 4MQ2A 5JMSA 2C47A 3R0TA 4GG5A 2IJMA 1S9JA 3F61A 5D11A 4E26A 4GVAA 1XR1A 3VQUA 1YXSA 4R1VA 3FMKA 4KAOA 4TWNA 4UXLA 4OLIA 2IZSA 4U45A 5L8JA 4YO6A 5L2QA 3Q4ZA 4MEDA 4O1OA 4DAWA 5M4IA 5DYJA 1DAWA 5E4HA 3GC7A 4UWYA 1IASA 3VBQA 3MFRA 3VS7A 2XP2A 4FYOA 2W96B 3H3CA 3G6GA 4L00A 5D9HA 1PKDA 2ONLC 4BZNA 3DAKA 4EUTA 1BMKA 2E9PA 3EYGA 3Q9YA 1L8TA 4D55A 1Y6BA 2W1DA 4FV6A 4IJ9A 3UTOA 3W2SA 4C3RA 4O7RA 3GQIA 4D2TA 4BDJA 2BVAA 5JRQA 4I22A 5L2TA 4XG8A 2C5XA 4HCVA 5IKWA 4CFMA 1JAMA 3FV8A 3UIXA 4S30A 3LVPA 1MRYA 3HMOA 3W8QA 5DHJA 1YI4A 5HU3A 4DLJA 1PXMA 4OBOA 5B2KA 4YJRA 1WBWA 5CU4A 1M14A 4L01A 3VJNA 4BYJA 2OZAB 1K3AA 3H9FA 3TZ9A 2IZRA 2YWPA 3OW3A 4FE2A 5E8TA 4AOIA 3MI9A 4B4LA 4U44A 4A9TA 3QCYA 4M69B 4M0YA 2BMCA 2VWBA 3VS6A 5CAUA 4IVDA 3LMHA 5K9IA 5HTIA 3E63A 2HZ4A 4MHAA 2J5EA 3EJ1A 5HESA 3PDTA 5FDXA 4NCTC 4IM2A 4BZDA 3F3VA 5A4EA 2UZEA 3ZH8A 4DGLC 3BU6A 3UPXA 5BUIA 4DE4A 4CKIA 4MX9A 2OO8X 4FNXA 3Q52A 4USDA 3UO4A 4IFGA 1KV2A 5J95A 1FQ1B 4FKSA 5IA5A 3TDWA 4FSMA 3DNDA 3UPZA 4I23A 2WU7A 4Z7GA 4XNEA 3FL5A 1H24A 3PVWA 5CEIA 3A61A 3RBWA 1P14A 5AEPA 1U5QA 1KOBA 4W8DA 4O81A 5JZNA 2C6KA 4IB5A 5M4FA 4M3QA 4OUCA 2FGIA 3PWYA 2ZJWA 4BY9E 4PPBA 3I79A 4H3QA 3TXOA 2JD5A 1BX6A 1BL7A 3KULA 5LCJA 3G5DA 3QRTA 2BPMA 4HOKA 4UV0A 1PXKA 2JFMA 1JPAA 2XZSA 2Z60A 3WZEA 4F1TA 1J7IA 1S9IA 1O6KA 3HECA 4OTWA 4ZTHA 3AMAA 1JNKA 2OJIA 2BR1A 2F9GA 3FY2A 5A4QA 2G2HA 4E6CA 4UN0C 4V0GA 3TKIA 2ITVA 3EFKA 4DT8A 4WBBB 3VULA 5FTGA 3AT4A 3CJGA 2H96A 2XNEA 3VO3A 2R3NA 5EM6A 1SMHA 1G3NA 1XKKA 2QO2A 4AZFA 1QPEA 4FL2A 4EH8A 2FH9A 2V7AA 4YZMA 3RK7A 3O2MA 4FSWA 5ETFA 2XM8A 4I94A 2P33A 4FGBA 2G2FA 4L52A 4G31A 3DBDA 4IAYA 4MCVA 2F49A 2QOHA 2ZB1A 3HV5A 2QO9A 3QHRA 2X81A 3SHEA 4FGRA 5DG5A 3RAIA 4D9TA 4YLKA 2OIBA 4QTAA 5C8NA 3QTIA 2R7BA 2XB7A 3Q32A 3ZXTA 4EKLA 1FGIA 4Y73A 2W1IA 2OBJA 2PVRA 3GGFA 3U55A 4EONA 4CV9A 2WMBA 4GUEA 4YTFA 3F82A 5E7RA 5D7AA 2R3OA 3HMMA 4QP6A 5IQGA 3F3TA 2X2MA 2VU3A 5DVRA 3QXPA 4FKOA 4C3PA 4AZVA 4A07A 4QP9A 5LMKA 2QD9A 2J50A 2RKUA 3G0FA 3FI3A 3AC5A 1OECA 4EOOA 3W2CA 4HZRA 4DFXE 4JIAA 3SXSA 4ORKA 2RIOA 2VNYA 4GFMA 3GU7A 1OL6A 4ZEGA 3BI6A 4M15A 4CMUA 2A19B 2BROA 2OXDA 1TVOA 1WZYA 2WFYA 2VZ6A 2WQMA 2I1MA 3O7LD 3QL8A 3NUYA 3ZM4A 5AR5A 1F5QA 4FV4A 2HZ0A 3C4ZA 1UWJA 2WMVA 3QD3A 3FZ1A 4RIWB 3TZ7A 2XEZA 2XJ0A 4ANNA 3FJQE 4KBAA 3EMGA 5TKDA 1CKIA 4L8MA 2RFSA 4PQNA 5AAFA 4LOOA 3TV6A 4B99A 3GBZA 2FA2A 5KNJA 4LG4A 2UZBA 2YZLA 1ZYDA 4RPVA 1IEPA 4X2FA 3KN5A 3R2YA 3ROYA 2ACXA 4B9DA 2F7ZE 4XLIA 4BWPA 3R63A 3E62A 4UZDA 3L1SA 3QZFA 3VUKA 4P5ZA 4C2WA 1B39A 2PU8A 5T68A 4XYFA 4RZVA 5HKMA 1UNLA 4AOTA 4JLCA 2JBOA 3Q04A 4RX5A 1ZMUA 1YOLA 2BTRA 3KXZA 5EW8A 1WMKA 3UJGA 4HVIA 3NX8A 5HG8A 2CHLA 3ZSGA 5AP3A 3MH2A 4YJSA 2OSCA 2C6MA 3DKFA 1R1WA 3QYZA 3KMUA 4NEUA 1DI8A 4BTKA 4EEVA 2IG7A 4ASEA 3RAWA 3I7CA 3N9XA 4F9CA 2WMUA 2X8IA 2DUVA 3ELJA 2OH0E 4B6LA 3ZLYA 1RW8A 3PIYA 5D12A 2BZKB 2GS2A 4EYMA 3MVHA 4AW5A 5CQWA 4ZLOA 4J99A 2W4KA 2QU5A 4YTHA 2BALA 4B8MA 4GKHA 4GEOA 2F2CB 3LCKA 4KINA 3F66A 3QAME 2O63A 4WUAA 4B7TA 5LVNA 5J9YA 3LAUA 4C7TA 3HAMA 3EN9A 2VWXA 5KMMA 2JDTA 4EH9A 3DJ7A 3EHAA 3GC0A 4TNBA 3I81A 2GSFA 2CN5A 3I5NA 2X4FA 1H00A 1IAHA 4DH5A 2XK9A 4JX3A 2C5YA 3D83A 4QMXA 4TYHB 4QMTA 3LCTA 3S2PA 3CLYA 4U0IA 1BI7A 2CNVA 4GK3A 4FTKA 2H6DA 2UZLA 4BDHA 2WMXA 3K54A 3RCJA 4C4HA 2QO7A 4QMSA 2YJSA 3SDJA 3TNQB 4OGRA 4USEA 2OK1A 1Q8WA 1QL6A 3BHYA 3ORTA 4F6SA 3QUEA 4NM3A 4L44A 2QNJA 3QUDA 4BKJA 4AT4A 4A4XA 3FY0A 2YIYA 3VUHA 2EU9A 2QOLA 2R3KA 2WTVA 3KXMA 2BUJA 2CGXA 2Z2WA 4IZ7A 4XV3A 5IMEA 2R7IA 5E9EA 1WBOA 4XG6A 3G6HA 5AP4A 5JGAA 2GQSA 1GAGA 5AP5A 5CENA 5M4CA 3DDPA 