1SVEA

Crystal structure of protein kinase a in complex with azepane derivative 1
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
344
structure length
341
Chain Sequence
KKGEQESVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVMLVKHMETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFSEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords cAMP-dependent protein kinase, alpha-catalytic subunit
publication title Structure-based optimization of novel azepane derivatives as PKB inhibitors
pubmed doi rcsb
source organism Bos taurus
total genus 109
structure length 341
sequence length 344
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2004-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1sveA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1sveA02
5EQEA 5AAGA 3D5UA 2W1FA 3LW0A 3CY2A 3BHTA 1H00A 1CMKE 2ITQA 2X4FA 2XZSA 2YISA 3A7FA 3NRMA 3PIZA 3SOCA 4MD8E 5EKOA 3VS0A 5LJJA 3LLAA 3BPRA 3ZO2A 3NVKI 1X8BA 2ERKA 1VEBA 4DH3A 2YM4A 3C9WA 5CAVA 3EHAA 2YJSA 2EXCX 2JBOA 4OTRA 5J87A 2ZMDA 2ITPA 3F3TA 3W16A 4U9AA 4DYMA 1KOAA 5EKNA 3VVHA 4YC8A 1KWPA 3UYTA 2WQNA 4GYIA 1DAYA 5LCJA 4J1RA 5CXZA 1VZOA 2WTVA 5KMMA 5L2TA 3FI2A 2R3HA 4BTMA 3W2SA 5FBOA 3WZDA 4RT7A 4R5SA 4JIKA 4CKIA 5L6PA 3DPKA 3L9NA 3DJ7A 5IZFA 2BRHA 2Y4IC 3E7OA 1XBAA 2VWZA 3AC4A 3DAKA 2Y9QA 4KAOA 5IA0A 4IX3A 4JJRA 4BDFA 2BALA 3D2IA 3QD4A 4L3LA 4RX7A 2ETMA 1R0PA 3RK7A 4C4GA 4A9UA 4D2TA 4M7IA 2WGJA 4HZRA 2QU5A 3TI1A 4BBMA 1J3HA 3UO4A 4FTCA 2H8HA 5DFPA 1ZY4A 2UW4A 4DFYA 2I0HA 5IKWA 1OGUA 3GC9A 4IANA 3CTJA 3F69A 2C3KA 3Q6WA 5IQFA 2YACA 4WT6A 3PLAE 4UV0A 3QQLA 4IM3A 1WVXA 5JZJA 3VIDA 4XG6A 3A4OX 4FKUA 4GIIA 3RMFA 2IVUA 3ZDUA 4BHZA 3Q6UA 2JAVA 4D5HA 3BHUA 3O7LD 4JG6A 4RA5A 4CQGA 3FXZA 3S95A 2YIQA 4BI0A 3TDVA 1M52A 4FL3A 2VTMA 5HCYA 2Z7LA 3JS2A 3JY0A 1Q3DA 4S30A 5FUTA 4ERWA 3R8LA 3COKA 4IXPA 4F99A 5IH5A 3DAEA 4NL0A 4CCUA 3OCGA 4Q9ZA 5A9UA 3QQHA 4LYNA 5FRIA 2QURA 3FDNA 5A4CA 4LGHA 3A62A 2IN6A 3RWQA 3TKUA 1IR3A 2WMQA 4AZSA 4QMNA 2XYNA 4O0TA 5FXSA 4DGGA 3ORXA 2HOGA 2C1BA 2QLUA 4DEHA 2C3IB 4K2RA 5M51A 4L6QA 3B2WA 3WF9A 4ACHA 2YCRA 2VD5A 5HE0A 3O7LB 2J7TA 1XBBA 2OJFE 2OO8X 4IAYA 4JBOA 5JFVA 3EL7A 3Q9XA 5JZNA 4G6LA 3VUKA 3EZVA 2C69A 4MX9A 3NW6A 3VS3A 3FHRA 4ENXA 2O64A 2R2PA 5HG5A 2PUIA 4MNEA 4FTJA 4HVHA 5HG7A 4DE4A 3MDYA 3DS6A 3Q9YA 4IX5A 4LUEA 4ZSEA 3QHRA 5DT3A 4GT3A 3MY0A 3UNZA 3ZBXA 3CPCA 4CG8A 5HG9A 3NZ0A 4UN0C 1UV5A 1CM8A 2YWPA 3FMLA 5ETAA 3WF8A 5CAOA 2OI4X 3WZEA 3BU3A 3EN6A 3ORMA 3PE1A 3QZHA 2X9EA 5CEIA 2BVAA 4B99A 1NY3A 2C5OA 4MK0A 3QCQA 4JAIA 3QX2A 4HYIA 3OXTA 5TOZA 2VTJA 5AUWA 4BBFA 3L9MA 4MVFA 2J2IB 2Z60A 5DRDA 5IMXA 1LP4A 2UW7A 4GYGA 2VUWA 2PVYA 4C4EA 3UC3A 2WMUA 4BCKA 3AC2A 2OLCA 1JNKA 2VTHA 2E9UA 1KE5A 3RAKA 3GEQA 4F7LA 3Q2JA 3VQUA 1XKKA 3NW5A 4DFNA 5E9EA 3TUCA 5T3QA 4PF4A 4GUBA 3OUNB 1Q8WA 2UUEA 4FSQA 4Q5HA 3WIKA 4C4FA 3G90X 4O82A 4FSTA 3FLZA 4G3CA 4O91A 1QPCA 2CSNA 4IWPA 3R7EA 4BDGA 3Q96A 1ZYLA 3MESA 4FGRA 3R8UA 4F08A 3EWHA 3L8SA 4JNWA 4R6VA 4XG3A 3D7TA 4NWMA 3R04A 3QA0A 3QRUA 2R3GA 3PTGA 4P7EA 4BZDA 3NAXA 4RJ4A 4GKHA 1STCE 3M42A 4YNOA 2FA2A 5DI1A 3KU2A 2WMXA 3BHVA 4FTMA 1CTPE 1YOLA 3QTQA 2OJJA 3GCVA 4G5PA 4HNIA 5CI6A 3R9HA 2CNQA 5AAEA 3OWLA 4IADA 4JDIA 3VN9A 1FVRA 2Y8OA 3TUDA 4G3EA 4ORKA 3DB6A 4U81A 1H4LA 3R30A 5CANA 4JX3A 3R71A 2C6DA 2B52A 4XG9A 4ZZMA 4QD6A 2XA4A 4I6BA 4HVGA 2UW0A 2IW6A 2VGPA 4WA9A 4KKEA 4F9AA 1WBTA 5BUIA 4IB1A 1WBWA 4O0WA 4QTCA 3SG8A 4A7CA 3KCKA 3HEGA 3TUBA 2OIDA 2X2LA 5HNGA 4BDIA 4UBAA 2C6OA 2JD5A 4MXXA 3QLFA 4BVUA 4EH6A 4NJDA 5CF8A 2QOFA 4FODA 5EW8A 1PXIA 5KE0A 4FKOA 4NIFB 4MBJA 2PZYA 2CGUA 5CX9A 5DN3A 3N4VA 4W9XA 2F7EE 4QYHA 1YI3A 2ZVAA 2B9JA 4IB3A 3GB2A 2UVYA 4O7YA 3RCJA 3PXKA 1U46A 3BYOA 2V0DA 3P4KA 3QTXA 5G1XA 3W10A 1JAMA 2J51A 2OKRA 3DBEA 4JQEA 2OIBA 4U7ZA 2YM3A 5HVJA 4QMWA 2V5QA 4HGEA 2BRGA 3MY1A 2WQEA 4RG0A 4RJ6A 4DEDA 4O86A 5G6VA 4FNYA 4R8QA 4JRVA 3FY2A 3ZSIA 2BZJA 4QPAA 4X3FA 3QC9A 3PVUA 2GS7A 3FMJA 3WOWA 4EOLA 2YIWA 3E62A 4RJ3A 5J9LA 4A4XA 4U80A 4YLJA 3BE9A 2BHHA 3R8ZA 3FXWA 2RFDA 3EJ1A 4C37A 4NT4A 1H24A 5EI6A 5EOLA 4FSRA 4P4CA 5DT0A 5CF5A 1PYEA 3FYJX 4CKRA 2XBJA 2PU8A 4QP9A 5I9YA 2HIWA 3ET7A 3NEWA 2YZAA 2ZM1A 4UWCA 4EWQA 5GINE 2QKRA 1FOTA 4BDDA 2B9IA 3MB7A 5J5SA 4KWPA 3AG9A 4E8AA 3SOAA 1W7HA 4CZYB 2IVSA 3ZC5A 4HVDA 2O5KA 3P08A 3R1QA 4FG9A 3VUGA 3NPCA 4O0XA 4S34A 3ZEWA 4E4NA 1Z9XA 3GCPA 2GFCA 2JDSA 2RG6A 2BIKB 2XKCA 4E6CA 1LUFA 3TNQB 5D9HA 3KXXA 4QP1A 4YUQA 2OFUA 4R7IA 2VTNA 5CT7A 4BDBA 3VWAA 5IA5A 1OBGA 5DMZA 1JQHA 4BCOA 5DVRA 4TYIA 4NTTA 3UVPA 3AC8A 4D2SA 1LR4A 4PMMA 3E8CA 5CTPA 5IEVA 3KXHA 5FTGA 4DEGA 3ZCLA 3QALE 2BTRA 4I1ZA 4J8MA 3QUPA 5AUUA 1V0BA 4G9CA 4L52A 1AQ1A 3TACA 2BROA 2J0MB 4CFVA 2WU7A 5CU6A 3DDQA 4CFWA 4AWIA 4QOXA 5CXHA 4DINA 3OS3A 2BFYA 1YXXA 3SD0A 2OK1A 2BRMA 2VU3A 3H0YA 4IMYA 5CSVA 4B9DA 1TQMA 3P1AA 3EQHA 5T6KA 3TZ7A 4A9RA 3R6XA 4AOJA 3RP9A 2HELA 5HNIX 1G3NA 4AACA 5IPJA 2QO7A 4NKSA 2I1MA 2JKKA 1L3RE 1UNHA 4PMPA 1SVGA 2RFNA 2IJMA 4MD7E 2HY0A 3ORIA 4FV1A 4E6AA 4EHVA 2NRYA 2I7QA 4FEWA 5CZIA 3GQIA 1IG1A 5AUXA 3LZBA 3LQ5A 5FM3A 5BVWA 4QPSA 