3QKLA

Spirochromane akt inhibitors
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
335
structure length
317
Chain Sequence
RVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKILKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLSRERVFSEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGIKDGATMKFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILMEEIRFPRTLGPEAKSLLSGLLKKDPKQRLGGGSEDAKEIMQHRFFAGIVWQHVYEKKLSPPFKPQVTSETDTRYFDEEFTAQMITRPHFPQFDYSASS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords RAC-alpha serine/threonine-protein kinase
publication title Discovery and SAR of spirochromane Akt inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 97
structure length 317
sequence length 335
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2011-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF00433 Pkinase_C Protein kinase C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3qklA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3qklA01
2JDTA 4YMJA 5F20A 3LHJA 4CNHA 1PRYA 4AW2A 4JBPA 2ITQA 4OBQA 3GXLA 3RTPA 3QCYA 3QZIA 3UIBA 4G6NA 3ORMA 5IEVA 4ZSEA 4YTFA 4TW9A 3PJ3A 3DKFA 2H34A 3KL8A 3WF6A 4MXZA 4Z7GA 5GIOE 5TOZA 4FT3A 5DEWA 5LWMA 2JBOA 4D28A 3LFBA 4KS8A 2X6DA 3D94A 3EQGA 3MIAA 4FV9A 4QP8A 5CI6A 5DOSA 3UC4A 2OWBA 5IZFA 4RJ3A 4FSWA 4ALUA 5BUEA 1H26A 4NFMA 4IE9A 3TNHA 4XV1A 2XK8A 2EB3A 2F4JA 3AD6A 4JBOA 4KRCA 5EFQA 3MH1A 1JOWB 3FLYA 3MDYA 2XF0A 1YXXA 3QQLA 4UXQA 5EM8A 3BYUA 3CGOA 2HWOA 4BDEA 3BI6A 1BL6A 3ZRLA 4MYGA 3MH0A 4TXCA 5A54A 3LFAA 5B2MA 5IG1A 3TG1A 4DFXE 4RVMA 3N4VA 3FKOA 3DBCA 3IK3A 4V0GB 4YBJA 3I0QA 1VYZA 2WTIA 2OFUA 1ZYJA 2UZWE 4RFYA 3DXPA 2WO6A 1MQBA 2HXLA 2PSQA 3JXWA 3ACKA 3R7YA 3V5QA 4C7TA 3TEIA 4EOIA 4YNEA 2XKFA 3D2KA 3OWLA 4YC6A 5JQ5A 2CNVA 3BQCA 5FLFA 4AW0A 2X9FA 3MA3A 4HPUE 4JRVA 3C4XA 3E7OA 3Q9YA 4CT1A 2YZAA 3ORLA 5C1QB 4XH6A 3F5UA 3RK5A 1XR1A 3NYOA 4BFMA 4WNKA 4JBVA 1UU9A 5IUIA 3BRBA 1BL7A 2WTKC 4GG5A 5DWRA 5CAPA 3O0GA 4IX4A 1XH7A 4IBMA 1H08A 4E6AA 3FL4A 2BKZA 2O63A 2QKWB 4IC7A 4KINA 4P5QA 1WBOA 2VWWA 4ANNA 4EOQA 3VS1A 5L2TA 2VU3A 2ESMA 3KF4A 4YNOA 3D0EA 1OIYA 4I24A 3O96A 3VBQA 3MYGA 4TYIA 2W1DA 4EYJA 3NCZA 3FY0A 4FL2A 5HD4A 4EOOA 4JDJA 1TQMA 4RIYB 2O0UA 4TYGA 4QMNA 3JYAA 4C3FA 3PUPA 4O7SA 4EK8A 4YJTA 2HW6A 2YM8A 4ZY6A 2C0OA 4CZUA 1TQIA 2WAJA 3ZS5A 1ZZLA 1HCLA 3M2WA 2XBJA 4FEXA 4M12A 3L1SA 4H1MA 4FKJA 4KBKA 5CWZA 3UPXA 3FHIA 1APME 4TY1A 4GVJA 2B9FA 3QQUA 4O0VA 4BB4A 4CCBA 5HVKA 4ZY4A 2CSNA 3I6UA 4CKRA 4PUZA 4O0SA 4X21A 5AAFA 5B0XA 3LZBA 5EW9A 3HV3A 5HIEA 3HVCA 3ITZA 1YHSA 5IH6A 3TTIA 4Q2AA 3R8PA 4MWIA 3EHAA 3CSVA 3UOLA 2OXDA 3FLZA 4V01A 4FF8A 5LVNA 4BZOA 1WBWA 3TUCA 2GS6A 3QCQA 2OJ9A 4NM5A 3FQHA 4QMQA 3V01A 1VR2A 4YZBA 1DS5A 4FV0A 3Q9ZA 4WBOA 4DEAA 4BCJA 3A4OX 3OWJA 3R7UA 3QCXA 1ZOEA 3UVPA 5HE0A 3U9CA 4N70A 2YLFA 3BWJA 4DTAA 5F4NA 3AC5A 4EJ7A 4OBOA 3ZBFA 2CPKE 5J9LA 4BBEA 4W9WA 4LGHA 3QUDA 4E26A 3G6GA 3RGFA 4I5MA 5FDPA 3FLWA 2PMOX 3G33A 3NDMA 5HNGA 2PVFA 2C5XA 1OKZA 2GNIA 2W5BA 4I92A 4JI9A 4C0TA 3CBLA 3WZJA 2J0IA 3C0HA 4PRJA 3I81A 4XNEA 2XJ2A 1W98A 2R3NA 4C61A 2GNLA 1R39A 2GTMA 3MVMA 1PKDA 4MKCA 4L3JA 4WUNA 3Q6UA 5BUJA 5IISA 5ACKA 4AF3A 4RX8A 3GCPA 3FY2A 4IZ7A 2HZIA 5A4LA 3KXXA 3OF0A 3HGKA 1UU7A 3QQHA 2GDOA 3VNTA 1H07A 3UVQA 3DS6A 4O0RA 1XH4A 4BCFA 4UWYA 3KRRA 4AGUA 1Y57A 4QQTA 2C0IA 4S32A 5JQ8A 1OPKA 4ZTLA 2XM8A 4AA0A 3RK7A 1IG1A 1Q61A 3VS6A 3DTCA 3GT8A 4BC6A 4DYMA 3A7GA 2WQOA 2JIUA 4GK2A 5C8MA 2XH5A 3TCPA 4RX7A 1O9UA 3QL8A 4WIHA 4DH7A 3MN3A 1B38A 4RVTA 2UVXA 2W5HA 2B9JA 3FE3A 3LXLA 5JFXA 1J1BA 2XIZA 4G31A 3VS3A 4NYEA 3W18A 5D9HA 2BKKA 2PE2A 4GJ3A 3ZEWA 5FP5A 3MPMA 4U41A 5M56A 4RA4A 2YCQA 2WHBA 5JFSA 1CSNA 2WPAA 5CQUA 2YIRA 3A8WA 3O8UA 3IW8A 4XLVA 5G6VA 3TT0A 4USEA 4RA5A 3V6RA 1H0WA 1Q8UA 2C6DA 5CT0A 4BKJA 4HOKA 4YBKA 2XNBA 3AMYA 3BGQA 3NYVA 4IQ6A 2ETMA 3R01A 1KE7A 2Y4IC 2QO9A 4QMXA 2G2HA 3RK9A 4EQMA 3VBXA 2BILB 2X8EA 4YO4A 3DBDA 5CXHA 5M4CA 5AP2A 2W5AA 1OL7A 1ZOGA 3U51A 3R8VA 5CASA 4AE6A 2J0LA 1XBCA 2J0MB 4G6OA 5DT3A 4ZOGA 2YITA 3HRBA 3LOKA 5EDRA 4OW8A 4E93A 5F95A 3G15A 2JGZA 3L9MA 5ANKA 3QKKA 4RC4A 4L7FA 1OGUA 4CV8A 5HX6A 4IACA 3R8UA 2F49A 3K5VA 1Y8YA 2ITYA 4C8BA 4QRCA 3JY9A 3MPTA 1JSUA 1PY5A 1Q24A 2BAKA 2X2KA 4O86A 3PY3A 3BHYA 3KXMA 1JNKA 3AQVA 4MH7A 4OTPA 2H96A 3BE2A 5K5NA 2WMTA 3AD4A 3BYSA 4KNBA 1U46A 1Y6AA 3MVLA 5JKGA 2YWVA 2OKRA 1JVPP 2BFXA 3CCNA 3VRZA 3EL7A 3ORPA 4FTJA 4GUBA 2HY81 4EH8A 1PXOA 2X8DA 1M17A 4DN5A 2PVYA 5EOBA 2G2FA 3ZMMA 1PXLA 4CZTA 2YHVA 3QTUA 3TV4A 5KBRA 4ZZOA 3CTQA 4UX9A 1UU3A 3NEWA 4WSYA 3KA0A 1YWRA 3RAIA 3V04A 4DCAA 3AC8A 4ZJVA 4FOBA 1OIRA 1PXKA 3P4KA 4J98A 3QRKA 4FA2A 4DHFA 2PUPA 3NAYA 2BAJA 5J9YA 3LCTA 4D4RA 4L9IA 4PDOA 4YLKA 3DNEA 3EZVA 1WBSA 3HMPA 1ZY5A 3UZPA 3FMEA 4E1ZA 1Q8TA 4FR4A 4NWMA 3HAVA 3E64A 3V51A 1QPCA 3LPBA 4BL1A 1Y6BA 3CE3A 4U81A 2XIRA 3Q04A 2PZ5A 4XP3A 5A9UA 2J2IB 4AZWA 2FA2A 5LJJA 3V5JA 4I41A 4G3EA 2QLUA 4RC2A 4BIBA 4DFUA 3FMLA 1Q4LA 3FZOA 5DIAA 1H1WA 3OTUA 5BVFA 3QU0A 2VAGA 4F7LA 3OG7A 4FZDB 4V0GA 2EUFB 3IOPA 4YJUA 4B4LA 2B7AA 2C30A 3SG8A 4Y72A 5L2SA 2VWUA 4YO6A 5JK3A 5LCJA 2J7TA 