1KE6A 4MNEB 3DBFA 3OOGA 4DCEA 2C0TA 5HX6A 3PPKA 2J9MA 2OF2A 3SKCA 2ZDTA 4HPUE 5JH6A 5GJGA 4I41A 2ITPA 4RT7A 3OXIA 4YU2A 3GCUA 4K33A 3VUGA 3NVKI 1M2QA 2P2HA 2WOTA 3QCXA 4IX4A 5AA9A 1MRVA 4RIOA 3OCTA 5ANIA 4QQTA 5HIEA 4YJTA 4ASXA 2CNQA 5KKRC 3LXLA 5D7VA 3NCZA 2BRMA 3BHHA 2GNFA 3KU2A 5TF9A 2QG5A 1DS5A 5KBRA 1LP4A 3FMLA 1LPUA 4NIFA 4HZSA 1PRYA 3A60A 3BYVA 4LM5A 1URWA 1W84A 3IK3A 4F64A 2PZIA 3TUBA 4IWOA 5HCYA 3BLQA 5IQCA 3PA5A 3AGLA 3R04A 5EHYA 3ROCA 3SW7A 4YBKA 3R01A 4ZTLA 4CMTA 2WTJA 1E1VA 3ORLA 4M84A 4FSRA 4O0RA 5IH4A 1YDTE 5EDRA 3RMFA 3OUNB 2E2BA 4M8TA 5AUZA 1KWPA 4AOJA 3DNEA 4DFNA 3O8PA 2FSLX 4ZY6A 2QC6A 5HZNA 5KKRB 4UX9A 2YM3A 5GZ8A 3ZC5A 3KF7A 3PSBA 2BDJA 5KMLA 3K3IA 3DBEA 3IKAA 3GUBA 4GJ3A 4FNYA 4OAVB 2PMNX 3FMEA 3FZTA 5H8BA 2YA9A 3U4UA 2Z8CA 3MA6A 2XK3A 3MPMA 3QRIA 5HBEA 3WBLA 4IE9A 4C4IA 4QMNA 4O86A 2C5VA 3CTJA 3PPJA 3ZYAA 4EQMA 4ZLZA 4FNZA 4ANMA 3QTRA 5I9UA 1ZY5A 4HNIA 1BUHA 5CY3A 5C03A 3RK9A 5LQFA 3TTIA 5M44A 5AR7A 2B0QA 4WIHA 3QFVA 3CKWA 3WF7A 5BVDA 3V5WA 4Q2AA 3F7WA 3EQFA 2HXQA 4DT9A 3DDQA 5H8EA 4CKJA 4G16A 4O7YA 2E9VA 4M68A 4ONAA 5GZAA 4FKQA 5AM6A 4BTMA 4IQ6A 4FVRA 3POZA 4OT6A 5AX3A 3R7GA 2R3FA 2W5BA 3KRRA 5CU6A 3H30A 1H28A 5AR2A 3FKNA 2Z7RA 2VGPA 1YRPA 5M08A 3FLWA 4G3DA 4WRSA 4UZHA 2G9XA 2RGPA 3ZEPA 2Z02A 3QYWA 4WA9A 5FP6A 1NVRA 3BBTB 2BRNA 3JY0A 4FTAA 5IZFA 3UZTA 3D7TA 5FBOA 4JR3A 2Y9QA 4A06A 5KMJA 3PJ1A 4H1MA 1UU7A 2H9VA 4GYIA 4O7VA 1JKLA 2G01A 3LFAA 3RM6A 3CJFA 2WGJA 4DYMA 3ID6C 3GCPA 2UW8A 4JJRA 4PL5A 3H4JA 1OI9A 2O5KA 4KIPA 1H01A 4U81A 1GZ8A 5M06A 3ZXZA 4XRJA 5GJFA 3FXWA 2A2AA 2ETKA 2VWIA 3C50A 4FNWA 4HGSA 4O22A 5DR9A 4F1MA 5E90A 2VN9A 2VO6A 4I1ZA 4QYEA 4FSYA 3C4WA 2R9SA 3UVRA 4F9YA 4F7NA 3G90X 1OVEA 3C4EA 3SW4A 3RWPA 4ZTSA 3C5UA 4G6LA 2BRGA 2C3JA 2ITZA 3KL8A 3S0OA 4O7ZA 3TJCA 1QMZA 3VW8A 2DWBA 5CEKA 4II5A 1OB3A 2B53A 2XYUA 3LW0A 3R1YA 2PUUA 4M67A 4R8QA 4TW9A 4IVCA 3VIDA 4DTKA 5CU3A 3ZRKA 5HLNA 3OT8A 2WIHA 5BVEA 3LLAA 2J0IA 4G2FA 3EIDA 4OTGA 1JSTA 1Z9XA 3KXXA 4BIDA 4M12A 4KBCA 4OAUC 1Q41A 2YIQA 5HO7A 1YVJA 4O2ZA 2ITOA 3EQIA 4MXYA 4EC9A 4CNHA 3QA0A 2FVDA 3CPCA 3FZRA 2RFNA 2Y6MA 2PVFA 4RWIA 3HRCA 3MVMA 4XBUA 5EQYA 2J0LA 3E93A 4ASDA 4BFMA 1WBVA 2ITQA 2XKEA 3FKOA 4HW7A 2YN8A 4FKIA 1CMKE 2YCFA 4IM0A 3FI2A 4IWQA 3JR1A 3WILA 5EKOA 3RAHA 4E3CA 3BX5A 2R5TA 1H1SA 3PLAE 3PWDA 2F2UA 2I0HA 1PW2A 5FDPA 2LAVA 3CBLA 3QD2B 3HLLA 3ULIA 3VS1A 4BCGA 3PUPA 4C38A 4QPSA 5HEZA 4S32A 3NWWA 5E1SA 5ANEA 4A9SA 3F5XA 3M1SA 1OITA 4GCJA 1J3HA 3QC9A 4Y5QA 5FGKA 4AW2A 5K5NA 2PYWA 3F2NA 2CLQA 4LL0A 3R28A 2PZYA 2R3QA 3D5WA 4AFEA 5KMKA 2JGZA 2EXCX 1JSVA 3EWHA 3CD8A 1WVWA 3V8WA 4QT1A 3DQXA 3GOKA 4HNFA 3WZKA 4E4MA 4JDKA 3RZBA 3MESA 3LFNA 3Q5IA 3KVXA 4L3JA 3I60A 4WSYA 3DJ6A 4DF3A 3VBTA 3VF9A 2YLFA 1V0OA 5JFVA 4NKAA 3W2RA 4I0TA 2O65A 1H1QA 1AQ1A 1B38A 2VTOA 3EFLA 4ZXTA 4CVAA 2PUNA 3R1QA 5DRDA 3WOWA 3UQFA 4IXPA 4EK3A 1XWSA 3EL7A 3NYNA 3OWJA 3VS2A 5AV3A 2UVZA 3R30A 4ALUA 3COKA 5L6WL 1ZYSA 3DCVA 3Q53A 2P3GX 3UYSA 1R3CA 4OR5A 4XRLA 3MY0A 2PULA 4DFBA 3BE9A 5D10A 1P2AA 2E9UA 2IZTA 3OEFX 4O27B 4WNOA 4ITIA 4ZZMA 3OD6X 3FLYA 3PG3A 4CYJA 4MXOA 2ZM1A 3QZGA 1PF8A 1LEWA 4J8NA 2OWBA 3SAYA 2PVLA 3GU6A 2C4GA 4PY1A 5BPYA 1I44A 2CPKE 5LCKA 2J2IB 1JKSA 4OBPA 3O8UA 4BTFA 2XNBA 5CX9A 3CY2A 4IW0A 4IIRA 5I9ZA 2ESMA 5KMNA 4OTRA 3A7JA 3IOPA 4Q9ZA 4RQVA 3FHIA 5D41A 3VS5A 1UWHA 2GHGA 2OH4A 3WI6A 2C30A 5AA8A 2XNOA 4HVGA 3O17A 4RVLA 1NW1A 3MVJA 4TYHA 3THBA 3BEGA 2R0IA 2J51A 3EYHA 3TZMA 3JVRA 3QBNA 4IAZA 3L9NA 2BCJA 3WF8A 3MB7A 3OS3A 3QLFA 4DEIA 4RIYB 2X7OA 3RPSA 3TNPC 3I6UA 2NRUA 1H25A 3C4FA 1YHVA 3W32A 4D1SA 4FTTA 