3QKLA

Spirochromane akt inhibitors
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
335
structure length
317
Chain Sequence
RVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKILKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLSRERVFSEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGIKDGATMKFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILMEEIRFPRTLGPEAKSLLSGLLKKDPKQRLGGGSEDAKEIMQHRFFAGIVWQHVYEKKLSPPFKPQVTSETDTRYFDEEFTAQMITRPHFPQFDYSASS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RAC-alpha serine/threonine-protein kinase
publication title Discovery and SAR of spirochromane Akt inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 97
structure length 317
sequence length 335
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2011-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF00433 Pkinase_C Protein kinase C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3qklA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3qklA01
4DG3E 4DTKA 5JKGA 3ANRA 3EH9A 2AUHA 2C0IA 3FI4A 3QC4A 4WD5A 4I5CA 1ZY5A 4EH2A 5IA3A 2H96A 3LPBA 3BWJA 4U81A 4F1OA 3PSDA 1IAJA 2XIXA 3LIJA 3C51A 1V0OA 3AT4A 4ZY6A 3S2PA 4BI1A 5CAOA 3KRLA 4IWDA 4QQCA 4TTHB 5I9WA 2YN8A 2QKWB 4IVCA 3QA8A 4W9XA 3PVBA 2PZRA 3KRJA 4JBPA 4OTQA 3GOKA 2W1EA 4JVGA 5LXMA 3BGPA 2VO7A 1OIQA 5TT7A 4JLCA 4W4WA 2ACXA 2RFEA 2VN9A 3H9FA 4DLIA 3MPAA 1OIUA 4ZSGA 2GCDA 3WIGA 4L68A 4DH7A 3SGCA 2C6TA 4C4IA 1YHWA 4USFA 3SQQA 1UU7A 4L00A 3MA6A 4XRLA 2GNIA 2VRXA 4BGQA 2XUUA 4H1MA 1ZZ2A 3ULZA 2C69A 3DLZA 3Q52A 3LVPA 3LJ0A 3RPYA 4QMUA 2YZLA 4AA4A 2I0YA 2EXCX 4EH3A 4KIOA 4CTCA 3F7WA 4BYIA 4QMSA 4X2FA 4NEUA 4R3CA 4DH1A 4EK4A 3ZFYA 4N57A 2E9PA 2G01A 4O1OA 4JJRA 3VUHA 2WU6A 4CMTA 3BHHA 3NW7A 4FT5A 4E7WA 4J8NA 3HMMA 5BQ0A 3P4KA 3BBWA 4IX3A 3BRBA 4USDA 4CZYB 4D0XA 1QCFA 2BAJA 1YRPA 4TYHA 4M14A 3C13A 4EEVA 3NUPA 5IH4A 3ORTA 3B8RA 2R3PA 2QOIA 3UO5A 2B4SB 3UO4A 1FVRA 2R3QA 4DBNA 4AGUA 5H8EA 2HY0A 4O6LA 2J50A 2Z7LA 4YTCA 3SDJA 4JX3A 3QD4A 5AFVA 4ONAA 3HP2A 4FV6A 2OH4A 4HGTA 4IAKA 4JDKA 4XV3A 4B7TA 2Y4IB 4JNWA 3EFKA 4FKRA 4LV8A 3A7HA 3NYXA 4KB8A 4ZTHA 4UYNA 4BDAA 4Q5HA 4FZ7A 3E5AA 2XVDA 4KIKA 4CZUA 1JSTA 4I4FA 4BZOA 1RW8A 5KHXA 4CSVA 4HVIA 2ZB0A 4JR7A 4PQNA 2NNWB 2R4BA 2A19B 1YOMA 4O1PA 4BBFA 1XH9A 1BLXA 4CXAA 4O7SA 4D5KA 4HGLA 1XWSA 1ZOHA 3BELA 2R3GA 4RVTA 3PXYA 1Q97A 4KS7A 5CVHA 5CAPA 4BBEA 4I0RA 4ZIMA 3DAKA 2BDWA 3PSCA 3QKMA 4J8MA 4PMTA 2WIHA 3I6WA 4YNEA 3VS0A 4CFVA 4R78A 1OL5A 1YHVA 5DVRA 1OPKA 4RQKA 4UMUA 3DT1A 3LFFA 4ZSLA 4MD7E 2XMYA 4BBMA 1X8BA 1CM8A 2G1TA 4ZTSA 4C4GA 3FXXA 1VEBA 2O65A 4C35A 4UX9A 3FMNA 3IW8A 4M84A 4IZ5A 4YR8A 3UOHA 4MX9A 2IO6A 3NYNA 5HE1A 3I79A 2R3RA 1H8FA 1ZLTA 3KEXA 4U80A 3RNIA 4A07A 3TDVA 3MV5A 2GNJA 2J51A 3UMXA 3COIA 3KFAA 1H08A 3GNIB 3EQHA 3TV6A 3Q9ZA 1CKIA 4W8DA 3WYYA 4ANQA 1DM2A 5CF8A 3D2IA 2I0HA 3EQRA 5DT4A 5DOSA 3RNYA 3QC9A 2JLDA 4EOIA 1Q5KA 3QAME 3IDCA 5E8XA 5IH5A 4EUTA 2HY81 4FEVA 3QQUA 4UZDA 4X0MA 4E8AA 1OBGA 3T9TA 4FGRA 3EQDA 2BAQA 4GRBA 4CGAA 1GZOA 1UWHA 3GP0A 4JQ8A 4QQJA 4QMZA 4NFNA 4G17A 2QLUA 4E4XA 5HLPA 2G9XA 4FV7A 1YDSE 3HMPA 3DNEA 4ZAUA 3B2TA 2BIYA 4IFGA 4G34A 2WQNA 5FP6A 3MSSA 4IQ6A 3ZXZA 4GYGA 5K0KA 3RAKA 3SXFA 1ZYSA 2W5HA 4BDHA 3ZSHA 3QGYA 4RJ8A 2C5OA 2DS1A 4DAWA 4EOSA 3FMMA 1G8SA 3R1SA 3GU4A 1Q3WA 5DR9A 4FTAA 4HVHA 3KXXA 2J0JA 2DUVA 2F9GA 3E87A 3LMGA 1P4OA 4FT3A 4HYSA 4A4LA 5M56A 3EN4A 3TIYA 3I5ZA 3NS9A 2C6DA 3C4FA 5DT3A 3P0MA 4QP9A 5EFQA 2Y8OA 3R9OA 4ACMA 4CYIA 1K9AA 2WAJA 2VWWA 3LFCA 4CT1A 3TN8A 5EM7A 4BZNA 4X2GA 2GFSA 3MH2A 2WQOA 2GSFA 4ZMFA 5KCVA 1Y6AA 5FGKA 4C58A 4EKLA 4M8TA 3WE4A 2HK5A 3ORKA 2YABA 5JN2A 3WF8A 3M2WA 3R1YA 2XJ0A 2PVKA 2UW8A 3ELJA 5CANA 1ND4A 3DBDA 4FV5A 1PYEA 2IVUA 4F9YA 2J0MB 3A7JA 3HYHA 3TM0A 4E3CA 5GJFA 1ZOGA 1WVYA 3DZOA 5DPVA 3RPSA 5AR3A 5IG1A 2J0KA 3IW5A 3R7IA 2RSVA 3S0OA 2OFUA 5BYZA 4ZJIA 3R2BA 4PDSA 3BZ3A 4BCNA 1ZMUA 2UW6A 2XNMA 2A0CX 3F5PA 2GS7A 4RA4A 5BVOA 1V1KA 3VHKA 2DQ7X 3ODYX 4I4EA 4CT2A 4MXOA 3E92A 4CZTA 4RLLA 3L1SA 3U87A 5HO6A 1UNLA 2QONA 4QP3A 1YDRE 5GZAA 3GC7A 3A61A 3ORMA 4PRJA 3NMUF 2RIOA 4LGGA 4NKSA 1HOWA 2CPKE 2WMUA 4GT5A 4TNDA 4IB1A 2ESMA 2QR8A 4L52A 1H1QA 3KMMA 4YU2A 5HZNA 3WI6A 3VUKA 1JKTA 4CG9A 2X4FA 4I41A 4ZY4A 2BTSA 4FKPA 2W4OA 3Q60A 4L44A 3H0ZA 3IO7A 1BUHA 2GTNA 4PDYA 3OF0A 2PPQA 1M7QA 3PPJA 4R3RA 5BYYA 2QCSA 4RVLA 4RBLA 3QQLA 4L01A 5EW8A 2IWIA 4FSYA 5JQ5A 4HVGA 4CV8A 3TNIA 4F0IA 5ITAA 3OC1A 3A2CA 3ANQA 3VN9A 1JAMA 2QU5A 3OBJA 4FV1A 2X7GA 4OTHA 5HOAA 4Z7HA 5AEPA 5IA2A 1H07A 4GJ3A 5KMMA 4UBAA 3KY2A 3LAUA 3NGAA 4MBLA 1OVEA 4J96A 3P7CA 4RFYA 5EW9A 3VUIA 4IWOA 2OJGA 4EI4A 3LOKA 4W4XA 3R83A 3NAXA 4BDIA 3QTQA 5LWNA 3UQCA 3F82A 1H4LA 2ITPA 2YAKA 4TRLA 1JNKA 4FKWA 4M15A 2CKOA 3Q6UA 4FOBA 4QQTA 3BX5A 4ALWA 3HV5A 2YM7A 4BZDA 2R3IA 4EH4A 2PE2A 4BGGA 5L2TA 3ZM9A 3MFRA 5HIEA 1H24A 4Q9SA 5AV4A 3E93A 4HZRA 4DEHA 4RVMA 2XNNA 3RPRA 1I09A 3VJOA 4CFFA 4LI5A 2G2IA 1OECA 2XJ2A 4ZXTA 2J4ZA 3DQXA 2UZWE 3F2AA 3E88A 5JGDA 4RIOA 4MBIA 1PRYA 2JEDA 2YLFA 2EWAA 3UE4A 3U4WA 4B4LA 2UZNA 4BDEA 4BRXA 3CPCA 3COKA 5GIOE 4FKJA 4XBUA 2HW6A 4H3PA 3I5NA 3QUDA 1XBAA 