3Q32A 4HNFA 3A8XA 5KNJA 2PVFA 1RQQA 4J8NA 2IW8A 3PUPA 4J97A 4WBOA 3G6GA 1Z5MA 3DJ5A 3NNWA 2BR1A 5FDPA 5B2KA 3HMNA 4AFJA 2RIOA 4XRJA 5CY3A 3C4FA 5IDPA 1ZOGA 2IPXA 3A2CA 3CKWA 5C27A 5BYYA 2CDZA 3DJ6A 1U5QA 4R77A 4O1OA 4DT9A 2ITZA 4AS0A 4J98A 3HA6A 4JI9A 3KA0A 4CVAA 1CKIA 4Y8DA 3NWWA 4I0TA 2YITA 3VJNA 3VO3A 3G5DA 3BLHA 4G16A 1W84A 1SVHA 5M06A 5B7VA 5AR8A 2P2HA 3R73A 4UXQA 3POOA 3LMGA 2VTLA 3R7OA 3LFSA 3OWKA 5AP7A 3LFFA 3MIYA 3GOPA 1YDSE 3TIYA 4EQUA 4ERKA 3HECA 4U41A 4FVRA 3DK6A 3CD8A 4K11A 5HE3A 2VWWA 4NM7A 2J50A 1O9UA 3BKBA 2VX3A 5FD2A 2O8YA 4L45A 3UQCA 4ZSJA 2P55A 2YFXA 4TT7A 3SXSA 3TZ8A 4FT5A 4BGQA 2UZUE 4GCJA 4ZJVA 1OB3A 3R7UA 4EZ7A 4HGTA 3P9JA 4RA4A 3F82A 3UOKA 1F3MC 4YZNA 3ZRMA 5J95A 4KSQA 1H27A 2ZM4A 4AA5A 4F6WA 1WVWA 4FTQA 5KZ0A 2YLEA 2E2BA 2UVXA 5ACKA 5IEXA 4WUAA 1JKTA 3FZSA 4S31A 1WBNA 1W8CA 3IGOA 1K2PA 3HMOA 3HP5A 2W9FB 4RJ7A 3NUNA 5LVNA 2Z02A 3O8TA 3RPYA 2WMRA 4L3JA 3U87A 4EH3A 4KINA 1YOMA 2EB2A 3T3VA 2YM6A 3AT4A 3FHIA 4KD1A 2FO0A 2X39A 3ORZA 1Q8UA 3GC8A 4H1MA 3ALOA 4ZTHA 1UWHA 5BUEA 4ZOGA 4NJ3A 2C0TA 3TJCA 4QTBA 2GTNA 4BCNA 3NS9A 3PPZA 2PWLA 4DFXE 1ZAOA 3CGOA 2WHBA 3LCSA 4FKLA 5DE2A 3ODZX 3MVHA 2HYYA 3ACJA 1Q8ZA 2R3RA 5AR7A 3RINA 3TZMA 4BCQA 2Z2WA 2HENA 3DKOA 4BCMA 5IQIA 4XCUA 4DGNA 5H2UA 1APME 4GW8A 5AX3A 3GCUA 5HZNA 1R0EA 3DDPA 2OU7A 1MQBA 5JK3A 4J99A 3RTPA 4M0YA 4Y46A 3U4WA 4YO6A 3BYUA 5E92A 3EFLA 5M56A 5HCXA 4E5WA 4FOBA 2F4JA 3D9VA 2J0LA 2ETRA 3VBTA 4F1MA 1Y6BA 3DV3A 4ZTSA 1M7QA 1REKA 3I5NA 4FKVA 3LJ2A 4M69A 3JVSA 4V01A 3QU0A 3VS4A 3C4CA 4DAWA 2GPHA 3BWFA 2XIYA 2VWBA 3MW1A 3WF7A 2WXVA 4JXFA 2R3OA 4F6SA 2CNVA 3UIMA 1Z57A 5M07A 1M2RA 2YWVA 3NUUA 4R1YA 4ACDA 3RPOA 2QU6A 4F70A 4FT9A 5BVKA 2ZOQA 5BX0A 3LPBA 1OKYA 3PRIA 2PYWA 3PSDA 1OPLA 3PXFA 3QTWA 3VW8A 2W0JA 1FPUA 4MNFA 4FKRA 4EEVA 4D58A 3MIAA 2C5VA 3FMNA 1HCLA 4XYFA 4ALWA 4OLIA 3QGYA 4E73A 1OL2A 5FLFA 4X2GA 3S0OA 2NNWB 4W4WA 4YC6A 3R00A 4M13A 5AP2A 2EU9A 5KX8A 3HV7A 5ANKA 1Q5KA 2GNGA 3F5UA 3E3PA 4D9TA 4ZMEA 2R3MA 4IDTA 4RIXB 4FMQA 2VTRA 4USFA 5AUTA 3CTQA 3THBA 3BYVA 4C35A 1YQJA 3MGYA 4E20A 3KMMA 2XJ1A 4TYJA 3M1SA 4Y83A 3CY3A 2F49A 5EOBA 5CVHA 2ESMA 3RPVA 5KMJA 2RF9A 2BZKB 3U6JA 4MXOA 2YJRA 2B1PA 5I9WA 2W5HA 4QO9A 3DY7A 4FTRA 5HBEA 1Q4LA 4YU2A 1BL7A 1R39A 3NYXA 2XKFA 2JBPA 4FSUA 4CQEA 4QMUA 2YM8A 4ZZOA 1XBCA 1PRYA 1B6CB 4ITHA 5J8IA 3JYAA 3U9CA 1KE7A 2OIQA 3MN3A 4I4EA 5L2QA 3ZFYA 4IB0A 3U55A 4MYGA 5EDPA 1GZNA 1Y8YA 2B53A 3BGPA 4M14A 5A3XA 2P2IA 5FGKA 2UZLA 4AUAA 4MQ1A 2P33A 4K77A 4MNEB 4I20A 2YCSA 3G51A 4GG5A 3LAUA 5EYCA 3MS9A 3ITZA 4FTLA 4FX3A 1OBDA 5HO7A 1XH6A 4MD9E 4CV9A 2R9SA 3TV6A 1GJOA 3WZKA 3PJ1A 5IUHA 4DT8A 4AZFA 3H9FA 4QTDA 4EJ7A 2HW6A 5J9YA 5E8YA 4ZLYA 4RSSA 3BV2A 4L68A 4UYAA 3K54A 1OM1A 1SVEA 2IVVA 3UC4A 4C4HA 3UVQA 4EBWA 1PXKA 1BUHA 4FSMA 3I7CA 4RGJA 3LMHA 5FDXA 2XBAA 4YZCA 4JG7A 4IACA 5AV2A 1SNXA 4ASXA 1KV2A 5AV3A 1ZYSA 2RSVA 3NCZA 2RG5A 2Z7SA 3O0GA 4O27B 4YJSA 4ARKA 5F1ZA 4EKLA 3PY1A 1ZARA 2G15A 4C2WA 3AC3A 4P2KA 3GVUA 3PY0A 2VWUA 4RVLA 4FV5A 4FGBA 4CTBA 1VR2A 1DS5A 2LAVA 3COIA 3TL8A 2CLXA 5FTQA 3W33A 3OFMA 4IE9A 3C0IA 1RE8A 1NW1A 3LCDA 2GQSA 3KF4A 1UU7A 2FSMX 3IQ7A 4F7NA 4TZRA 2BDFA 2X2MA 3C0HA 5FP5A 5GHVA 2WTCA 5D41A 3FQSA 4PTEA 2DWBA 4C36A 4F9WA 4AAAA 1PW2A 4UYNA 3FI8A 2XK3A 4FG8A 4AW2A 2C6LA 5K5XA 4MXAA 4IX6A 1V0PA 2EXMA 3QLGA 2XP2A 3G2FA 2BAJA 5GJFA 3V5TA 3TN8A 4QMSA 1JKLA 3SQQA 1MUOA 3AOXA 4LL0A 4PX6A 2JKQA 5AR5A 5M4UA 2PPQA 3V8TA 3UTOA 1MP8A 3V6SA 4QMVA 3C1XA 4NM0A 4EOSA 4CD0A 1YDTE 3F3UA 4EH7A 2HWPA 3PA3A 3SAYA 1W83A 4IAFA 4GV1A 2QOKA 3FQEA 5HGIA 2WTWA 3EN7A 3O23A 4S32A 3RPRA 4Z3VA 4HOKA 1Q8TA 3G6HA 3UZPA 3T3UA 1MQ4A 4G17A 3GU8A 4RX5A 1OL1A 4NCTC 4QP2A 4BZOA 5HLNA 3ORPA 1WCCA 3OW4A 4WBBB 5CQUA 1PKDA 4C8BA 1O6LA 3ETAA 3IDPA 3PYYA 4AU8A 4KIKA 2WOUA 3MWUA 4GU9A 5A14A 3UPZA 2G2HA 2PMIA 4BWPA 5I5ZA 2Q83A 2QOLA 2JDRA 2HWOA 2J0JA 1BX6A 2G01A 3KRJA 4HCTA 4Z9LA 4ANOA 2WTKB 1Y8GA 3L9PA 2GTMA 2ITVA 2ZB1A 3DLZA 4RIWA 2OF4A 4WOVA 4IWOA 5EW9A 4WG3A 5ETCA 4AGUA 4BDCA 5C26A 1KOBA 3Q4UA 3KY2A 3F5PA 3NX8A 3Q53A 4ZY6A 3ZDIA 2Q0NA 2Z8CA 3SDJA 4FV2A 4X3FB 3LXNA 4GL9A 4HPTE 4QNAA 3ZO1A 5DR6A 3TV7A 4YHJA 4D1XA 5HLWA 5E8TA 2RGPA 3RCDA 4O7SA 3R9DA 4EUUA 2V7OA 4YGAA 2JLDA 4RFMA 2X4ZA 5ANEA 2SRCA 4FTNA 2O2UA 4FV8A 2WKMA 5EM5A 2X6EA 3BRBA 4TXCA 3FZOA 3KC3A 3LFBA 3BEGA 4OTIA 4ASEA 2WIPA 4CV8A 5BVDA 4L42A 3OD6X 3FMHA 5AA8A 4RIOA 5IU2A 4FEVA 1OECA 5F4NA 3TXOA 2HXLA 2OICA 3WF6A 3R9OA 1S9JA 5JGDA 4XOZA 2UW9A 1XJDA 3PXRA 3QYZA 4YZ9A 3VC4A 4C4IA 4RBLA 2YDIA 4UALA 2XEYA 4LV5A 3DAJA 4NK9A 5I9UA 3ZRKA 5CVGA 3HKOA 2X7GA 2X9FA 4QQJA 4CNHA 4G3FA 5DYJA 4O84A 4I4FA 3MJ2A 4OBOA 4GSBA 4P5ZA 4XOYA 4MBLA 1XH8A 3KMUA 4WSQA 3SX9A 4I24A 3GU4A 5IQDA 5AFVA 4FNXA 1SNUA 3AT3A 1CDKA 4DGLC 5CU2A 3EQDA 1YOJA 3NDMA 4BKZA 3CQEA 4HYHA 5L8KA 2CN8A 4J53A 5C4LA 2PVRA 3FY0A 3EMGA 3EQBA 4OGRA 4DA5A 2WMBA 2ZYBA 4V0GA 5E90A 2OF2A 1NXKA 4FICA 3D14A 5GZ8A 5EYKA 5HO8A 3PSCA 5HX8A 4UMTA 2KTYA 2ZV9A 1OVEA 1Q3WA 4TWPA 5HU3A 4OBPA 3SXFA 4DH5A 1XH7A 3GCQA 3R1NA 4QYFA 4E4XA 2XIXA 4RIXA 4E5AX 4LOQA 2UW6A 2HZ4A 3BHHA 1G5SA 3GQLA 3PJ8A 2W1EA 2XCKA 