4G5JA 1OKYA 3SRVA 3SXFA 3K2LA 4O0XA 3ZO1A 3IDBA 3CC6A 3DAJA 4EJ7A 4BRXA 4RVMA 5M55A 2PSQA 4A7CA 5AP1A 4EZ7A 4TYIA 2W1EA 3D14A 3QCSA 4FBXA 4QP2A 3QQJA 5EYMA 2ERKA 4BCPA 3KRXA 4JOAA 3WARA 2WEIA 1OPLA 3WYYA 3LMGA 3ATTA 1OUYA 4HVDA 4G5PA 2BDFA 3EKNA 4I92A 3E8DA 3KFAA 4UALA 5GZ9A 2CKOA 5DN3A 3DU8A 3H9OA 2HXLA 2XK4A 5M57A 5E1EA 4LGHA 3QLGA 5CEOA 4RLKA 4PV0A 2W99B 4A4LA 3KY2A 4ZTRA 3BYUA 5AIRA 5FRIA 3U6IA 4MNFA 2XVDA 1YOMA 4EZ3A 4DLIA 1JBPE 2QOFA 1XH7A 4EORA 4FF8A 5AFVA 1H4LA 3AC3A 3L8PA 4QYGA 5AJQA 4IWPA 4BBEA 5FLFA 4KIKB 3CSVA 4IZYA 3OTUA 4ZOGA 4OTIA 3C0HA 3UOLA 5B2MA 4AT3A 2UW0A 4EL9A 2V0DA 4FKWA 2B9IA 3PXYA 4EOIA 3I7BA 3KXNA 3SXRA 4D4RA 4MH7A 1FVTA 3EN5A 3D7ZA 3UOHA 5EI6A 4XLVA 5K4JA 3VHEA 2W1HA 4ZMEA 2YAAA 3BYOA 5IA2A 4FR4A 2FYSA 4I5MA 3RJCA 2BHHA 3FZOA 4LRJA 4RJ4A 2JITA 5BYZA 4R5YA 5IQIA 2BAJA 3PTGA 4ERKA 2YM8A 1OL5A 4BI0A 1R39A 4JT3A 3F5UA 3UIUA 2HWOA 3NUUA 4K77A 4L46A 4DC2A 4BI1A 1GZOA 3EL8A 4YHFA 5AMNA 3D2IA 2W9FB 4EHEA 3M2WA 4PDYA 3HZTA 4ZTNA 3OOMA 4S33A 1M7QA 5IUIA 3LFDA 4QO9A 4I6QA 4BCJA 3OP5A 2A27A 5ETAA 4P5QA 3UQGA 1PYXA 3KRWA 3W18A 1MRUA 4FZ7A 1OPKA 3GT8A 4YURA 5AV1A 4D4SA 4N0SA 4O96A 3D2KA 2XF0A 3AOXA 3TG1A 1LEZA 4C57A 2CCIA 4PTEA 2GNGA 2IVVA 3PJCA 4R6VA 5C4LA 1YWNA 1YI6A 4TN6A 4F70A 5AP2A 1BL6A 3C7QA 4DG3E 3A99A 3U8WA 1Q99A 2PWLA 2GNJA 5EHLA 1OKVA 4BCFA 3T9TA 5DFPA 3KN6A 3DA6A 2WHBA 2C5OA 2GPHA 3G9LX 3KCFA 3ORIA 4HGTA 2AYPA 4IEBA 3E87A 4WG3A 1W8CA 2BFXA 5CSHA 3F7ZA 2XIKA 5BVOA 3IW7A 4CKRA 5DIAA 3E88A 3BU3A 1BLXA 4G3GA 4G9CA 2AUHA 4I20A 5HGIA 2YM6A 2ZV9A 4GT3A 4QP4A 2F4JA 5EYDA 1V0BA 3EQRA 4GVJA 4IAIA 3VW6A 4BCQA 2E9OA 2AC5A 2XUUA 4CFVA 1V0PA 4E73A 3DXQA 3CS9A 4HGEA 5CTPA 5F4NA 3E7VA 5EK7A 3H0YA 3KXGA 1PXJA 4FTQA 3D9VA 1PMUA 5HG9A 3R1SA 3VUIA 4HVSA 5HVJA 3E8CA 5L3AA 2WMAA 4W8EA 5DT4A 3F69A 3LJ2A 1PMEA 1M17A 1VR2A 3PPZA 4QRCA 3U4WA 1OKWA 2YFXA 3JS2A 4BHZA 5BMSA 3NEWA 3UZRA 1PY5A 2OKRA 4XS2A 3A2CA 4O82A 5KE0A 4BDIA 4CLJA 5I0BA 4IJPA 4GU6A 3REPA 3P7BA 4YHJA 4RC2A 4XOYA 5EDQA 2QOKA 5EYKA 4C58A 3IO7A 5J8IA 4EK6A 3HP2A 2CLXA 5M51A 4QTBA 4OT5A 3FPMA 2ITYA 5AWMA 3UP2A 2BZJA 5DGZA 5JN2A 2GNLA 4WT6A 4QTEA 5JQ8A 2VRXA 4BB4A 4V01A 3AMBA 5DEWA 4UBAA 4JBQA 3FBVA 3MH3A 2JAVA 3QXOA 3NNVA 1HOWA 4R3PA 3ZZWA 3HNGA 3GCSA 4K11A 2YCQA 2UZUE 4HYIA 3TWJA 3UOKA 4N4SA 3QTUA 1APME 4E5BA 5BYYA 5A4CA 1ZYLA 3NW5A 3KCKA 4O0TA 4NYEA 1CSNA 2VUWA 4XG2A 4RFYA 5ANGA 4UXQA 3UOJA 4CV8A 3TEIA 4F63A 3K5VA 4IC7A 5E91A 4DH7A 1UU9A 4FODA 3O71A 2WOUA 2YERA 1K9AA 3BLRA 3RVGA 5J1VA 3GC9A 1KSWA 4K2RA 3VS0A 4MVFA 4BCHA 2UVXA 2XIYA 3MFUA 4FEUA 3LQ8A 1PXIA 3NYVA 2JKMA 2W17A 4GJ2A 4WG4A 5EM7A 2X2LA 2JIIA 2H8HA 4BL1A 3LLTA 3P86A 4TXCA 4JQEA 3W55A 4P90A 2JKOA 2WTIA 1IA8A 1DI9A 1UKIA 3E3BX 5JKGA 3DFAA 4J96A 5BVKA 4QQCA 2B55A 1ZAOA 4HGLA 4TY1A 3HDNA 2WTCA 4JBPA 1A9UA 2UVYA 2HY81 3Q9WA 2VTHA 3KF4A 5CSVA 3QUPA 4UMQA 5HICA 3NYXA 4IB3A 4FTIA 4BKZA 4DGNA 3LFCA 4C33A 3R9DA 5LXMA 3HUCA 3W2QA 3UP7A 3EOCA 4FTLA 5TR6A 4ENYA 4WOVA 4K8AA 4FK6A 4EUUA 2CDZA 3MJ1A 4NU1A 2R3HA 4QMQA 2QQ7A 2ZDUA 3HA6A 4GMYA 2RFEA 4PMSA 3G51A 4GW8A 1RJBA 3ANQA 4Q9SA 5F95A 4JG6A 3FXZA 1WVYA 1ZZLA 4IAKA 4UEUA 4EH5A 4R7HA 3NUXA 4CTCA 2C6IA 4LV5A 5A9UA 5CEQA 5T3QA 4PL4A 1P4OA 2ETMA 4FV1A 4Z7HA 3ATSA 3FKLA 4EH4A 3DV3A 2EVAA 5IQHA 3I0OA 2X2KA 3LQ5A 2XKFA 4O7SA 3U87A 3DZOA 3RZFA 1G5SA 4CCBA 4CTBA 1YXVA 3HRFA 4BBMA 1WBPA 1BI8A 5C9CA 1CDKA 1UVRA 3OF0A 4U97A 3ZO3A 1GJOA 2YCRA 4BDBA 5AUTA 3NMUF 2UV2A 2ERZE 2VWYA 4E4NA 4YO4A 4NL0A 4ANQA 4YZCA 3WE8A 4W4XA 4RWJA 3FMNA 4YLLA 4JI9A 4D1XA 3QA8A 4LYNA 3O51A 1U46A 4D0WA 3L8SA 3OFMA 3DS6A 4NW5A 4AX8A 3LHJA 3ZSHA 4G34A 