3NNWA 5KNJA 4AZEA 2WTJA 3NW7A 3OW3A 3KMWA 4UZHA 1HOWA 2QOLA 1OVEA 1UKHA 1RW8A 1CMKE 2W4KA 5JGDA 5AV3A 5A3XA 5AR4A 4GKHA 1YOLA 3JVSA 4ANLA 4DF3A 3PTGA 4FUYA 4BCKA 3EFKA 4C59A 3IG7A 1G8AA 4CXAA 3QBNA 5LVMA 4DG0E 3R6XA 1Q97A 4Q9SA 1Q8ZA 3WIKA 4X2NA 4IW0A 3DJ5A 1CTPE 4QPAA 4RPVA 4JQEA 1H1PA 5LQFA 3DFCB 2JBPA 4BI2A 3DV3A 4YJPA 4BGHA 4XG3A 3G2FA 3FJQE 3MA6A 5IQGA 4B99A 4GFOA 4ID7A 4IAFA 1FOTA 4G16A 4OTRA 2JEDA 4C33A 2J6MA 3R2BA 4Q5EA 5HLNA 2R3LA 4D55A 3ULZA 3PXFA 5JFWA 5C01A 5KKRC 2AC3A 3MY5A 5CNNA 5K9IA 3OXIA 4D9TA 2VO3A 4E6CA 4PTGA 2OF4A 3OCTA 3MJ1A 3I7CA 3LFCA 4EORA 5BVKA 3E8NA 3P78A 4YTCA 4FX3A 2JDOA 2UW8A 4IZ5A 3K3IA 2BHHA 2WMWA 4EWHA 4EK3A 4ERKA 4FZ6A 3NR9A 1LR4A 4CV9A 4Z16A 2BMCA 3BX5A 3NSZA 4CZYB 2HXQA 5CNOA 5J1VA 4R7BA 1L3RE 4FOCA 5FM2A 4K33A 4J53A 5LARA 4EHVA 4DGGA 5DRDA 2C6LA 3VVHA 4FMQA 3LLTA 3NVMB 3EKKA 4H3QA 5AWMA 1MP8A 3A61A 2RF9A 2A0CX 4C37A 2BRBA 3I5NA 3R73A 4OTHA 4TN6A 5EKNA 4GT4A 3HX4A 3LFSA 3NNVA 4M15A 1ZYSA 4QD6A 3VWAA 4DITA 4F6WA 2WELA 3KCFA 4O0YA 3CJFA 4O7VA 1OKVA 1PYEA 2R3IA 3U9NA 4FICA 4ANBA 5CSHA 4YC8A 5L4QA 2ITUA 4LUDA 3CD8A 1T46A 3QALE 4FTTA 4DBXA 1PKGA 4D0WA 3A60A 4U7ZA 4BYJA 2XEYA 4C58A 4LGGA 4DCEA 3TM0A 3LFEA 2ZMDA 2OJIA 4JG6A 5CSXA 5H2UA 1TVOA 3NUAA 2JITA 3GU6A 5ANIA 1YOJA 2WMXA 3E8CA 5DPVA 1A48A 4TL0A 1M14A 3EQDA 3I6WA 3H3CA 3ORZA 1ZRZA 3LCOA 3VBWA 5IUGA 2VTHA 3ORNA 4FZ7A 3Q32A 5EG3A 2Y4PA 3FMHA 4F63A 4IX3A 3LFNA 2NO3A 4PNKA 1YXSA 2GTNA 1NVQA 4IM2A 1X8BA 3UQFA 3GC9A 3M1SA 4H1JA 3MWUA 4OTGA 3ANQA 3GU4A 1JQHA 3PPKA 1SVHA 4FTLA 4JQ7A 2I0HA 2E9NA 4RFZA 5AV4A 4PPCA 4BRXA 4DT8A 2ZAZA 5I3OA 4O7TA 3QTRA 4TTHB 3RHXA 5HE3A 4U97A 5M53A 4X2FA 3CTHA 4I6QA 4USFA 3FZRA 3O51A 3QF9A 3ZRMA 4UWCA 4QMSA 3MFSA 3OT3A 4DEIA 3ZRKA 4EH2A 3OCGA 2BTRA 4U0IA 4YJSA 3GEQA 4AGCA 3ZO3A 1NVRA 2O2UA 2WIHA 3OY1A 5IH4A 2PTKA 5IA2A 3DAEA 3OMVA 4E6DA 4EH7A 5JEBA 3QQJA 1UKIA 4NZWB 3JVRA 3TUDA 4CG8A 4BDDA 3CY3A 3UGCA 4PF4A 4L67A 2ZB1A 3R7IA 1OL2A 2WMBA 5AUVA 1PMNA 2HENA 2UZOA 3PVGA 4HZRA 4KKEA 4XUFA 4PP9A 4YJRA 4M67A 5EQEA 2F2UA 2PL0A 3KC3A 5HGIA 4GT3A 3UYTA 1IRKA 3NYXA 2EVAA 3ZO1A 4M14A 5HBJA 2JDSA 4EBWA 3VQUA 3S4QA 2V22A 3GU5A 3DBEA 2C6TA 5HX8A 1CDKA 4CKIA 5LCKA 3POZA 4U45A 3PXRA 5DR6A 2JIIA 1G8SA 3MESA 5IQBA 1O6YA 2YCSA 4FNXA 2BUJA 2WTCA 5DT0A 3SDJA 4K6ZA 5AP7A 4C3RA 2VTAA 2EXMA 2CGUA 2WU6A 4I5CA 3PPJA 4JBQA 4F9YA 3IDBA 3P7BA 4FSUA 5HO6A 2GHLA 4I0SA 2CGWA 4CFNA 2UW3A 5D11A 4CFWA 2PWLA 2VUWA 5LVOA 3F82A 4QYGA 4ACGA 4HJOA 2XNGA 3GCQA 4L52A 4WNPA 4WBBB 4O2PA 2PMLX 4TYHA 4NW5A 4BI1A 4FEWA 1PXNA 3IQ7A 2B52A 3F3ZA 3ZSHA 4EJNA 2BZIB 2YJSA 5T6KA 4U3YA 2PUIA 2C47A 3MVJA 3M11A 2LAVA 4PNIA 4FKTA 3W33A 4BDJA 3ZDIA 3F6XA 3QA8A 4NFNA 4NM3A 3D7TB 5TO8A 5IEYA 2WKMA 4R6VA 1ZXEA 1GIJA 2FO0A 4DH3A 5HBHA 3ELJA 4F0GA 1KWPA 4QMWA 2GS2A 2HCKA 4J96A 2YM5A 5FUTA 3LJ0A 5HOAA 4FIGA 2PVMA 4DEDA 2XNMA 1OMWA 1WVYA 3P1AA 2WQNA 1Z5MA 3IW7A 3UVRA 5BPYA 5J9ZA 2ITVA 5BX0A 3R04A 4K18A 4J8MA 4M69B 3FC2A 4RWKA 1A9UA 1CKJA 5ETCA 2Z2WA 2O65A 4P7EA 1YQJA 4XBUA 5HZNA 2Y0AA 4P2KA 4BDBA 4JL9A 4J99A 4AUAA 1H01A 3LJ2A 4E8AA 4CG9A 4FT5A 5CSWA 5L6OA 2FSOX 3TKHA 5M4FA 2UZUE 4ALVA 1XH8A 4F64A 4MBLA 4EZ5A 3EQBA 5HCXA 4YHFA 3LVPA 3WF8A 3NRMA 1OL5A 3R02A 2GHMA 3UMWA 4EOMA 4FEVA 2E9OA 3Q4UA 4WG4A 5KZ0A 3KXZA 4HVHA 2PE0A 3WYYA 2PPQA 4GKIA 5M44A 2ITZA 3W10A 4OAUC 4TKSA 4H39A 2VZ6A 3TNIA 4IB1A 3OD6X 2WMVA 1REJA 3K2LA 3KRLA 3LM5A 4GYGA 4BR3A 1WBPA 3A7JA 3JR1A 1DI8A 2FSMX 5BUIA 1GIHA 2UV2A 4FKQA 3CXWA 3I4BA 1V0PA 1UVRA 3QD2B 3OHTA 1FVTA 3KXGA 2ERKA 3OTVA 4BZNA 1VZOA 4OT5A 4JX3A 4O7NA 3SXFA 2VV9A 4Y85A 4I3ZA 2CLXA 5FTGA 3GGFA 2B53A 5AUYA 3PXKA 4BBFA 5TF9A 4E4LA 1U59A 3RP9A 4HYSA 2BDFA 4MNEA 3WZDA 4CGAA 3FZTA 2GNHA 1JSTA 4RQKA 4BCIA 4CTCA 2JKQA 2WZJA 3GC8A 4JT3A 5LOHA 3LJ1A 3SRVB 4C4FA 3CQEA 4I6HA 5AX3A 1F0QA 2WOTA 3VS2A 2CMWA 1JKKA 2Z7RA 4DAWA 2OZAA 2Z02A 2W1HA 2IN6A 3R21A 3FC1X 4PL3A 3Q53A 5AJQA 5AX9A 3PJ8A 3SA0A 4L45A 4G3CA 1H0VA 3C13A 3NNUA 5E8UA 1WMKA 3R1QA 4MD8E 5GJDA 4GIHA 4IWPA 1H1RA 3BKBA 3ODZX 3OCBA 1FGIA 3OOMA 4LV5A 4F9BA 3FLQA 4E4XA 1GNGA 2F7EE 1XH5A 4WKQA 1XH6A 4IVAA 3SHEA 5JT2A 2HWPA 4CMOA 4QTAA 2XIKA 5L2QA 3DBQA 3KULB 2E9VA 2WMQA 2VTTA 3FXXA 4QP4A 3NW6A 4NKSA 4QQCA 3I0OA 2XM9A 3FMKA 4L46A 3NYNA 4AW1A 4BDAA 3DDPA 2HYYA 2ZYBA 2GNGA 2W96B 4IX6A 2QU6A 2GMXA 5ANOA 4O38A 5AR7A 3QTWA 5HD7A 4ENYA 3H0ZA 4FTIA 4IDTA 2RFEA 4FK6A 4YGAA 4DH5A 2PMIA 5CVGA 4LOOA 1E1VA 4UEUA 4YTIA 4WT6A 2VO6A 3E5AA 5HVYA 2R3PA 4RVLA 5D7VA 4ASDA 4XV9A 4NH1A 5C4KA 4JOAA 1Z57A 4JJRA 3DFAA 1FPUA 3KQ7A 3QRTA 4R7IA 3OEFX 5ETAA 3FQEA 5BNJA 3JY0A 5J5TA 4FSRA 1XHAA 3R28A 4BCPA 3RPVA 3G5DA 4MQ1A 2QCSA 5EM7A 4ZLYA 5HI2A 2SRCA 5JGAA 4BTJA 4XP2A 3QUEA 1PJKA 2VGOA 3O2MA 3TI1A 3W2SA 4F1TA 4U80A 3G6HA 2V7OA 3CKXA 3EB0A 1BMKA 4S2ZA 2YFXA 4W9XA 3Q4TA 4YJQA 5CTPA 5DRBA 2GU8A 2QOOA 3COHA 3KXHA 1ZMUA 2PVJA 2DS1A 3E93A 5ICPA 2F7XE 5FEEA 4S30A 5E8WA 4HZSA 4DFZE 5IF1A 2XJ0A 5HTBA 5JMSA 2WQMA 5IA5A 3F2RA 1YDTE 4D2VA 2C68A 2XKEA 5EI8A 1P2AA 4O27B 4XBRA 3EWHA 2YWPA 4KUJA 2VTMA 2C6EA 1S9JA 3EFWA 3QWJA 3I79A 4YZCA 4ZEGA 1UV5A 3GP0A 2V5QA 3PJ2A 4O84A 4L3LA 5CU0A 4WNMA 3EQHA 3PWDA 5I9UA 4AT3A 