4ZMFA 4OTPA 2BKZA 4KS7A 5AV1A 4IB5A 4PTCA 3FZTA 4CSVA 4PL3A 2J90A 4QMYA 4I5PA 3QTSA 1KE9A 1OKVA 4H3PA 4O1PA 4YHTA 1FGIA 4DEAA 4CFNA 5IMEA 3FZPA 2UZTA 5EDRA 3U6IA 3OWPA 2JIVA 4IAZA 4DF3A 1YWVA 3NYVA 3QRKA 4JX7A 4WKQA 5F94A 4BC6A 3WYXA 4EL9A 2JKOA 5EM7A 4YO4A 3VJOA 2Z7RA 2RKUA 3NAYA 4PL5A 1JPAA 1H28A 3Q9ZA 2A27A 1XH5A 2EVAA 2GNJA 4M8TA 4RQKA 2UV2A 3EQRA 4FIEA 4AT3A 4L44A 3UIBA 3QRTA 2E9NA 4YSJA 2J6MA 4ZZNA 3RI1A 3F5XA 3QZIA 5M4CA 3B2TA 2Y6OA 1IA8A 5HNBA 3FMMA 3PPKA 2H6DA 5AMNA 5FQDC 2C30A 3D5WA 1H25A 3RHKA 3F9NA 4Y5HA 3SA0A 1G8SA 5KBRA 1PMVA 3OBGA 4FKTA 3GI3A 5JRSA 4ITJA 4I0RA 5JFSA 4WG5A 3DBDA 4Y73A 4PV0A 4PMSA 5HTIA 1W82A 5H8GA 5IA2A 3UZRA 2YCFA 4P90A 2W1IA 4UZDA 4WNKA 4RX9A 4YSMA 3H9OA 4A4OA 1W0XC 4W9WA 2J0IA 4TNBA 5AAFA 3QKMA 3QQFA 2B9HA 1JVPP 3ELJA 4NW5A 5CT0A 1PXPA 4FT0A 2F57A 3UP7A 2VWYA 4O81A 1M7NA 2ZDUA 1QCFA 3HNGA 5CVFA 4AXAA 3SLSA 1BI7A 3VUHA 4CGAA 5EYDA 2OXDA 3UG1A 3V3VA 4F7SA 3UJGA 4DEIA 3EYHA 3ZLYA 5C8NA 3SVVA 4DBXA 2PVKA 4RZWA 3ZBFA 4ALVA 4ANNA 4G34A 1UNLA 1YI6A 2IZSA 3ZLWA 3OXIA 2OH0E 4B6LA 4KKGA 4W4YA 3PY3A 3CQUA 5E7RA 2QKWB 5H9BA 4U97A 4DGOA 4PDPA 2XNMA 2C6KA 4EOOA 4QMQA 4C61A 4I6FA 4ZSLA 3K3IA 5F9EA 4IFGA 5HTCA 1WFCA 3E87A 1H1WA 4EOPA 4X6QC 4RC2A 4Z16A 1PYXA 3QC4A 2CPKE 3P5KA 3KK9A 3FZ1A 4WNMA 1UVRA 2GNLA 1GIHA 2GHMA 3HX4A 3NYOA 5L2WA 4R7BA 2VX1A 4IZ7A 3QHWA 3TNWA 2G2FA 4EJNA 5ICPA 3O51A 1I44A 3DXNA 4Y5QA 4J7BA 2X8IA 3I1AA 3GC0A 4GU6A 4CFMA 3E5AA 2G1TA 5ACBC 3OC1A 1S9IA 5AR4A 3KKVA 5K4JA 5E8VA 4FVPA 2XNBA 4BZNA 2PZRA 4ZTLA 4DITA 3PIYA 2ZV7A 2PZPA 4D0XA 4M69B 3R28A 5IISA 3KN6A 3E8EA 2P4IA 3MVMA 4MWHA 4EK5A 2H34A 5IQBA 2XVDA 3NIEA 2DS1A 2FSTX 4PTGA 4IZYA 3BGZA 5DR9A 4MAOA 2CNUA 4DCAA 3WF5A 1YHSA 1P14A 2UZNA 3CD3A 3FLWA 3TIZA 4Z7GA 3GU7A 3PDTA 5L2IA 4IEBA 3QD0A 5L6WL 3NUXA 4PMTA 4AW0A 3F66A 4GT5A 3K5VA 3C51A 2JEDA 4FV0A 4DTAA 5IH4A 3CTHA 3EIDA 1PXJA 3IDBA 5HD4A 3NUYA 2DYLA 2WD1A 1CSNA 2XIRA 3F7WA 3JUHA 3QTUA 5ANIA 1KV1A 4FG7A 3ZSHA 4APCA 3S1HA 4XV9A 5TF9A 2YIRA 4PNIA 3BEAA 4O0VA 4QYYA 1T46A 5LVLA 2OXYA 3TCPA 2AC5A 4FKPA 3W55A 4K18A 5HESA 5BMSA 5CASA 4AP7A 3N4UA 5D12A 2QO9A 5D7AA 3ZXTA 5LMKA 4XX9A 2O3PA 3DB8A 4FI1A 1DI9A 3OOMA 4U42A 4AGWA 4YBJA 1J7UA 4ZJIA 5H3QA 4RWIA 2G2IA 4A9YA 5A6NA 4U44A 2BFXA 3UQGA 4BTFA 4FR4A 4II5A 1BL6A 3PJCA 2XM8A 2AYPA 3UODA 3PJ3A 3VF8A 2XNGA 4JBQA 5KZIA 2W4JA 4DG2E 3OCTA 3QX4A 3R2YA 1WMKA 2WPAA 3VUDA 1OI9A 5TE0A 2WMWA 2FSOX 2JFLA 3NNVA 2IO6A 4JVGA 2IZUA 4M68A 2VNWA 3UOLA 3VHEA 5HBHA 4FT3A 5CENA 4QMMA 2EB3A 1WZYA 5ETFA 2VTIA 4F9YA 2W4OA 4LG4A 4C34A 5JRQA 4FKJA 5TO8A 2R4BA 3DBCA 4B8MA 1FMKA 2Q0BA 3PJ2A 2V55A 4YPDA 4G9RA 4DHFA 1GZKA 2A19B 3FE3A 2YDJA 2R3LA 5ETIA 3VS5A 3DBFA 3QZGA 2C4GA 3CR0A 1BYGA 2X8EA 3RGFA 1U5RA 3WE8A 4RIYA 1U59A 3RNYA 2Y0AA 4XS2A 3UZTA 4IZAA 4MBIA 2OXXA 1TKIA 4LQMA 1ZY5A 2GSFA 4I41A 5KO1A 4EYMA 2I6LA 4N70A 4IWQA 5HG8A 4NKAA 1PKGA 4AG8A 3JY9A 5CU4A 2RL5A 3PG3A 3Q5ZA 3H10A 3O2MA 4XP3A 4FBXA 4AT4A 4EC8A 4O83A 5C8MA 4D4RA 2GDOA 2YAAA 3F7ZA 3QCXA 5CNOA 4APPA 2XM9A 3L9LA 4EOIA 5AA9A 4S2ZA 4CG9A 3GFEA 3GUBA 4A9SA 4WNOA 3ZOSA 1LEWA 4GMYA 3BI6A 3UBDA 5BYZA 3ZUUA 4G31A 4U79A 4FYNA 3CE3A 2A0CX 4YC3A 3FLNC 3ZC6A 3ZFMA 4BWXA 4RFZA 3PSBA 4IQ6A 3ZLXA 4D4YA 2VTOA 4FNWA 2PHKA 4WG4A 3LMIA 1NVSA 4RZVA 3VNTA 3VS6A 3W2QA 4IVDA 3ID6C 4F64A 4NFNA 4UMQA 3MH1A 4LV8A 4NU1A 3NVMB 1PHKA 4RC4A 3E63A 5HOAA 5EM6A 3P7AA 3D15A 1O6YA 4G6OA 4B8LA 3OWJA 5BUJA 4FOCA 1UNGA 2F2CB 5BMMA 4ASZA 5DNRA 1J7LA 1ZMWA 3DU8A 4X3FC 3ZO4A 4I0SA 2YN8A 2WEVA 4FEQA 4MF1A 4AT5A 4DG3E 2XRWA 3R22A 1WBSA 4E1ZA 3HUCA 3R02A 3SXRA 4JLCA 5J5TA 4TNDA 3OBJA 4RJ5A 5K9IA 4ACMA 3AC1A 4FL2A 1UU8A 2PZIA 3MY5A 2E9VA 4O0SA 4KRCA 3FMDA 4G6NA 4XV1A 3VULA 4L9IA 4BKYA 5D11A 3W2RA 4ACCA 2HZ0A 4MH7A 2OW3A 2WB8A 4NZWB 3AMAA 4DFUA 4D2RA 2QO2A 3UNJA 1FVVA 4NM3A 5BPYA 3RVGA 2QVSE 5JFWA 1H08A 4KNBA 3K3JA 3VS1A 3DA6A 3H9RA 4QMLA 3NNXA 5JMSA 5AR2A 2PE1A 4WD5A 3RAHA 4HJOA 3GENA 4GIHA 4FIGA 4PPAA 4D1ZA 2Y4IB 4ZY4A 5CU0A 2J9MA 3ERKA 4G1WA 2ETKA 2J5FA 3G0EA 4FKQA 2J0KA 2C1AA 5KHXA 2UW3A 3MVJA 1UWJA 3KRLA 4GH2A 3V8WA 5A4QA 3Q2MA 3FMKA 3LLTA 1J91A 4KIKB 3LXLA 1R1WA 2C6EA 4I6HA 1XO2B 2PVLA 2X8DA 3R21A 4O0UA 4W4XA 5HIDA 3QKKA 4C7TA 2ONLA 4GG7A 1XQZA 3N9XA 4NH1A 5KMIA 4JBVA 3OTUA 4HCVA 4A9TA 5L4QA 4RIWB 3Q52A 4FTOA 4IIRA 1BI8A 2XNNA 2Z7QA 3QBNA 5CSHA 1DI8A 4OAUC 4PWNA 3ZONA 4OT6A 5IH6A 3JPVA 4OBQA 4CFFA 4FNZA 4GT4A 4TYEA 2KULA 1U4DA 2R3FA 3OTVA 4A4LA 4ZAUA 4BTJA 2C6IA 3ZMMA 2W06A 2QCSA 4PDOA 4U6RA 3KVXA 2VO7A 2WQBA 4JS8A 4K9YA 1QL6A 2WO6A 2XMYA 4AW5A 4PDYA 4BY9E 1AGWA 1ATPE 2JIUA 4PDSA 2FGIA 3ULZA 3L1SA 4X2NA 5L3AA 5LVOA 2CMWA 3C4WA 3ZLSA 2BPMA 4FIHA 3P79A 3U51A 5IQGA 3II5A 4O7RA 4MKCA 4IC7A 4TKSA 3COHA 3V04A 1OL5A 3I0OA 3RKBA 2VO0A 4M84A 4PUZA 4NUSA 5AM7A 3G9NA 5IDNA 3QXPA 4JIAA 5FM2A 3E92A 1JKKA 3IW5A 1JBPE 3A7JA 4FV9A 2C0IA 4QT1A 2EXEA 2B9FA 4TN6A 3H4JA 5EHYA 1PMNA 4KUJA 4IC8A 3I6WA 4LMNA 1TQPA 4BDJA 1YDRE 1YKRA 2IWIA 1O6KA 2Y6MA 3QAME 4IDVA 2C68A 4WRGA 4O96A 5AEPA 5EK7A 2GQRA 5HTBA 1URWA 4O0RA 5C1QB 1UA2A 3R7GA 1HOWA 1K9AA 1MRVA 2Y7JA 3KULB 1ZXEA 3R0TA 4QMOA 4QYEA 3ZUTA 3R9RA 4UEUA 2GS2A 