2XNPA 5GIOE 3DTCA 5CZIA 3UG1A 5HIBA 5I5ZA 3PE2A 5EW3A 3TM0A 3TT0A 3FMDA 2BAQA 4U43A 3MY5A 1OIUA 2X9EA 1CKJA 2YCSA 4I5PA 3WZUA 5IEVA 3FMJA 4UWBA 5F1ZA 4DEBA 4FVQA 3BGPA 2Z7QA 4ITJA 3NNXA 2YITA 2VTPA 5LMAA 2I0YA 3N4TA 1W0XC 2IWIA 5KBQA 4MWHA 3WZDA 3PXRA 5AV0A 3R7OA 4NSTA 4BZOA 5DR6A 4F9AA 5JGBA 3JUHA 4NUSA 5F94A 2VO3A 1H08A 3HP5A 5CQUA 4U7ZA 4G17A 4LGGA 5K4IA 3RPYA 4QD6A 4M0ZA 3QQGA 5A3XA 2J0JA 5J9LA 4O0VA 4GG7A 5HLPA 2UZVA 3VC4A 3CTQA 3IGOA 5F20A 2QOBA 4JL9A 2J4ZA 3IONA 1NXKA 4TWPA 4ZSGA 3TACA 5HE1A 1KV1A 4FEXA 4JQ8A 3TL8A 5CU2A 4H1JA 4HPTE 2XJ1A 3MFTA 4DH8A 4EOLA 5J5TA 4XOZA 1ZMWA 3D5XA 3DKCA 4IZ5A 1KE8A 4MD9E 1YHWA 4MXZA 2W4OA 3FQEA 4DN5A 4EK8A 3FLSA 3HEGA 3NIEA 4KBKA 3A62A 1RQQA 4IWDA 4CEGA 3I4BA 3LPBA 3V5LA 2ZV7A 5FM2A 5HX8A 5L2IA 5L6PA 4GIIA 3KVWA 5CT0A 2BFYA 5HORA 2GDOA 2YLEA 4YBJA 5FUTA 3Q3BA 4UYAA 2VNWA 4L45A 4IDVA 2W05A 2YDIA 1PXLA 1U54B 3CY3A 2XCKA 1P4FA 4GV1A 4LL5A 4GK4A 3OC1A 4R7BA 4RBLA 3NUPA 4E6QA 4XV1A 1H1RA 3UZPA 2BILB 3MBLA 4FSNA 4R5SA 5E8UA 5CS6A 4XG3A 1AD5A 4KKEA 4MF0A 4C02A 4UMRA 2R3LA 1J1CA 3LZBA 5J87A 5A6OA 3TIYA 3ZC6A 2ITWA 4U3ZA 2YISA 2C68A 2WMSA 3LCDA 3P9JA 5C8MA 3ET7A 3QCQA 1AGWA 4RIXB 5EI8A 4UWCA 4NT4A 3SA0A 2Q83A 2YABA 4TKSA 4K0YA 4BDDA 4E1ZA 3QQFA 2QHNA 4CQGA 4R78A 4C36A 3HV3A 2RF9A 3PY1A 4WNPA 4CRSA 2V7OA 4M14A 1Q97A 5HNBA 3NSZA 5CF8A 5LWMA 5AR4A 2DS1A 2X4ZA 1FPUA 1Q5KA 3Q4CA 4AE9A 2UW5A 4S31A 3V3VA 1IAJA 1OZ1A 1YWRA 5JGDA 1LUFA 3T3VA 5HCZA 5CEMA 2RFDA 3N4VA 5KMOA 4QQJA 3C51A 2EWAA 1Q3DA 4RGJA 1E1XA 4ACMA 2OJFE 4O0UA 3A4OX 4RJ5A 3ZUUA 2WEVA 1QPDA 4TZRA 2GHLA 3DXPA 3POOA 2J7TA 4MKCA 4ACCA 3DKOA 3BWFA 4AXAA 4C4EA 1ZOEA 3GXLA 3E5AA 1QCFA 1JKTA 2WQOA 4MF1A 1XBCA 4R3CA 3LJ1A 3HV7A 3R7IA 4E5AX 3S95A 2UW6A 5HE3A 3ZDIA 4EOKA 2OXXA 4W4WA 2HIWA 3D5VA 2WQBA 4WKQA 4ANBA 3CPBA 2ZAZA 4NWMA 3FAAA 2XIZA 4RJ6A 4JRVA 4P4CA 4NTTA 2X7GA 4FIFA 4KKHA 2X8EA 2XCHA 1Q8YA 2HENA 4FL1A 5AP7A 3LM0A 4BKYA 3SD0A 3MA3A 5EM5A 5B0XA 2B52A 2QR8A 3R21A 1NT2A 3FQSA 1F3MC 1M52A 2PZPA 2WELA 4J52A 4ID7A 3VWAA 3PRFA 2W1FA 4CXAA 4DINA 4LUDA 4X3FC 3R8VA 4IZAA 4O21A 5IUHA 5AAGA 3ANRA 1GNGA 2IVTA 3CTHA 3VAPA 5DH3A 4IH8A 4ZTMA 4FV9A 4D2VA 3V5QA 3WF5A 4IAAA 1REJA 4ZJJA 3JYAA 3AT2A 3BE2A 1U5RA 5FP5A 2VD5A 2OXYA 2BAKA 4FT0A 4QP7A 2OI4X 3HA8A 3LFSA 4EHGA 4FG9A 4OTFA 1G8SA 4O83A 3U54A 1VJYA 3TNIA 3PSDA 4TYGA 3KREA 4QMLA 3ZM9A 5J9ZA 5L2WA 2C3KA 2VO0A 5TT7A 5DPVA 2OZAA 3JPVA 1YXTA 4QP1A 3LM5A 4UYNA 5CSWA 5CAVA 2ONLA 5LVOA 5AUXA 3MV5A 4FSTA 4KUJA 2PVKA 4PUZA 2HAKA 1TQMA 4FYNA 3HYHA 3A7HA 4JXFA 4M69A 3BQCA 5HG7A 4AF3A 4FKVA 3PJ2A 4IC8A 4KIOA 4RMZA 5DA3A 2YIWA 2ZYBA 4RZWA 5A4TA 3DY7A 1YOJA 4GL9A 3BIZA 3TI1A 3HMIA 4YC3A 3DPKA 2W1ZA 1PHKA 3VRYA 1HCKA 5HTCA 4BDKA 4E20A 3HV6A 4RFZA 4I4FA 2VX1A 5CVFA 3C4XA 5CANA 3FSKA 4IADA 2HW6A 3C1XA 3E92A 3ORKA 2UZDA 3OXTA 5LVLA 3A7IA 3UC3A 3BV3A 2WTKC 4GT4A 1JOWB 4MWIA 5ICPA 2WXVA 3ORXA 4L53A 4J71A 3SG8A 3AMYA 3MIAA 3VBWA 4GT5A 5M4UA 4JAJA 4YLJA 4MK0A 2W06A 3NS9A 2EUFB 5ANOA 3WIGA 5KX8A 2VV9A 2ZV8A 3HX4A 4EHZA 5J7BA 2UW3A 4CT2A 2F57A 3UIBA 1YXXA 3PXKA 3VUTA 2W5HA 4M7IA 4QMPA 3TIZA 1H1WA 2JIVA 1XO2B 4U8ZA 3A4PA 4F4PA 5A14A 4NM0A 4XG7A 3RWQA 4PP9A 3CR0A 3DTWA 2GMXA 3Q4TA 4NCTA 4QMMA 3VHKA 4LGDA 4KRCA 2GTMA 3EQDA 4NFNA 4XMOA 5L4QA 4ZSAA 4Y85A 3TUDA 3NYOA 4RA4A 4EI4A 3VS3A 4F7SA 2QI8A 2BTSA 4FIEA 2O0UA 3D4QA 4RJ3A 5LVPA 3U6HA 4OTHA 4AP7A 3FE3A 4PP7A 3DK7A 3ZLXA 3UE4A 3F2RA 2O3PA 2WTKB 3F3UA 2WAJA 3NNWA 5TO8A 2PVNA 4IM3A 3NZ0A 4AUAA 1SYKA 2NPQA 3W33A 5B2LA 2W0JA 1WBNA 4WNKA 5AADA 3SV0A 4AQCA 5FXQA 2BZIB 4FL3A 2YM4A 2XNMA 1W83A 5HVYA 2R2PA 2VX3A 5L6OA 4RC3A 2VGOA 5EKNA 