4D2SA 2B55A 3IS5A 4LRMA 3C1XA 5TR6A 2BCJA 3LFFA 2UZNA 2QG5A 3QKMA 5E8XA 4NCTA 3R2YA 4D58A 2XYNA 3D4QA 4ZJIA 2ITOA 2W4JA 4DTKA 5EW3A 2VTPA 2V7AA 4RJ8A 5IKWA 3MPAA 5LVPA 5HG5A 4AN2A 4HYHA 2YIYA 3SXSA 3I60A 3W16A 3HAMA 3F3TA 4MXCA 2YZLA 3DKGA 2GPHA 5M07A 3LMGA 4G5JA 2YCFA 2C0TA 2O64A 3MFUA 4GFMA 4AXAA 2OIQA 4H3PA 1MQ4A 2EXCX 2YCRA 2DWBA 2HW7A 3CIKA 5DT4A 3WF9A 3ZFMA 3GC7A 3TNWA 4APPA 4FKSA 4A4XA 4EONA 5HO7A 4HCVA 4GS6A 4KSPA 3TN8A 4BCNA 5B7VA 3SW4A 4EKKA 2BHEA 1MRYA 2FSTX 2VTOA 1XWSA 2R5TA 3O7LB 4KRDA 4AA4A 2PVHA 2F7ZE 4DT9A 5EH0A 3UE4A 3QD0A 1ZWSA 4EL9A 5FXRA 3F69A 5JSMA 1TKIA 1QPDA 3FYKX 2XCKA 4FEQA 5E1EA 2I6LA 5DA3A 5IU2A 2CKOA 4WRSA 2ZM1A 2FSLX 3RPSA 5CY3A 4BGGA 1H27A 1H1SA 4GVAA 2OIBA 2DYLA 2C3IB 4HCUA 4UYNA 4D1XA 4EI4A 1GZKA 4JR3A 4ACCA 4OTFA 2Y8OA 4BKZA 3PY1A 3F7ZA 4FSQA 1GY3A 2VD5A 3DZQA 3RKBA 4D4SA 1BI7A 2BALA 1STCE 1OIQA 3EYGA 3HEGA 4G3GA 3QCSA 4IVCA 4X3FA 5TKDA 1H28A 2UUEA 3LFDA 4ITJA 2R0UA 5HG8A 3MSSA 5E92A 4F9CA 3C9WA 5I9WA 4BDCA 3MIYA 3PE2A 3FMDA 4MVFA 5KX8A 4NKAA 1G5SA 1IEPA 3H10A 4R5SA 2UZDA 4ZSAA 2XUUA 4ONAA 1L8TA 3R1YA 2ITNA 2OG8A 2PMNX 2WXVA 4W4VA 3SOCA 1E1XA 2I0VA 3GU7A 1SYKA 4C02A 3OXZA 5J7HA 4O82A 4Y83A 4L43A 1YVJA 3FXWA 4JAIA 4Z9LA 3RI1A 3OXTA 4ZS0A 1RQQA 4N6YA 4A07A 4E20A 3LMIA 3KRWA 3E3BX 2ITPA 4XG8A 4XX9A 4MBIA 4MHAA 4BIDA 2OW3A 5CSPA 1ERKA 2CGXA 4KBCA 3ZDUA 2PVKA 2P2IA 4TWCA 2JKKA 2B0QA 2J51A 1K3AA 3BLRA 4ALWA 4BWPA 2WTKB 3FI2A 2PZRA 3RVGA 4CFVA 3FYJX 4RLKA 4QYYA 4R1VA 5IUHA 2YIWA 4BDFA 1H25A 1XO2B 4HVDA 2CNQA 4C4HA 3U54A 5EI6A 4I5PA 4F9WA 4LOPA 4IVBA 4WSQA 3H4JA 3L9NA 5CEKA 4GT5A 4PDYA 3DGKA 3LM0A 3QGWA 1V0BA 3VJOA 4IB3A 2WTWA 3TWJA 4HPTE 3ZLWA 5ETFA 5L6WL 4UALA 3FI3A 4O0XA 4MWHA 3P08A 5JGBA 2QR7A 1AD5A 4O83A 4F1MA 4F1OA 4KIKA 2W0JA 2W06A 2X2LA 4EUUA 3EQRA 4QYHA 1XH9A 2YAAA 2BRMA 3QXPA 5HCZA 3P79A 1B6CB 3HV4A 3T3VA 4BCQA 4E3CA 5BMSA 4YHJA 4FSTA 3U55A 3P5KA 4QP2A 3QGYA 3UPZA 4MXAA 4NTSA 5CZHA 3UC3A 1YDSE 3PFQA 4O0WA 3F88A 1U54B 2RG6A 1G3NA 4XRJA 5DVRA 2G15A 3QZHA 1YHVA 2IVVA 3BYVA 4MX9A 4RC3A 3T8OA 4YZ9A 3FLSA 2XVDA 4FVQA 2HK5A 3KEXA 4ZTRA 3UBDA 3VIDA 3FKLA 5L8KA 3U6JA 2QO7A 3ZYAA 3ZH8A 3QWKA 1LEWA 2XRWA 4EOSA 3FKNA 1R0PA 2B54A 3IW4A 5HIBA 5KBQA 5KMMA 3OZ6A 3BV2A 2CN5A 3NUUA 3QXOA 4NIFA 5FEQA 4Q9ZA 4UN0C 1SMHA 4DTBA 1KE6A 4FNZA 4ASXA 2OIDA 3CQUA 2W1GA 3PPZA 1DM2A 4XRLA 5E7RA 3SV0A 3A99A 3OC1A 4FE2A 4DEBA 2X1NA 3MBLA 3ZONA 2VWYA 4RX5A 4I22A 4OTQA 4RIXA 1Q41A 2C3LA 4EKLA 3C4FA 4IFGA 3VN9A 4M0YA 2BRHA 3PA4A 3BEGA 1W84A 4IEBA 4OTWA 5J95A 2F57A 3A62A 3GQLA 2J5EA 2R3FA 1OIUA 2VTIA 1JLUE 2A1AB 3Q5IA 4EBVA 1W0XC 4TZRA 1MRUA 2C3KA 1H4LA 2UW6A 3VUDA 5F1ZA 4I21A 4DFNA 5L2WA 1VJYA 3R7GA 4N6ZA 4KD1A 2NNWB 3QZFA 1Y8GA 5A6OA 2JC6A 4NT4A 3RAWA 1M2PA 4RZVA 4YP8A 3IGGA 1FVVA 5C9CA 1VEBA 5EYDA 3GB2A 3R8LA 4AOTA 5DR2A 4FKGA 1M52A 3KRJA 4D9UA 4NTTA 4OT6A 4DINA 3KXNA 4ERWA 4I5HA 3R00A 4I1ZA 1U5QA 2PVRA 2CDZA 4TNDA 4EOJA 3ZO4A 3G9LX 5HTIA 3HNGA 2QOIA 2X7GA 3O7LD 4EC8A 5B2LA 5K5XA 4N0SA 2YM6A 1GJOA 5JZJA 4O22A 3NWWA 5C03A 2XNEA 4F9AA 2Q0NA 2W9FB 3AOXA 4M97A 4YSMA 5KUPA 2BDJA 3ENHA 4G9RA 4K9YA 3E3PA 5IA4A 4CFMA 2H9VA 2LGCA 1PXIA 2A4LA 1H8FA 2ITTA 4QP7A 3BU5A 3WZEA 2GHGA 1FINA 2UW7A 3OT8A 1ZARA 5HE1A 2VNYA 2W7XA 4R77A 2CKEA 1WVWA 1Z9XA 2WQBA 5HIDA 4RFMA 4IM3A 3NZ0A 3B8QA 5K4JA 3HA6A 5DG5A 4K8AA 3R63A 5AAEA 1TQPA 2ZV7A 1W83A 5JZNA 3RPYA 5JFVA 1WVXA 4NEUA 1OKYA 4TT7A 4CMTA 2QOQA 4MXXA 4HVGA 1OL6A 1ZYLA 1PXPA 4PWNA 2RSVA 5EYCA 2Z8CA 3R30A 5A4TA 3CD3A 4RIWB 3V5LA 3HECA 3ZTXA 2Y4IB 5FP6A 4XV2A 2UZEA 3E88A 4QMZA 5GJFA 5HLWA 4E5BA 3MI9A 4ZZMA 1P14A 2IVTA 3AC1A 3QLGA 4QP6A 4XMOA 2QKRA 5HG7A 5DI1A 4JG8A 4FV4A 3RAKA 4C34A 5JN2A 1IR3A 2R3RA 2EU9A 5F94A 3WZUA 3SLSA 4B8LA 2WMSA 2E9PA 2QNJA 4K11A 1GAGA 1YI4A 3BEAA 2VRXA 2C3JA 3GBZA 3O23A 3Q4ZA 4JAJA 4PL4A 4RIYA 5FQDC 2OJGA 4KB8A 4EH4A 5CXZA 5F9EA 1OBGA 4NK9A 4AGWA 3DT1A 5HLPA 3SGCA 3KFAA 3QRUA 4ZAUA 3ID6C 3UOKA 2YDIA 3A4PA 2X81A 4PMPA 4PDSA 1SVEA 3EQPA 1WZYA 4E7WA 3ZLSA 4CQGA 3F7WA 4NCTC 3TDVA 3H9RA 4C57A 5TE0A 3MV5A 4IJ9A 4JS8A 4BDIA 4BVUA 3OCSA 1PXJA 3ULIA 3FI4A 4KAOA 4B8MA 3A7FA 2ETKA 5IA0A 2W4OA 5IMEA 3LMHA 5IQCA 3TZMA 3ZC5A 3Q2JA 1I09A 1NVSA 2AC5A 2OXXA 3NUSA 3RWQA 3ATTA 4YC3A 2VO0A 4FV2A 5AP5A 2R2PA 1XJDA 4EK5A 2GS7A 3GCVA 1W82A 2XNOA 3Q4CA 4DE4A 4CRLA 4RX9A 1M7NA 2CCIA 4R1YA 1R0EA 4J1RA 3UNZA 4IB0A 4F0FA 3C51A 3HMIA 3T9IA 3C50A 4QP9A 4N4SA 3CJGA 3ZFYA 3VJNA 3P7CA 4B6LA 4EH5A 2WD1A 2XBAA 3A2CA 4WG3A 5DMZA 3FEGA 4EH3A 4X0MA 3OUKA 5FG8A 4ZTMA 5EDPA 1YOMA 4WG5A 3QQKA 4P4CA 2OFVA 2OXYA 2JKMA 2OU7A 5KMOA 5I9YA 3TV6A 4BYIA 3PIZA 3POOA 4PMMA 3RZBA 4IWOA 4NM0A 3BHVA 1KUTA 4BICA 3KY2A 3QQFA 3VULA 4QYEA 4EOKA 5DBXA 2OK1A 4HCTA 3PIYA 3FMMA 4I0TA 3ROYA 3NIZA 3D7ZA 3E8EA 3OBGA 4FSYA 4D1ZA 5A6NA 2P33A 4R3RA 3MB6A 3L9PA 3ZU7A 2YIQA 2R64A 3QTQA 4LM5A 3MY0A 2FYSA 4X3FC 5CI7A 4LMUA 4A9UA 2IVUA 2QOCA 3L9LA 3PG1A 3QRIA 3RBWA 4KIQA 2WQEA 4RWLA 3UP7A 1CM8A 2VO7A 2PVNA 2NPQA 2CGVA 4D4YA 5EYKA 4FT0A 3SC1A 3QTXA 3U8WA 4FTQA 4I4FA 4Y8DA 2W1FA 2WU7A 4ACMA 4P90A 2QC6A 2G01A 1R3CA 1Q3DA 3AGLA 4DBNA 4ANSA 1NW1A 3IDPA 3NUXA 3P23A 3PJ1A 2WEVA 4XG4A 4APCA 3GFWA 4K0YA 4M8TA 