1GY3A 1OKZA 3RAWA 3KXMA 4BGHA 4IM2A 1XH4A 3K5UA 4HGSA 3BHYA 2WZJA 3BLRA 3ZZWA 4YMJA 4FSWA 3U8WA 5JQ8A 5L6OA 3LHJA 5KMOA 3C4ZA 3FKOA 4DFLA 4Z55A 5CALA 3QTRA 4HVSA 4G2FA 3UPXA 4OTWA 3T9IA 5LVMA 3TTJA 1KSWA 4XJ0A 2HXQA 1DM2A 3R8MA 4YR8A 5A4TA 4EK6A 3SW7A 4ZTRA 3U54A 4V0GB 4CMUA 3V5JA 2YA9A 2PE2A 3GU5A 3GC7A 4ID7A 4UWYA 4YTHA 4QTAA 3FI3A 3NUPA 4WNPA 5BVNA 4JDHA 2OSCA 3UMWA 4ANLA 5AIRA 2IZTA 2NPQA 3P78A 5I0BA 4CEGA 3ZH8A 4K8AA 2PULA 3LCTA 3O17A 1FINA 2BCJA 2YDKA 3CKXA 3DZOA 2NO3A 3SKCA 2QR8A 5AIKA 4O7NA 3RM6A 3RM7A 2WTIA 2CN5A 4M0ZA 1NVQA 2X7FA 4FKSA 3WZUA 5HHWA 3QTIA 2HZIA 4JR3A 4S33A 4E3CA 2RFEA 3DZQA 3DKFA 4TWOA 3DNEA 3SHEA 1F5QA 4LUDA 5AM6A 4KBKA 3GP0A 5KKRB 3PZHA 1OZ1A 3KRWA 3LKMA 1RW8A 3E8NA 1UKIA 3LXKA 3ALNA 4QPMA 4H05A 4NFMA 2CCIA 3DLSA 3OCSA 5JKGA 1PXLA 4DTBA 1V0OA 4RX8A 3KXGA 2VNYA 3R7YA 3RZBA 3SGCA 2ITYA 3KCFA 4X2KA 2GNFA 4AOIA 4M3QA 2I0YA 4BR3A 4OUCA 2Y4PA 4EHGA 3CC6A 1REJA 3OEFX 4F9BA 4X21A 1IAJA 5AX9A 4FIIA 2BRBA 4U40A 3PVBA 5CI7A 4OW8A 2NP8A 4B7TA 5ITAA 2FVDA 2ITOA 5D7VA 4E6DA 4IVCA 4EH8A 2CLQA 2WMSA 4UX9A 4F09A 2W5AA 3M2WA 3SC1A 5CS6A 4CT2A 3ANQA 3AXWA 3P23A 4R3RA 4F65A 3TKHA 4MCVA 4YZBA 2DUVA 2H9VA 3BZ3A 3D0EA 5DRBA 4ZLZA 2OGVA 4DGMA 3PXQA 4L7FA 4D5KA 4D4SA 3CPBA 2C6TA 2WQMA 3A8WA 3DGKA 5L8JA 2VRXA 1JSTA 4J71A 2PSQA 3VUTA 3G9LX 4L8MA 3F2RA 4QP6A 3Q3BA 4DEEA 2F7ZE 3CJFA 3NGAA 3N4TA 3E3BX 3UVRA 1WBOA 4BDEA 1RDQE 3PVGA 5DEYA 4EHEA 4GJ3A 5HORA 1OIYA 3HDNA 4N4SA 3UO6A 3P86A 3R63A 4ANSA 2W1GA 4C62A 4BDAA 2UZEA 2BZIB 4HCUA 5JT2A 1E9HA 1Y57A 2B4SB 4H58A 4EI4A 5M4IA 4UZHA 4DCEA 5KCVA 2UZVA 1NA7A 3W8QA 4YJUA 5DIAA 5HE1A 5FEDA 1UU9A 2C47A 2ZMCA 4MQ2A 4ZP5A 3FJQE 5HLPA 3WILA 3TNHA 5KUPA 1E1VA 4ZEGA 4FUXA 2FSLX 4ZIMA 1JSVA 5J7HA 3QUEA 4AN9A 4Y72A 3I79A 3V01A 2AUHA 2GU8A 4IVBA 1SM2A 3E7VA 4KIOA 5E1SA 5I9XA 3VS2A 5HIEA 2VO3A 4GFGA 4WUNA 2PK9A 1FGKA 5EI8A 2JGZA 4FIJA 3I60A 1B39A 3F3WA 3RK5A 3SRVA 2CKOA 5AUVA 3V5QA 4EZ5A 5DWRA 2R3QA 3FLYA 4LGDA 3OT8A 4I23A 3HV5A 3HV3A 4YLKA 3Q4CA 5CYIA 3UGCA 3TDWA 4GKIA 4I92A 5HBJA 5DGZA 3AD5A 2W96B 3OROA 3IONA 4UY9A 4EK3A 1JWHA 1B38A 4Q2AA 4L3PA 4PPCA 2X6DA 3FSKA 3IK3A 3LQ8A 1H07A 3PLSA 3PIXA 1Q61A 4LOOA 4BI1A 2YEXA 1PF8A 2I40A 2C3LA 3UOHA 4UMPA 4FE2A 1H1RA 5AP6A 3CCNA 4C57A 4MXZA 1JOWB 1R78A 4XV3A 3IO7A 4FUYA 4YLLA 5CF4A 5E8ZA 3U6HA 2XKDA 3FBVA 4X3JA 4NW6A 3DFAA 1IASA 2VWVA 2F7XE 3DTCA 4GJ2A 2HCKA 3PRFA 4XUFA 4YHFA 4YJRA 3AC5A 4GFMA 4N57A 4C3FA 2JKMA 2QLQA 4G3DA 2XK7A 3GFWA 3KGAA 4KIQA 4MTAA 5EM8A 5EYMA 3OHTA 4BCFA 2XJ0A 4O38A 4XG2A 2VTSA 4BFMA 4EOKA 1ZOEA 3JR1A 3C5IA 1QPEA 3ZEPA 4DLJA 3BV3A 5CEKA 3FYKX 3IS5A 2XK9A 3EQGA 1ZMUA 3HP2A 3HRBA 5EW3A 3Q60A 5EFQA 4L53A 1WBPA 4MXYA 4C0TA 3MFRA 3ORKA 4JDJA 5K5NA 3HA8A 2GQGA 5E8UA 3UP2A 3LFNA 1IRKA 4BDKA 4CKJA 5EQYA 5M09A 3R01A 2CGWA 2C5XA 3FXXA 3QKLA 4KB8A 1R3CA 4BCPA 3ORNA 3OY3A 5E8WA 2BDWA 5A54A 3GGFA 1IA9A 3NMUF 1VJYA 3OG7A 4JRNA 2WU6A 3RJCA 5B2LA 3FZRA 2I0EA 3DOGA 3HL7A 2BDJA 4PRJA 2QQ7A 2LGCA 3P7CA 3E88A 3IG7A 5AR3A 4EYJA 3TT0A 5IA3A 1ZZLA 4EHZA 5C01A 2OZOA 2XRUA 3KL8A 1WBVA 4XRLA 1OKWA 3IW7A 4JAJA 4XV2A 3F61A 2WNTA 3DK3A 3HV6A 5AV0A 3Q5IA 3ZO3A 4ASDA 4JBPA 1W98A 2QD9A 3VBVA 3NUAA 5GIPE 5M08A 3DBQA 3OF0A 1OIUA 1QPDA 2WMTA 3A7IA 1ZRZA 3REPA 5CF6A 5JH6A 3DXPA 3R9NA 3GOKA 3KULA 3GCSA 4BB4A 2PMOX 4BIEA 4L00A 4EUTA 2R7IA 3UO5A 1XH9A 3EQPA 3EFJA 4O22A 4ZSGA 3KXZA 4BYIA 3MVLA 1YWRA 2PL0A 4J95A 4CMOA 2GNIA 4RIYB 5HICA 5JGAA 3LFAA 4W8EA 5DOSA 2W9ZB 1YXVA 2BIYA 3L8XA 3QL8A 5AP0A 3C5UA 5LARA 2JFMA 2IG7A 4TWNA 4AOTA 4TY1A 4YJOA 3V51A 3MH0A 2WTDA 4PY1A 2HY81 3QFVA 1U54A 4ZK5A 3AD6A 1BMKA 4TWCA 4ZXTA 3OW3A 3T9TA 2O63A 3OT3A 4JL9A 4YJTA 5DEWA 4M97A 3ZUVA 4D55A 3NR9A 5EG3A 4AX8A 5F95A 5CEQA 4EH4A 3MFSA 3B8QA 3G15A 2C0OA 5DT4A 4N0SA 5C9CA 4ONAA 3ZFXA 4ZTMA 3A4PA 3R7IA 3WBLA 2XUUA 4FEXA 3QWJA 4RLLA 2WMVA 4AN3A 2UVZA 3E8DA 3Q04A 3EQIA 4LGGA 5KMKA 2VZ6A 3A61A 2O0UA 3OMVA 3E93A 3QYWA 3ROCA 2CHLA 4IW0A 1SZMA 1OMWA 3LFEA 4R7HA 3NCGA 2R7BA 4BYJA 3AT2A 5HU9A 5C03A 3BYMA 3C4EA 1NT2A 3C4XA 3KFAA 4IBMA 4MXCA 5LMAA 3ZHPC 2ACXA 4HZSA 4C4JA 4X2FA 3NUSA 5L2SA 5I3OA 5B2MA 4D9UA 2R3JA 4H1JA 4JQ8A 4KSPA 4EH2A 3LOKA 2R0IA 5EQPA 3MPAA 3QCSA 5IQHA 4U0IA 4QP4A 4AGCA 2WELA 1GOLA 2R3KA 5GZ9A 1H26A 3VBYA 2C3JA 3UDBA 4IX4A 3IOPA 4TW9A 3RHXA 2VTQA 3O8PA 5J1VA 4ZJJA 4AA4A 3SG9A 3HMIA 3VAPA 4BBEA 3CXWA 1YHVA 1YW2A 3RALA 4L7SA 5L8LA 3T8OA 3WARA 2WOTA 2XH5A 4O7WA 1LPUA 4DEBA 2A1AB 5GJDA 4BCJA 3C7QA 2WFYA 4FZ7A 5AP4A 5HI2A 1LEZA 2PTKA 3W8LA 4PL4A 3UIUA 2GNHA 4I6QA 4EQMA 3PFQA 3VBWA 2W1ZA 4GK2A 1ZMVA 3GBZA 3HV4A 3I4BA 3V5PA 3VUIA 4ZS4A 2OZAA 2YHVA 4I3ZA 4FTTA 5M44A 4XG7A 2QG5A 4FSNA 3OOGA 3ZZEA 2VTAA 4EOMA 3TTIA 4LMUA 3UIXA 3LCKA 4EC9A 1QMZA 4X2JA 3EH9A 4I22A 4AFEA 4R5YA 4USDA 1M2PA 3GNIB 3A7HA 2RFSA 3Q4TA 5HD7A 1OUYA 4QQCA 4XLVA 3UE4A 3DCVA 2XNOA 3UQFA 2JIIA 3EYGA 3ODYX 3CSVA 1JLUE 2J5EA 2E9PA 4ANMA 3M11A 5HIBA 5IQAA 3W2CA 3BYSA 5DH3A 4GVJA 4L43A 1WAKA 4EKKA 1AD5A 2PVNA 3HAMA 4RVMA 2R3IA 1GNGA 5T68A 4H39A 2H96A 3O8UA 4XP0A 4YTCA 1NVRA 4BCIA 4AGDA 4O21A 4FF8A 4U3ZA 3K2LA 5AUYA 4FZ6A 2GFSA 3AGLA 1FQ1B 2HK5A 2XK6A 5IQCA 3R83A 