3S00A 1M2QA 2EB2A 3Q96A 4XMOA 5K9IA 2VWBA 3SHEA 3D5VA 3GU8A 4XV2A 3ZRMA 1PXJA 3O8TA 5CNOA 2QLQA 1M17A 3P78A 4TYGA 3LMHA 3FKOA 4E6AA 2BRNA 2H8HA 2ZMDA 3QRTA 5JEBA 2FH9A 5CU3A 4GU6A 5CTPA 4AFJA 2F7XE 4YZBA 5J9LA 2B55A 3WZKA 1PYXA 3AC8A 3KCFA 3G51A 4O86A 4GG5A 3ODZX 4ANBA 4M7IA 2OJ9A 1KOAA 3RVGA 3ZLYA 3UPZA 1Y57A 4ZEGA 1OI9A 4F6WA 3QHRA 4JRVA 4C33A 1CKPA 4EH8A 4EOLA 3S4QA 2VTPA 4FZDB 4GFGA 4IHPA 5EK7A 4FV0A 4EK5A 3BIZA 4ZP5A 3HUCA 2B9HA 4OGRA 3HMNA 4F6UA 4IAIA 2QOOA 3VO3A 3QHWA 4FNWA 3QRIA 4NK9A 3ULIA 2JAVA 4I5PA 4MNFA 4X2JA 2HELA 3GU7A 1Y8YA 3MJ2A 5AJQA 4O96A 3THBA 4L67A 3QRKA 3R9RA 3GB2A 5M08A 3G9LX 2I0EA 3VBTA 2VV9A 2YCSA 3OWPA 3ZLXA 5JK3A 3K2LA 5HHWA 3D4QA 4LGHA 3DK7A 5IQCA 5HX6A 4IE9A 4LUDA 3VW6A 2XK3A 5GNKA 1UNHA 3UG2A 2VX1A 3VUMA 5M06A 3OOMA 4TWOA 4XP0A 5D12A 5DWRA 5E90A 3U51A 3EFWA 4FEUA 1H0VA 3ERKA 4PPCA 3PDTA 2YDJA 4F9BA 3IW7A 3P08A 1JSUA 4AWIA 3QTWA 5KNJA 3COHA 3P7AA 3NNWA 4TY1A 3R63A 2QU6A 2NO3A 3GBZA 4FTJA 5AMNA 2IG7A 3VWAA 5A4QA 3O8PA 4KWPA 5HIBA 5KKRC 2HAKA 3F7ZA 4BDKA 4YJOA 3FLZA 4PTGA 2FSOX 3EWHA 3S1HA 4RWLA 4D2WA 4DFUA 4BCHA 4YJRA 5CI6A 3G0EA 1NA7A 2PE0A 2UW4A 4QYEA 2CLXA 1CSNA 2RL5A 2QR7A 3JVRA 3OWKA 4L3JA 4FV4A 4P5QA 1T45A 4Q5EA 3WZJA 5L8KA 4DT8A 3IG7A 2J5FA 3FQSA 5CZIA 3H3CA 2P0CA 5FBNC 4Y72A 2X8DA 4AW1A 3EN6A 3MI9A 3JXWA 1IG1A 4C62A 4AE6A 4JBVA 4TWPA 3MB6A 2PZYA 2OZAB 4X3FA 2VTMA 3QL8A 5E8ZA 3EKKA 1IEPA 4BB4A 5K4IA 3R0TA 4EK6A 4YURA 4ID7A 3C9WA 4CFNA 2C5YA 4AZTA 3DBEA 4ZSJA 3EOCA 2BZHB 4ZY5A 4P4CA 3ZUVA 1FVTA 2C5VA 2ZDTA 5ETFA 4Z55A 5ICPA 3MN3A 4EOQA 5KUPA 2X1NA 4DYMA 4GJ2A 1XH7A 1WZYA 2HW7A 4EH9A 4GSBA 3RP9A 5DG5A 4I20A 4ZMEA 4NIFB 4QMXA 3BCEA 5H2UA 2H9VA 3DXPA 4IMYA 5CEIA 4O7LA 4L8MA 3DQWA 5AR2A 5AP4A 4ITIA 4ACGA 3A99A 3MYGA 4EOPA 4GK2A 4JI9A 1E9HA 4FSQA 4BC6A 4XBRA 4GK4A 3ID6C 2PVLA 4U45A 2C6OA 2R3NA 3CXWA 4XS2A 3E64A 3SA0A 2W1FA 3BU6A 3BHUA 5EOLA 4FTMA 4F63A 3TNWA 1XJDA 2O64A 4OBPA 5GJDA 5AP5A 2HWOA 5TF9A 3GENA 1H00A 4FSUA 4YZNA 3QQJA 5C03A 3UOJA 2WMQA 3DZQA 4NM5A 3BE2A 3GC0A 4X3JA 2WHBA 2V5QA 5ANDA 5J1WA 3VJNA 5AUXA 4CKJA 1XO2B 3F3VA 5CQWA 5DGZA 5E8VA 3R00A 3AQVA 4MXYA 2HOGA 3S95A 4HGEA 4D2SA 3RPVA 2SRCA 5HO8A 3WF5A 3MA3A 3HVCA 4IC8A 2GPHA 3VAPA 3OG7A 4WOVA 1IAHA 2C1AA 3VS3A 3CY3A 4DGNA 4WBOA 4MXZA 1S9IA 5LARA 1MP8A 2VO0A 4I94A 3SAYA 2WO6A 5JQ8A 1OIRA 4I1ZA 1CMKE 5AP7A 5DR2A 3DJ5A 3IW4A 2ERZE 2PMOX 4KINA 5DE2A 3PIYA 4R1YA 4C3PA 3R1QA 4R5YA 2XS0A 1H1RA 3DY7A 4OAVB 3ZTXA 3LXLA 3ZLWA 2GTMA 5DA3A 4XNEA 4A9RA 3RCDA 1GZ8A 4AW0A 3ORZA 2PVYA 3VRYA 5HNIX 2R3MA 5JZJA 3G6HA 3DDQA 5J9YA 3MVMA 3SC1A 3U55A 5KMJA 1ZWSA 5CU6A 4O7YA 1QMZA 4XG4A 5LJJA 5CF4A 4D9UA 2ZB1A 3R9NA 3ETAA 3GCSA 5EDPA 1XH8A 3ZCLA 4FNYA 3QX2A 4K6ZA 2X8EA 3FZTA 3DXQA 1XKKA 4TZRA 2BCJA 3MW1A 1UVRA 4FV9A 4LL5A 3EQPA 4O0VA 4AF3A 3FPMA 3OCGA 4J71A 4YLLA 2R3FA 3R7VA 3LFEA 1BKXA 4YMJA 4TYHB 4XG6A 3C4XA 4QPSA 5J79A 3COMA 4D2RA 5JFSA 3GU5A 2YITA 3CJFA 2BR1A 3L9MA 3VBQA 3VS5A 4G3EA 2WZJA 4DEDA 2QOLA 3F66A 1BMKA 4PMSA 4RSSA 4ENXA 2CNUA 2VNYA 3TNHA 4YJTA 2XNEA 4YZ9A 3LFNA 1U54B 2OWBA 5C27A 4B8LA 3PVUA 4RIYB 4H05A 1WBPA 4KIQA 4GVAA 4HCTA 4UV0A 5IEVA 4NH1A 2ITXA 5EW3A 2JAMA 3G5DA 5HEZA 3GFWA 4CFXA 5I4NA 4FL2A 4RIWB 1Q8WA 2JKQA 4XG2A 3HUBA 3MH0A 3DFAA 2H6DA 3PPKA 3QKLA 1OL2A 4HCUA 2PVHA 4AGCA 4ZJJA 3VNTA 4FIFA 3UC3A 2B9IA 5C8MA 2WQMA 1Q4LA 4O7NA 5CSPA 4U79A 3V8TA 2Z02A 2FSTX 3UYSA 2JIIA 4U7ZA 4QMNA 4GIHA 5E8SA 1PJKA 1O6YA 4HCVA 4D4VA 4DFZE 4YUQA 4HYIA 4AGWA 3Q4TA 4AN3A 3VS6A 4C2WA 4IIRA 3MFSA 4UXLA 3RTPA 4EHZA 3KRWA 2WELA 3FLSA 4OAUC 2Y9QA 3UIMA 4MD8E 2OO8X 5IQDA 1ERKA 4X2NA 3SLSA 4EZ7A 2WGJA 3FLYA 5CAUA 4R77A 5CT7A 4C4JA 3R28A 5HE0A 2OBJA 1PXOA 3HECA 1VR2A 2NRYA 5ACKA 1V0BA 3ZH8A 3CY2A 4FTOA 3C1XA 3V51A 3ORIA 4I6FA 5AA8A 3SXSA 4ERKA 3ZRKA 4OBQA 3HMOA 3CKXA 4YLJA 4I23A 2GU8A 3PLSA 1F3MC 2ETRA 4MD9E 1G3NA 3KGAA 3LZBA 4WG3A 1PF8A 3KMWA 2XM9A 5DHJA 4EOOA 3EN7A 3QYZA 4J99A 4QT1A 4I0SA 2YM5A 3GI3A 4QMLA 3O50A 3ITZA 1YKRA 1SVEA 4NU1A 2VNWA 4F9WA 2C68A 2YAAA 3C4WA 3O7LB 4G6LA 4PNKA 2I1MA 4ITJA 4D0WA 3D14A 3KC3A 3BV3A 5I3OA 4UALA 2GQSA 4MAOA 5D7AA 3UBDA 4G3FA 1LEZA 4OR5A 4UMQA 5IQEA 5CNNA 4U8ZA 5BVFA 3DJ7A 3DS6A 3SXRA 3UZRA 1JVPP 1MQBA 3W10A 4AAAA 1OKVA 2I7QA 2YWVA 3TCPA 4HPTE 5CF5A 4FK3A 2CCIA 4XOYA 3C5UA 4MBJA 4BGHA 2EB3A 4YTIA 2F7ZE 4F99A 1PXMA 4DGLC 1PMVA 2PMNX 3AGLA 5IU2A 2FGIA 5FTOA 5F95A 2VTQA 3UIBA 3NIZA 5KO1A 3HX4A 1JLUE 1TQIA 1YW2A 2DWBA 4UMTA 3GCVA 5H8GA 3LLAA 2PY3A 5CU4A 4S31A 4V04A 1JSVA 4JAIA 2CN5A 3DV3A 4LOPA 2PZPA 1TVOA 3OT3A 3SD0A 3PTGA 4CTBA 3LE6A 4C0TA 2A27A 4HNIA 4DN5A 4DGOA 1KUTA 2EVAA 2WEVA 3PE2A 4O81A 4C36A 4FKOA 1GIIA 3FWQA 3D7ZA 4FYNA 4CVAA 3MJ1A 1Q62A 4XG8A 3OY3A 3SV0A 4EONA 2VWYA 2WIPA 5C26A 1G8AA 3KU2A 3TG1A 3OBGA 3ZC6A 3ZDUA 3CD8A 3POOA 4FNXA 2GNLA 4NSTA 3F5XA 2VTLA 4GU9A 4BCOA 1A48A 3UIXA 3C0GA 4FEQA 3EHAA 4RA5A 5JFWA 1ZYCA 1BX6A 5KMLA 4DA5A 2R7BA 2YCRA 1B6CB 4RC2A 2B7AA 5I9UA 3IKAA 5KMNA 3F5UA 4RFMA 1O6KA 4QOXA 3PYYA 3ZRLA 2XP2A 4FTNA 3I81A 4YJPA 4FGBA 1WAKA 1R3CA 1YXSA 4TNBA 4WUAA 5BVEA 5FXRA 1WMKA 2V62A 3R7UA 3TXOA 5IUIA 4N0SA 4R6VA 3V6SA 4C3FA 4DHFA 3CBLA 2KULA 3BYUA 4YTFA 2W9FB 3WE8A 