1CKIA 2G2IA 2ZVAA 4QNAA 4MF0A 5EHYA 4FTNA 5FEDA 3VBYA 2B1PA 3Q3BA 5KKRB 4G5PA 4YTHA 4HGEA 3FHRA 3IPHA 5ETIA 1P4FA 2XNNA 3F3WA 3PVBA 3QYWA 3P9JA 3NCGA 4GV1A 1MUOA 4QMMA 4AQCA 5EQPA 1ZYDA 4P5ZA 4BKYA 5HU9A 2WOUA 2UW5A 2X0GA 1PW2A 4JVGA 4K77A 5AUZA 4HVSA 3MFRA 5EQYA 3W55A 3DAKA 5D1JA 4F99A 2OH4A 5IQEA 1XQZA 2QOFA 4CMUA 5CU6A 2C6MA 2QODA 2J0JA 4FTOA 4D4VA 5BVNA 4IH8A 4WNOA 3DBFA 3WYXA 2ZJWA 4M0ZA 2C1AA 3NMUF 3AG9A 3BQRA 3OFMA 4FUXA 4AS0A 5J5SA 4J7BA 3TDWA 4RWIA 2FH9A 3UNJA 4U42A 3RALA 3VHKA 5HNIX 3OP5A 1FMKA 3W2RA 5IA3A 1H24A 1Q8WA 4JNWA 2GQSA 1URCA 3TZ9A 3TIZA 5M08A 4FTRA 5DGZA 4FV1A 2QVSE 4F7SA 5CANA 3NLBA 4IFCA 1GOLA 4A9YA 3LKMA 2ONLA 3KB7A 5CSVA 4IADA 4ZTHA 3DAJA 1JAMA 4C3PA 3RM7A 3FQSA 2I7QA 5CZIA 2VTNA 5DN3A 1GZNA 3HLLA 2VWIA 5HG9A 4ZSJA 3EZRA 2XK4A 4HGSA 4HVIA 1UU8A 4UV0A 3R7OA 2YAKA 5GZ9A 3DB8A 5AFVA 3W2PA 3WILA 4F7JA 2OLCA 4HNFA 1OUYA 3D5WA 4Y46A 2P0CA 4F7NA 4XS2A 4CFUA 3EH9A 4TYEA 4R8QA 4PDPA 3BWFA 4XJ0A 2ZM4A 2ZDTA 4MEDA 4EUTA 2KTYA 3IDCA 4QTCA 4ZK5A 3T3UA 3ZXTA 4QTEA 5IMXA 3I5ZA 4FV5A 1Q8YA 2YABA 1YWNA 1W7HA 3TKUA 4KIOA 3Q9WA 4BCMA 2UZTA 3GOKA 4W4XA 3RNYA 4TWPA 5KHWA 5M09A 1YKRA 4BDKA 1KOBA 3VRYA 4IC8A 2HY0A 4BDHA 4RZWA 2WEIA 1J7LA 4FZFB 4FTUA 3UOJA 5H9BA 5AP6A 2HELA 3BELA 3QLFA 5CAUA 2GFCA 4XOYA 2XJ1A 1WBTA 4X2JA 5CT7A 2NP8A 4WD5A 4XOZA 3DCVA 5E8YA 5LWNA 3FI8A 2VX3A 3GU8A 4FBXA 4MCVA 2VTRA 4GG7A 3R7EA 4JG7A 1A06A 3ALNA 4TRLA 5KMJA 3ODYX 5EOLA 4RQVA 4YLLA 2FB8A 4CYJA 3BBWA 3V8TA 4H36A 4Y5HA 2PZIA 1BX6A 4BWKA 5AV2A 1KE5A 3F5GA 1J3HA 3DA6A 3F2NA 3HRFA 4II5A 5D41A 5CEIA 5D10A 4A9TA 2YEXA 3DK3A 5E8TA 1KV1A 2XYUA 4GUEA 5EYMA 3V5PA 1IASA 4AN3A 4X3JA 2CN8A 4C36A 4YJVA 5M4UA 4C38A 5KCVA 3E7VA 4O91A 4W8EA 1REKA 3H9OA 3EQCA 4YJOA 4CFFA 1ZY4A 3QHRA 5IQHA 3PXZA 2QQ7A 3NUNA 5ITAA 5AR2A 4ANMA 4FNWA 3E8DA 4EHEA 4JQ8A 3PIXA 4KKHA 4O2ZA 5BMMA 3PG3A 2X8IA 2F2CB 2X9EA 2BPMA 4PV0A 3WZKA 3ETAA 4HW7A 4LV8A 3SVVA 3DZOA 1ZAOA 5KZIA 4EOPA 3MTFA 3BYMA 2Y6MA 2UW4A 5CQWA 3HDMA 4AN9A 3QD3A 1QPEA 3NNXA 4FT7A 1ZYCA 1ZMVA 1U4DA 1RJBA 5G1XA 2CNUA 4DH1A 4YZDA 5CEPA 3D83A 4KABA 1SNUA 4FL3A 3W8QA 3QTSA 3FUPA 2UZVA 4ZY5A 2REIA 5CALA 4C4EA 4PPBA 4XCUA 3PSBA 3UIUA 2NRYA 3C5UA 4FK3A 2OF2A 3D14A 3PWYA 4ENXA 2QLQA 1FMOE 5ANGA 4U8ZA 4OBPA 2QHMA 3F5XA 4L7SA 2YISA 3B2TA 3RMFA 3TACA 1FQ1B 4YZMA 3P86A 4FSMA 3RCDA 4O7LA 4TYJA 5C8NA 2R9SA 2XNPA 2J4ZA 5GIPE 3PA3A 3EIDA 4NU1A 4ITIA 1JPAA 5DEYA 3FXZA 5FBNC 3D9VA 3NUPA 4XG6A 3OOGA 4YZNA 1OB3A 4Y5QA 4IWDA 1OKWA 3HKOA 3FPQA 4TWNA 5E8VA 4JDIA 4LG4A 4MF1A 3NX8A 3R7VA 4IMYA 5ANDA 4BZDA 4ARKA 4BTMA 3W1FA 4UMRA 4GL9A 4B0GA 2PK9A 3N51A 4JRNA 4QYFA 4RVKA 4DFYA 2XIYA 3FZSA 1P5EA 4JIAA 4FTMA 3DK6A 2XZSA 1SZMA 3F5PA 3PRFA 3RZFA 5AA8A 2QOHA 3LXKA 3V8SA 4RGJA 3S1HA 4AAAA 3E63A 5AAGA 4QMLA 3DJ7A 4OAVB 4A9SA 4D1SA 5DR9A 3UIMA 3MB7A 4MD7E 3TJCA 5LMAA 5FTQA 4BHNA 1JKTA 3QC4A 4ASZA 4IAIA 4ZP5A 1WBNA 3OWKA 2HZ0A 3BCEA 3BIZA 3HYHA 4FSZA 4LI5A 4OTDA 2R3JA 5BVEA 3ZUVA 3GFEA 3BGZA 4RT7A 3OS3A 1UNGA 3IW5A 4X2GA 2XKDA 4E5AX 4IANA 1J7IA 3BPRA 3TV7A 5K0KA 4RIOA 5E9EA 3EMGA 3R0TA 3GQIA 3NGAA 3PA5A 3T9TA 5H8BA 4IWQA 4I4EA 4AU8A 3FDNA 3R1NA 3UDBA 4F08A 3ZUUA 3NUYA 4FC0A 2UZLA 2ZV9A 3DQXA 5T3QA 3VUGA 3ET7A 4O7ZA 3LXNA 4CVAA 2WTVA 3PJCA 2X7OA 4ZTSA 4FZAB 4QPSA 4EH9A 3BV3A 3HV6A 3THBA 3R8MA 4BF2A 4DGLC 1FVRA 4GK4A 1WAKA 4YLJA 3ZOSA 2YJRA 4D2WA 5HICA 5AR3A 1OM1A 5DYJA 4BTKA 3WARA 5HO8A 3AGMA 4DFLA 3QD4A 2CHLA 2IZUA 1SM2A 2I0YA 3AMAA 4FKUA 2CJMA 4FVPA 4PTCA 2XRUA 5CX9A 4DG2E 3E62A 3VC4A 3CPCA 4PY1A 3JPVA 2E2BA 4JR7A 4GSBA 4RJ7A 4Z3VA 5J1WA 5KMKA 3OROA 3L8VA 3SAYA 1FGKA 1OPLA 3EJ1A 5CEOA 4CKJA 5CEMA 2BRGA 2X4FA 4U5JA 3ZXZA 2P4IA 4RG0A 5I0BA 2PYWA 3COIA 1BUHA 4USDA 4Q5HA 4U6RA 3DB6A 5HTCA 5IQFA 2YERA 3QAME 4N57A 4HGLA 2AUHA 2QURA 3DXNA 4L53A 4LUEA 3KU2A 3UMXA 5AUTA 5L8LA 5CENA 4O7YA 5L2IA 5AV1A 3REPA 2PZPA 2X39A 4RLLA 4FKOA 4XYFA 4ZMEA 4CFXA 3TL8A 5C27A 3FZPA 4U3ZA 1I44A 2VTQA 3R71A 2C5NA 2JFMA 3S3IA 3PZEA 5AR5A 3V8WA 2JLDA 5CAOA 3COMA 3ALOA 4BGQA 3VS5A 3EFLA 4UY9A 3HRCA 2ITWA 5AM7A 5H3QA 5BVWA 4L00A 3LCDA 4QMPA 3VW8A 3DKCA 5M55A 2ACXA 3DDQA 1R1WA 4WRGA 3VS4A 4M3QA 4RJ4A 4O7WA 4QTDA 2C5YA 3IONA 2W1ZA 4QNYA 4F6UA 2GSFA 4FIEA 5M4IA 2NRUA 3F2AA 4QTBA 5L8JA 1O6KA 4IX5A 4GMYA 3DTWA 2Z60A 2XA4A 3TKIA 3QUPA 3ZZWA 2C1BA 5HE2A 1K9AA 5CYIA 4EHGA 1J1CA 4F4PA 2OJJA 2R7BA 2EXEA 2VTSA 3VO3A 4BY9E 5AP1A 3PDTA 3PVUA 3ZEPA 3CGFA 2H8HA 4RJ6A 3C4CA 3S95A 2W1EA 5HBEA 3SX9A 3HL7A 3L8PA 2IW8A 3HP5A 4LYNA 5CS6A 4I94A 4JLCA 5CU4A 1V0OA 4R78A 3GCUA 4QMYA 2OICA 5AIKA 4E5WA 2VTLA 5E90A 1ZMWA 2GQRA 3KCKA 2ONLC 4FIIA 2OGVA 4OR5A 4G17A 4I23A 2OSCA 4AZVA 1OECA 1RE8A 2R3KA 2C5OA 5GNKA 2BRNA 5I9ZA 4CRSA 2B9IA 3BHUA 1J91A 4CD0A 2PU8A 3I1AA 4RJ5A 3QRJA 4J97A 3D7TA 3DLSA 3DQWA 1JWHA 4PMTA 3V6SA 4ZSLA 2QR8A 2UW0A 2HZ4A 1WBVA 5FXQA 2XS0A 4AFJA 3C5IA 3QC9A 4R7HA 2RFDA 4EK4A 4O21A 2HIWA 3UQGA 4WOVA 4G1WA 4CLJA 4J95A 2I0EA 4XG7A 2JDVA 2QI8A 4X7QA 2IZTA 2YDKA 1V1KA 2VWXA 2WGJA 3LAUA 5AP0A 3G0EA 4M69A 2VTJA 2W9ZB 2XP2A 4C4GA 3Q2MA 2DQ7X 1YXTA 2PVLA 4IHPA 3D5VA 4ANOA 4QO9A 3ORXA 3HMOA 3W2CA 4I93A 4Y73A 4ASEA 3NIEA 1YW2A 3HUCA 1YRPA 3OY3A 1NA7A 2F9GA 