2HZNA 3OY1A 4AZTA 2C5YA 1UU3A 4MHAA 4G5JA 1F0QA 1M17A 3FWQA 3FUPA 3BGQA 4YTFA 2PVMA 3AQVA 3MBLA 3F6XA 4XH6A 5GNKA 2WIHA 2XK4A 3BU5A 2QHMA 3MFTA 3QCYA 4EQCA 3CLYA 3TJDA 1ND4A 5KKRC 1Q24A 3POZA 2YM5A 3VW6A 2WEIA 1ZOHA 3PA4A 3CQWA 5AUZA 4GVAA 3KREA 4TTHB 5H8BA 3LFDA 2WMAA 4P5QA 2QOBA 2X1NA 3D7ZA 1YHWA 3MTLA 4GK4A 2CKPA 1YVJA 4O2PA 1XR1A 2W7XA 4ZTNA 3ENHA 4CCBA 3HMMA 3QRJA 4QRCA 4TYHA 4BN1A 4RFYA 4D1SA 3IW4A 3I81A 4FTAA 1OITA 2XYUA 2QOQA 2YM7A 3BWJA 2HAKA 2R3PA 4RWLA 4B4LA 4BIBA 2F2UA 4C3PA 4ENYA 4YP8A 4F7JA 2ITUA 4BGGA 3KQ7A 3LFCA 4JG8A 2FYSA 3QQUA 2XK8A 3KRXA 5CZHA 4O7ZA 2QOHA 2WQOA 4FZDB 2PVHA 3ENMA 3RK9A 2XNEA 3O96A 3IKAA 2QOIA 4YJQA 4EONA 5JEBA 5KMLA 3ATSA 4QMXA 3VBQA 4E4LA 3LE6A 4KIPA 4M67A 3ZXZA 3W2PA 3W32A 1ZYJA 2JDOA 3D5VA 4FKGA 4X6RA 1Q97A 4HGLA 2BZHB 3EKNA 3OVVA 4DH1A 1TVOA 1KE6A 2CGXA 5JFXA 5M4FA 5HE2A 4CYJA 5I3RA 2BKKA 4M66A 4RWJA 2BILB 3N51A 2YIXA 4IAIA 3ZM4A 5M57A 5J1WA 3MB6A 4RWKA 3FEGA 5LQFA 3MH2A 5HCZA 3U9NA 4IZ5A 3D5XA 3LIJA 4C02A 5A6OA 3EN4A 3ZM9A 4CFXA 5IG1A 1KE8A 4W4VA 3FLSA 4D4VA 4EK4A 2ITWA 2G9XA 5CEPA 5IA1A 3V6RA 2FUMA 4TYGA 4F1OA 5FTOA 5I9ZA 4R3CA 2NRUA 2JDVA 3R1YA 2CGVA 4ANQA 4FZAB 3L8PA 4CZUA 1BLXA 5LOHA 3IW8A 4KABA 4KRDA 2EUFB 3G33A 3KXNA 3VBXA 4DG0E 4FVQA 4IWDA 4XBUA 4RVKA 4KBCA 4H3QA 3W18A 4AE9A 3PVWA 3AD4A 1A9UA 3ANRA 3LJ1A 4N6ZA 4B0GA 1OPKA 3ROYA 3QQKA 4BICA 4PP7A 4N6YA 4EWHA 5AADA 2VTTA 4RJ8A 3HZTA 4XHKB 4O7TA 4J96A 4FV4A 2W1HA 3HVCA 4X0MA 3BBWA 5I9VA 5AP3A 1DAWA 1P4OA 4QQ5A 3RZFA 4BRXA 5LXMA 5LMBA 3IECA 5M53A 2OFVA 4JT3A 4XNEA 4EOJA 2YZLA 1OPJA 3EN5A 3EFWA 2BAQA 3MPMA 3P0MA 3MH3A 3I6UA 4FV6A 3DK7A 4ACGA 1RJBA 3NSZA 1PXOA 1P4FA 1T45A 4CZTA 2R0UA 3FL5A 1Q99A 4KKHA 4BL1A 5CSPA 4I5MA 4AZWA 5CEOA 3PE2A 3PWYA 4BTKA 5CWZA 4GUEA 4Q9SA 2B55A 4FSYA 1VYZA 3SV0A 4E93A 5GIOE 4C3RA 5BVOA 4WO5A 4X7QA 5CEMA 5AWMA 4UMRA 3R7VA 2W05A 2ITXA 4IFCA 4O7LA 3MA3A 4OTFA 4HVIA 2ZJWA 3F5GA 2YERA 3UOJA 3O71A 1FMOE 3D94A 4IAKA 5CQWA 2WTKC 3ZSGA 5A4LA 3WYYA 3JXWA 4WRSA 5CU3A 2R64A 4OR5A 4BHNA 4U43A 4KA3A 4F0GA 3FAAA 3QWKA 3UNKA 5LVPA 4GFOA 4AN2A 2R5TA 4L46A 4F1TA 4AA0A 3D83A 3IGGA 3TKIA 3ZRLA 1GIJA 2PMNX 4QTEA 5J7BA 4F4PA 5AP5A 4R1VA 3SRVB 3TG1A 3VRYA 1H8FA 3WZJA 3EN9A 4FK6A 5LMKC 5KHWA 5DHJA 4PPBA 1HCKA 2ERZE 1EH4A 3HDMA 4JOAA 3MFUA 4K0YA 3V8SA 1YRPA 3VS7A 3ZTXA 2OH4A 4FK3A 1OUKA 4C33A 4ITIA 3FKNA 2UZBA 1ZZ2A 2YAKA 4HW7A 2QI8A 4PP9A 4FSZA 4I5CA 4I94A 4IHPA 3S2PA 3VRZA 4BWKA 4JR7A 1M14A 3KVWA 3MSSA 4Z7HA 4O7VA 2W4KA 4NEUA 5AJQA 5BNJA 4O2ZA 3RAIA 5FBNC 3DQWA 2OJIA 4O6EA 1Q62A 3LJ0A 5DA3A 4FA2A 4BKJA 4LRMA 3E64A 2E9OA 3EZRA 5ANDA 3I7BA 4YJPA 5LWNA 5BVFA 4LRJA 4AZVA 4OAVB 5H8EA 1KUTA 4BI2A 4MWIA 3S4QA 3EQCA 3HUBA 4OTGA 4G3GA 3LFQA 3OZ6A 3V5WA 1PY5A 3WE4A 4U5JA 4LM5A 3SW4A 4FV7A 4DFBA 5KBQA 3C50A 2I0VA 2ZB0A 3FMEA 4V05A 3AGMA 4IAAA 4PQNA 3G0FA 3ULIA 5LWMA 2FH9A 1IEPA 2V7AA 4DN5A 2QR7A 4ZTQA 5CAQA 4WSYA 4PNKA 5HVYA 2CJMA 3EOCA 4ZY5A 4LI5A 4A07A 1QPJA 2JC6A 3ACKA 3RNIA 3CP9A 3S00A 2DQ7X 1YXTA 1H0WA 4QP8A 3VUMA 2BTSA 5DPVA 3BLQA 3HRCA 2VX0A 3BX5A 4AZEA 4LRKA 3RPSA 4QMZA 4AW1A 2QOOA 3H30A 4IH8A 2XS0A 3KB7A 5JGBA 5IA4A 4L67A 5FXRA 2ZM3A 4NSTA 3U4UA 5HVKA 3KEXA 2WTJA 5EDQA 3UG2A 5IEYA 5EH0A 4U3YA 1PMEA 4L01A 3PA5A 4LOPA 5GJGA 3WIGA 2VO6A 1H01A 2UW8A 3C0GA 3DQXA 3EKKA 4YJVA 3DXQA 2PZ5A 3DFCB 1ZWSA 3MI9A 4E6QA 5EHOA 4UB7A 5B0XA 3PZEA 3AMYA 4Y85A 2XNPA 1H1PA 4RRVA 3OP5A 3QTZA 3HLLA 4XLIA 3F3VA 3O50A 1OL7A 1V1KA 4R3PA 3D4QA 4F0FA 5CNNA 3TWJA 4ALUA 1GIIA 3PXZA 5K4IA 4MEDA 4FTIA 3KMWA 2V62A 3UYSA 1IAHA 4EH5A 1GZOA 1J1BA 5LCKA 4F63A 5A4EA 5IF1A 2OJGA 3FL4A 5BYLA 3BELA 2GHLA 2QOCA 3CBLA 1YXSA 4MF0A 2PUUA 3PP0A 4CRLA 4CYIA 3HRFA 3JVRA 4D2PA 5BQ0A 3BQCA 3BCEA 4F6UA 5JQ5A 3ATTA 3B8RA 1Y6AA 4AE6A 4RMZA 2GS6A 3VF9A 5AV4A 4GK3A 1CKPA 3R2BA 4V04A 2VWIA 5TKDA 4DTKA 3TNPC 3W2OA 3EQFA 3BBTB 4NIFA 4ANBA 5ANGA 1U54B 2VAGA 3QQJA 3QA8A 4FZFB 4YBKA 4UWBA 4D2WA 3QUDA 4OTDA 3FQHA 4XBRA 2PUPA 3FI4A 4C58A 4CFUA 3FSFA 3ORLA 3QXOA 4F0IA 5BVEA 3HGKA 3TNIA 3R8PA 4D28A 3DNDA 4XMOA 4E4MA 3PPJA 3HYHA 4HYUA 3LQ3A 3COMA 4FKIA 4I21A 3QF9A 1XHAA 5E8XA 3IOKA 1A48A 3P7BA 2UZWE 2VN9A 4Y95A 5I4NA 4NYEA 3D2KA 4GS6A 2CKQA 3PP1A 3C13A 4UMUA 2OWBA 2YCQA 4HYSA 3LVPA 2CCHA 2ONLC 5D1JA 5E91A 3PXYA 4C59A 2ZV8A 4CRSA 5TT7A 3FPQA 2JDTA 3Q9WA 4RQVA 2QNJA 3NW7A 3EFKA 1J1CA 4LFIA 4CT1A 4NM5A 5DR2A 3NIZA 5FP6A 3S3IA 2AC3A 4J52A 3BE2A 4EZ3A 3FLQA 4WHZA 4C38A 3I5ZA 4IJ9A 5J9ZA 5DBXA 4EORA 2FB8A 3GXLA 5A46A 4AF3A 3FPMA 3I0QA 5M55A 3MTFA 4F9CA 4FYOA 4UXLA 1MRUA 3DTWA 2EWAA 4GEOA 4W8DA 3FKLA 5C8KA 4XG4A 2PE0A 2R3NA 4RVTA 4NCTA 5ANJA 4QYGA 4E7WA 4FT7A 3HMPA 4M15A 2QC6A 3IDCA 5CAUA 1ZYDA 4CLJA 4FKWA 4YURA 2UZOA 3KN5A 5HQ0A 1YWNA 1A06A 3MJ1A 1YXUA 4U8ZA 4KBAA 1H0VA 2P3GX 3L8VA 5K0KA 4C2VA 4YZMA 5FEQA 3VHKA 3BIZA 4TL0A 4USEA 5JN2A 4BCGA 1PMUA 1WVYA 3QD2B 4QMPA 4BCHA 3W1FA 2GMXA 3IW6A 3MYGA 5EI2A 4CMTA 5IUGA 4ZS0A 2ZV2A 2F9GA 4YTIA 2VV9A 4FIFA 1PJKA 4H36A 1CKJA 2OZAB 3BU6A 4H3BA 1I09A 3RWPA 3WI6A 4RLKA 2IW9A 2BAKA 2QHNA 3GU6A 4K33A 1XWSA 4AQCA 4E5BA 2JAMA 4I93A 4BF2A 1UKHA 2B7AA 2BMCA 5HX6A 1H1QA 4TRLA 4KS8A 2XIKA 3OXZA 2VTPA 2GHGA 