2CNUA 2J90A 1Z57A 5JEBA 3MIYA 3PFQA 4KWPA 4ARKA 4F7JA 3CP9A 3CKXA 2ITUA 2C0OA 5AP0A 4Q5EA 2A1AB 3ERKA 4AACA 4C0TA 5JFXA 2CKQA 2OGVA 4PTCA 1UNHA 3SVVA 2XK6A 4GYGA 2NO3A 2YM7A 3ZFXA 1NVSA 4F08A 3GNIB 4M66A 5BYLA 1OL2A 5HCXA 1KE5A 1PKGA 2JLDA 1R0EA 3DBCA 3NRMA 4DEEA 5KCVA 3R9RA 2CGWA 1B6CB 5CSPA 2QOIA 2X1NA 2KTYA 4I0SA 4D4YA 4AT5A 2XYNA 2GHMA 3P7AA 5L8LA 4PWNA 2XK7A 3RAKA 5CSXA 1XQZA 4U41A 3CXWA 4DA5A 1E9HA 3BHVA 3LMIA 1QPCA 3T8OA 2W4JA 4HYUA 2XIRA 3F9NA 3LFFA 1HCLA 2UW9A 2CN8A 3KK9A 3NNUA 4E8AA 2PMOX 2QLQA 3MJ2A 4D58A 3IDCA 3R02A 4FIIA 4RIWA 3HVCA 4FSUA 2I6LA 2WMTA 4IHPA 4HYHA 1XBBA 4D0XA 1O9UA 4FTMA 2XA4A 4EYJA 3O96A 4FV2A 5FWKK 4RC4A 4BICA 5LVMA 4RA5A 2XKCA 1H26A 4YSJA 1G8AA 5IUGA 3BYMA 4ENXA 3OROA 2HY0A
chains in the Genus database with same CATH superfamily
4FT9A 1OM1A 3NCGA 2J0KA 4U6RA 5CNOA 2BKKA 3B2WA 1X8BA 1KE9A 4XP3A 3KULB 3WE4A 1ZZ2A 4JG8A 3QRKA 2WTDA 3GP0A 2C5NA 4ZTQA 3D5UA 4AGUA 3H9RA 3PIZA 4DG0E 4PDOA 5CI6A 3AGMA 4AWIA 4EQUA 5JSMA 3V6RA 3ZS5A 2BIKB 3FL4A 4H39A 4LUEA 3QHWA 3KC3A 5CYIA 3OCBA 4V0GB 5M07A 2XH5A 4ZK5A 1MQBA 1M2RA 3LFBA 4WRGA 3I1AA 3KXHA 3BBWA 4FTOA 5CI7A 2NNWB 5DNRA 5LMKC 2JFLA 4D1ZA 4X7QA 4N6ZA 2PZ5A 4F9WA 4DBXA 4L68A 4ZSJA 3PZEA 2CJMA 4N57A 1ZY4A 2I40A 2XKDA 5DLSA 3T9IA 4RWKA 4QTDA 3ACKA 3C13A 2RG6A 4R1YA 3QRUA 5FEQA 3FPQA 3ZO2A 4Z16A 4PDSA 4BF2A 4BYIA 3P1AA 2G15A 4GU9A 1UV5A 2GU8A 2WO6A 3QTSA 3N4UA 3Q96A 4QNYA 4QYHA 4FV5A 2WMQA 4GS6A 2OF4A 2XJ2A 3NAXA 3R8PA 1TQIA 3IW5A 4RX7A 2KULA 4IBMA 1JVPP 2X39A 1ZYJA 2ZB0A 4IDTA 3U51A 3W10A 3ZZEA 5K5XA 5EOLA 3V5JA 4DDGA 1OKZA 1SNXA 2C6OA 2EB3A 3ACJA 4FKUA 4FZDB 4DFLA 4YP8A 4E5WA 5CEPA 2EB2A 5IH6A 3MS9A 4WO5A 3LFEA 4MD7E 4DEHA 1VLRA 4FKGA 2ITXA 3RP9A 2QKWB 4L7SA 3PYYA 3ZOSA 3NUSA 3R2BA 4F0IA 1YDRE 3NUNA 3IW4A 3EQBA 2Q0NA 4XUFA 4YTCA 3S1HA 1YW2A 4JDJA 2R3JA 3PJ8A 4RVTA 3ULZA 4EH3A 4GKIA 3QX2A 1DAYA 1H8FA 1GOLA 5AAEA 4ZJIA 2QODA 4MNEA 1OL1A 4MXCA 3R9OA 2EXMA 4AXFA 4JDIA 4YJUA 3TNWA 4JDHA 2GCDA 4AXEA 2BKZA 2QLUA 3DQWA 5E8ZA 3FMMA 3OUKA 3IW8A 5CAOA 2UW4A 2HW7A 4FRFA 1ZXEA 3NR9A 3PE1A 5FQDC 3DBQA 4BDAA 2X0PA 1UU3A 3PG1A 1YHSA 2QOQA 2CSNA 1UU8A 4DGOA 2IVSA 4AW1A 1MUOA 2FSTX 1ND4A 4BI2A 4CFXA 3UG2A 4RFMA 4LV8A 4KS7A 2PTKA 3IPHA 3EQPA 3O8TA 2IO6A 4LFIA 4UY9A 1SZMA 5L8KA 2Z7SA 4E4XA 2J5FA 3TV7A 3V01A 3UDBA 4IVAA 3VNTA 3G9NA 5CZHA 2C1BA 4O1PA 4QOXA 3N51A 1SM2A 2AC3A 3Q6WA 1XBAA 3SQQA 4Q5HA 3FSFA 3R8MA 3K3JA 4AZTA 4K9YA 2PL0A 2FSMX 3ORPA 3OW4A 4YZNA 4FSZA 4ZSLA 1GIJA 1Q24A 4TWCA 2B9JA 5BVWA 3UIMA 4F99A 1O6YA 2PZRA 4RRVA 4YZ9A 3UMWA 3PUFC 4EOQA 1U59A 1JLUE 4UB7A 4XBRA 2YJRA 4RJ8A 4WBOA 4DHFA 1ZLTA 2Y0AA 5HU9A 2JBPA 4YPDA 4C35A 1GZNA 3V5PA 3Q60A 2PUIA 3ML1A 5BQ0A 5DR2A 1OIRA 4QMVA 3ORMA 3DZQA 3ZUVA 1Y8YA 4WG5A 4X2NA 2REIA 1NY3A 1YXUA 3AD4A 1MP8A 5ETCA 4AAAA 2OJJA 3Q9ZA 4Z3VA 4BVUA 5M56A 2XALA 3KKVA 3VVHA 4DCAA 1YQJA 3GC8A 1NA7A 4H36A 5E8XA 2JDVA 4YNOA 3UQCA 1DM2A 1QPJA 5DT0A 1T46A 3CEKA 3BLHA 4FUYA 3VUDA 3ZMMA 1J91A 3TV4A 4CMOA 2X8DA 3KMMA 1FVVA 3FLQA 5A54A 3RHXA 4G6OA 4D4VA 3ODZX 5AIKA 3LFQA 1OMWA 4J1RA 3PA4A 4TYEA 1OIQA 4U80A 1J7LA 3NUAA 4G9RA 3WIKA 4FC0A 5CAPA 2XBJA 2QVSE 3GQLA 3SOCA 4FK3A 3DAEA 5AUVA 2WIPA 2BRHA 2YACA 4CFFA 4E6DA 1XMMA 4UMUA 3LKMA 3QQUA 4OTPA 2VTRA 4J97A 4R7IA 4YNEA 2DYLA 5K3YA 2FO0A 1ERKA 3QD0A 3EQHA 5FD2A 3KA0A 4EHVA 2VTMA 4E93A 4AA0A 5J5SA 4R77A 1A06A 3BPRA 4O7LA 2A4LA 3AC2A 2VTIA 3QQLA 4EBVA 4ZAUA 2W7XA 3GOPA 3HRBA 4L42A 4YJVA 4E6AA 4MXAA 4OBQA 3IOKA 3ORZA 1WCCA 2JDSA 2CKPA 4F6WA 5IEYA 3FQHA 3EZRA 3VRZA 3UNKA 4NIFB 2GQGA 3QGYA 5HLWA 5LMBA 4NKSA 1PYEA 4EBWA 2V5QA 4GK2A 5CXZA 4CG9A 1URCA 2R3RA 