2WMTA 3PY1A 2WMWA 5L6WL 4IM2A 3A4OX 2AC5A 2WKMA 4LM5A 4RVKA 4IB0A 4ZJVA 3PP1A 4NL0A 3C7QA 1T46A 1G5SA 3R2YA 2JDSA 3FC2A 3AGMA 4IFCA 2AYPA 1DS5A 2VO3A 2J0IA 2C3KA 3Q5ZA 1H1SA 3FL5A 3QF9A 3RK9A 1Q8TA 1PKGA 3N4UA 4NCTA 5CF6A 3KVXA 1FMKA 4OW8A 4IANA 3FJQE 2RFDA 3PJ8A 1IASA 4GUEA 5DIAA 5HNGA 2BDJA 4NCTC 4W4VA 4D28A 3W16A 3GCUA 4EORA 3MGYA 4NWMA 3OMVA 4M0ZA 1LP4A 3FI3A 4AGDA 5FUTA 4FTLA 3RZBA 5CEMA 5BYLA 4I5MA 5HU9A 4WG5A 3PFQA 4L45A 5A4TA 3EZVA 5BUEA 3U6IA 2PZ5A 4FSMA 5HBJA 4HW7A 1XBBA 5J5SA 3NLBA 4UWCA 2QOBA 4NUSA 4GUBA 4CQGA 4PY1A 3FV8A 3B8QA 4PPAA 5HI2A 4KKEA 3U9CA 3TKUA 5AIRA 5HKMA 1OM1A 4QNYA 4RG0A 1E1VA 1KE8A 2CMWA 4DEIA 4BY9E 4CG8A 1ZZLA 4OTDA 1SM2A 4JG6A 5IMEA 2YERA 2HWPA 4YJUA 3ENMA 5A4EA 1H0WA 4CQEA 2R3OA 4MQ2A 3QTSA 1OGUA 3FZPA 2IVVA 3BYVA 3QXPA 3DFCB 4LFIA 3K3JA 3ZXTA 4EQCA 2OFVA 1YOJA 5CY3A 3TACA 2FA2A 4YP8A 4RJ3A 5M4FA 3O0GA 4FKSA 3KXHA 3R73A 3DKGA 4D2TA 5LMBA 3OHTA 3FBVA 4FZAB 3JPVA 1WVWA 1M14A 5E9EA 3FKLA 2O2UA 3KULA 3V04A 3EFLA 2QQ7A 2OSCA 4QMMA 4UN0C 1GZKA 4MK0A 4FSTA 2VTHA 4BCJA 3QGWA 2UZEA 3R7OA 4JDIA 3MVHA 3F3WA 2UZUE 4R7BA 2JIUA 4V0GB 5EM5A 4QTCA 3FMLA 2OIDA 4O7VA 1XH5A 2RF9A 3PPZA 3A4PA 4I6QA 4IBMA 2C5XA 4CNHA 2GNHA 5CSWA 4PP7A 4FKLA 2R9SA 5EQYA 3F88A 4C7TA 3G6GA 1B38A 3T8OA 1FOTA 4QP1A 3NEWA 4FVQA 2GNFA 2YHVA 3GFEA 2CGWA 5J95A 3IOPA 4DFXE 3KF4A 4YHFA 1URWA 1QPEA 2IZSA 4KSQA 1OUKA 2WU7A 4KABA 4WHZA 4TYIA 3DKOA 3NNVA 3FZOA 5AUWA 3ZEWA 4U3ZA 2X81A 4ARKA 5DNRA 3GOPA 3LLTA 3VW8A 2YDIA 2C6LA 4JQ7A 3MPTA 5CXHA 4NW5A 3T3UA 3NCZA 4KKGA 2C3JA 3D5WA 4OTRA 4ANOA 5LVNA 4DE4A 3TT0A 5IZFA 3D94A 4BDJA 1VYWA 2X7OA 4AE9A 4O27B 2XK6A 2XRWA 1OITA 1ZOEA 2IJMA 2JBOA 5LVOA 3TL8A 4HOKA 2WTWA 4DGMA 4BHNA 5IA4A 4M67A 5KX8A 3TUBA 4JBOA 1W8CA 3DTWA 5JRSA 3A7IA 4I93A 4UWBA 2J90A 4S33A 5J7HA 4ZZOA 3NVMB 1PMUA 2UZTA 4ASZA 4FA2A 3ALOA 3ET7A 1BL7A 2VTIA 5EDQA 3DB8A 3POZA 5H8BA 3E8NA 1OUYA 2O8YA 5AV1A 4F7JA 2WTKB 4XG7A 1KE9A 4AZFA 4A9UA 2JDTA 4FTTA 3VUTA 4BIEA 3ENHA 1K2PA 4O2PA 4YO6A 1H27A 2QOCA 4Z9LA 4MNEA 4U6RA 4MQ1A 4ASDA 2JBPA 4W9WA 5IKWA 1ZMVA 4E5AX 5L4QA 2XA4A 3VBYA 3WF6A 4XG3A 3ORPA 3R7GA 2HZNA 3G2FA 4ZS4A 4HGSA 2VTNA 4K9YA 2YM4A 4E4NA 2IZRA 3NR9A 5AR8A 3Q9WA 5L8LA 3FYJX 3LFSA 2I0VA 2ITNA 5EKOA 4DBXA 4X3FB 2WTIA 5IA5A 3ZSGA 3WBLA 2JFMA 5KHWA 1M2RA 1E1XA 1VZOA 2E9UA 3BLRA 3I0QA 3LQ3A 3AC3A 3UVRA 3O8UA 2CNQA 3W32A 1GJOA 2HENA 3DA6A 4QNAA 3UVQA 4EOKA 1YHSA 3TV4A 1ZYJA 3CPBA 3CTJA 4E4MA 2OLCA 5EQPA 2QOFA 3QTIA 4BL1A 4B99A 3W2SA 2GFCA 2PYWA 1REJA 3GQIA 4QTBA 3ZMMA 3TKHA 4JT3A 4B8MA 2J9MA 2VTJA 2JGZA 3GC9A 3E7OA 4WNPA 4AZVA 4BYJA 3R02A 4E26A 4I92A 3NPCA 4KIPA 4FR4A 3QZGA 3VF8A 4F64A 1GZNA 2ZV8A 4WSQA 2PK9A 5AA9A 4MXAA 3I60A 5HVJA 4C4EA 4FTUA 3IOKA 2VWZA 2PUPA 2CJMA 2V55A 3DPKA 3GEQA 3LCDA 3NYVA 4FK6A 2C6KA 4GIIA 1GY3A 5CAVA 3QX4A 5HU3A 2WNTA 2W1HA 4QTAA 4TPTA 3UQGA 1CDKA 5AUTA 3KF7A 4MTAA 1A9UA 4DG0E 4B9DA 3RINA 4YBKA 4I22A 3F2NA 3QQGA 4M12A 4BN1A 3Q9XA 1ZYDA 2R3HA 4HYUA 4QO9A 2J6MA 4FI1A 1DI9A 2LGCA 3LFAA 5E8YA 4EH5A 4BR3A 4DTAA 2CLQA 3QCYA 4EWHA 4JS8A 5EM8A 3DTCA 1SMHA 4IX5A 3M11A 5B2KA 3Q6WA 3SRVB 4YO4A 3V6RA 5IUHA 3KN5A 5LVPA 4UXQA 4FV8A 3FEGA 4CRLA 4D4RA 2Q83A 2CGXA 3O71A 2Y4IC 5HCXA 4A4OA 4H36A 2HXQA 4XJ0A 3UGCA 4RJ4A 2BPMA 5M53A 4DF3A 1KE6A 3LHJA 1YWRA 4E5BA 5I9VA 1W84A 4PX6A 3TZ9A 3AD4A 4NT4A 3BYMA 4DINA 3RKBA 4YNOA 3NCGA 2X39A 5JSMA 4OLIA 4AS0A 3L8XA 3FZ1A 4DEBA 3NSZA 4ORKA 1NVQA 3MTFA 4L7FA 3MPMA 4A7CA 3V5LA 2GQGA 2BTRA 3FXWA 4EYMA 3QKKA 3LXNA 3PJCA 4I6BA 4L6QA 4RT7A 1W98A 4XG9A 3LCOA 2VAGA 3IDBA 2ZOQA 2WOUA 2XZSA 2O5KA 2C6IA 5FEEA 1J91A 2OJIA 2VGPA 5EDRA 5CI7A 5CWZA 2YWPA 3GVUA 3IW6A 4FSZA 2OH0E 4FUYA 5AP2A 4C8BA 2WMXA 2WB8A 1YXXA 3HDNA 4O21A 1F0QA 2OI4X 2CGVA 3MFTA 3RAWA 4K33A 4IEBA 3CJGA 3QYWA 1FPUA 3P7BA 3TZMA 2E9VA 2ITVA 4EJ7A 4WKQA 4RPVA 4XOZA 5L2WA 4P7EA 3JR1A 5J87A 2BRMA 3FSFA 3HRCA 5HESA 2VWXA 3RM6A 4Q9ZA 3HNGA 4FKVA 5D1JA 2X9EA 5EI8A 3V01A 4TYJA 4ZZMA 3R8MA 1XH4A 1UU9A 2GS2A 4N4SA 4XH6A 4LG4A 2CCHA 4P2KA 5IDNA 4CV9A 5IMXA 3UNKA 2WMAA 2ZMCA 2EXMA 3R21A 2YM3A 4QQ5A 5CX9A 4IAFA 4UWYA 4BHZA 1OL1A 2XIRA 3D7TA 4GVJA 4D1SA 2XKDA 5KMKA 5JGBA 3CEKA 2WMBA 4O38A 1PMEA 3MY0A 2H34A 3JYAA 1UU8A 3R9HA 4EZ3A 2W1IA 2C6EA 4G5PA 2R5TA 4ZTNA 4QP2A 3QLGA 3PXKA 4EJNA 4ZLYA 5BVNA 4BCIA 3P79A 1O6LA 4F7SA 4QTEA 3NYOA 2IZTA 2XIZA 4B6LA 4FX3A 3K5UA 4I21A 3D83A 4KS8A 4NM0A 3BEAA 3PIXA 1XR1A 2XCHA 4HYHA 2OICA 2B9JA 5M07A 3CP9A 1U5RA 2OIBA 3DBCA 4Y5HA 3EKNA 4A06A 2VTOA 4BTFA 4F4PA 4CFUA 4PF4A 4G31A 2QG5A 5C4LA 4CD0A 3BEGA 3EYHA 3REPA 3ZYAA 3PA3A 3TKIA 5L2QA 4KBKA 2YA9A 3I4BA 5C8NA 3HAMA 2HZ4A 4CLIA 1Q61A 2PUUA 1PW2A 4J97A 4J95A 4PMMA 4ZLOA 5IEXA 3B2WA 5HLWA 1H28A 4FKUA 4FNZA 3AD5A 4FSWA 1LR4A 2UV2A 4FT7A 4K18A 3GGFA 4NJ3A 3WF7A 4EOJA 5HTCA 3FQHA 3W2PA 1P2AA 5J7BA 4TW9A 4FEWA 4KKHA 1PXIA 1WCCA 4G6NA 4WNOA 4XP2A 3O17A 4MXCA 3AMAA 3JUHA 4FIGA 2RG5A 4ZSEA 1KV2A 3ZU7A 4A9YA 5IF1A 2RFSA 4F0GA 2YM6A 4V05A 3VC4A 1M2PA 5IQBA 4J53A 2XK7A 4BTKA 2CSNA 4FBXA 1OPJA 3C0IA 4ACHA 2V22A 5TR6A 2W1DA 2X6DA 3EMGA 2QO9A 1BL6A 5ANGA 3FY0A 4MWHA 5EG3A 3GUBA 4FV3A 1PMNA 4FG7A 5K0XA 4UMPA 4BFMA 5EQEA 3QA0A 3R9DA 2VTRA 1HCLA 5EM6A 