2X81A 3H3CA 4OT5A 4QMTA 3UMXA 3FC2A 3CGFA 3KK8A 4JQ7A 5K3YA 5ANOA 4DLIA 5DG5A 4IM0A 3TM0A 3LXPA 1E1XA 1PXNA 4YNEA 2IVTA 1FVTA 2BHEA 3ZYAA 2YABA 2C6MA 4YJNA 2O65A 4BIDA 1H1SA 3GT8A 3NLBA 4M12A 3F2AA 3RBWA 5IQEA 2W99B 1ZLTA 5D10A 4RC3A 2YLFA 3DKGA 3DT1A 3A99A 1VYWA 2XKEA 3PWDA 4QQTA 3KF7A 2PVJA 2WAJA 4WIHA 4I5HA 1YI4A 1Q8YA 4YZDA 3ZU7A 4EBVA 1Y91A 1TQIA 1Q41A 3ORTA 3QQGA 4GRBA 1L8TA 2HW7A 4FTUA 4O0YA 2QODA 4HPUE 5K0XA 3MPTA 3A60A 4QNYA 3D7TB 2QONA 3V5LA 1FBNA 3LCOA 3LM0A 1JSUA 4IJPA 1SMHA 2UW5A 3QGWA 5KMNA 4XP2A 4E26A 4EK8A 2XF0A 3NNUA 1BKXA 1OL6A 4CXAA 3EL8A 2XB7A 3FC1X 3IPHA 3OEZA 4FTKA 3CS9A 2PMLX 3OCBA 5JSMA 3EB0A 1OIQA 2X7OA 3R1SA 5CAPA 1P5EA 4OTQA 2YIYA 2BUJA 4XEYA 3TZ9A 5DLSA 2VGOA 4TYHB 3QZFA 5C4KA 4QP3A 1P2AA 2XCHA 5HKMA 3F2NA 5CSXA 2W5BA 2BRNA 2X2KA 5FXQA 5AP1A 3DKCA 4JDKA 5FWKK 4DBNA 4ZSAA 1JKSA 2ITNA 4LL5A 5GZAA 2W1CA 5J79A 1MRYA 2QG7A 2PUNA 2XEZA 3CEKA 1OIRA 3F3ZA 4ZLOA 2V22A 3MV5A 4QP7A 5FG8A 4DFZE 2B54A 4U45A 3AMBA 3PG1A 1K3AA 3TV4A 3QD3A 4OTHA 2OBJA 2XJ2A 2OJ9A 5EHLA 3Q4ZA 1URCA 3BQRA 4RPVA 2CKEA 4K1BA 3ZS5A 2J4ZA 2VWXA 5CSWA 4A06A 5E1EA 3R8VA 3HAVA 3CIKA 5E8SA 1J7IA 4K6ZA 5HO6A 4BDHA 4CTCA 4DC2A 1G8AA 3MA6A 4XG8A 2X0GA 3FV8A 2IZRA 2OG8A 4D0WA 1GAGA 5F20A 5IUIA 3OUKA 4DH7A 4D2VA 3KRRA 2ZDTA 3LM5A 4DH8A 1SYKA 5E4HA 5HEZA 4O6LA 4EOQA 2A4LA 2W1DA 3TEIA 2PY3A 3A7GA 4CLIA 4YPSA 2W17A 4IVAA 4TPTA 4R78A 4FV3A 4EH9A 2B0QA 4Q5EA 3VQHA 2REIA 4FEUA 1ERKA 2A2AA 2JITA 2XIZA 2ITTA 3QRIA 2ZAZA 4NTSA 5TR6A 4FL1A 1ZYCA 2GCDA 4FC0A 1GZ8A 1PXMA 3CJGA 5CLPA 3H0ZA 3NYNA 2C5NA 3F88A 5FEEA 2P0CA 1M2QA 2UZDA
chains in the Genus database with same CATH superfamily
5EQEA 5AAGA 3D5UA 2W1FA 3LW0A 3CY2A 3BHTA 1H00A 1CMKE 2ITQA 2X4FA 2XZSA 2YISA 3A7FA 3NRMA 3PIZA 3SOCA 4MD8E 5EKOA 3VS0A 5LJJA 3LLAA 3BPRA 3ZO2A 3NVKI 1X8BA 2ERKA 1VEBA 4DH3A 2YM4A 3C9WA 5CAVA 3EHAA 2YJSA 2EXCX 2JBOA 4OTRA 5J87A 2ZMDA 2ITPA 3F3TA 4BZDA 3W16A 4U9AA 4DYMA 1KOAA 5EKNA 3VVHA 4YC8A 1KWPA 3UYTA 2WQNA 4GYIA 1DAYA 5LCJA 4J1RA 5CXZA 1VZOA 2WTVA 5KMMA 5L2TA 3FI2A 2R3HA 4JMQA 4BTMA 3W2SA 5FBOA 3WZDA 4RT7A 4R5SA 4JIKA 4CKIA 5L6PA 3DPKA 4DDGA 3L9NA 3DJ7A 5IZFA 2BRHA 2Y4IC 3E7OA 1XBAA 2VWZA 3AC4A 3DAKA 2Y9QA 4KAOA 5IA0A 4IX3A 4JJRA 4BDFA 2BALA 3D2IA 3QD4A 4L3LA 4RX7A 2ETMA 1R0PA 3RK7A 4C4GA 4A9UA 4D2TA 4M7IA 2WGJA 4HZRA 2QU5A 3TI1A 4BBMA 3UDSA 1J3HA 3UO4A 4FTCA 2H8HA 5DFPA 1ZY4A 2UW4A 4DFYA 2I0HA 5IKWA 1OGUA 3GC9A 4IANA 3CTJA 3F69A 2C3KA 3Q6WA 5IQFA 2YACA 4WT6A 3PLAE 4UV0A 3QQLA 4IM3A 1WVXA 5JZJA 3VIDA 4XG6A 3A4OX 4FKUA 4GIIA 3RMFA 2IVUA 3ZDUA 4BHZA 3Q6UA 2JAVA 4D5HA 3BHUA 3O7LD 4JG6A 4RA5A 4CQGA 3FXZA 3S95A 2YIQA 4BI0A 3TDVA 1M52A 4FL3A 2VTMA 5HCYA 2Z7LA 3JS2A 3JY0A 1Q3DA 4S30A 5FUTA 4ERWA 3R8LA 3COKA 4IXPA 4F99A 5IH5A 3DAEA 4NL0A 4CCUA 3OCGA 4Q9ZA 5A9UA 3QQHA 4LYNA 5FRIA 2QURA 3FDNA 5A4CA 4LGHA 3A62A 3NFFB 2IN6A 3RWQA 3TKUA 1IR3A 2WMQA 4AZSA 4QMNA 2XYNA 4O0TA 5FXSA 4DGGA 3ORXA 2HOGA 2C1BA 2QLUA 4DEHA 2C3IB 4K2RA 5M51A 4L6QA 3B2WA 3WF9A 4ACHA 2YCRA 2VD5A 5HE0A 3O7LB 2J7TA 1XBBA 2OJFE 2OO8X 4IAYA 4JBOA 5JFVA 3EL7A 3Q9XA 5JZNA 4G6LA 3VUKA 3EZVA 2C69A 4MX9A 3NW6A 3VS3A 3FHRA 4ENXA 2O64A 2R2PA 5HG5A 2PUIA 4MNEA 4FTJA 4HVHA 5HG7A 4DE4A 3MDYA 3DS6A 3Q9YA 4IX5A 4LUEA 4ZSEA 2XAOA 3QHRA 5DT3A 4GT3A 3MY0A 3UNZA 3ZBXA 3CPCA 4CG8A 5HG9A 3NZ0A 4UN0C 1UV5A 1CM8A 2YWPA 3FMLA 5ETAA 3WF8A 5CAOA 2OI4X 3WZEA 3BU3A 3EN6A 3ORMA 3PE1A 3QZHA 2X9EA 5CEIA 2BVAA 4B99A 1NY3A 2C5OA 4MK0A 3QCQA 4JAIA 3QX2A 4HYIA 3OXTA 5TOZA 2VTJA 2IEWA 5AUWA 4BBFA 3L9MA 4MVFA 2J2IB 2Z60A 5DRDA 5IMXA 1LP4A 2UW7A 4GYGA 2VUWA 2PVYA 4C4EA 3UC3A 2WMUA 4BCKA 3AC2A 2OLCA 1JNKA 2VTHA 2E9UA 1KE5A 3RAKA 3GEQA 4F7LA 3Q2JA 3VQUA 1XKKA 3NW5A 4DFNA 5E9EA 3TUCA 5T3QA 4PF4A 4GUBA 3OUNB 1Q8WA 2UUEA 4FSQA 4Q5HA 3WIKA 4C4FA 3G90X 4O82A 4FSTA 3FLZA 4G3CA 4O91A 3UDZA 1QPCA 2CSNA 4IWPA 3R7EA 4BDGA 3Q96A 1ZYLA 3MESA 4FGRA 3R8UA 4F08A 3EWHA 3L8SA 4JNWA 4R6VA 4XG3A 3D7TA 4NWMA 3R04A 2X0QA 3QA0A 2R3GA 3PTGA 3QRUA 4P7EA 3NAXA 4RJ4A 4GKHA 1STCE 3M42A 4YNOA 2FA2A 5DI1A 3KU2A 2WMXA 3BHVA 4FTMA 1CTPE 1YOLA 3QTQA 2OJJA 3GCVA 4G5PA 4HNIA 5CI6A 3R9HA 2CNQA 5AAEA 3OWLA 4IADA 4JDIA 3VN9A 1FVRA 2Y8OA 3TUDA 4G3EA 4ORKA 3DB6A 4U81A 1H4LA 3R30A 5CANA 4JX3A 3R71A 2C6DA 2B52A 4XG9A 4ZZMA 4QD6A 2XA4A 4I6BA 4O4FA 2UW0A 2IW6A 2VGPA 4WA9A 4HVGA 4KKEA 4F9AA 1WBTA 5BUIA 4IB1A 1WBWA 4O0WA 4QTCA 3SG8A 4A7CA 3KCKA 3HEGA 3TUBA 2OIDA 2X2LA 5HNGA 4BDIA 4UBAA 2C6OA 2JD5A 4MXXA 3QLFA 4BVUA 4EH6A 4NJDA 5CF8A 2QOFA 4FODA 5EW8A 1PXIA 5KE0A 4FKOA 4NIFB 4MBJA 2PZYA 2CGUA 5CX9A 5DN3A 3N4VA 4W9XA 2F7EE 4QYHA 1YI3A 2ZVAA 2B9JA 4IB3A 3GB2A 2UVYA 4O7YA 3RCJA 3PXKA 1U46A 3BYOA 2V0DA 3P4KA 3QTXA 5G1XA 3W10A 1JAMA 2J51A 2OKRA 3DBEA 4JQEA 2OIBA 4U7ZA 2YM3A 5HVJA 4QMWA 2V5QA 4HGEA 2BRGA 3MY1A 2WQEA 4RG0A 4RJ6A 4DEDA 4O86A 5G6VA 4FNYA 4R8QA 4JRVA 4BJJA 3FY2A 3ZSIA 2BZJA 4QPAA 4X3FA 3QC9A 3PVUA 2GS7A 3FMJA 3WOWA 4EOLA 2YIWA 3E62A 4RJ3A 5J9LA 4A4XA 4U80A 4YLJA 3BE9A 2BHHA 3R8ZA 3FXWA 2RFDA 3EJ1A 4C37A 4NT4A 1H24A 5EI6A 5EOLA 4FSRA 4P4CA 5DT0A 5CF5A 1PYEA 3BLAA 3FYJX 4CKRA 2XBJA 2PU8A 4QP9A 5I9YA 2HIWA 3ET7A 3NEWA 2YZAA 