3B8QA 4EQCA 3UO5A 2HZNA 4BCOA 2Z7LA 1GIIA 3L8VA 2YHVA 3LXKA 3RTPA 4AN9A 2WMWA 4GSBA 4JQ7A 3VS4A 1PXOA 4JBVA 2CMWA 3FYKX 1XH8A 4OTQA 2OJ9A 4ASZA 3QTWA 4CYIA 1YI3A 3MY1A 5IDNA 2O8YA 3OY1A 4JR7A 3JY9A 4LRMA 4ERWA 4X2GA 2IVUA 4ZY4A 4BTJA 2XMYA 3V5TA 4IMYA 4RVKA 4A4OA 4X6RA 5C1QB 4JX7A 4KB8A 4NTSA 4USFA 3A8WA 3MH1A 2GQRA 5GINE 4QMWA 5I3RA 1CKPA 5TE0A 2X0GA 3RGFA 5IQAA 4EOJA 3GU8A 5FEDA 3TKHA 2PY3A 3IQ7A 3G0EA 2GNHA 1JWHA 3PSCA 2JDOA 4BC6A 4ANOA 5I9VA 4CFWA 3RPOA 3ZDUA 3LOKA 3SOAA 3T3UA 3ZLSA 4BR3A 3P4KA 3O7LB 5CVHA 4AFJA 4QEBA 5IDPA 4DDIA 1KOAA 3R1NA 3ZHPC 3O0GA 5ANJA 2BRBA 3OHTA 4MQ1A 2PVHA 5DI1A 2ITNA 3PVUA 3OZ6A 3DJ5A 4AN2A 3FC1X 2QOOA 3QD4A 4J8MA 4F6UA 5I9XA 3A7FA 4GFGA 4J53A 4YJOA 2O64A 4RQKA 3QTXA 4D2RA 3RNIA 3ZFMA 3A8XA 4ACGA 3AC1A 3OEZA 5JQ5A 2PVMA 4TPTA 3SG9A 2JEDA 1Z5MA 1OIYA 4FT7A 3IG7A 2ZVAA 3R8ZA 4H3BA 2VTQA 3FI8A 3W0PA 4C8BA 3L8XA 3NW7A 2UW7A 4XEYA 4ALWA 4PNKA 3LE6A 1WBSA 4FTJA 4BBFA 3K5UA 1R78A 5IISA 3R7VA 3BELA 4FI1A 3QKLA 3D7TB 4D2SA 3CQEA 1FGKA 4BGHA 4HVHA 5K0XA 3FLNC 3ZTXA 1SVHA 3M42A 2W9ZB 1WVXA 3C9WA 1NVQA 3R9NA 4EH7A 4YPSA 4O7TA 3GFWA 5EQPA 2IW8A 1J1BA 1PMVA 3BV2A 3EH9A 2R3MA 2XIXA 1W2CA 2FSOX 3MDYA 5A4LA 4FIGA 3HAVA 3IDPA 5HE0A 2P2IA 3OCSA 4L3PA 3Q2MA 3B2TA 4MTAA 3MN3A 5BMMA 3R9HA 1Y8GA 1ZYCA 5IA3A 3MFSA 2OICA 3KRJA 4YHTA 3RHKA 4PMPA 2PE0A 3UYTA 1BKXA 1Q4LA 4GUBA 2Y8OA 1BYGA 3HV4A 2Y4IC 3PXQA 4QMZA 4RX9A 3ZSIA 4EOPA 1VYWA 4ACHA 3UBDA 5JZJA 4FTRA 4IVBA 3TMOA 3V8TA 2CGVA 4KKGA 2ETRA 5C8KA 4IX3A 4EOMA 2BZHB 2VAGA 2PE2A 3NAYA 5HBHA 3U9NA 4EJNA 3P78A 2IN6A 3PY0A 3FYJX 4QMYA 5FBNC 3RM7A 4A9UA 2OIQA 1LR4A 1H0VA 4PMMA 4ZJVA 2W5AA 3MGYA 4F09A 3UVQA 3W0SA 4O4CA 2J0MB 4EH6A 2BDWA 2QURA 3BHUA 4RG0A 5DWRA 2XM9A 4C2VA 3UNZA 2C6DA 4X6QC 3TDVA 3ZBXA 2YM5A 3OWPA 4QYYA 3WYXA 4Y83A 2VO7A 5IQEA 2ITTA 4PRJA 5E8SA 4FZAB 4JAIA 2Y4IB 4O2PA 5ETIA 3AC4A 4FIJA 5E92A 3A7GA 4AA4A 3ZO4A 4YC8A 1G8KA 4LI5A 5AV2A 1W7HA 3AKJA 3CGFA 4O0SA 1MQ4A 4B8LA 4FUXA 4LOQA 3OWLA 2X7FA 4JBOA 4RIYA 4LMNA 3R6XA 5E8VA 3ZU7A 4WSQA 4WNMA 3L9MA 4EWQA 4JVGA 2Y6OA 3VBVA 3MVLA 2Y4PA 4TL0A 4UMPA 3PP0A 4NW6A 4JIKA 4JNWA 4F0FA 3ALNA 2FUMA 1KE7A 5IMXA 2LGCA 3KB7A 1H07A 2GFSA 3QQKA 2OFVA 3HMPA 4AZSA 4HCTA 3VF8A 4MBLA 4J98A 4FKRA 4LV7A 4XCUA 4D28A 5HHWA 5EQEA 3R8LA 1OGUA 1JKKA 2PMLX 4RJ7A 2ZOQA 3QKKA 4GRBA 4XG4A 1FMOE 3DK6A 4C4JA 4U3YA 3QWKA 4ZY5A 4ZS0A 4J7BA 1YWVA 3QTZA 4L7FA 5C27A 1GZKA 4MBJA 3QF9A 3PP1A 4L9IA 5FTQA 4GIHA 4JRNA 3FHRA 4DTAA 4CGAA 1ZMVA 1KUTA 1XJDA 4W9WA 3D0EA 3BHTA 2YWVA 3P7CA 1OUKA 2ZFYA 1GY3A 1TZDA 3O23A 4C34A 1FINA 5IG1A 1Q8TA 5FG8A 4PMTA 4KIKA 2XNGA 3CCNA 2A0CX 3RPRA 2PMIA 2V22A 5H3QA 4CLIA 5HQ0A 2W1CA 5IH5A 3TKUA 5E8YA 3S3IA 4IFCA 3AD5A 4DHIB 3QX4A 4G3CA 4U9AA 4FOBA 4C61A 4FX3A 1A48A 4FVPA 5ANDA 3BCEA 4FICA 1FVRA 5FEEA 4IB0A 3RPVA 3UGCA 5BX0A 4EZ5A 3OMVA 3BEAA 2JC6A 4PL3A 3II5A 4YJPA 5B7VA 1WFCA 2VTLA 4HJOA 4QNAA 2B54A 5BUEA 4XV2A 1H1PA 3EZVA 3PY3A 3KEXA 5BNJA 3ORNA 3COHA 1STCE 3W1FA 4AGWA 2WZJA 4FG8A 2EXEA 5H2UA 3PLSA 3QZHA 3WF9A 5HIDA 3KK8A 4FV8A 5CNNA 4AS0A 1PMNA 4EC8A 5IF1A 5HE2A 4LRKA 3EN7A 3GENA 3FI4A 4O7NA 5CF6A 5DBXA 5JT2A 2RG5A 3MTFA 1FBNA 3GEQA 3V51A 1F0QA 4FKJA 4AN3A 5CF5A 1JSUA 3HUBA 4K6ZA 4PPCA 5IA4A 3E64A 4ITHA 5LWNA 1O6LA 2UZOA 3MPAA 5AX9A 5AP6A 3FWQA 3QZIA 3KMWA 3BYSA 2VTJA 2WKMA 4NFMA 5EI2A 3BZ3A 2C1AA 2YIXA 3DB8A 1P5EA 1RE8A 3MTLA 5GNKA 3MB6A 2HCKA 4I0RA 3QALE 4XH6A 3SRVB 4AU8A 4FA2A 1TFFA 2VX0A 4QPAA 3UO6A 2CKEA 3UDZA 1Q62A 2IW9A 2H34A 3P08A 4FZ6A 5KHXA 2HK5A 2XAMA 1XH9A 2C3LA 3W2OA 3SGCA 5J79A 4C37A 3AC8A 5EOBA 5DE2A 3SC1A 4U40A 5KMIA 2PK9A 3DFCB 5CVGA 4CD0A 4AZEA 4FMQA 