4U97A 4QP4A 4G2FA 3NNUA 1R1WA 2X2MA 3ROYA 2YIRA 3V5QA 3NUNA 5JH6A 4JIKA 1ZXEA 3ZBXA 1RDQE 4LQMA 4R7IA 3LM5A 5AP0A 5CEQA 3OT8A 3FHIA 4D5HA 5D10A 4C2VA 4MYGA 1R39A 4GT3A 4XRJA 1R0EA 2WQEA 4U44A 5FXQA 2BRBA 4GW8A 3FZSA 5IA1A 3OS3A 4IAAA 4FVPA 3ORXA 3ZDIA 5GINE 3GT8A 4IXPA 2YISA 4BCQA 3G0FA 4M69A 3CTQA 3T3VA 3QD0A 5E8TA 5F20A 3RZFA 2YCQA 5CZHA 4TL0A 4IVBA 3EJ1A 5FEDA 1W0XC 3O23A 3QBNA 4RC4A 3N51A 1SNXA 4AG8A 1MUOA 3RWPA 4Y83A 2WFYA 2X8IA 4QMQA 4U0IA 3V8WA 3VF9A 4FF8A 4QMWA 4D2VA 3AMBA 4AN2A 2YIYA 3KQ7A 4RMZA 5KBRA 3IPHA 3FY2A 3KA0A 2BRGA 5H3QA 3GCPA 2C3LA 4F6SA 2GNGA 3AXWA 1JKKA 4CYJA 3BGZA 2HYYA 2HCKA 3E62A 3AT2A 4RC3A 5DLSA 3UOKA 3CD3A 4EH7A 4TT7A 2ITTA 5CENA 3UJGA 4U42A 3R30A 4FMQA 3TJCA 4ZK5A 3T9IA 3OXTA 4AZSA 2UZVA 5J1VA 4ENYA 4AACA 1WBOA 5AR4A 4YPSA 1A06A 1F5QA 2UZDA 5L3AA 3DAJA 2Y0AA 4NZWB 5D9HA 2W5BA 3FE3A 4V01A 4S2ZA 5AWMA 2O0UA 4K2RA 4J7BA 1FGKA 3DAEA 4ERWA 3R04A 4O7WA 4PMPA 2PMLX 1OKYA 4IM0A 5AP1A 2OJFE 3BLHA 2R3JA 4RZWA 1WBTA 4XX9A 5EHYA 3UTOA 3A8WA 2WMRA 2XRUA 3ZO1A 1YOLA 2HXLA 5FLFA 1RE8A 3W2QA 3CS9A 5E91A 4DEEA 3ACKA 4E6CA 5FTQA 4ACCA 3FLQA 3RK5A 3MH1A 1QPDA 2YZAA 5C8KA 4RX5A 2Y6OA 4X6QC 3OROA 2ZVAA 3MDYA 5M4CA 1W83A 3DGKA 1Q8UA 4AT3A 3I6UA 4CEGA 3CGOA 3UDBA 1WVXA 3ALNA 3K5VA 3Q4UA 4YJSA 1SNUA 4BDFA 4O91A 1OBDA 1UNGA 3P1AA 1Z9XA 3QD2B 5EI2A 3H9RA 3VRZA 3DXNA 5HD4A 3QRUA 1H26A 3RI1A 3PZEA 5LMKA 4PTCA 2G2FA 4WG4A 2CGUA 5IDPA 1QL6A 2VZ6A 1H1WA 5HG9A 5LMKC 5HTBA 2C30A 3K3IA 3IDPA 3Q04A 4KRDA 3A7FA 2XIKA 5A6OA 5I9XA 5EI6A 4LRJA 3EZRA 2W1ZA 3FAAA 4NJDA 4DC2A 3P23A 4FZ6A 3AT3A 2XJ1A 4LRMA 3RJCA 5HLNA 2PULA 5GHVA 5FTGA 5JRQA 3GC8A 3HKOA 3BQRA 2GMXA 2REIA 2A2AA 2ZAZA 2BALA 2OXXA 3D9VA 2O3PA 2C47A 2X9FA 3DB6A 4KIKB 4RJ7A 5DEWA 4AP7A 4O7TA 1XH6A 3BPRA 4XCUA 1UKIA 3CQEA 3RBWA 4HVDA 4AT4A 5T3QA 5TKDA 2I40A 4XYFA 2YEXA 5CEOA 3ORLA 2E2BA 3VBVA 2YJSA 5FDPA 3IK3A 4BI0A 3KRXA 4IZYA 4BIDA 2QVSE 1VYZA 3OXZA 3FMJA 4FKTA 1XBCA 4RX9A 5FQDC 4IWQA 2B53A 5DT0A 1IR3A 4QD6A 1M52A 2V0DA 2AC3A 4BICA 3NNXA 5EOBA 3CTHA 2FSLX 2CKPA 2XH5A 3QQHA 2O63A 1H25A 4C59A 5T6KA 1IA8A 4JDJA 4ZOGA 2NRUA 2JKMA 3R22A 4YPDA 4EWQA 4RIXA 4UB7A 2LAVA 4EHEA 4QP6A 2OZOA 1NVSA 2GQRA 2BRHA 4Y95A 4O7ZA 2ONLC 4E73A 5LOHA 4G5JA 1JOWB 5EYMA 3S3IA 3OP5A 3FMKA 3W33A 3RK7A 4H1JA 2QHMA 2WTDA 3IGGA 3P9JA 1QPCA 3R8ZA 3ROCA 3M42A 3UPXA 2JC6A 3KRRA 1YI6A 3KULB 2G2HA 2R3LA 4IC7A 4W4YA 3EFJA 3HV6A 5AUZA 4YJQA 5JGAA 4EKKA 1S9JA 5E1SA 3A62A 1U46A 1SYKA 2XEZA 4TYEA 2OZAA 2ZV2A 4L3LA 5C01A 3KXGA 5IEYA 2OW3A 4S34A 3ZFMA 4K77A 4FTIA 3FL4A 3TIZA 3BHYA 3FYKX 4G9CA 2VWIA 3U6JA 3DJ6A 3R71A 3VUGA 1DAYA 5EHLA 1UV5A 4FTKA 4IW0A 4OBOA 3SOCA 3UNJA 3V8SA 2C4GA 2XNOA 2XF0A 4C37A 4IX4A 2HIWA 3QCXA 4GCJA 3LQ5A 4AZWA 4WO5A 3HRBA 5DN3A 5FM2A 3FC1X 4RWKA 5HBHA 3EL7A 4R1VA 2JDOA 3CC6A 2VUWA 4LGDA 4DCAA 5FM3A 3ZFXA 2JFLA 4I24A 2GDOA 4IJ9A 4L46A 2XKCA 2C5NA 4F08A 4CKRA 3HP5A 4JBQA 3E3BX 4JQEA 5FD2A 1OIYA 3PZHA 4RX8A 5E4HA 3C0HA 2FO0A 4Q2AA 2X4ZA 1Z57A 1Y6BA 3GXLA 4ZTQA 5IQHA 3GU6A 3PJ1A 4APCA 4XV1A 1NXKA 3OTVA 5HE2A 3ACJA 5CSVA 3KXZA 4O84A 3TJDA 1LEWA 3ZBFA 4FIEA 3PE1A 4C61A 4ZLZA 2IVSA 2W17A 1TQPA 4IH8A 3PXRA 4QMOA 5ANEA 1P14A 2J0LA 5DI1A 5FP5A 1NW1A 3WF9A 5AM6A 4C34A 5JFVA 2BZJA 2EXEA 1GAGA 1DAWA 1ZRZA 3F3ZA 4EYJA 3GQLA 2YJRA 4RWJA 4P90A 3FLNC 2YIWA 3VS7A 1BI7A 5H9BA 3MH3A 1WFCA 4JXFA 4YSMA 4WIHA 4OTIA 3QD3A 2BAKA 2W5AA 4DH3A 1FBNA 1NY3A 3BYOA 4E4LA 4EOMA 1WBNA 3NDMA 3EL8A 4MNEB 4BI2A 2ZDUA 4QYFA 3PWDA 4BWPA 1LPUA 3EQIA 1R78A 5HG5A 5HICA 4IDTA 4EC9A 4KUJA 3HV4A 4IAZA 3FKNA 3H0YA 5B0XA 4R8QA 3EIDA 4IZ7A 3A8XA 3UODA 4IJPA 2PVRA 4IX6A 3KXMA 4FZFB 4TWCA 4RRVA 4F7LA 1YWNA 5CEKA 4MXXA 2PUIA 3N4TA 5IQGA 4CMUA 1AQ1A 3FMEA 4TXCA 3RHKA 2YCFA 3Q5IA 4G1WA 3ZO2A 3OOGA 3ZONA 4UY9A 5IQFA 2QG7A 2JDVA 2PZIA 4JDHA 4QRCA 4USEA 4ZZNA 5ANIA 3MIYA 4W8EA 1ATPE 1XQZA 4Z7GA 2VTAA 3NUSA 1IRKA 4L9IA 4F0FA 2WEIA 4N70A 3SW7A 2WPAA 4CKIA 1HCKA 5FRIA 5HNBA 1YQJA 3QALE 3TZ8A 5C9CA 4KSPA 2JKOA 4ANSA 4BDBA 4FYOA 3H30A 4KRCA 4R7HA 3LCTA 4ZSAA 4Y5QA 2W1CA 3QWJA 4GFOA 1BYGA 4WA9A 2Z2WA 3F6XA 4A4XA 2FUMA 4YZDA 2OF4A 4FSNA 4ALVA 1GIJA 3NUYA 3WZUA 5TOZA 3K54A 4U41A 5HX8A 4BDGA 3VQHA 3WZDA 4IVAA 1JPAA 3V5TA 2JDRA 4FV2A 2ETKA 3MB7A 4JOAA 1Y91A 3QLFA 4G3CA 4ASXA 4MVFA 4XP3A 5CU0A 3LJ1A 3MESA 4AA5A 4CFMA 2ZV7A 4Y73A 3CKWA 3HA8A 3KMUA 4O0TA 3PJ3A 3AMYA 5A3XA 4WSYA 5AR7A 5A4CA 2FB8A 3CIKA 4H3QA 4ZS0A 3PG1A 1JBPE 2XYNA 3DOGA 2UZLA 4JIAA 5JZNA 4FKQA 3ZS5A 4E6QA 4GKHA 1OL6A 4AOIA 2W9ZB 3NAYA 4JR3A 1U54A 2DYLA 5CXZA 1J1CA 4IDVA 3W18A 4RIYA 2X0GA 5HG8A 4GFMA 4K8AA 4G6OA 5T68A 3R7YA 2WTCA 1LUFA 5JT2A 4IADA 4RIWA 5B2LA 4M97A 1CTPE 3RMFA 3D5XA 4F1MA 4YC3A 4X21A 3PVGA 5BVKA 1APME 2UW9A 2QURA 2V7AA 5L6PA 5HVYA 1ZARA 3NZ0A 2P33A 3HGKA 3WZEA 2ITWA 5ETAA 3EQFA 2A4LA 3F9NA 4XEYA 3H4JA 3LQ8A 3UO6A 4AX8A 4NYEA 2Y7JA 2RFNA 1FGIA 3BGQA 1ZY4A 4HVSA 4RGJA 3TZ7A 5KBQA 1PXNA 5IUGA 1Q41A 5CU2A 5BVWA 3NRMA 2IZUA 2Y6MA 2BZIB 4UMRA 2J2IB 3D2KA 3PJ2A 4WNKA 3LXKA 3TWJA 2B52A 3VIDA 5J5TA 3G15A 5I3RA 5HGIA 5FWKK 4D55A 3F61A 3AC2A 3NIEA 2ITZA 3Q4ZA 4AUAA 2OGVA 3PY0A 5M4UA 4JX7A 1IA9A 2YLEA 3PLAE 3JY9A 3L8PA 3KK8A 4FTCA 2C1BA 4UYAA 