2ZM1A 4UWCA 4EWQA 5GINE 2QKRA 1FOTA 4BDDA 2B9IA 3MB7A 5J5SA 4KWPA 3AG9A 4E8AA 3SOAA 1W7HA 4CZYB 2IVSA 3ZC5A 4HVDA 2O5KA 3P08A 3R1QA 4FG9A 3VUGA 3NPCA 4O0XA 4S34A 3ZEWA 4E4NA 1Z9XA 3GCPA 2GFCA 2JDSA 2RG6A 2BIKB 2XKCA 4E6CA 1LUFA 3TNQB 5D9HA 3KXXA 4QP1A 4YUQA 2OFUA 4R7IA 2VTNA 5CT7A 4BDBA 3VWAA 5IA5A 1OBGA 5DMZA 1JQHA 4BCOA 5DVRA 4TYIA 4NTTA 3UVPA 3AC8A 4D2SA 1LR4A 4PMMA 3E8CA 5CTPA 5IEVA 3KXHA 5FTGA 4DEGA 3ZCLA 3QALE 2BTRA 4I1ZA 4J8MA 3QUPA 5AUUA 1V0BA 4G9CA 4L52A 1AQ1A 3TACA 2BROA 2J0MB 4CFVA 2WU7A 5CU6A 3DDQA 4CFWA 4AWIA 4QOXA 5CXHA 4DINA 3OS3A 2BFYA 1YXXA 3SD0A 2OK1A 2BRMA 2VU3A 3H0YA 4IMYA 5CSVA 4B9DA 1TQMA 3P1AA 3EQHA 5T6KA 3TZ7A 4A9RA 3R6XA 4AOJA 3RP9A 2HELA 5HNIX 1G3NA 4AACA 5IPJA 2QO7A 4NKSA 2I1MA 2JKKA 1L3RE 1UNHA 4PMPA 1SVGA 2RFNA 2IJMA 4MD7E 2HY0A 3ORIA 4FV1A 4E6AA 4EHVA 2NRYA 2I7QA 4FEWA 5CZIA 3GQIA 1IG1A 5AUXA 3LZBA 3LQ5A 5FM3A 5BVWA 4QPSA 3Q32A 4HNFA 3A8XA 5KNJA 2PVFA 1RQQA 4J8NA 2IW8A 3PUPA 4J97A 4WBOA 3G6GA 1Z5MA 3DJ5A 3NNWA 2BR1A 5FDPA 5B2KA 3HMNA 4AFJA 2RIOA 4XRJA 5CY3A 3C4FA 5IDPA 1ZOGA 2IPXA 3A2CA 3CKWA 5C27A 5BYYA 2CDZA 3DJ6A 1U5QA 4R77A 4O1OA 4DT9A 2ITZA 4AS0A 4J98A 3HA6A 4JI9A 3KA0A 4CVAA 1CKIA 4Y8DA 3NWWA 4I0TA 2YITA 3VJNA 3VO3A 3G5DA 3BLHA 4G16A 1W84A 1SVHA 5M06A 5B7VA 5AR8A 2P2HA 3R73A 4UXQA 3POOA 3LMGA 2VTLA 3R7OA 3LFSA 3OWKA 5AP7A 3LFFA 3MIYA 3GOPA 1YDSE 3TIYA 4EQUA 4ERKA 3HECA 4U41A 4FVRA 3DK6A 3CD8A 4K11A 5HE3A 2VWWA 4NM7A 2J50A 1O9UA 3BKBA 2VX3A 5FD2A 2O8YA 4L45A 3UQCA 4ZSJA 2P55A 2YFXA 4TT7A 3SXSA 3TZ8A 4FT5A 4BGQA 2UZUE 4GCJA 4ZJVA 1OB3A 3R7UA 4EZ7A 4HGTA 3P9JA 4RA4A 3F82A 3UOKA 1F3MC 4YZNA 3ZRMA 5J95A 4KSQA 1H27A 2ZM4A 4AA5A 4F6WA 1WVWA 4FTQA 5KZ0A 2YLEA 2E2BA 2UVXA 5ACKA 5IEXA 4WUAA 1JKTA 3FZSA 4S31A 1WBNA 1W8CA 3IGOA 1K2PA 3HMOA 3HP5A 2W9FB 4RJ7A 3NUNA 5LVNA 2Z02A 3O8TA 3RPYA 2WMRA 4L3JA 3U87A 4MUQA 4EH3A 4KINA 1YOMA 2EB2A 3T3VA 2YM6A 3AT4A 3FHIA 4KD1A 2FO0A 2X39A 3ORZA 1Q8UA 3GC8A 4H1MA 3ALOA 4ZTHA 1UWHA 5BUEA 4ZOGA 4NJ3A 2C0TA 3TJCA 4QTBA 2GTNA 4BCNA 3NS9A 3PPZA 2PWLA 4DFXE 1ZAOA 3CGOA 2WHBA 3LCSA 4FKLA 5DE2A 3ODZX 3MVHA 2HYYA 3ACJA 1Q8ZA 2R3RA 5AR7A 3RINA 3TZMA 4BCQA 2Z2WA 2HENA 3DKOA 4BCMA 5IQIA 4XCUA 4DGNA 5H2UA 1APME 4GW8A 5AX3A 3GCUA 5HZNA 1R0EA 3DDPA 2OU7A 1MQBA 5JK3A 4J99A 3RTPA 4M0YA 4Y46A 3U4WA 4YO6A 3BYUA 5E92A 3EFLA 5M56A 5HCXA 4E5WA 4FOBA 2F4JA 3D9VA 2J0LA 2ETRA 3VBTA 4F1MA 1Y6BA 3DV3A 4ZTSA 1M7QA 1REKA 3I5NA 4FKVA 3LJ2A 4M69A 3JVSA 4V01A 3QU0A 3VS4A 3C4CA 4DAWA 2GPHA 3BWFA 2XIYA 2VWBA 3MW1A 3WF7A 2WXVA 4JXFA 2R3OA 4F6SA 2CNVA 3UIMA 1Z57A 5M07A 1M2RA 2YWVA 3NUUA 4R1YA 4ACDA 3RPOA 2QU6A 4F70A 4FT9A 5BVKA 2ZOQA 5BX0A 3LPBA 1OKYA 3PRIA 2PYWA 3PSDA 1OPLA 3PXFA 3QTWA 3VW8A 2W0JA 1FPUA 4MNFA 4FKRA 4EEVA 4D58A 3MIAA 2C5VA 3FMNA 1HCLA 4XYFA 4ALWA 4OLIA 3QGYA 4E73A 1OL2A 5FLFA 4X2GA 3S0OA 2NNWB 4W4WA 4YC6A 3R00A 4M13A 5AP2A 2EU9A 5KX8A 3HV7A 5ANKA 1W2FA 1Q5KA 2GNGA 3F5UA 3E3PA 4D9TA 4ZMEA 2R3MA 4IDTA 4RIXB 4FMQA 2VTRA 4USFA 5AUTA 3CTQA 3THBA 3BYVA 4C35A 1YQJA 3MGYA 4E20A 3KMMA 2XJ1A 4TYJA 2AEGA 3M1SA 4Y83A 2F49A 3CY3A 5EOBA 5CVHA 2ESMA 3RPVA 5KMJA 2RF9A 2BZKB 3U6JA 4MXOA 2YJRA 2B1PA 5I9WA 2W5HA 4QO9A 3DY7A 4FTRA 5HBEA 1Q4LA 4YU2A 1BL7A 1R39A 3NYXA 2XKFA 2JBPA 4FSUA 4CQEA 4QMUA 2YM8A 4ZZOA 1XBCA 1PRYA 1B6CB 4ITHA 5J8IA 3JYAA 3U9CA 1KE7A 2OIQA 3MN3A 4I4EA 5L2QA 3ZFYA 4IB0A 3U55A 4MYGA 5EDPA 1GZNA 1Y8YA 2B53A 3BGPA 4M14A 5A3XA 2P2IA 5FGKA 2UZLA 4AUAA 4DDIA 4MQ1A 2P33A 4K77A 4MNEB 4I20A 2YCSA 3G51A 4GG5A 3LAUA 5EYCA 3MS9A 3ITZA 4FTLA 4FX3A 1OBDA 5HO7A 1XH6A 4MD9E 4CV9A 2R9SA 3TV6A 1GJOA 3WZKA 3PJ1A 5IUHA 4DT8A 4AZFA 3H9FA 4QTDA 3W0QA 4EJ7A 2HW6A 5J9YA 5E8YA 4ZLYA 4RSSA 3BV2A 4L68A 4UYAA 3K54A 1OM1A 1SVEA 2IVVA 3UC4A 4C4HA 3UVQA 4EBWA 1PXKA 1BUHA 4FSMA 3I7CA 4RGJA 3LMHA 5FDXA 2XBAA 4YZCA 4JG7A 4IACA 5AV2A 1SNXA 4ASXA 1KV2A 5AV3A 1ZYSA 2RSVA 3NCZA 2RG5A 2Z7SA 3O0GA 4O27B 4YJSA 4ARKA 5F1ZA 4EKLA 3PY1A 1ZARA 2G15A 4C2WA 3AC3A 4P2KA 3GVUA 3PY0A 2VWUA 4RVLA 4FV5A 4FGBA 4CTBA 4AXDA 1VR2A 1DS5A 2LAVA 3COIA 3TL8A 2CLXA 5FTQA 3W33A 3OFMA 4IE9A 3C0IA 1RE8A 1NW1A 3LCDA 2GQSA 3KF4A 1UU7A 2FSMX 3IQ7A 4F7NA 4TZRA 2BDFA 2X2MA 3C0HA 5FP5A 5GHVA 2WTCA 5D41A 3FQSA 4PTEA 2DWBA 4C36A 4F9WA 4AAAA 1PW2A 4UYNA 3FI8A 2XK3A 4FG8A 4AW2A 2C6LA 5K5XA 4MXAA 4IX6A 1V0PA 2EXMA 3QLGA 2XP2A 3G2FA 2BAJA 5GJFA 3V5TA 3TN8A 4QMSA 1JKLA 3SQQA 1MUOA 3AOXA 4LL0A 4PX6A 2JKQA 5AR5A 5M4UA 2PPQA 3V8TA 3UTOA 1MP8A 3V6SA 4QMVA 3C1XA 4NM0A 3NFGB 4EOSA 4CD0A 1YDTE 3F3UA 4EH7A 2HWPA 3PA3A 3SAYA 1W83A 4IAFA 4GV1A 2QOKA 3FQEA 5HGIA 2WTWA 3EN7A 3O23A 4S32A 3RPRA 4Z3VA 4HOKA 1Q8TA 3G6HA 3UZPA 3T3UA 1MQ4A 4G17A 3GU8A 4RX5A 1OL1A 4NCTC 4QP2A 4BZOA 5HLNA 3ORPA 1WCCA 3OW4A 4WBBB 5CQUA 1PKDA 4C8BA 1O6LA 3ETAA 3IDPA 3PYYA 4AU8A 4KIKA 2WOUA 3MWUA 4GU9A 5A14A 3UPZA 2G2HA 2PMIA 4BWPA 5I5ZA 2Q83A 2QOLA 2JDRA 2HWOA 2J0JA 1BX6A 2G01A 3KRJA 4HCTA 4Z9LA 4ANOA 2WTKB 1Y8GA 3L9PA 2GTMA 2ITVA 2ZB1A 3DLZA 4RIWA 2OF4A 4WOVA 4IWOA 5EW9A 4WG3A 5ETCA 4AGUA 4BDCA 5C26A 1KOBA 3Q4UA 3KY2A 3F5PA 3NX8A 3Q53A 4ZY6A 3ZDIA 2Q0NA 2Z8CA 3SDJA 3BL9A 4FV2A 4X3FB 3LXNA 4GL9A 4HPTE 4QNAA 3ZO1A 5DR6A 3TV7A 