3DK3A 4QPMA 4OW8A 5HD7A 2HOGA 3F2AA 2ZMDA 1JQHA 3MH0A 4BCIA 4DFYA 2B9HA 4XG9A 2VTNA 5FM3A 3JXWA 2GNIA 3RNYA 2XNNA 2B7AA 4G3EA 4L43A 5AUUA 4APPA 5CU0A 4PNIA 2CCHA 5HG5A 4X0MA 3ZRLA 2JKKA 4C59A 3UVPA 4H3PA 4WHZA 3RCDA 3PXFA 2YAKA 4LQMA 1W2FA 3FLZA 4ZMFA 3GCQA 5HBJA 3CIKA 4FOCA 4WUNA 3S4QA 3COMA 4I3ZA 5I9WA 5FXRA 2HYYA 5ANKA 2I7QA 5GHVA 4CZYB 3DLZA 4CG8A 2WQNA 2UUEA 4FIHA 1Q8ZA 1REKA 3AKLA 3R71A 1ATPE 4BDFA 4BGGA 3IECA 1SVEA 3C4CA 2R4BA 2WD1A 3PFYA 3VUMA 3D94A 1W82A 3OWKA 4V04A 2P4IA 4CSVA 4CZTA 4D2PA 2R3IA 5ITAA 3F6XA 4L3LA 3Q2JA 3QQHA 2PVJA 2JKQA 3PIXA 4QMUA 2WMRA 3QU0A 4FKPA 4PTGA 5HI2A 3WF6A 5KZ0A 4OTDA 1Y6AA 1FOTA 5DMZA 2P0CA 4KIQA 4AAYA 3FMHA 5G1XA 2QG7A 4K18A 2OJGA 5KZIA 3DGKA 3RK5A 3JVSA 3ZBFA 2YEXA 4AG8A 4KD1A 5IPJA 2X6DA 1ZRZA 4X3FB 1OPJA 4BCKA 1U4DA 3KGAA 4I5HA 5EFQA 3TCPA 4MBIA 4RWLA 5GJDA 4DITA 4B0GA 2IF8A 4FV7A 2BIYA 3SLSA 2WTWA 3NLBA 3I5ZA 3EB0A 5L2SA 4NM7A 5D1JA 3W2PA 4BGQA 4U5JA 3ODYX 4I6FA 1UKHA 4G1WA 4BWKA 4X2JA 3RI1A 1IRKA 1WAKA 5BVFA 5IU2A 3F88A 2C0IA 3Q9XA 4FV0A 4KS8A 4L6QA 4YJNA 3C0GA 2O2UA 3HGKA 3ZRMA 4BCMA 1XH5A 2JIUA 1M2PA 2OW3A 3E8EA 3EKKA 3OG7A 3U9CA 4BN1A 4F0GA 1UA2A 4EK5A 4PF4A 1Q61A 4QP3A 3CQUA 2SRCA 4IAFA 4Y8DA 3IW6A 5CAQA 1J7UA 3OTVA 5AUWA 5IA0A 5KUPA 4FG7A 3U6JA 1CTPE 4A9YA 2VWZA 3EQGA 3GCVA 4YJQA 3RALA 4I24A 2F7XE 5EM8A 1R0PA 3Q4UA 3OBJA 4U79A 4DH3A 4K1BA 3WZJA 4TYJA 3H10A 4YMJA 4H05A 4EKKA 4EK4A 1GIHA 1VYZA 3NPCA 3TN8A 2B4SB 4AE6A 4FSQA 4ALVA 2I0VA 4S34A 4CFUA 4LMUA 4ZZOA 4MXXA 5T6KA 1YDSE 2ZV2A 3G2FA 5FXSA 3UODA 1RDQE 4D2WA 4EOSA 4KSQA 3TZ8A 2VWUA 5CWZA 4FTCA 4I5CA 5J1WA 4R3RA 3HL7A 4TNDA 2QONA 4YC6A 3VBYA 4E4LA 4EH2A 3NVMB 2QKRA 2R3GA 2JDRA 4KSPA 3R83A 3QKMA 1I09A 4ACDA 1TQPA 3DT1A 2V62A 3C0IA 4FT5A 2FB8A 3CGOA 2WQEA 5EG3A 3ZEWA 2OFUA 3AKKA 4ZLYA 4E7WA 2X9FA 1OBGA 3GFEA 3IS5A 5KHWA 2ZMCA 4CZUA 2ZM3A 3D15A 3EN6A 1Q8UA 3ZONA 4DG2E 2C3IB 2IW6A 3ZLWA 4AZWA 2XEYA 4RLLA 2DQ7X 3PVBA 3L9LA 4G6NA 1G8JA 4L67A 5J7HA 2C69A 3BGQA 2VTAA 4S2ZA 4Y72A 5HO6A 4FEVA 4AGCA 4IACA 3FDNA 4DEDA 4DGGA 4DFUA 4BHNA 2GFCA 1XHAA 4U42A 4YZDA 5CF4A 3PA3A 3IGGA 4IB1A 2CGUA 2QR7A 3VBXA 4W4YA 1SNUA 4NJ3A 5IQFA 3V6SA 2PVYA 2OU7A 4Z9LA 4BDCA 5HD4A 2C6TA 2ZM4A 4H58A 1TKIA 4XV9A 3TTJA 3GU4A 3L9PA 1SVGA 3BWJA 4O6LA 4I93A 3TUCA 3M11A 4TT7A 3B8RA 2I0EA 2GTNA 4XJ0A 4YGAA 1IA9A 3UDTA 4A9RA 4G3FA 3V04A 2XK8A 3NIZA 3W8LA 1IR3A 4F7LA 2IZUA 3HDMA 2X0QA 1H27A 2YZAA 5AR8A 3GVUA 4ANLA 5HNGA 3P23A 5I4NA 2UZWE 4D5KA 4O91A 3NW6A 5JK3A 3VN9A 1PXNA 3P79A 4TRLA 4D5HA 4F1OA 3DOGA 3FUPA 4GH2A 3QRJA 2YIRA 5EH0A 3CQWA 3I0QA 4YTIA 3UMXA 3OCGA 4NJDA 3ALOA 2XBAA 4IX6A 2QHMA 4DFZE 3EFJA 3I6WA 4I4EA 4P7EA 4C62A 4X2KA 1L3RE 4XP2A 4MD8E 3LJ0A 3FEGA 5GIPE 5FTOA 5EW9A 2BHEA 4C4GA 3DLSA 4N70A 2QCSA 2PE1A 2WNTA 3G15A 4FEWA 1Y57A 4JG7A 2QOCA 4ZZNA 1M7NA 5M53A 3BL7A 4BWXA 3KRLA 4KRDA 2OG8A 3KQ7A 3R7UA 3Q6UA 4ANSA 4APCA 4AW0A 4BIBA 5F9EA 5AV4A 5E8WA 2VTTA 4O7WA 1UNGA 2B1PA 2V55A 1K2PA 4FTUA 4NH1A 4O38A 3F3ZA 4YUQA 2Q0BA 4BDGA 1U54A 2IPXA 2XRUA 4KABA 3AXWA 2WU6A 3LIJA 2HZIA 3R7YA 3P0MA 2AEGA 3SX9A 4FZFB 5KO1A 1OL7A 2R3PA 4FT3A 5AUYA 3ENHA 3MWUA 4I6HA 3OY3A 2PHKA 4M97A 4HCUA 2NRYA 3F5GA 5DOSA 3LCOA 3EFWA 2JAMA 4Y46A 3OBGA 3CD3A 4CT1A 4N6YA 1ZOHA 4YR8A 1XH4A 2GS6A 4FKLA 2PUPA 2WB8A 1XH6A 3QTQA 5LJJA 1H0WA 4RIXA 4J95A 3EQCA 1CM8A 4IX5A 4C4FA 4KA3A 4V05A 5M09A 2WPAA 5DRBA 3E3PA 4D9UA 2NP8A 3COIA 2OLCA 4Z55A 3UC4A 4NK9A 3F5PA 2VTSA 1V1KA 1IG1A 4DEAA 3F3WA 4FV3A 3OT3A 5HNIX 1ZOGA 2R0UA 4JS8A 3BKBA 1T45A 4XHKB 5H9BA 1EH4A 3TJDA 2C6EA 1ZARA 5I9YA 1W98A 4DH1A 2PPQA 1VEBA 4W9XA 4RX8A 3PZHA 4QQ5A 2W1GA 4FTNA 4YZBA 3BL9A 