4UYAA 3VBTA 4Z55A 3A8XA 4F65A 1DAWA 3HMNA 1LEZA 4W8DA 4WHZA 2QG7A 1R78A 3OW4A 3QX4A 3ATSA 2YLEA 4JX7A 2IWIA 4R5YA 3ZO2A 5FRIA 1XBAA 4M68A 2AYPA 4LOQA 4CYIA 2UZBA 4AA5A 3ZSIA 5LXMA 1ND4A 2X2MA 4QT1A 2UW9A 4UMPA 2ETRA 1UNHA 2ERZE 1FBNA 1AGWA 2ZV2A 3SOAA 1OI9A 3FBVA 5CF5A 3IECA 4JIKA 5DNRA 2YACA 2HAKA 4JXFA 3R8ZA 4DGNA 5IH5A 2QO2A 3A7HA 2I40A 3R1SA 5TT7A 1QMZA 1QL6A 2GNJA 3PYYA 2R3QA 4L6QA 4YJNA 2C6OA 3HP2A 5K0XA 1RDQE 4DEGA 4ACDA 3PSCA 4NL0A 4DA5A 2OZOA 3Q9XA 3ZM9A 3H0YA 4EWQA 4C4IA 5IDPA 3OEZA 3V5WA 4JDHA 3N4TA 4G9CA 1PHKA 3EKNA 3BU3A 2XKCA 3N9XA 4ITHA 4V04A 4XG2A 2PUNA 3BHTA 3SRVA 3UQCA 3GC0A 2O5KA 1WFCA 3OUNB 2W05A 2J90A 4GW8A 3ZLYA 2X7FA 3ZZEA 5KO1A 5GJGA 3F3VA 3RNIA 3GUBA 3IKAA 4CCUA 2VGPA 3D5XA 1NXKA 3MW1A 4LL0A 3PP1A 4D2RA 3TZ8A 1W8CA 3NPCA 5FXSA 1DAYA 1M2RA 1CKPA 4YPSA 3R9DA 3ZLXA 2JD5A 4GU9A 4RMZA 3SG9A 3MH2A 4NW6A 3VF8A 4BN1A 2O3PA 5FTOA 4OTIA 5DHJA 4EOLA 3IO7A 3AXWA 3FSFA 4G34A 2IO6A 4QMTA 3KULA 3ZC6A 4R3CA 3AT2A 4FV6A 4CTBA 4AWIA 4FG8A 4FKVA 1H00A 4FI1A 2ZB0A 5C8KA 4M13A 3SKCA 4WO5A 2BZJA 3PVWA 4FIFA 2QHNA 4QMVA 4AP7A 3UO5A 3DOGA 4GIIA 4QP1A 3RPRA 5BQ0A 2V0DA 4LQMA 3RM6A 1JKSA 2R3GA 4O1OA 4YUQA 4BCHA 4BDGA 4XV3A 2HOGA 4GYIA 3VUHA 4LGDA 4TYHB 3F3UA 4GJ2A 2Q83A 3H9FA 1VYWA 3FMNA 5DH3A 1Y91A 2BIKB 2CLQA 3DPKA 4CEGA 4FNYA 4G6LA 4S33A 4DH8A 5M06A 2WNTA 3QHWA 3LFQA 3EQIA 4O7RA 4U79A 4EC9A 3WIGA 1NY3A 4HNIA 4AZFA 5E1SA 4AE9A 3G9NA 4XP0A 2VX0A 1YI3A 4UWBA 5BYLA 3C0IA 4MNFA 3LXPA 4QQJA 1Q3WA 3KK9A 1ZLTA 1OUKA 4FKRA 4TPTA 4UMTA 2EB2A 3E92A 5EKOA 5AV0A 5EHOA 4KIPA 5FM3A 3O8TA 3DKOA 2XMYA 3EFJA 2Y6OA 2JIVA 3VHEA 2PHKA 2XEZA 5JRQA 4D5HA 4EH6A 4QOXA 2ZOQA 2ZMCA 5HHWA 5CF6A 2VWBA 3KMUA 2Z7LA 5L6PA 3E87A 5IQAA 1LUFA 3VW6A 1AQ1A 1KE9A 1YI6A 5FGKA 3FAAA 3M42A 1ZZ2A 4J71A 3DNDA 5I3RA 4EK6A 2PULA 4RWJA 5EDQA 5HKMA 3WF7A 3QQGA 2Q0BA 3GVUA 2Y9QA 4KA3A 5AR8A 4WA9A 4Y95A 2IG7A 1URWA 5CF8A 5AEPA 2BTSA 3KMMA 3OBJA 3ORIA 3PY0A 3RCJA 4E73A 1XBBA 2JFLA 3AD5A 3U4WA 4B7TA 4FIJA 5A4QA 1JBPE 5GHVA 5AMNA 5ACBC 2P55A 3ACJA 3C4ZA 4NUSA 5I9XA 3JUHA 5H8EA 4AT5A 3DXQA 4FKWA 3UG2A 4YU2A 4L42A 3SXRA 2C6IA 5EI2A 4B9DA 4LRKA 4ZZNA 3FSKA 3HV7A 3FPMA 2UVZA 4I0RA 3UP2A 3ZSGA 5KE0A 4FYNA 4G3FA 2KULA 3VS0A 3LIJA 4U43A 2ZV8A 3DU8A 3R22A 4FV8A 3C4WA 3QA0A 4AGDA 1P4OA 4C2WA 3QYZA 4EQUA 3AC4A 4L68A 3FZ1A 3CPBA 2YM4A 5HESA 3UO4A 1JKLA 4IZYA 4EHZA 4FEUA 5KMNA 5LMKA 5BVOA 3HMMA 4S31A 2VX1A 4HYUA 3KF7A 4W4YA 2C4GA 2R3OA 1U5RA 3DJ6A 4I6FA 5EK7A 4BTFA 5LMBA 5CAQA 3ORKA 4O0TA 4BWXA 4GFGA 4MNEB 1YXVA 3MVHA 5IDNA 5D7AA 3EN9A 1SVGA 5AA9A 5DLSA 2WTDA 2VNWA 4QQ5A 3K3JA 4HYIA 2OZAB 3EN7A 3ROCA 3BLHA 4D2TA 4MXYA 3VAPA 4YHTA 4PL5A 4AT4A 3ERKA 3R9RA 2GFSA 4RSSA 2H6DA 4IAKA 4DGMA 1J7UA 3G90X 2O8YA 3RHKA 3SQQA 5D12A 4UZDA 5LVLA 2CCHA 3EOCA 1K2PA 4A06A 5L3AA 5HEZA 3W8LA 2Z7SA 5J7BA 2RL5A 4A9RA 5AUWA 3UODA 4FKPA 3WE8A 2IZRA 4YPDA 4IM0A 1QPJA 5K3YA 2XK7A 5HQ0A 2J0KA 3C7QA 4FG7A 4DGOA 2BIYA 2QONA 5A14A 2WIPA 2YDJA 3OWPA 1GZ8A 4LL5A 3HA8A 2JAMA 3MTLA 3CY2A 3VUTA 3H30A 1O6LA 3EL8A 4C4JA 2Z7QA 4EYMA 4A4OA 5BYYA 1JSVA 3TNPC 2R7IA 3EQFA 4IAAA 4NJDA 2XK9A 5H8GA 4HGTA 3TXOA 3SD0A 2FUMA 4DLJA 3TUBA 3GENA 3LE6A 1M7QA 2A27A 4FKIA 4O96A 4FGBA 4X6QC 5CEQA 2E9UA 3GCSA 3FLNC 3VQHA 5JRSA 3EN4A 3U87A 4QPMA 1BI8A 3DY7A 3W32A 2RG5A 4RBLA 1WCCA 3NS9A 4MBJA 4O6LA 3VS7A 5KMIA 4CLIA 3A7IA 4GCJA 5BVDA 3JS2A 3AC2A 2RIOA 3MH3A 1SNXA 3ZCLA 3S2PA 4A4LA 2IW9A 3NVKI 3KN5A 4FTAA 4FODA 2W17A 5IEXA 3LCKA 5J8IA 3D5UA 4EEVA 2UVYA 2RGPA 4XEYA 3Q96A 5HVJA 4EQCA 4XLIA 3W2OA 4GU6A 3O8PA 1OL1A 3RWPA 5A46A 3LQ5A 2CKPA 3ENMA 3UTOA 4O81A 4E4NA 1BKXA 3WI6A 4FV7A 5GZ8A 5JH6A 5E91A 3PSDA 2W1IA 1BYGA 2YM3A 4DLIA 4FSNA 1F5QA 2ZM3A 3LCSA 2ITXA 2OH0E 3RAHA 4MQ2A 3F9NA 4G2FA 2DUVA 1UNLA 1Q62A 3MS9A 2OO8X 4GEOA 3MFTA 2RFSA 4L44A 2VWVA 1UA2A 3BHHA 2WB8A 3UYSA 3FV8A 1IA8A 2YIXA 1PYXA 4ZTQA 5CVHA 1KOAA 2X4ZA 4MAOA 2IZSA 2CKQA 2W99B 3IW6A 1KE8A 2BFYA 4WUAA 2ZDUA 3PE1A 5AP4A 4U44A 2HZNA 3GNIB 4MK0A 2G9XA 4IJPA 1PMUA 3L8XA 3R83A 1OITA 4TNBA 3HUBA 5AUUA 2YN8A 3KKVA 3L8SA 3Q6WA 2YA9A 4PPAA 4X6RA 1HCKA 2JAVA 4KS7A 5KMLA 2V62A 4FTCA 3HDNA 2QOKA 5EW8A 5E8SA 4AFEA 1XKKA 4AOJA 4FGRA 5GINE 1U54A 5AIRA 1PF8A 1H1QA 4BCGA 5HU3A 2WMUA 4JDKA 2JKOA 5DE2A 1GIIA 4NM7A 3BGPA 4YR8A 3PRIA 4BIEA 1ATPE 1ZOHA 4F6SA 5K4IA 4MTAA 3IGOA 3FL5A 3PXQA 4DFBA 4C2VA 4UMUA 3KGAA 1OPJA 3K54A 3V5TA 3C4EA 4IB5A 4DEHA 1LPUA 2R0IA 3VUKA 3D2IA 3VF9A 1UWJA 3GOPA 2YM7A 1PMEA 2C6KA 2J9MA 4H05A 3QX2A 4F0IA 3II5A 4KKGA 4O0UA 4IDVA 3HZTA 3CP9A 2WMRA 2A19B 3ZBXA 4EZ3A 3I7BA 3G0FA 3O71A 4PP7A 4ZTNA 3WE4A 5IPJA 2Y7JA 4CQEA 2XCHA 3BZ3A 4KSQA 3UZTA 5CVFA 2WFYA 5I5ZA 3IOKA 3EYHA 4ACHA 3DLZA 1QCFA 4R3PA 3UJGA 3ZFXA 3U6HA 1OBDA 3CLYA 5T68A 1GZOA 2I1MA 2R4BA 4FTKA 2EWAA 4KBAA 1EH4A 3GI3A 4OLIA 3QKLA 3P0MA 1MRVA 5AADA 3W2QA 3WF5A 4CT2A 5FD2A 3VBVA 2WMAA 2XK3A 3UG1A 2C5VA 4IAZA 4CSVA 5C26A 3UO6A 4XHKB 4O1PA 3V3VA 4KWPA 3EN6A 3C0GA 1IAHA 1YWVA 4L01A 3TZ7A 4X3FB 2QU5A 3PZHA 2VWZA 4PQNA 3NW5A 4QP3A 2X6EA 3TJDA 4G3DA 5AP3A 4E6QA 2FVDA 3AT3A 3U4UA 4S34A 4PTEA 3WBLA 4GK3A 5FWKK 4AZSA 2PUUA 2QOBA 4EZ7A 5IQIA 3QTIA 4FG9A 3ANRA 2PE1A 4O6EA 5B2KA 2OBJA 3ZUTA 2J50A 