4DLJA 3U54A 5E92A 5EHOA 3KXNA 3PSBA 3C4EA 4YGAA 2UZBA 3FHRA 3RCJA 2QKRA 5ETCA 3Q32A 1MQ4A 4BTMA 3W2RA 3DDPA 2X2LA 2FVDA 4FODA 3QU0A 3L8SA 5GJGA 3CCNA 3NUAA 2W7XA 5AR5A 2W96B 4JL9A 5AP3A 4FTRA 2YDKA 2X2KA 3QFVA 4O82A 2XNBA 4HPUE 4ANNA 5AAEA 5BUJA 2R3KA 3QUEA 3ATTA 4MWIA 3RALA 1JKSA 3PP0A 5GZ8A 3NW5A 4U43A 3UIUA 3ZM4A 2B9FA 4FT0A 3SG9A 2ZV9A 1WBVA 3FUPA 1L8TA 2BILB 3ZSIA 2UW5A 4D58A 4AQCA 4EHVA 4X2KA 2BROA 4II5A 3FMDA 2WMSA 5BUIA 5FEQA 3UYTA 3HMIA 3L9PA 2PVNA 2Z60A 3AG9A 3E8CA 4PP9A 4OTGA 3D7TB 5BPYA 2A1AB 4FICA 3PVWA 5CT0A 4RFZA 1OZ1A 3AC4A 5CS6A 5KKRB 5L6OA 2BVAA 4OT5A 2F49A 2QOQA 2WOTA 3NWWA 2ETMA 3F69A 1OPLA 5BVDA 1Q8ZA 2W4KA 1DI8A 4DFLA 3VBXA 3TNPC 1ZMWA 4A9TA 3CQWA 3QTRA 2NPQA 3IONA 3G90X 4P5ZA 4KBAA 2W06A 2CNVA 4PNIA 2C3IB 3AC5A 3W8QA 4YHJA 2GS6A 4O0YA 3L9LA 4QTDA 3ZC5A 4F1TA 1RJBA 3QTZA 5CALA 1WBWA 3G33A 4EL9A 4Z3VA 3DKCA 5DRDA 4PV0A 2XK8A 3UQFA 2HZ0A 1KOBA 3MIAA 4FEXA 4QMYA 4LUEA 4YZMA 3Q4CA 4FT9A 1YI3A 4FL3A 2QHNA 4L53A 4Z16A 2F7EE 3P5KA 3DLSA 2ZYBA 2Q0NA 4WT6A 5K5XA 2R0UA 2OF2A 3UNZA 3LFDA 4GG7A 3EQBA 3ATSA 3E8EA 4BVUA 3BYSA 4WBBB 3IQ7A 4ANMA 3UP7A 1BI8A 3PRFA 2BKKA 3ORNA 4ITHA 2BDFA 3D0EA 3BE9A 2VU3A 1U5QA 1KV1A 2PVMA 3HRFA 5ETIA 2NP8A 2PMIA 2OK1A 3OUKA 1P5EA 4LMUA 2ZM4A 4NFMA 4C57A 4CRSA 4M68A 1GIHA 4MF0A 3PXFA 5LCKA 2P4IA 3PA4A 1PY5A 3WOWA 3BKBA 4FG8A 4MF1A 3VVHA 4XHKB 4LOQA 1Q24A 3E3PA 4H58A 5IA0A 3AC1A 5D11A 2R64A 4IWPA 3TI1A 3VUDA 5M51A 5M57A 3II5A 5KZ0A 2YACA 4PL5A 3EYGA 3HDMA 3HZTA 3LXPA 4WRSA 4E93A 2BFXA 3LCSA 3U8WA 4AW2A 2J7TA 4EHGA 4IAYA 4LOOA 2QOHA 4ZTLA 2GHGA 4R5SA 2UW0A 3CR0A 4M3QA 5EKNA 5D41A 4JRNA 1PXKA 4DITA 5AM7A 5HCZA 1AGWA 2ZJWA 5E8WA 4CFWA 4M69B 3CGFA 3TTIA 4G16A 5BX0A 5AADA 4QYHA 2IVTA 3UG1A 4PL3A 2FYSA 4ANLA 4CLJA 2W1GA 4QPMA 3LCKA 2PE1A 5A54A 2F2CB 2RKUA 2XCKA 5HG7A 1FQ1B 3MWUA 5HD7A 2UW3A 2XK4A 3OW3A 4G9RA 4IZAA 2EUFB 2OXDA 3BLQA 4F9AA 3PUPA 3R8LA 4XV9A 2J5EA 3VHEA 5HQ0A 5FBOA 3MTLA 2Q0BA 1H1PA 3BWFA 4PL4A 4M13A 4PDOA 5A46A 1UKHA 3CLYA 4C4FA 5CEPA 5IQAA 4DT9A 3EN9A 5A14A 4O0XA 3SKCA 2V7OA 1NVRA 5AV0A 4R3PA 3RHXA 4F7NA 5K5NA 3TEIA 1TKIA 3U4UA 4AZEA 4JG8A 3M1SA 2VWVA 4CMOA 3KCKA 3MBLA 4MH7A 2W05A 4IVDA 4O2ZA 5AV2A 3IGOA 5AIKA 2C6MA 4DTBA 2XBJA 1U4DA 4KBCA 2IW9A 4O0SA 5F1ZA 2RGPA 2VTSA 3A60A 2UUEA 1OB3A 3NUXA 4I5HA 3WYXA 4DGGA 3QZIA 2YM8A 4F65A 3C4CA 3TUCA 5BMMA 4MCVA 2HZIA 3ZHPC 3GCQA 2Z7RA 4O0UA 4DCEA 5IH6A 3OEZA 4BIBA 2PUNA 4BKJA 3HAVA 4HZSA 3OWJA 4AFEA 4FKIA 3OD6X 4KD1A 3G9NA 3W1FA 3QZHA 3MVJA 4V0GA 5LQFA 3OVVA 5ANJA 1V0PA 3NW6A 1J7LA 4NTTA 2G15A 3E8DA 4GH2A 4PUZA 4GS6A 4QP8A 4K11A 1JWHA 5E8UA 5FDXA 3V5JA 4L3PA 2BHEA 4UEUA 5DEYA 3CSVA 3BHVA 3N9XA 4UZHA 3VS4A 4BWXA 2E9NA 1MRYA 1Q3DA 4NM7A 1YVJA 2GHMA 3HL7A 4RWIA 1J3HA 4D1XA 5L2SA 3D15A 2F4JA 4PTEA 4NW6A 5AP6A 4APPA 1J1BA 4IACA 4BCGA 3TUDA 3OW4A 3QZFA 4DEAA 5F9EA 4PPBA 1R0PA 2VWUA 2XKFA 2OG8A 4K0YA 2X7FA 4RX7A 4X7QA 4BCKA 2CN8A 4A9SA 1GOLA 3PIZA 4WRGA 5B2MA 5F94A 3VBWA 1YXTA 2BMCA 3LM0A 4GYIA 5AV3A 5HVKA 3BU3A 3IECA 4GT4A 3C5IA 4M66A 5HORA 3O7LD 5B7VA 1KE7A 3O51A 2BFYA 2UZOA 3A7GA 3P86A 4FIIA 4O0RA 4OTFA 3IS5A 3Q2JA 1K3AA 1REKA 4NKAA 4KNBA 2Z7QA 2PWLA 4XLVA 4OT6A 4YC8A 3EB0A 4N6YA 2YFXA 3SOAA 3V5PA 3JS2A 2CKQA 2JKKA 1PHKA 2VTTA 5CSXA 3RPOA 2QI8A 3FI2A 4I3ZA 4DFNA 1OKZA 5ANOA 1I44A 2QNJA 4J98A 2ZM1A 4F9CA 1U59A 4RIXB 4ZTRA 5DYJA 1URCA 2WQBA 3MY5A 4EBWA 2WTKC 5HE3A 4NTSA 3KK9A 2B0QA 4G3DA 3WIKA 5M55A 3RAHA 3ZO4A 3O2MA 5EH0A 3HEGA 5M09A 2R2PA 3OCSA 2Z7SA 5M44A 4LYNA 5LWMA 4PWNA 3FPQA 1YWVA 3W2OA 4C02A 4I6HA 4D9TA 3OCBA 2PSQA 2ITQA 2XNGA 2QODA 4FL1A 4YC6A 3RM7A 4ALUA 4YTHA 2IPXA 5FG8A 2W99B 1M7NA 5J8IA 2YIXA 5CVFA 2R0IA 4ACDA 4F70A 3PWYA 5DMZA 2ITOA 4PDPA 4QYGA 2VO6A 4X3FC 3DBQA 4LL0A 1YI4A 2CKEA 2VX3A 3V5WA 3BV2A 3PRIA 2BZKB 5EYDA 4BCFA 2B54A 3JY0A 3UOLA 3OTUA 1FMOE 4Y8DA 2OJJA 3H10A 2F2UA 4QMPA 4GV1A 4DEGA 4EK3A 4EK8A 5GIPE 5E1EA 4AN9A 3R1NA 5D7VA 4C3RA 5DR6A 3HV7A 4FIJA 4D2PA 1PKDA 1P4FA 3I7BA 1ZAOA 4DFBA 5IISA 1AD5A 2PVFA 5HCYA 3ZEPA 3SVVA 4L42A 3WILA 3MVLA 5K3YA 3KN6A 5C4KA 4GK3A 5CSHA 2P3GX 1J7UA 3OXIA 3MS9A 4M0YA 4I0TA 4K1BA 4Y85A 5CVGA 4D4YA 4B0GA 2P2HA 3QCQA 1UU3A 5E7RA 3PG3A 3DKFA 4ZTMA 4MHAA 4DH8A 3FMHA 4NM3A 4LV5A 4U5JA 3LMIA 3MFUA 5I5ZA 4N6ZA 1OL7A 2WTVA 1XHAA 2C0OA 4HNFA 1MRVA 3FDNA 5M4IA 5I9ZA 1CKJA 3DU8A 3NVKI 3C50A 3ZUUA 4F09A 4FTQA 3BQCA 4BKZA 3BHTA 3SRVA 5HBEA 5I9YA 5G1XA 2CHLA 2JD5A 5GZ9A 3QRJA 2CDZA 3OWLA 3ZO3A 4IB5A 5LMAA 4BWKA 4DH5A 5C1QB 5I0BA 4J1RA 4EUUA 3DCVA 3OY1A 1SZMA 2XM8A 5FXSA 1STCE 4CCBA 4YBJA 1Q8YA 2RG6A 3ZZWA 4RQVA 4QP7A 4BCPA 5A4LA 3D5UA 5A6NA 3UZTA 4HJOA 1W82A 4CCUA 3OFMA 1H01A 2BUJA 2ITUA 3QXOA 5EYCA 4O7RA 5JMSA 4KA3A 2F57A 3Q3BA 5LVMA 4X6RA 3W55A 2W0JA 3I0OA 5HIDA 4L43A 3HV3A 5A9UA 2PVJA 2VD5A 3I1AA 5KE0A 4YJVA 3OEFX 3OCTA 4U3YA 4O22A 3ZUTA 3LKMA 3BI6A 1O9UA 4OTWA 2QO2A 2WXVA 4RLKA 4TWNA 4JG7A 3W8LA 2ITYA 2XB7A 4FC0A 4FIHA 5L8JA 3HLLA 2B1PA 3N4VA 1JQHA 4YLKA 3Q9YA 4YSJA 3ZOSA 1EH4A 3UMWA 5IPJA 2Y4PA 2P55A 4KAOA 4BKYA 4LMNA 1WBSA 3QWKA 2IN6A 2Z8CA 2OU7A 4AW5A 3QQKA 1PXLA 4Y46A 1KWPA 4AU8A 2C0TA 3EN5A 5KMOA 1SVGA 1UWJA 2IW6A 3I7CA 3ZLSA 4BDCA 2XK9A 3QTUA 1MRUA 