3ENMA 1WBTA 4CQEA 3R00A 4IANA 3H0ZA 3ETAA 3MW1A 2YDKA 3GB2A 5CALA 5HTBA 3E8NA 4BIEA 3MPTA 5CASA 5EHOA 3UNJA 3EN4A 5LOHA 5I3OA 2UZNA 3LXPA 4X3JA 2P55A 3BGZA 4GFOA 5H8GA 3R8UA 3TNHA 5HO8A 2C6LA 5EDPA 3ZCLA 5CXHA 4NZWB 4TWOA 4W4VA 3PRIA 4CFNA 5JFSA 4DGMA 3MSSA 1OBDA 3GI3A 5IA1A 3R73A 2J6MA 3ITZA 4QYFA 3ZUTA 2R64A 4PDPA 4QMOA 2E9NA 4O0WA 3O50A 1PXPA 4WD5A 3AD6A 3VQHA 4I21A 4LOPA 4O0YA 4ZS4A 3R22A 2B9FA 4PX6A 2XARA 1Y91A 3BU5A 2XS0A 3FZSA 4MYGA 4BCNA 4AA5A 2VWWA 3QWJA 3OVVA 3AQVA 3PXZA 3AT3A 5AR3A 5LARA 4P2KA 3PJ3A 5IQDA 3RKBA 5EYCA 3HKOA 5G6VA 3HMNA 3NDMA 4HYSA 1PJKA 1ZWSA 2OIDA 4MAOA 5C26A 5HOAA 2VWVA 3C5IA 4C3FA 4YSMA 3G33A 5A46A 2Y7JA 1VZOA 3DXNA 4KNBA 5JFWA 5JRSA 3FZPA 4UMTA 4DTBA 2X6EA 2X0OA 4QP8A 4NM5A 4F9BA 4RSSA 2RL5A 3DB6A 2OZOA 3W16A 3LQ3A 4CCUA 5HVKA 3LXNA 4CRLA 3GU5A 5BVNA 4X3FA 5BV3A 5DT3A 5IEXA 3VJOA 3ZFYA 4AGDA 1YKRA 4XX9A 3S00A 4O6EA 5IQBA 3P5KA 4QTCA 5BUJA 5C4KA 1Q3WA 3Q5ZA 3BQRA 5ACBC 3RINA 4ZIMA 2QU6A 5C01A 3PVGA 3CE3A 4TTHB 3NGAA 5DEYA 3OXZA 3QC4A 5ACKA 3FC2A 3DKGA 1FMKA 2G1TA 3BRBA 4BDEA 4XP0A 3E7OA 4X21A 4DEGA 2YDJA 2RSVA 4ZP5A 2F7EE 4M13A 4ZSEA 3V8SA 2HELA 2UZTA 5A6NA 3MYGA 3LCSA 3R7EA 2HWPA 4I6BA 5CLPA 5AM7A 2XRWA 2GS7A 5K0KA 4DBNA 4O84A 2G2IA 3QGWA 4FKTA 4PPAA 4Y5HA 4F65A 4FEQA 3FXXA 5TOZA 4Y95A 5CT7A 4EWHA 3AG9A 4MQ2A 5JMSA 2C47A 3R0TA 4GG5A 2IJMA 1S9JA 3F61A 5D11A 4E26A 4GVAA 1XR1A 3VQUA 1YXSA 4R1VA 3FMKA 4KAOA 4TWNA 4UXLA 4OLIA 2IZSA 4U45A 5L8JA 4YO6A 5L2QA 3Q4ZA 4MEDA 4O1OA 4DAWA 5M4IA 5DYJA 1DAWA 5E4HA 3GC7A 4UWYA 1IASA 3VBQA 3MFRA 3VS7A 2XP2A 4FYOA 2W96B 3H3CA 3G6GA 4L00A 5D9HA 1PKDA 2ONLC 4BZNA 3DAKA 4EUTA 1BMKA 2E9PA 3EYGA 3Q9YA 3W0MA 1L8TA 4D55A 1Y6BA 2W1DA 4FV6A 4IJ9A 3UTOA 3W2SA 4C3RA 4O7RA 3GQIA 4D2TA 4BDJA 2BVAA 5JRQA 4I22A 5L2TA 4XG8A 2C5XA 4HCVA 5IKWA 4CFMA 1JAMA 3FV8A 3UIXA 4S30A 3W0NA 3LVPA 1MRYA 3HMOA 3W8QA 5DHJA 1YI4A 5HU3A 4DLJA 1PXMA 4OBOA 5B2KA 4LDTA 4YJRA 1WBWA 5CU4A 1M14A 4L01A 3VJNA 4BYJA 2OZAB 1K3AA 3H9FA 3TZ9A 2IZRA 2YWPA 3OW3A 4FE2A 5E8TA 4AOIA 1ST4A 3MI9A 4B4LA 4U44A 4A9TA 3QCYA 4M69B 4M0YA 2BMCA 2VWBA 3VS6A 5CAUA 4IVDA 3LMHA 5K9IA 5HTIA 3E63A 2HZ4A 4MHAA 2J5EA 3EJ1A 5HESA 3PDTA 5FDXA 4NCTC 4IM2A 4BZDA 3F3VA 5A4EA 2UZEA 3ZH8A 4DGLC 3BU6A 3UPXA 5BUIA 4DE4A 4CKIA 4MX9A 2OO8X 4FNXA 3Q52A 4USDA 3UO4A 4IFGA 1KV2A 5J95A 1FQ1B 4FKSA 5IA5A 3TDWA 4FSMA 3DNDA 3UPZA 4I23A 2WU7A 4Z7GA 4XNEA 3FL5A 1H24A 3PVWA 5CEIA 3A61A 3RBWA 1P14A 5AEPA 1U5QA 1KOBA 4W8DA 4O81A 5JZNA 2C6KA 4IB5A 5M4FA 4M3QA 4OUCA 2FGIA 3PWYA 2ZJWA 4BY9E 4PPBA 3I79A 4H3QA 3TXOA 2JD5A 3BLAA 1BX6A 1BL7A 3KULA 5LCJA 3G5DA 3QRTA 2BPMA 4HOKA 4UV0A 1PXKA 2JFMA 1JPAA 2XZSA 2Z60A 3WZEA 4F1TA 1J7IA 1S9IA 1O6KA 3HECA 4OTWA 4ZTHA 3AMAA 1JNKA 2OJIA 2BR1A 2F9GA 3FY2A 5A4QA 2G2HA 4E6CA 4UN0C 4V0GA 3TKIA 2ITVA 3EFKA 4DT8A 4WBBB 3VULA 5FTGA 3AT4A 3CJGA 2H96A 2XNEA 3VO3A 2R3NA 5EM6A 1SMHA 1G3NA 1XKKA 2QO2A 4AZFA 1QPEA 4FL2A 4EH8A 2FH9A 2V7AA 4YZMA 3RK7A 3O2MA 4FSWA 5ETFA 2XM8A 4I94A 2P33A 4FGBA 2G2FA 4L52A 4G31A 3DBDA 4IAYA 4MCVA 2F49A 2QOHA 2ZB1A 3HV5A 2QO9A 3QHRA 2X81A 3SHEA 4FGRA 5DG5A 3RAIA 4D9TA 4YLKA 2OIBA 4QTAA 5C8NA 3QTIA 2R7BA 2XB7A 3Q32A 3ZXTA 4EKLA 1FGIA 4Y73A 2W1IA 2OBJA 2PVRA 3GGFA 3U55A 4EONA 4CV9A 2WMBA 4GUEA 4YTFA 3F82A 5E7RA 5D7AA 2R3OA 3HMMA 4QP6A 5IQGA 3F3TA 2X2MA 2VU3A 5DVRA 3QXPA 4FKOA 4C3PA 4AZVA 4A07A 4QP9A 5LMKA 2QD9A 2J50A 2RKUA 3G0FA 3FI3A 3AC5A 1OECA 4EOOA 3W2CA 4HZRA 4DFXE 4JIAA 3SXSA 4ORKA 2RIOA 2VNYA 4GFMA 3GU7A 1OL6A 4ZEGA 3BI6A 4M15A 4CMUA 2A19B 2BROA 2OXDA 1TVOA 1WZYA 2WFYA 2VZ6A 2WQMA 2I1MA 3O7LD 3QL8A 3NUYA 3ZM4A 5AR5A 1F5QA 4FV4A 2HZ0A 3C4ZA 1UWJA