5EHLA 2PY3A 2BAQA 3BYOA 1YDRE 3Q52A 4U40A 4E4MA 4YSJA 1IA9A 3PLSA 5CU2A 5IQDA 3O17A 4FT9A 4J52A 4M66A 2G1TA 3UZRA 3QFVA 4PMSA 4GH2A 4GRBA 4L8MA 5EM5A 1BLXA 3UIXA 4RRVA 3ZM4A 3ORTA 3K5UA 3CR0A 4NSTA 3CTJA 4ZJJA 4QMUA 3B2WA 1T45A 2XK6A 1Q99A 2RFNA 3KVWA 1E9HA 1S9IA 4J8NA 3VUMA 5GZAA 2OI4X 4AZTA 3MY1A 3MJ2A 4F09A 4IIRA 1F3MC 4BBMA 2C69A 4AOIA 5FDXA 2V55A 3CEKA 4IAYA 5AM6A 4NJ3A 1PXMA 2IVSA 3NAXA 3P7AA 3BE9A 4AX8A 5C4LA 3S0OA 2PZYA 3Q60A 4L3PA 4FVRA 2IPXA 4UMQA 4ZS4A 5CLPA 3RINA 3WOWA 4AG8A 2BDWA 1B39A 4XG9A 3OVVA 3CS9A 1LP4A 5AUXA 3QZGA 3RJCA 4RIWA 4V05A 4LRJA 4BCOA 3AC3A 5E8ZA 5HORA 3PLAE 3KRXA 3AT4A 3N4UA 3U6IA 2P2HA 2R3MA 4QMOA 4DG3E 4AW5A 3Q5ZA 2P3GX 3R9HA 5E4HA 2FGIA 3PXYA 4FL1A 4KIKB 2B4SB 2R3HA 4DEEA 3B8RA 5CAVA 3SW7A 3CKWA 1UWHA 4IVDA 2VN9A 4MXOA 3KN6A 4H58A 4ORKA 3D15A 3RPOA 3UOHA 2GNFA 1YXUA 3COKA 2IW6A 3TIYA 3VUIA 1YHWA 3KVXA 3R9OA 4BI0A 3LW0A 3CQWA 2W1CA 3G51A 4IXPA 4PX6A 5HNBA 4C35A 1NT2A 2IJMA 3FWQA 4F70A 4ZIMA 3ZHPC 4X2KA 4TWOA 3CC6A 3TTJA 2BZKB 2BR1A 3BLQA 5BYZA 4FKLA 4IZAA 1PMVA 4LMNA 3QTZA 3EN5A 4K2RA 2JDRA 5ANJA 4C62A 4ZLZA 5A4EA 3R9NA 1DI9A 4ANQA 4D2PA 1IAJA 4M84A 2B9HA 5ANEA 2OJFE 5FBOA 1OZ1A 4Z7HA 3HV5A 4NIFB 2BVAA 3TNQB 4K1BA 1M2QA 4ZXTA 5M51A 3FMJA 4ZLOA 3DK7A 3LLAA 3MGYA 5LMKC 2RKUA 4ZMFA 2GCDA 4UBAA 2XB7A 3KK8A 4A7CA 1KV2A 3O50A 4RIXB 3LQ3A 4ZSGA 3AMBA 3BBTB 3F61A 3F66A 5HCYA 4M7IA 4D5KA 4DC2A 4BHZA 1Q5KA 4UB7A 5I4NA 4LFIA 5CF4A 2A2AA 2BZHB 4H3BA 2XIXA 5DFPA 4W4WA 2GQGA 4MD9E 3S00A 5J87A 5J79A 2QD9A 4U9AA 5CU3A 2BROA 4UXLA 4D0XA 3UNKA 5IA1A 4FYOA 5A4CA 5M57A 3BU6A 4AACA 4I6BA 1KSWA 5KHXA 4FV3A 5EM6A 4I20A 4OUCA 3KREA 3LQ8A 4OGRA 2J5FA 3PP0A 4FIHA 5I9VA 4YURA
chains in the Genus database with same CATH superfamily
2JDTA 4YMJA 5F20A 3LHJA 4CNHA 1PRYA 4AW2A 4JBPA 2ITQA 4OBQA 3GXLA 3RTPA 3QCYA 3QZIA 3UIBA 4G6NA 3ORMA 5IEVA 4ZSEA 4YTFA 4TW9A 3PJ3A 3DKFA 2H34A 3KL8A 3WF6A 4MXZA 4Z7GA 5GIOE 5TOZA 4FT3A 5DEWA 5LWMA 2JBOA 4D28A 3LFBA 4KS8A 2X6DA 3D94A 3EQGA 3MIAA 4FV9A 4QP8A 5CI6A 5DOSA 3UC4A 2OWBA 5IZFA 4RJ3A 4FSWA 4ALUA 5BUEA 1H26A 4NFMA 4IE9A 3TNHA 4XV1A 2XK8A 2EB3A 2F4JA 3AD6A 4JBOA 4KRCA 5EFQA 3MH1A 1JOWB 3FLYA 3MDYA 2XF0A 1YXXA 3QQLA 4UXQA 5EM8A 3BYUA 3CGOA 2HWOA 4BDEA 3BI6A 1BL6A 3ZRLA 4MYGA 3MH0A 4TXCA 5A54A 3LFAA 5B2MA 5IG1A 3TG1A 4DFXE 4RVMA 1TFFA 3FKOA 3DBCA 3IK3A 4V0GB 3N4VA 4YBJA 3I0QA 1VYZA 3W0MA 2WTIA 2OFUA 1ZYJA 2UZWE 4RFYA 2XAOA 3DXPA 2WO6A 1MQBA 2HXLA 2PSQA 3JXWA 3ACKA 3R7YA 3V5QA 4C7TA 3TEIA 4EOIA 4YNEA 2XKFA 3D2KA 3OWLA 4YC6A 5JQ5A 2CNVA 3BQCA 5FLFA 4AW0A 2X9FA 3MA3A 4HPUE 4JRVA 3C4XA 3E7OA 3Q9YA 4CT1A 2YZAA 3ORLA 5C1QB 4XH6A 3F5UA 3RK5A 1XR1A 3NYOA 4BFMA 4WNKA 4JBVA 1UU9A 5IUIA 3BRBA 1BL7A 2WTKC 4GG5A 5DWRA 5CAPA 4QDEA 3O0GA 4IX4A 1XH7A 4IBMA 1H08A 4E6AA 3FL4A 2BKZA 2O63A 2QKWB 4IC7A 4KINA 4P5QA 1WBOA 2VWWA 4ANNA 4EOQA 3VS1A 5L2TA 2VU3A 2ESMA 3KF4A 4YNOA 3D0EA 3W0SA 1OIYA 4I24A 3O96A 3VBQA 3MYGA 4TYIA 2W1DA 4EYJA 3NCZA 3FY0A 4FL2A 5HD4A 4EOOA 4JDJA 1TQMA 4RIYB 2O0UA 4TYGA 4QMNA 3JYAA 4C3FA 3PUPA 4O7SA 4EK8A 4YJTA 2HW6A 2YM8A 4ZY6A 2C0OA 4CZUA 1TQIA 2WAJA 3ZS5A 1ZZLA 4O4CA 1HCLA 3M2WA 2XBJA 4FEXA 4M12A 3L1SA 4H1MA 4FKJA 4KBKA 5CWZA 3UPXA 3FHIA 1APME 4TY1A 4GVJA 2B9FA 3QQUA 4O0VA 4BB4A 4CCBA 5HVKA 4ZY4A 2CSNA 3I6UA 4CKRA 1ST4A 4PUZA 4O0SA 4X21A 5AAFA 5B0XA 3LZBA 5EW9A 3HV3A 5HIEA 3HVCA 3ITZA 1YHSA 5IH6A 3TTIA 4Q2AA 3R8PA 4MWIA 3EHAA 3CSVA 3UOLA 2OXDA 3FLZA 4V01A 4FF8A 5LVNA 4BZOA 1WBWA 2X0PA 3TUCA 2GS6A 3QCQA 2OJ9A 4NM5A 3FQHA 4QMQA 3V01A 1VR2A 4YZBA 1DS5A 4FV0A 3Q9ZA 4WBOA 4DEAA 4BCJA 3A4OX 3OWJA 3R7UA 3QCXA 1ZOEA 3UVPA 5HE0A 3U9CA 4N70A 2YLFA 3BWJA 4DTAA 5F4NA 3AC5A 4EJ7A 4OBOA 3ZBFA 2CPKE 5J9LA 4BBEA 3NFFB 4W9WA 4LGHA 3QUDA 4E26A 3G6GA 3RGFA 4I5MA 5FDPA 3FLWA 2PMOX 3G33A 3NDMA 5HNGA 2PVFA 2C5XA 1OKZA 2GNIA 2W5BA 4I92A 4JI9A 4C0TA 3CBLA 3WZJA 2J0IA 3C0HA 4PRJA 3I81A 4XNEA 2XJ2A 1W98A 4LV7A 2R3NA 4C61A 2GNLA 1R39A 2GTMA 3MVMA 1PKDA 4MKCA 4L3JA 4WUNA 3Q6UA 5BUJA 5IISA 5ACKA 4AF3A 4RX8A 3GCPA 3FY2A 4IZ7A 2HZIA 5A4LA 3KXXA 3OF0A 3HGKA 1UU7A 3QQHA 2GDOA 3VNTA 1H07A 3UVQA 3DS6A 4O0RA 1XH4A 4BCFA 4UWYA 3KRRA 4AGUA 1Y57A 4QQTA 2C0IA 4S32A 5JQ8A 1OPKA 2IF8A 2XM8A 4ZTLA 4AA0A 3RK7A 1IG1A 1Q61A 3VS6A 3DTCA 3GT8A 4BC6A 4O4DA 3A7GA 2WQOA 2JIUA 4GK2A 4DYMA 5C8MA 3BL7A 2XH5A 3TCPA 4RX7A 1O9UA 3QL8A 4WIHA 1OGYA 4DH7A 3MN3A 1B38A 4RVTA 2UVXA 2W5HA 2B9JA 3FE3A 3LXLA 5JFXA 1J1BA 2XIZA 4G31A 3VS3A 4NYEA 3W18A 1G8JA 5D9HA 2BKKA 2PE2A 4GJ3A 3ZEWA 5FP5A 3MPMA 4U41A 5M56A 4RA4A 2YCQA 2WHBA 5JFSA 1VLRA 1CSNA 2WPAA 5CQUA 2YIRA 3A8WA 3O8UA 3IW8A 4XLVA 5G6VA 3TT0A 4USEA 4RA5A 3V6RA 2NYAA 1H0WA 1Q8UA 2C6DA 5CT0A 4BKJA 4HOKA 4YBKA 2XNBA 3AMYA 3BGQA 3NYVA 4IQ6A 2ETMA 3R01A 1KE7A 2Y4IC 2QO9A 4QMXA 2G2HA 3RK9A 4EQMA 3VBXA 2BILB 2X8EA 4YO4A 3DBDA 5CXHA 5M4CA 2XARA 1ST0A 5AP2A 2W5AA 1OL7A 1ZOGA 3U51A 3R8VA 5CASA 4AE6A 2J0LA 1XBCA 2J0MB 4G6OA 5DT3A 4ZOGA 2YITA 3HRBA 3LOKA 5EDRA 4OW8A 4E93A 5F95A 3G15A 4O4BB 2JGZA 3L9MA 5ANKA 3QKKA 4RC4A 4L7FA 1OGUA 4CV8A 5HX6A 4IACA 3R8UA 2F49A 3K5VA 1Y8YA 2ITYA 4C8BA 4QRCA 3JY9A 3MPTA 1JSUA 1PY5A 1Q24A 2BAKA 2X2KA 4O86A 3PY3A 3BHYA 3KXMA 1JNKA 