3R8VA 4TKSA 1YDTE 4E1ZA 4EQMA 4EBVA 5J9ZA 4BCMA 1B39A 3BBTB 2QC6A 3R8UA 1SVHA 1KE5A 3H9OA 1VJYA 3PXZA 4AT5A 3FQEA 4FSRA 3Q2MA 4FUXA 4J52A 5HTIA 3TDWA 4OUCA 3FI8A 1Y8GA 3CQUA 3LJ2A 2UVZA 2W4JA 3VQUA 5EYKA 2PTKA 3DK3A 4XUFA 2I6LA 5BMSA 3SX9A 3QTXA 4JAJA 5TE0A 2E9OA 1YXVA 2ZM3A 4GMYA 3FZRA 4FVRA 2GHLA 3W2CA 3FLWA 3U9NA 4AA0A 5CASA 3KREA 4BDDA 2JITA 4L7SA 3FXZA 4S30A 3AD6A 5TO8A 2BKZA 4GKIA 4YJNA 4BF2A 5G6VA 3HA6A 4H39A 4QPAA 2VGOA 3R01A 4QYYA 5KMIA 2WMVA 2VX0A 2EU9A 3RGFA 1L3RE 1W7HA 4RJ5A 4AOTA 4ASEA 4FOCA 3UVPA 4E20A 1UA2A 3F5GA 3FSKA 3QQFA 4RZVA 2IW8A 3VS1A 4E6DA 5JFXA 4QMTA 2ONLA 4IB3A 3UP2A 3LFQA 4EH6A 3EQCA 4RJ6A 3R7EA 3DBFA 4FE2A 3LW0A 3Q53A 1TQMA 5BNJA 3C4ZA 3RWQA 5DFPA 3F3UA 2OIQA 4D4SA 4YHTA 4C38A 5AUYA 4BTJA 2UW7A 4O83A 3E7VA 3V3VA 3QCSA 3R6XA 5AUVA 2BIKB 1FINA 3QUPA 4OTPA 4G3GA 4WNMA 3E63A 2XEYA 2BHHA 5L2IA 4GL9A 1OMWA 4O6EA 3VULA 3PXQA 4DG2E 4EC8A 2X6EA 5AAFA 3UC4A 3U6HA 2QD9A 3PY3A 3DK6A 4EZ5A 1FVVA 4H3BA 5CLPA 5ANKA 2OKRA 2XYUA 5F4NA 2PU8A 4E5WA 2JIVA 3NX8A 5ACBC 4YZCA 3RAIA 3EQGA 4XLIA 2FSMX 3JVSA 3KKVA 3TV7A 3DNDA 4C4HA 1NT2A 1OKWA 4MKCA 3ZZEA 5IQIA 2XKEA 3PA5A 3VS2A 2UVXA 5CAQA 3WARA 3L8VA 5CQUA 3KL8A 1KSWA 4MEDA 2XIYA 2XBAA 2YIQA 1JKLA 4O0WA 4NIFA 3LFBA 4AXAA 3AOXA 1Q99A 5AX9A 1Z5MA 2P2IA 1RQQA 2XNPA 2UVYA 3L9NA 4GEOA 4IM3A 4QMVA 5CYIA 4FG9A 4S32A 2OXYA 4DFYA 4EQUA 2QOKA 1YXUA 2QO7A 2PL0A 1PXPA 2WD1A 5DRBA 5AUUA 5HO7A 3OZ6A 3SW4A 1GNGA 5DBXA 4TN6A 4D1ZA 5AX3A 3BU5A 3OUNB 5AAGA 4U9AA 3UZPA 1QPJA 3O96A 5K4JA 1ZYLA 4AOJA 2WTJA 4FKGA 3SG8A 3F3TA 2ERKA 5LVLA 3TNQB 3TTJA 3MY1A 4LRKA 2KTYA 2R7IA 3F2RA 3R8PA 3NUUA 1J7IA 3KB7A 3CE3A 4U40A 5DH3A 5KZIA 5LCJA 4WUNA 3KVWA 2PHKA
chains in the Genus database with same CATH superfamily
4DG3E 4DTKA 5JKGA 3ANRA 3EH9A 2AUHA 2C0IA 3FI4A 3QC4A 4WD5A 4I5CA 1ZY5A 4EH2A 5IA3A 2H96A 3LPBA 3BWJA 4U81A 4F1OA 3PSDA 1IAJA 2XIXA 3LIJA 3C51A 1V0OA 3AT4A 4ZY6A 3S2PA 4BI1A 5CAOA 3KRLA 4IWDA 3AKJA 4QQCA 4TTHB 5I9WA 2YN8A 2QKWB 4IVCA 3QA8A 4W9XA 3PVBA 2PZRA 3KRJA 4JBPA 4OTQA 4DDGA 3GOKA 2W1EA 4JVGA 3W0OA 5LXMA 3BGPA 2VO7A 1OIQA 5TT7A 4JLCA 4W4WA 2ACXA 2RFEA 2XAOA 2VN9A 3H9FA 4DLIA 3MPAA 1OIUA 4ZSGA 2GCDA 3WIGA 4L68A 4DH7A 3SGCA 2C6TA 4C4IA 1YHWA 4USFA 3SQQA 1UU7A 4L00A 3MA6A 4XRLA 2GNIA 2VRXA 4BGQA 2XUUA 4H1MA 1ZZ2A 3ULZA 2C69A 3DLZA 3Q52A 3LVPA 3LJ0A 3RPYA 4QMUA 2YZLA 5BV3A 4AA4A 2I0YA 2EXCX 4EH3A 4KIOA 4CTCA 3F7WA 4BYIA 4QMSA 4X2FA 4NEUA 4R3CA 4DH1A 4EK4A 3ZFYA 4N57A 2E9PA 2G01A 4O1OA 4JJRA 3VUHA 2WU6A 4CMTA 3BHHA 3NW7A 4FT5A 4E7WA 4J8NA 3HMMA 5BQ0A 3P4KA 3BBWA 4IX3A 3BRBA 4USDA 4CZYB 4D0XA 1QCFA 2BAJA 1YRPA 4TYHA 4M14A 3C13A 4EEVA 3NUPA 5IH4A 3ORTA 3B8RA 2R3PA 2QOIA 3UO5A 2B4SB 3UO4A 1FVRA 2R3QA 4DBNA 4AGUA 5H8EA 2HY0A 4O6LA 2J50A 2Z7LA 4YTCA 3SDJA 4JX3A 3QD4A 5AFVA 4ONAA 3HP2A 4FV6A 2OH4A 4HGTA 4IAKA 4JDKA 4XV3A 4B7TA 2Y4IB 4JNWA 3EFKA 4FKRA 4LV8A 3A7HA 3NYXA 4KB8A 4ZTHA 4UYNA 4BDAA 4Q5HA 4FZ7A 3E5AA 2XVDA 4KIKA 4CZUA 1JSTA 4I4FA 4BZOA 1RW8A 5KHXA 4CSVA 4HVIA 2ZB0A 4JR7A 4PQNA 2NNWB 3PUFC 2R4BA 2A19B 1YOMA 4O1PA 4BBFA 1XH9A 1BLXA 4CXAA 4O7SA 4D5KA 4HGLA 1XWSA 1ZOHA 3BELA 2R3GA 4RVTA 3PXYA 1Q97A 4KS7A 5CVHA 5CAPA 4BBEA 4I0RA 4ZIMA 3DAKA 2BDWA 3PSCA 3QKMA 4J8MA 4PMTA 2WIHA 3I6WA 4YNEA 3VS0A 4CFVA 4R78A 1OL5A 1YHVA 5DVRA 1OPKA 4RQKA 4UMUA 3DT1A 3LFFA 4ZSLA 4MD7E 2XMYA 4BBMA 1X8BA 1CM8A 2G1TA 4ZTSA 4C4GA 3FXXA 1VEBA 2O65A 4C35A 4UX9A 3FMNA 3IW8A 4M84A 4IZ5A 4YR8A 3UOHA 4MX9A 2IO6A 3NYNA 5HE1A 3I79A 2R3RA 1H8FA 1ZLTA 3KEXA 4U80A 3RNIA 4A07A 3TDVA 3MV5A 2GNJA 2J51A 3UMXA 3COIA 3KFAA 1H08A 3GNIB 3EQHA 3TV6A 3Q9ZA 1CKIA 4W8DA 3WYYA 4ANQA 1DM2A 5CF8A 3D2IA 2I0HA 3EQRA 5DT4A 5DOSA 3RNYA 3QC9A 2JLDA 4EOIA 1Q5KA 3QAME 3IDCA 5E8XA 5IH5A 4EUTA 2HY81 4FRFA 4FEVA 3QQUA 4UZDA 4X0MA 4E8AA 1OBGA 3T9TA 4FGRA 3EQDA 2BAQA 4GRBA 4CGAA 1GZOA 1UWHA 3GP0A 4JQ8A 4QQJA 4QMZA 4NFNA 4G17A 2QLUA 4E4XA 5HLPA 3UDSA 2G9XA 4FV7A 1YDSE 3HMPA 3DNEA 4ZAUA 3B2TA 2BIYA 4IFGA 4G34A 2WQNA 5FP6A 3W0SA 3MSSA 4IQ6A 3ZXZA 4GYGA 5K0KA 3RAKA 3SXFA 1ZYSA 2W5HA 4BDHA 3ZSHA 3QGYA 4RJ8A 2C5OA 2DS1A 4DAWA 4EOSA 3FMMA 1G8SA 3R1SA 3GU4A 1Q3WA 5DR9A 4FTAA 4HVHA 3KXXA 2J0JA 2DUVA 2F9GA 3E87A 3LMGA 1P4OA 4FT3A 4HYSA 4A4LA 5M56A 3EN4A 3TIYA 3I5ZA 3NS9A 2C6DA 3C4FA 5DT3A 3P0MA 4QP9A 5EFQA 2Y8OA 3R9OA 4ACMA 4CYIA 1K9AA 2WAJA 3AKKA 2VWWA 3LFCA 4CT1A 3TN8A 5EM7A 4BZNA 4X2GA 2GFSA 3MH2A 2WQOA 2GSFA 4ZMFA 5KCVA 1Y6AA 5FGKA 4C58A 4EKLA 4M8TA 3WE4A 2HK5A 3ORKA 2YABA 5JN2A 3WF8A 3M2WA 3R1YA 2XJ0A 2PVKA 2UW8A 3ELJA 5CANA 1ND4A 3DBDA 4FV5A 1PYEA 2IVUA 4F9YA 2J0MB 3A7JA 3HYHA 3TM0A 4E3CA 5GJFA 1ZOGA 1WVYA 3DZOA 5DPVA 3RPSA 5AR3A 5IG1A 1ST4A 2J0KA 3IW5A 3R7IA 2RSVA 3S0OA 2OFUA 5BYZA 4ZJIA 3R2BA 4PDSA 3BZ3A 4BCNA 1ZMUA 2UW6A 2XNMA 2A0CX 3F5PA 2GS7A 4RA4A 5BVOA 1V1KA 3VHKA 2DQ7X 3ODYX 4I4EA 4CT2A 4MXOA 3E92A 4CZTA 4RLLA 3L1SA 3U87A 5HO6A 1UNLA 2QONA 4QP3A 1YDRE 5GZAA 3GC7A 3A61A 3ORMA 4PRJA 3NMUF 2RIOA 4LGGA 4NKSA 1HOWA 2CPKE 2WMUA 4GT5A 4TNDA 4IB1A 2ESMA 2QR8A 4L52A 1H1QA 3KMMA 4YU2A 5HZNA 3WI6A 3VUKA 1JKTA 4CG9A 2X4FA 4I41A 4ZY4A 2BTSA 4FKPA 2W4OA 3Q60A 4L44A 3H0ZA 3IO7A 1BUHA 2GTNA 4PDYA 3OF0A 2PPQA 1M7QA 3PPJA 4R3RA 