4YHJA 4D1XA 5HLWA 5E8TA 2RGPA 3RCDA 4O7SA 3R9DA 4EUUA 2V7OA 4YGAA 2JLDA 4RFMA 2X4ZA 5ANEA 2SRCA 4FTNA 2O2UA 4QEBA 4FV8A 4AXCA 2WKMA 5EM5A 2X6EA 3BRBA 4TXCA 3FZOA 3KC3A 3LFBA 3BEGA 4OTIA 4ASEA 2WIPA 4CV8A 5BVDA 4L42A 3OD6X 3FMHA 5AA8A 4RIOA 5IU2A 4FEVA 1OECA 5F4NA 3TXOA 2HXLA 2OICA 3WF6A 4QDVA 3R9OA 1S9JA 5JGDA 4XOZA 2UW9A 1XJDA 3PXRA 3QYZA 4YZ9A 3VC4A 4C4IA 4RBLA 2YDIA 4UALA 2XEYA 4LV5A 3DAJA 4NK9A 5I9UA 3ZRKA 5CVGA 3HKOA 2X7GA 2X9FA 4QQJA 4CNHA 4G3FA 5DYJA 4O84A 4I4FA 3MJ2A 4OBOA 4GSBA 4P5ZA 4XOYA 4MBLA 1XH8A 3KMUA 4WSQA 3SX9A 4I24A 3GU4A 5IQDA 5AFVA 4FNXA 1SNUA 3AT3A 1CDKA 4DGLC 5CU2A 3EQDA 1YOJA 3NDMA 4BKZA 3CQEA 4HYHA 5L8KA 2CN8A 3W0RA 4J53A 5C4LA 2PVRA 3FY0A 3EMGA 3EQBA 4OGRA 4DA5A 2WMBA 2ZYBA 4V0GA 5E90A 4I6LA 2OF2A 1NXKA 4FICA 3D14A 5GZ8A 5EYKA 5HO8A 3PSCA 5HX8A 4UMTA 2KTYA 2ZV9A 1OVEA 1Q3WA 4TWPA 5HU3A 4OBPA 3SXFA 4DH5A 1XH7A 3GCQA 3R1NA 4QYFA 4E4XA 2XIXA 4RIXA 4E5AX 4LOQA 2UW6A 2HZ4A 3BHHA 1G5SA 3GQLA 3PJ8A 3W0PA 2W1EA 2XCKA 4ZMFA 4OTPA 2BKZA 4KS7A 5AV1A 4IB5A 4PTCA 3FZTA 4CSVA 4PL3A 2J90A 4QMYA 4I5PA 3AKKA 3QTSA 1KE9A 1OKVA 4H3PA 4O1PA 4YHTA 1FGIA 4DEAA 3TYKA 4CFNA 5IMEA 3FZPA 2UZTA 5EDRA 3U6IA 3OWPA 2JIVA 4IAZA 4DF3A 1YWVA 3NYVA 3QRKA 4JX7A 4WKQA 5F94A 4BC6A 3WYXA 4EL9A 3KIOC 2JKOA 5EM7A 4YO4A 3VJOA 2Z7RA 2RKUA 3NAYA 4PL5A 1JPAA 1H28A 3Q9ZA 2A27A 1XH5A 2EVAA 2GNJA 4M8TA 4RQKA 2UV2A 3EQRA 4FIEA 4AT3A 4L44A 3UIBA 3QRTA 2E9NA 4YSJA 2J6MA 4ZZNA 3RI1A 3F5XA 3QZIA 5M4CA 3B2TA 2Y6OA 4FJVA 1IA8A 5HNBA 3FMMA 3PPKA 2H6DA 5AMNA 5FQDC 2C30A 3D5WA 1H25A 3RHKA 3F9NA 4Y5HA 3SA0A 1G8SA 5KBRA 1PMVA 3OBGA 4FKTA 3GI3A 5JRSA 4ITJA 4I0RA 5JFSA 4WG5A 3DBDA 4Y73A 4PV0A 4PMSA 5HTIA 1W82A 5H8GA 5IA2A 3UZRA 2YCFA 4P90A 2W1IA 4UZDA 4WNKA 4RX9A 4YSMA 3H9OA 4A4OA 1W0XC 4W9WA 2J0IA 4TNBA 5AAFA 3QKMA 3QQFA 2B9HA 1JVPP 3ELJA 4NW5A 5CT0A 1PXPA 4FT0A 2F57A 3UP7A 2VWYA 4O81A 1M7NA 2ZDUA 1QCFA 3HNGA 5CVFA 4AXAA 3SLSA 1BI7A 3VUHA 4CGAA 5EYDA 2OXDA 3UG1A 3V3VA 4F7SA 3UJGA 4DEIA 3EYHA 3ZLYA 5C8NA 3SVVA 4DBXA 2PVKA 4RZWA 3ZBFA 4ALVA 4ANNA 4G34A 1UNLA 1YI6A 2IZSA 3ZLWA 3OXIA 2OH0E 4B6LA 4KKGA 4W4YA 3PY3A 3CQUA 5E7RA 1W2CA 2QKWB 4U97A 5H9BA 4PDPA 4DGOA 2XNMA 2C6KA 4EOOA 4QMQA 4C61A 4I6FA 4ZSLA 3K3IA 5F9EA 4IFGA 5HTCA 1WFCA 3E87A 1H1WA 4EOPA 4X6QC 4RC2A 4Z16A 1PYXA 3QC4A 2CPKE 3P5KA 3KK9A 3FZ1A 4WNMA 1UVRA 2GNLA 1GIHA 2GHMA 3HX4A 3NYOA 5L2WA 4R7BA 2VX1A 4IZ7A 3QHWA 3TNWA 2G2FA 4EJNA 5ICPA 3O51A 1I44A 3DXNA 4Y5QA 4J7BA 2X8IA 3I1AA 3GC0A 4GU6A 4CFMA 3E5AA 2G1TA 5ACBC 3OC1A 1S9IA 5AR4A 3KKVA 5K4JA 5E8VA 4FVPA 2XNBA 4BZNA 2PZRA 4ZTLA 4DITA 3PIYA 2ZV7A 2PZPA 4D0XA 4M69B 3R28A 5IISA 3KN6A 3E8EA 2P4IA 3MVMA 4MWHA 4EK5A 2H34A 5IQBA 2XVDA 3NIEA 2DS1A 2FSTX 4PTGA 4IZYA 3BGZA 5DR9A 4MAOA 2CNUA 4AXFA 4DCAA 3WF5A 1YHSA 1P14A 2UZNA 3CD3A 3FLWA 3TIZA 4Z7GA 3W0OA 3GU7A 3PDTA 5L2IA 4IEBA 3QD0A 5L6WL 3NUXA 4PMTA 4AW0A 3F66A 4GT5A 3K5VA 3C51A 2JEDA 4FV0A 4DTAA 5IH4A 3CTHA 3EIDA 1PXJA 3IDBA 5HD4A 3NUYA 2DYLA 2WD1A 1CSNA 2XIRA 3F7WA 3JUHA 3QTUA 5ANIA 1KV1A 4FG7A 3ZSHA 4APCA 3S1HA 4XV9A 5TF9A 2YIRA 4PNIA 3UDTA 3BEAA 4O0VA 4QYYA 1T46A 5LVLA 2OXYA 3TCPA 2AC5A 4FKPA 3W55A 4K18A 5HESA 5BMSA 5CASA 4AP7A 3N4UA 5D12A 2QO9A 5D7AA 3ZXTA 5LMKA 4XX9A 4LV7A 2O3PA 3DB8A 4FI1A 1DI9A 3OOMA 4U42A 4AGWA 4YBJA 1J7UA 4ZJIA 5H3QA 4RWIA 2G2IA 4A9YA 5A6NA 4U44A 2BFXA 3UQGA 4BTFA 4FR4A 4II5A 1BL6A 3PJCA 2XM8A 2AYPA 3UODA 3PJ3A 3VF8A 2XNGA 4JBQA 5KZIA 2W4JA 4DG2E 3OCTA 3QX4A 3R2YA 1WMKA 2X0OA 2WPAA 3VUDA 1OI9A 5TE0A 2WMWA 2FSOX 2JFLA 3NNVA 2IO6A 4JVGA 2IZUA 4M68A 2VNWA 3UOLA 3VHEA 5HBHA 4FT3A 5CENA 4QMMA 2EB3A 1WZYA 5ETFA 2VTIA 4F9YA 2W4OA 4LG4A 4C34A 5JRQA 4FKJA 5TO8A 2R4BA 3DBCA 4B8MA 1FMKA 2Q0BA 3PJ2A 2V55A 4YPDA 4G9RA 4DHFA 1GZKA 2A19B 3FE3A 2YDJA 2R3LA 5ETIA 3VS5A 3DBFA 3QZGA 2C4GA 3CR0A 1BYGA 2X8EA 3RGFA 1U5RA 3WE8A 4RIYA 1U59A 3RNYA 2Y0AA 4XS2A 3UZTA 4IZAA 4MBIA 2OXXA 1TKIA 4LQMA 1ZY5A 2GSFA 4I41A 5KO1A 4EYMA 2I6LA 4N70A 4IWQA 5HG8A 4NKAA 1PKGA 4AG8A 3JY9A 5CU4A 2RL5A 3PG3A 3Q5ZA 3H10A 3O2MA 4XP3A 4FBXA 4AT4A 4EC8A 4O83A 5C8MA 4D4RA 2GDOA 2YAAA 3F7ZA 3QCXA 5CNOA 4APPA 2XM9A 3L9LA 4EOIA 5AA9A 4S2ZA 4CG9A 3GFEA 3GUBA 4A9SA 4WNOA 3ZOSA 1LEWA 4GMYA 4DHIB 3BI6A 3UBDA 5BYZA 3ZUUA 4G31A 4U79A 4FYNA 3CE3A 2A0CX 4YC3A 3FLNC 3ZC6A 3ZFMA 4BWXA 4RFZA 3PSBA 4IQ6A 3ZLXA 4D4YA 2VTOA 4FNWA 2PHKA 4WG4A 3LMIA 1NVSA 4RZVA 3VNTA 3VS6A 3W2QA 4IVDA 3ID6C 4F64A 4NFNA 4UMQA 1G8JA 3MH1A 4LV8A 4NU1A 3NVMB 1PHKA 4RC4A 3E63A 5HOAA 5EM6A 3P7AA 3D15A 1O6YA 4G6OA 4B8LA 3OWJA 5BUJA 4FOCA 1UNGA 2F2CB 5BMMA 4ASZA 4DHJA 5DNRA 1J7LA 1ZMWA 3DU8A 4X3FC 3ZO4A 4I0SA 2YN8A 2WEVA 4FEQA 4MF1A 4AT5A 4DG3E 2XRWA 3R22A 1WBSA 4E1ZA 3HUCA 3R02A 3SXRA 4JLCA 5J5TA 4TNDA 3OBJA 4RJ5A 5K9IA 4ACMA 3AC1A 4FL2A 1UU8A 2PZIA 3MY5A 2E9VA 4O0SA 4KRCA 3FMDA 4G6NA 4XV1A 3VULA 4L9IA 4BKYA 5D11A 3W2RA 4ACCA 2HZ0A 4MH7A 2OW3A 2WB8A 4NZWB 3AMAA 4DFUA 4D2RA 2QO2A 3UNJA 1FVVA 4NM3A 5BPYA 3RVGA 2QVSE 5JFWA 1H08A 4KNBA 3K3JA 3VS1A 3DA6A 3H9RA 4QMLA 3NNXA 5JMSA 5AR2A 2PE1A 4WD5A 3RAHA 4HJOA 3GENA 4GIHA 4FIGA 4PPAA 4D1ZA 2Y4IB 4ZY4A 5CU0A 2J9MA 3ERKA 4G1WA 2ETKA 2J5FA 3G0EA 4FKQA 2J0KA 2C1AA 5KHXA