3AQVA 4MH7A 4OTPA 2H96A 3BE2A 5K5NA 2WMTA 3AD4A 3BYSA 4KNBA 1U46A 1Y6AA 3MVLA 5JKGA 2YWVA 2OKRA 1JVPP 2BFXA 3CCNA 3VRZA 3EL7A 3ORPA 4FTJA 4GUBA 2HY81 4EH8A 1PXOA 2X8DA 1M17A 4DN5A 2PVYA 5EOBA 2G2FA 3ZMMA 1PXLA 4CZTA 2YHVA 3QTUA 3TV4A 5KBRA 4ZZOA 3CTQA 4UX9A 1UU3A 3NEWA 4WSYA 3KA0A 1YWRA 3RAIA 3V04A 4DCAA 3AC8A 4ZJVA 4FOBA 1OIRA 1PXKA 3P4KA 4J98A 3QRKA 4FA2A 4DHFA 2PUPA 3NAYA 2BAJA 5J9YA 3LCTA 4D4RA 4L9IA 4PDOA 4YLKA 3DNEA 3EZVA 1WBSA 3HMPA 1ZY5A 3UZPA 3FMEA 4E1ZA 1Q8TA 4FR4A 4NWMA 3HAVA 3E64A 3V51A 1QPCA 3LPBA 4BL1A 1Y6BA 3CE3A 4U81A 2XIRA 3Q04A 2PZ5A 4XP3A 5A9UA 2J2IB 4AZWA 2FA2A 5LJJA 3V5JA 4I41A 4G3EA 2QLUA 4RC2A 4BIBA 4DFUA 3FMLA 1Q4LA 3FZOA 5DIAA 1H1WA 3OTUA 5BVFA 3QU0A 2VAGA 4F7LA 3OG7A 4FZDB 4V0GA 2EUFB 3IOPA 4YJUA 4B4LA 2B7AA 2C30A 3SG8A 4Y72A 5L2SA 2VWUA 4YO6A 5JK3A 5LCJA 2J7TA 3NNWA 5KNJA 4AZEA 2WTJA 3NW7A 3OW3A 3KMWA 4UZHA 1HOWA 2QOLA 1OVEA 1UKHA 1RW8A 1CMKE 2W4KA 5JGDA 5AV3A 5A3XA 5AR4A 4GKHA 1YOLA 3JVSA 4ANLA 4DF3A 3PTGA 4FUYA 4BCKA 3EFKA 4C59A 3IG7A 1G8AA 4CXAA 3QBNA 5LVMA 4DG0E 3R6XA 1Q97A 4Q9SA 1Q8ZA 3WIKA 4X2NA 4IW0A 3DJ5A 1CTPE 4QPAA 4RPVA 4JQEA 1H1PA 5LQFA 3DFCB 2JBPA 4BI2A 3DV3A 4YJPA 4BGHA 4XG3A 3G2FA 3FJQE 3MA6A 5IQGA 4B99A 4GFOA 4ID7A 4IAFA 1FOTA 4G16A 4OTRA 2JEDA 4C33A 2J6MA 3R2BA 4Q5EA 5HLNA 2R3LA 4D55A 3ULZA 3PXFA 5JFWA 5C01A 5KKRC 2AC3A 3MY5A 5CNNA 5K9IA 3OXIA 4D9TA 2VO3A 4E6CA 4PTGA 2OF4A 3OCTA 3MJ1A 4O4EA 3I7CA 3LFCA 4EORA 5BVKA 4AXCA 3E8NA 3P78A 4YTCA 4FX3A 2JDOA 2UW8A 4IZ5A 3K3IA 2BHHA 2WMWA 4EWHA 4EK3A 4ERKA 4FZ6A 3NR9A 1LR4A 4CV9A 4Z16A 2BMCA 3BX5A 3NSZA 4CZYB 2HXQA 5CNOA 5J1VA 4R7BA 1L3RE 4FOCA 5FM2A 4K33A 4J53A 5LARA 4EHVA 4DGGA 5DRDA 2C6LA 2IEWA 3TMOA 3VVHA 3AKLA 4FMQA 3LLTA 3NVMB 3EKKA 4H3QA 5AWMA 1MP8A 3A61A 2RF9A 2A0CX 4C37A 2BRBA 3I5NA 3R73A 4OTHA 4TN6A 5EKNA 4GT4A 3HX4A 3LFSA 3NNVA 4M15A 1ZYSA 4QD6A 3VWAA 4DITA 4F6WA 2WELA 3KCFA 4O0YA 3CJFA 4O7VA 1OKVA 1PYEA 2R3IA 3U9NA 2AEGA 4FICA 4ANBA 5CSHA 4YC8A 5L4QA 2ITUA 4LUDA 3CD8A 1T46A 3QALE 4FTTA 4DBXA 1PKGA 4D0WA 3A60A 4U7ZA 4BYJA 2XEYA 4C58A 4LGGA 4DCEA 3TM0A 3LFEA 2ZMDA 2OJIA 4DDIA 4JG6A 5CSXA 5H2UA 1TVOA 3NUAA 2JITA 3GU6A 5ANIA 1YOJA 2WMXA 3E8CA 5DPVA 1A48A 4TL0A 1M14A 3EQDA 3I6WA 3H3CA 3ORZA 1ZRZA 3LCOA 3VBWA 5IUGA 2VTHA 3ORNA 4FZ7A 3Q32A 5EG3A 2Y4PA 3FMHA 4F63A 4IX3A 3LFNA 2NO3A 4PNKA 1YXSA 2GTNA 1NVQA 4IM2A 1X8BA 3UQFA 3GC9A 3M1SA 4H1JA 3MWUA 4OTGA 3ANQA 3GU4A 1JQHA 3PPKA 1SVHA 4FTLA 4JQ7A 2I0HA 2E9NA 4RFZA 5AV4A 4PPCA 4BRXA 4DT8A 2ZAZA 5I3OA 4O7TA 3QTRA 4TTHB 3RHXA 4DDGA 5HE3A 4U97A 5M53A 4X2FA 3CTHA 4I6QA 4USFA 3FZRA 3O51A 3QF9A 3ZRMA 4UWCA 4QMSA 3MFSA 3OT3A 4DEIA 3ZRKA 4EH2A 3OCGA 2BTRA 4U0IA 4YJSA 3GEQA 4AGCA 3ZO3A 1NVRA 2O2UA 2WIHA 3OY1A 5IH4A 2PTKA 5IA2A 3DAEA 3OMVA 4E6DA 4EH7A 5JEBA 3QQJA 1UKIA 4NZWB 3JVRA 3TUDA 4CG8A 4BDDA 3CY3A 3UGCA 4PF4A 4L67A 2ZB1A 3R7IA 1OL2A 3TYKA 2WMBA 5AUVA 1PMNA 2HENA 2UZOA 3PVGA 4HZRA 4KKEA 4XUFA 4PP9A 4YJRA 4M67A 5EQEA 2F2UA 2PL0A 3KC3A 5HGIA 4GT3A 3UYTA 1IRKA 3NYXA 2EVAA 3ZO1A 4M14A 5HBJA 2JDSA 4EBWA 3VQUA 3S4QA 2V22A 3GU5A 3DBEA 2C6TA 5HX8A 1CDKA 4CKIA 5LCKA 3POZA 4U45A 3PXRA 5DR6A 2JIIA 1G8SA 3MESA 5IQBA 1O6YA 2YCSA 4FNXA 2BUJA 2WTCA 5DT0A 3SDJA 4K6ZA 5AP7A 4C3RA 2VTAA 2EXMA 2CGUA 2WU6A 4I5CA 3PPJA 4JBQA 4F9YA 3IDBA 3P7BA 4FSUA 5HO6A 2GHLA 4I0SA 2CGWA 4CFNA 2UW3A 5D11A 4CFWA 2PWLA 2VUWA 5LVOA 3F82A 4QYGA 4ACGA 4HJOA 2XNGA 3GCQA 4L52A 4WNPA 4WBBB 4O2PA 2PMLX 4TYHA 4NW5A 4BI1A 4FEWA 4LDTA 1PXNA 3IQ7A 2B52A 3F3ZA 3ZSHA 4EJNA 2BZIB 2YJSA 5T6KA 4U3YA 2PUIA 2C47A 3MVJA 3M11A 2LAVA 4PNIA 4FKTA 3W33A 4BDJA 3ZDIA 3F6XA 3QA8A 4NFNA 4NM3A 3D7TB 5TO8A 5IEYA 3UDTA 2WKMA 4R6VA 1ZXEA 1GIJA 2FO0A 4DH3A 5HBHA 3ELJA 4F0GA 1KWPA 4QMWA 2GS2A 2HCKA 3NFGB 4J96A 2YM5A 5FUTA 3LJ0A 5HOAA 4FIGA 2PVMA 4DEDA 2XNMA 1OMWA 1WVYA 3P1AA 2WQNA 1Z5MA 3IW7A 3UVRA 5BPYA 5J9ZA 2ITVA 5BX0A 3R04A 4K18A 4J8MA 4M69B 3FC2A 4RWKA 1A9UA 1CKJA 5ETCA 2Z2WA 2O65A 4P7EA 1YQJA 4XBUA 5HZNA 2Y0AA 4P2KA 4BDBA 4JL9A 4J99A 4AUAA 1H01A 3LJ2A 4E8AA 4CG9A 4FT5A 5CSWA 5L6OA 2FSOX 3TKHA 5M4FA 2UZUE 4ALVA 1XH8A 4F64A 4MBLA 4EZ5A 3EQBA 5HCXA 4YHFA 3LVPA 3WF8A 3NRMA 1OL5A 3R02A 2GHMA 3UMWA 4EOMA 4FEVA 2E9OA 3Q4UA 4WG4A 5KZ0A 3KXZA 4HVHA 2PE0A 3WYYA 2PPQA 4GKIA 5M44A 2ITZA 3W10A 4OAUC 4TKSA 4H39A 2VZ6A 3TNIA 4IB1A 3OD6X 2WMVA 1REJA 3K2LA 3KRLA 3LM5A 4GYGA 1G8KA 1WBPA 4BR3A 3A7JA 3JR1A 1DI8A 2FSMX 5BUIA 1GIHA 2UV2A 4FKQA 3CXWA 3I4BA 1V0PA 1UVRA 3QD2B 3OHTA 1FVTA 3KXGA 2ERKA 3OTVA 4BZNA 1VZOA 4OT5A 4JX3A 4O7NA 3SXFA 2VV9A 4Y85A 4I3ZA 2CLXA 5FTGA 3GGFA 2B53A 5AUYA 3PXKA 4BBFA 5TF9A 4E4LA 1U59A 3RP9A 4HYSA 2BDFA 4MNEA 3WZDA 4CGAA 3FZTA 2GNHA 1JSTA 4RQKA 4BCIA 4CTCA 2JKQA 2WZJA 3GC8A 4JT3A 5LOHA 3LJ1A 3SRVB 4C4FA 3CQEA 4I6HA 5AX3A 1F0QA 2WOTA 3VS2A 2CMWA 1JKKA 2Z7RA 4DAWA 2OZAA 2Z02A 2W1HA 2IN6A 3R21A 3FC1X 4PL3A 3Q53A 5AJQA 5AX9A 3PJ8A 3SA0A 4L45A 4G3CA 1H0VA 3C13A 3NNUA 5E8UA 1WMKA 3R1QA 4MD8E 5GJDA 4GIHA 4IWPA 1H1RA 3BKBA 3ODZX 3OCBA 1FGIA 3OOMA 4LV5A 4F9BA 3FLQA 4E4XA 1GNGA 2F7EE 1XH5A 4WKQA 1XH6A 4IVAA 3SHEA 5JT2A 2HWPA 4CMOA 4QTAA 2XIKA 5L2QA 3DBQA 3KULB 2E9VA 2WMQA 2VTTA 3FXXA 4QP4A 3NW6A 4NKSA 4QQCA 3I0OA 