5BYYA 2QCSA 4RVLA 4RBLA 3QQLA 4L01A 5EW8A 2IWIA 4FSYA 5JQ5A 4HVGA 4CV8A 3TNIA 4F0IA 5ITAA 3OC1A 3A2CA 3ANQA 3VN9A 1JAMA 2QU5A 3OBJA 4FV1A 2X7GA 4OTHA 5HOAA 4Z7HA 5AEPA 5IA2A 1H07A 4GJ3A 5KMMA 4UBAA 3KY2A 3LAUA 3NGAA 4MBLA 1OVEA 4J96A 3P7CA 4RFYA 5EW9A 3VUIA 4IWOA 2OJGA 4EI4A 3LOKA 4W4XA 3R83A 3NAXA 4BDIA 3QTQA 5LWNA 3UQCA 3F82A 1H4LA 2ITPA 2YAKA 4TRLA 1JNKA 4FKWA 4M15A 2CKOA 3Q6UA 4FOBA 4QQTA 3BX5A 4ALWA 3HV5A 2YM7A 4BZDA 2R3IA 4EH4A 2PE2A 4BGGA 5L2TA 3ZM9A 3MFRA 5HIEA 1H24A 4QDEA 4BJJA 4Q9SA 5AV4A 3E93A 4HZRA 4DEHA 4RVMA 2XNNA 3RPRA 1I09A 3VJOA 4CFFA 4LI5A 2G2IA 1OECA 2XJ2A 4ZXTA 2J4ZA 2X0OA 3DQXA 2UZWE 3F2AA 3E88A 5JGDA 4RIOA 3W0QA 4MBIA 1PRYA 2JEDA 2YLFA 2EWAA 3UE4A 3U4WA 4B4LA 2UZNA 4BDEA 4BRXA 3CPCA 3COKA 5GIOE 4FKJA 4XBUA 2HW6A 4H3PA 3I5NA 3QUDA 1XBAA 3S00A 1M2QA 2EB2A 3Q96A 4XMOA 5K9IA 2VWBA 3SHEA 3D5VA 3GU8A 4XV2A 3ZRMA 1PXJA 3O8TA 5CNOA 2QLQA 1M17A 3P78A 4TYGA 3LMHA 3FKOA 4E6AA 2BRNA 2H8HA 2ZMDA 3QRTA 5JEBA 2FH9A 5CU3A 4GU6A 5CTPA 4AFJA 2F7XE 4AXEA 4YZBA 5J9LA 2B55A 3WZKA 1PYXA 3AC8A 3KCFA 3G51A 4O86A 4GG5A 3ODZX 4ANBA 4M7IA 2OJ9A 1KOAA 3RVGA 3ZLYA 3UPZA 1Y57A 2XARA 4ZEGA 1OI9A 4F6WA 3QHRA 4JRVA 4C33A 1CKPA 4EH8A 4EOLA 3S4QA 2NYAA 2VTPA 4FZDB 4GFGA 4IHPA 5EK7A 4FV0A 4EK5A 3BIZA 4ZP5A 3HUCA 2B9HA 4OGRA 3HMNA 4F6UA 4IAIA 2QOOA 3VO3A 3QHWA 4FNWA 3QRIA 4NK9A 3ULIA 2JAVA 4I5PA 4MNFA 4X2JA 2HELA 3GU7A 1Y8YA 3MJ2A 5AJQA 4O96A 3THBA 4L67A 3QRKA 3R9RA 3GB2A 5M08A 3G9LX 2I0EA 3VBTA 2VV9A 2YCSA 3OWPA 3ZLXA 5JK3A 3K2LA 5HHWA 3D4QA 4LGHA 3DK7A 5IQCA 5HX6A 4IE9A 4LUDA 3VW6A 2XK3A 5GNKA 1UNHA 3UG2A 2VX1A 3VUMA 5M06A 3OOMA 4TWOA 4XP0A 5D12A 5DWRA 5E90A 3U51A 3EFWA 4FEUA 1H0VA 3ERKA 4PPCA 3PDTA 2YDJA 4F9BA 3IW7A 3P08A 1JSUA 4AWIA 3QTWA 5KNJA 3COHA 3P7AA 3NNWA 4TY1A 3R63A 2QU6A 2NO3A 3GBZA 4FTJA 5AMNA 2IG7A 3VWAA 5A4QA 3O8PA 4KWPA 5HIBA 5KKRC 2HAKA 3F7ZA 4BDKA 4YJOA 3FLZA 4PTGA 2FSOX 3EWHA 3S1HA 4RWLA 4D2WA 4DFUA 4BCHA 4YJRA 5CI6A 3G0EA 1NA7A 2PE0A 2UW4A 4QYEA 2CLXA 1CSNA 2RL5A 2QR7A 3JVRA 3OWKA 4L3JA 4FV4A 4P5QA 1T45A 4Q5EA 3WZJA 5L8KA 3W0NA 4DT8A 3IG7A 2J5FA 3FQSA 5CZIA 3H3CA 2P0CA 5FBNC 4Y72A 2X8DA 4AW1A 3EN6A 3MI9A 4QEBA 3JXWA 1IG1A 4C62A 4AE6A 4JBVA 4TWPA 3MB6A 2PZYA 2OZAB 4X3FA 2VTMA 3QL8A 5E8ZA 3EKKA 1IEPA 4BB4A 5K4IA 3R0TA 4EK6A 4YURA 4ID7A 3C9WA 4CFNA 2C5YA 4AZTA 3DBEA 4ZSJA 3EOCA 2BZHB 4ZY5A 4P4CA 3ZUVA 1FVTA 2C5VA 2ZDTA 5ETFA 4Z55A 5ICPA 3MN3A 4EOQA 5KUPA 2X1NA 4DYMA 4GJ2A 1XH7A 1WZYA 2HW7A 4EH9A 4GSBA 3RP9A 5DG5A 4I20A 4ZMEA 4NIFB 4QMXA 3BCEA 5H2UA 2H9VA 3DXPA 4IMYA 5CEIA 4O7LA 4L8MA 3DQWA 5AR2A 3KIOC 5AP4A 4ITIA 4ACGA 3A99A 3MYGA 4EOPA 4GK2A 4JI9A 1E9HA 4FSQA 4BC6A 4XBRA 4GK4A 3ID6C 2PVLA 4U45A 4JMQA 2C6OA 2R3NA 3CXWA 4XS2A 3E64A 3SA0A 2W1FA 3BU6A 3BHUA 5EOLA 4FTMA 4F63A 3TNWA 1XJDA 2O64A 4OBPA 5GJDA 5AP5A 2IF8A 2HWOA 5TF9A 3W0RA 3GENA 1H00A 4FSUA 4YZNA 3QQJA 5C03A 3UOJA 2WMQA 3DZQA 4NM5A 3BE2A 3GC0A 4X3JA 2WHBA 2V5QA 5ANDA 5J1WA 3VJNA 5AUXA 4CKJA 1XO2B 3F3VA 5CQWA 5DGZA 5E8VA 3R00A 3AQVA 4MXYA 2HOGA 3S95A 4HGEA 4D2SA 3RPVA 2SRCA 5HO8A 3WF5A 3MA3A 3HVCA 4IC8A 2GPHA 3VAPA 3OG7A 4WOVA 1IAHA 2C1AA 3VS3A 3CY3A 4DGNA 4WBOA 4DDIA 4MXZA 1S9IA 5LARA 1MP8A 2VO0A 4I94A 3SAYA 2WO6A 5JQ8A 1OIRA 4I1ZA 1CMKE 5AP7A 5DR2A 3DJ5A 3IW4A 2ERZE 2PMOX 4KINA 5DE2A 3PIYA 4R1YA 4C3PA 3R1QA 4R5YA 2XS0A 1H1RA 3DY7A 4OAVB 3ZTXA 3LXLA 3ZLWA 2GTMA 5DA3A 4XNEA 4A9RA 3RCDA 1GZ8A 4AW0A 3ORZA 2PVYA 3VRYA 5HNIX 1TZDA 2R3MA 3G6HA 3DDQA 5JZJA 5J9YA 3UDTA 3MVMA 3SC1A 3U55A 3TMOA 5KMJA 1ZWSA 5CU6A 4O7YA 1QMZA 4XG4A 5LJJA 5CF4A 4D9UA 2ZB1A 3R9NA 3ETAA 3GCSA 5EDPA 1XH8A 3ZCLA 4FNYA 3QX2A 4K6ZA 2X8EA 3FZTA 3DXQA 1XKKA 4TZRA 2BCJA 3MW1A 1UVRA 4FV9A 4LL5A 3EQPA 4O0VA 4AF3A 3FPMA 3OCGA 4J71A 4YLLA 2R3FA 3R7VA 3LFEA 1BKXA 4YMJA 4TYHB 4XG6A 3C4XA 4QPSA 4O4DA 5J79A 3COMA 4D2RA 5JFSA 3GU5A 2YITA 3CJFA 2BR1A 3L9MA 3VBQA 3VS5A 4G3EA 2WZJA 4DEDA 2QOLA 3F66A 1BMKA 4PMSA 4RSSA 4ENXA 2CNUA 2VNYA 3TNHA 4YJTA 2XNEA 4YZ9A 3LFNA 1U54B 2OWBA 5C27A 4B8LA 3PVUA 4RIYB 4H05A 1WBPA 4KIQA 4GVAA 4HCTA 4UV0A 5IEVA 3UDZA 4NH1A 2ITXA 5EW3A 2JAMA 3G5DA 5HEZA 3GFWA 4CFXA 5I4NA 4FL2A 4RIWB 1Q8WA 2JKQA 4XG2A 3HUBA 3MH0A 3DFAA 2H6DA 3PPKA 3QKLA 1OL2A 4O4BB 4HCUA 2PVHA 4AGCA 4ZJJA 3VNTA 4FIFA 3UC3A 2B9IA 5C8MA 2WQMA 1Q4LA 4O7NA 5CSPA 4U79A 3V8TA 2Z02A 2FSTX 3UYSA 2JIIA 4U7ZA 4QMNA 4GIHA 5E8SA 1PJKA 1O6YA 4HCVA 4D4VA 4DFZE 4YUQA 4HYIA 4AGWA 3Q4TA 4AN3A 3VS6A 4C2WA 4IIRA 1W2DA 3MFSA 4UXLA 3RTPA 4EHZA 3KRWA 2WELA 3FLSA 4OAUC 2Y9QA 3UIMA 4MD8E 2OO8X 5IQDA 1ERKA 4X2NA 3SLSA 4EZ7A 2WGJA 3FLYA 5CAUA 4R77A 5CT7A 4C4JA 3R28A 5HE0A 2OBJA 1PXOA 3HECA 1VR2A 2NRYA 5ACKA 1V0BA 3ZH8A 3CY2A 4FTOA 3C1XA 3V51A 3ORIA 4I6FA 5AA8A 3SXSA 4ERKA 3ZRKA 4OBQA 2X0QA 3HMOA 3CKXA 4YLJA 4I23A 2GU8A 3PLSA 1F3MC 2ETRA 4MD9E 1G3NA 3KGAA 3LZBA 4WG3A 1PF8A 3KMWA 2XM9A 5DHJA 4EOOA 3EN7A 3QYZA 4J99A 4QT1A 4I0SA 2YM5A 3GI3A 4QMLA 3O50A 3ITZA 1YKRA 1SVEA 4NU1A 2VNWA 4F9WA 2C68A 2YAAA 3C4WA 3O7LB 4G6LA 4PNKA 2I1MA 4ITJA 4D0WA 3D14A 3KC3A 3BV3A 5I3OA 4UALA 2GQSA 4MAOA 5D7AA 3UBDA 4G3FA 1LEZA 4OR5A 4UMQA 5IQEA 5CNNA 4U8ZA 5BVFA 3DJ7A 3DS6A 3SXRA 3UZRA 1JVPP 1MQBA 2IEWA 3W10A 1OKVA 4AAAA 2I7QA 2YWVA 3TCPA 4HPTE 5CF5A 4FK3A 2CCIA 4XOYA 3C5UA 4MBJA 4BGHA 2EB3A 4YTIA 2F7ZE 4F99A 1PXMA 4DGLC 1PMVA 2PMNX 3AGLA 4I6LA 5IU2A 2FGIA 5FTOA 5F95A 2VTQA 3UIBA 3NIZA 5KO1A 3HX4A 1JLUE 1TQIA 1YW2A 2DWBA 4UMTA 3GCVA 4F78A 5H8GA 3LLAA 2PY3A 5CU4A 4S31A 4V04A 1JSVA 4JAIA 2CN5A 3DV3A 4LOPA 2PZPA 1TVOA 3OT3A 3SD0A 3PTGA 4CTBA 3LE6A 4C0TA 2A27A 4HNIA 4DN5A 4DGOA 1KUTA 2EVAA 2WEVA 3PE2A 4O81A 4C36A 4FKOA 1GIIA 3FWQA 3D7ZA 4FYNA 4CVAA 3MJ1A 1Q62A 4XG8A 3OY3A 3SV0A 4EONA 2VWYA 2WIPA 5C26A 1G8AA 3KU2A 3TG1A 3OBGA 3ZC6A 3ZDUA 3CD8A 3POOA 4FNXA 2GNLA 4NSTA 3F5XA 2VTLA 4GU9A 4BCOA 1A48A 3UIXA 3C0GA 4FEQA 3EHAA 4RA5A 5JFWA 1ZYCA 1BX6A 5KMLA 4DA5A 2R7BA 2YCRA 1B6CB 4RC2A 2B7AA 5I9UA 3IKAA 5KMNA 3F5UA 4RFMA 1O6KA 4QOXA 3PYYA 3ZRLA 2XP2A 4FTNA 3I81A 4YJPA 4FGBA 1WAKA 1R3CA 1YXSA 4TNBA 4WUAA 5BVEA 5FXRA 1WMKA 2V62A 3R7UA 3TXOA 5IUIA 4N0SA 4R6VA 3V6SA 4C3FA 4DHFA 3CBLA 2KULA 3W0PA 3BYUA 4YTFA 2W9FB 3WE8A 2WMTA 3PY1A 2WMWA 5L6WL 4IM2A 3A4OX 2AC5A 2WKMA 4LM5A 4RVKA 4IB0A 4ZJVA 3PP1A 4NL0A 3C7QA 1T46A 1G5SA 3R2YA 2JDSA 3FC2A 3AGMA 4IFCA 2AYPA 1DS5A 2VO3A 2J0IA 2C3KA 3Q5ZA 1H1SA 3FL5A 3QF9A 3RK9A 1Q8TA 1PKGA 3N4UA 4NCTA 5CF6A 3KVXA 1FMKA 4OW8A 4IANA 3FJQE 2RFDA 3PJ8A 1IASA 4GUEA 5DIAA 5HNGA 2BDJA 4NCTC 4W4VA 4D28A 3W16A 3GCUA 4EORA 3MGYA 4NWMA 3OMVA 4M0ZA 1LP4A 3FI3A 4AGDA 5FUTA 4FTLA 3RZBA 5CEMA 5BYLA 4I5MA 5HU9A 4WG5A 3PFQA 4L45A 5A4TA 3EZVA 5BUEA 3U6IA 2PZ5A 4FSMA 5HBJA 4HW7A 4DHJA 1XBBA 5J5SA 3NLBA 4UWCA 2QOBA 4NUSA 4GUBA 4CQGA 4PY1A 3FV8A 3B8QA 4PPAA 5HI2A 4KKEA 3U9CA 3TKUA 5AIRA 5HKMA 1OM1A 4QNYA 4RG0A 1E1VA 1KE8A 2CMWA 4DEIA 4BY9E 4CG8A 1ZZLA 4OTDA 1SM2A 4JG6A 5IMEA 2YERA 2HWPA 4YJUA 3ENMA 5A4EA 1H0WA 4CQEA 2R3OA 4MQ2A 3QTSA 1OGUA 3FZPA 2IVVA 3BYVA 3QXPA 3DFCB 4LFIA 3K3JA 3ZXTA 4EQCA 2OFVA 1YOJA 5CY3A 3TACA 2FA2A 4YP8A 4RJ3A 5M4FA 3O0GA 4FKSA 3KXHA 3R73A 3DKGA 4D2TA 5LMBA 3OHTA 3FBVA 4FZAB 3JPVA 1WVWA 1M14A 5E9EA 3FKLA 2O2UA 3KULA 3V04A 3EFLA 2QQ7A 2OSCA 4QMMA 4UN0C 1GZKA 4MK0A 4FSTA 2VTHA 4BCJA 3QGWA 2UZEA 3R7OA 4JDIA 3MVHA 3F3WA 2UZUE 4R7BA 2JIUA 4V0GB 5EM5A 4QTCA 3FMLA 2OIDA 4O7VA 1XH5A 2RF9A 3PPZA 3A4PA 4I6QA 4IBMA 2C5XA 4CNHA 2GNHA 5CSWA 4PP7A 2XAMA 4LDTA 4FKLA 2R9SA 5EQYA 2X0PA 3F88A 1XMMA 4C7TA 3G6GA 1B38A 3T8OA 1FOTA 4QP1A 3NEWA 4FVQA 2GNFA 2YHVA 3GFEA 2CGWA 5J95A 3IOPA 4DFXE 3KF4A 4YHFA 1URWA 1QPEA 2IZSA 4KSQA 1OUKA 2WU7A 4KABA 4WHZA 4TYIA 3DKOA 3NNVA 3FZOA 5AUWA 3ZEWA 4U3ZA 2X81A 4ARKA 5DNRA 3GOPA 3LLTA 3VW8A 2YDIA 2C6LA 4JQ7A 3MPTA 5CXHA 4NW5A 3T3UA 3NCZA 4KKGA 2C3JA 3D5WA 4OTRA 4ANOA 5LVNA 4DE4A 3TT0A 5IZFA 3D94A 4BDJA 1VYWA 2X7OA 4AE9A 4O27B 2XK6A 2XRWA 1OITA 1ZOEA 2IJMA 2JBOA 5LVOA 3TL8A 4HOKA 2WTWA 4DGMA 4BHNA 5IA4A 4M67A 5KX8A 3TUBA 4JBOA 1W8CA 4QDVA 3DTWA 5JRSA 3A7IA 4I93A 4UWBA 2J90A 4S33A 5J7HA 4ZZOA 3NVMB 1PMUA 2UZTA 4ASZA 4FA2A 3ALOA 3ET7A 1BL7A 2VTIA 5EDQA 3DB8A 3POZA 5H8BA 3E8NA 1OUYA 2O8YA 5AV1A 4F7JA 2WTKB 4XG7A 1KE9A 4AZFA 4A9UA 2JDTA 4FTTA 3VUTA 4BIEA 3ENHA 4DHIB 1K2PA 4O2PA 4YO6A 1H27A 2QOCA 4Z9LA 4MNEA 4U6RA 4MQ1A 4ASDA 2JBPA 4W9WA 5IKWA 1ZMVA 4E5AX 5L4QA 2XA4A 3VBYA 3WF6A 4XG3A 3ORPA 3R7GA 2HZNA 3G2FA 4ZS4A 4HGSA 2VTNA 4K9YA 2YM4A 4E4NA 2IZRA 3NR9A 5AR8A 3Q9WA 5L8LA 3FYJX 3LFSA 2I0VA 2ITNA 5EKOA 4DBXA 4X3FB 2WTIA 5IA5A 3ZSGA 3WBLA 2JFMA 5KHWA 1M2RA 1E1XA 1VZOA 2E9UA 3BLRA 3I0QA 3LQ3A 3AC3A 3UVRA 3O8UA 2CNQA 3W32A 1GJOA 2HENA 3DA6A 4QNAA 3UVQA 4EOKA 1YHSA 3TV4A 1ZYJA 3CPBA 3CTJA 4E4MA 2OLCA 5EQPA 2QOFA 3QTIA 4BL1A 4B99A 3W2SA 2GFCA 2PYWA 1REJA 3GQIA 4QTBA 3ZMMA 3TKHA 4JT3A 4B8MA 2J9MA 2VTJA 2JGZA 3GC9A 3E7OA 4WNPA 4AZVA 4BYJA 3R02A 4E26A 4I92A 3NPCA 4KIPA 4FR4A 3QZGA 3VF8A 4F64A 1GZNA 2ZV8A 4WSQA 2PK9A 5AA9A 4MXAA 3I60A 5HVJA 4C4EA 4FTUA 3IOKA 2VWZA 2PUPA 2CJMA 2V55A 3DPKA 3GEQA 3LCDA 3NYVA 4FK6A 2C6KA 4GIIA 1GY3A 5CAVA 3QX4A 5HU3A 2WNTA 2W1HA 4QTAA 4TPTA 3UQGA 1CDKA 5AUTA 3KF7A 4MTAA 1A9UA 4DG0E 4B9DA 3RINA 4YBKA 4I22A 3F2NA 3QQGA 4M12A 4BN1A 3Q9XA 1ZYDA 2R3HA 4HYUA 4QO9A 2J6MA 4FI1A 1DI9A 2LGCA 3LFAA 5E8YA 4EH5A 4BR3A 4DTAA 2CLQA 3QCYA 4EWHA 4JS8A 5EM8A 3DTCA 1SMHA 4IX5A 3M11A 5B2KA 3Q6WA 3SRVB 4YO4A 3V6RA 5IUHA 3KN5A 5LVPA 4UXQA 4FV8A 3FEGA 4CRLA 4D4RA 2Q83A 2CGXA 3O71A 2Y4IC 5HCXA 4MUQA 4A4OA 4H36A 2HXQA 4XJ0A 3UGCA 4RJ4A 2BPMA 5M53A 4DF3A 1KE6A 3LHJA 1YWRA 4E5BA 5I9VA 1W84A 4PX6A 3TZ9A 4AXCA 3AD4A 4NT4A 3BYMA 4DINA 4FJVA 3RKBA 4YNOA 3NCGA 2X39A 5JSMA 4OLIA 4AS0A 3L8XA 3FZ1A 4DEBA 3NSZA 4ORKA 1NVQA 3MTFA 4L7FA 3MPMA 4A7CA 3V5LA 2GQGA 2BTRA 3FXWA 4EYMA 3QKKA 3LXNA 3PJCA 4I6BA 4L6QA 4RT7A 1W98A 4XG9A 3LCOA 2VAGA 3IDBA 2ZOQA 2WOUA 2XZSA 2O5KA 2C6IA 5FEEA 1J91A 2OJIA 2VGPA 5EDRA 5CI7A 5CWZA 2YWPA 3GVUA 3IW6A 4FSZA 2OH0E 4FUYA 5AP2A 4C8BA 2WMXA 2WB8A 1YXXA 3HDNA 4O21A 1F0QA 2OI4X 1OGYA 2CGVA 3MFTA 3RAWA 2ZFYA 4K33A 4IEBA 3CJGA 3QYWA 1FPUA 3P7BA 3TZMA 2E9VA 2ITVA 4EJ7A 4WKQA 4RPVA 4XOZA 5L2WA 4AQKA 4P7EA 3JR1A 5J87A 2BRMA 3FSFA 3HRCA 5HESA 2VWXA 3RM6A 4Q9ZA 3HNGA 4FKVA 5D1JA 2X9EA 5EI8A 3V01A 4TYJA 4ZZMA 3R8MA 1XH4A 1UU9A 2GS2A 4N4SA 4XH6A 4LG4A 2CCHA 4P2KA 5IDNA 4CV9A 5IMXA 3UNKA 2WMAA 2ZMCA 2EXMA 3R21A 2YM3A 4QQ5A 5CX9A 4IAFA 4UWYA 4BHZA 1OL1A 2XIRA 3D7TA 4GVJA 4D1