2XM9A 3FMKA 4L46A 3NYNA 4AW1A 4BDAA 3DDPA 2HYYA 2ZYBA 2GNGA 2W96B 4IX6A 2QU6A 2GMXA 5ANOA 4O38A 5AR7A 3QTWA 5HD7A 4ENYA 3H0ZA 4FTIA 4IDTA 2RFEA 4FK6A 4YGAA 4DH5A 2PMIA 5CVGA 4LOOA 1E1VA 4UEUA 4YTIA 4WT6A 2VO6A 3E5AA 5HVYA 2R3PA 4RVLA 5D7VA 4ASDA 4XV9A 4NH1A 5C4KA 4JOAA 1Z57A 4JJRA 3DFAA 1FPUA 3KQ7A 3QRTA 4R7IA 3OEFX 5ETAA 3FQEA 5BNJA 3JY0A 5J5TA 4FSRA 1XHAA 3R28A 4BCPA 3RPVA 3G5DA 4MQ1A 2QCSA 5EM7A 4ZLYA 5HI2A 2SRCA 5JGAA 4BTJA 4XP2A 3QUEA 1PJKA 2VGOA 3O2MA 3TI1A 3W2SA 4F1TA 4U80A 3G6HA 2V7OA 3CKXA 3EB0A 1BMKA 1W2DA 4S2ZA 2YFXA 4W9XA 3Q4TA 4YJQA 5CTPA 5DRBA 2GU8A 2QOOA 3COHA 3KXHA 1ZMUA 2PVJA 2DS1A 3E93A 5ICPA 2F7XE 5FEEA 4S30A 5E8WA 4HZSA 4DFZE 5IF1A 2XJ0A 5HTBA 5JMSA 2WQMA 5IA5A 3F2RA 1YDTE 4D2VA 2C68A 2XKEA 5EI8A 1P2AA 4O27B 4XBRA 3EWHA 2YWPA 4KUJA 2VTMA 2C6EA 1S9JA 3EFWA 3QWJA 3I79A 4YZCA 4ZEGA 1UV5A 3GP0A 2V5QA 3PJ2A 4O84A 4L3LA 5CU0A 4WNMA 3EQHA 3PWDA 5I9UA 4AT3A 4D2SA 2B55A 3IS5A 4LRMA 3C1XA 5TR6A 2BCJA 3LFFA 2UZNA 2QG5A 3QKMA 5E8XA 4NCTA 3R2YA 4D58A 2XYNA 3D4QA 4ZJIA 2ITOA 2W4JA 4DTKA 5EW3A 2VTPA 2V7AA 4RJ8A 5IKWA 3MPAA 5LVPA 5HG5A 4AN2A 4HYHA 2YIYA 3SXSA 3I60A 3W16A 3HAMA 3F3TA 4MXCA 2YZLA 3DKGA 2GPHA 5M07A 3LMGA 4G5JA 2YCFA 2C0TA 2O64A 3MFUA 1XMLA 4GFMA 4AXAA 2OIQA 4H3PA 1MQ4A 2EXCX 2YCRA 2DWBA 2HW7A 3CIKA 5DT4A 3WF9A 3O5AA 3ZFMA 3GC7A 3TNWA 4APPA 4FKSA 4A4XA 4EONA 5HO7A 4HCVA 4GS6A 4KSPA 3TN8A 4BCNA 5B7VA 3SW4A 4EKKA 2BHEA 1MRYA 2FSTX 2VTOA 1XWSA 2R5TA 3O7LB 4KRDA 4AA4A 2PVHA 2F7ZE 4DT9A 5EH0A 3UE4A 3QD0A 1ZWSA 4EL9A 5FXRA 3F69A 5JSMA 1TKIA 1QPDA 3FYKX 2XCKA 4FEQA 5E1EA 2I6LA 5DA3A 5IU2A 2CKOA 4WRSA 2ZM1A 2FSLX 3RPSA 5CY3A 4BGGA 1H27A 1H1SA 4GVAA 2OIBA 2DYLA 2C3IB 4HCUA 4UYNA 4D1XA 4EI4A 1GZKA 4JR3A 4ACCA 4FRFA 4OTFA 2Y8OA 4BKZA 3PY1A 3F7ZA 4QDVA 4FSQA 1GY3A 2VD5A 3DZQA 3RKBA 4D4SA 1BI7A 2BALA 1STCE 1OIQA 3EYGA 3HEGA 4G3GA 3QCSA 4IVCA 4X3FA 5TKDA 1H28A 2UUEA 4FJVA 3LFDA 4ITJA 2R0UA 5HG8A 3MSSA 5E92A 4F9CA 3C9WA 5I9WA 4BDCA 3MIYA 3PE2A 3FMDA 4MVFA 5KX8A 4NKAA 1G5SA 1IEPA 3H10A 4R5SA 2UZDA 4ZSAA 2XUUA 4ONAA 1L8TA 4BJJB 3R1YA 2ITNA 2OG8A 2PMNX 2WXVA 4W4VA 3SOCA 1E1XA 2I0VA 3GU7A 1SYKA 4C02A 3OXZA 5J7HA 4O82A 4Y83A 4L43A 1YVJA 3FXWA 4JAIA 4Z9LA 3RI1A 3OXTA 4ZS0A 1RQQA 4N6YA 4A07A 4E20A 3LMIA 3KRWA 2X0OA 3E3BX 2ITPA 4XG8A 4XX9A 4MBIA 4MHAA 4BIDA 2OW3A 5CSPA 1ERKA 2CGXA 4KBCA 3ZDUA 2PVKA 2P2IA 4TWCA 2JKKA 2B0QA 2J51A 1K3AA 3BLRA 4ALWA 4BWPA 2WTKB 3FI2A 2PZRA 3RVGA 3PFYA 4CFVA 3FYJX 4RLKA 4QYYA 4R1VA 5IUHA 2YIWA 4BDFA 1H25A 1XO2B 4HVDA 2CNQA 4C4HA 3U54A 5EI6A 4I5PA 4F9WA 4LOPA 4IVBA 4WSQA 3H4JA 3L9NA 5CEKA 4GT5A 2XANA 4PDYA 3DGKA 3LM0A 3QGWA 1V0BA 3VJOA 4IB3A 2WTWA 3TWJA 4HPTE 3ZLWA 5ETFA 5L6WL 4UALA 3FI3A 4O0XA 4MWHA 3P08A 5JGBA 2QR7A 1AD5A 4O83A 4F1MA 4F1OA 4KIKA 2W0JA 2W06A 2X2LA 4EUUA 3EQRA 4QYHA 1XH9A 2YAAA 2BRMA 3QXPA 5HCZA 3P79A 1B6CB 3HV4A 3T3VA 4BCQA 4E3CA 5BMSA 4YHJA 4FSTA 3U55A 3P5KA 4QP2A 3QGYA 3UPZA 4MXAA 4NTSA 5CZHA 3UC3A 1YDSE 3PFQA 4O0WA 3F88A 1U54B 2RG6A 1G3NA 4XRJA 5DVRA 3W0PA 2G15A 3QZHA 1YHVA 2IVVA 3BYVA 4MX9A 4RC3A 3T8OA 1W2CA 4YZ9A 3FLSA 2XVDA 4FVQA 2HK5A 3KEXA 4ZTRA 3UBDA 3VIDA 3FKLA 5L8KA 3U6JA 2QO7A 3ZYAA 3ZH8A 3QWKA 1LEWA 2XRWA 4EOSA 3FKNA 1R0PA 2B54A 3IW4A 5HIBA 5KBQA 5KMMA 3OZ6A 3BV2A 2CN5A 3NUUA 3QXOA 4NIFA 5FEQA 4Q9ZA 4UN0C 1SMHA 4DTBA 1KE6A 4FNZA 4ASXA 2OIDA 3CQUA 2W1GA 3PPZA 1DM2A 4XRLA 5E7RA 3SV0A 3A99A 3OC1A 4FE2A 4DEBA 2X1NA 3MBLA 3ZONA 2VWYA 4RX5A 4I22A 4OTQA 4RIXA 1Q41A 2C3LA 4EKLA 3C4FA 4IFGA 3VN9A 4M0YA 2BRHA 3PA4A 3BEGA 1W84A 4IEBA 4OTWA 5J95A 2F57A 3A62A 3GQLA 2J5EA 2R3FA 4MUQA 1OIUA 2VTIA 1JLUE 2A1AB 3Q5IA 4EBVA 1W0XC 4TZRA 1MRUA 2C3KA 1H4LA 2UW6A 3VUDA 5F1ZA 4I21A 4DFNA 5L2WA 1VJYA 3R7GA 4N6ZA 4KD1A 2NNWB 3QZFA 1Y8GA 5A6OA 2JC6A 4NT4A 3RAWA 4AXEA 1M2PA 4RZVA 4YP8A 3IGGA 1FVVA 5C9CA 1VEBA 5EYDA 3GB2A 3R8LA 4AOTA 5DR2A 4FKGA 1M52A 3KRJA 4D9UA 3PUFC 4NTTA 4OT6A 4DINA 3KXNA 4ERWA 4I5HA 3R00A 4I1ZA 1U5QA 2PVRA 2CDZA 4TNDA 4EOJA 3ZO4A 3G9LX 5HTIA 3HNGA 2QOIA 2X7GA 3O7LD 4EC8A 5B2LA 5K5XA 4N0SA 2YM6A 1GJOA 5JZJA 4O22A 3NWWA 5C03A 2XNEA 4F9AA 2Q0NA 2W9FB 3AOXA 4M97A 4YSMA 5KUPA 2BDJA 3ENHA 4G9RA 4K9YA 3E3PA 5IA4A 4AQKA 4CFMA 2H9VA 2LGCA 1PXIA 2A4LA 1H8FA 2ITTA 4QP7A 3BU5A 3WZEA 2GHGA 1FINA 2UW7A 2X0QA 3OT8A 1ZARA 5HE1A 2VNYA 2W7XA 4R77A 2CKEA 1WVWA 1Z9XA 2WQBA 5HIDA 4RFMA 4IM3A 3NZ0A 3B8QA 5K4JA 3HA6A 5DG5A 4K8AA 3R63A 5AAEA 1TQPA 2ZV7A 1W83A 5JZNA 3RPYA 5JFVA 1WVXA 4NEUA 1OKYA 4TT7A 4CMTA 2QOQA 4MXXA 4HVGA 1OL6A 1ZYLA 1PXPA 4PWNA 2RSVA 5EYCA 2Z8CA 3R30A 5A4TA 3CD3A 4RIWB 3V5LA 3HECA 3ZTXA 2Y4IB 5FP6A 4XV2A 2UZEA 3E88A 4QMZA 5GJFA 5HLWA 4E5BA 3MI9A 4ZZMA 1P14A 2IVTA 3AC1A 3QLGA 4QP6A 4XMOA 2QKRA 5HG7A 5DI1A 4JG8A 4FV4A 3RAKA 4C34A 5JN2A 4DHJA 1IR3A 2R3RA 2EU9A 5F94A 3WZUA 3SLSA 4B8LA 2WMSA 2E9PA 2QNJA 4K11A 1GAGA 1YI4A 3BEAA 2VRXA 2C3JA 3GBZA 3O23A 3Q4ZA 4JAJA 4PL4A 4RIYA 5FQDC 2OJGA 4KB8A 4EH4A 5CXZA 5F9EA 1OBGA 4NK9A 2ZFYA 4AGWA 3DT1A 5HLPA 3SGCA 3KFAA 3QRUA 4ZAUA 3ID6C 3UOKA 2YDIA 3A4PA 2X81A 4PMPA 4PDSA 1SVEA 3EQPA 1WZYA 4E7WA 3ZLSA 4CQGA 3F7WA 4NCTC 3TDVA 3H9RA 4C57A 2A98A 5TE0A 3MV5A 4IJ9A 4JS8A 4BDIA 4BVUA 3OCSA 1PXJA 3ULIA 3FI4A 4KAOA